U.S. patent application number 16/125580 was filed with the patent office on 2019-04-04 for tailored oils produced from recombinant oleaginous microorganisms.
This patent application is currently assigned to Corbion Biotech, Inc.. The applicant listed for this patent is Corbion Biotech, Inc.. Invention is credited to Riyaz Bhat, Scott Franklin, Jeffrey L. Moseley, Walter Rakitsky, George Rudenko, Aravind Somanchi, Janice Wee, Xinhua Zhao.
Application Number | 20190100780 16/125580 |
Document ID | / |
Family ID | 46601075 |
Filed Date | 2019-04-04 |
![](/patent/app/20190100780/US20190100780A1-20190404-C00001.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00002.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00003.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00004.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00005.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00006.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00007.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00008.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00009.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00010.png)
![](/patent/app/20190100780/US20190100780A1-20190404-C00011.png)
View All Diagrams
United States Patent
Application |
20190100780 |
Kind Code |
A1 |
Franklin; Scott ; et
al. |
April 4, 2019 |
TAILORED OILS PRODUCED FROM RECOMBINANT OLEAGINOUS
MICROORGANISMS
Abstract
Methods and compositions for the production of oil, fuels,
oleochemicals, and other compounds in recombinant microorganisms
are provided, including oil-bearing microorganisms and methods of
low cost cultivation of such microorganisms. Microalgal cells
containing exogenous genes encoding, for example, a lipase, a
sucrose transporter, a sucrose invertase, a fructokinase, a
polysaccharide-degrading enzyme, a keto acyl-ACP synthase enzyme, a
fatty acyl-ACP thioesterase, a fatty acyl-CoA/aldehyde reductase, a
fatty acyl-CoA reductase, a fatty aldehyde reductase, a fatty acid
hydroxylase, a desaturase enzyme, a fatty aldehyde decarbonylase,
and/or an acyl carrier protein are useful in manufacturing
transportation fuels such as renewable diesel, biodiesel, and
renewable jet fuel, as well as oleochemicals such as functional
fluids, surfactants, soaps and lubricants.
Inventors: |
Franklin; Scott; (Woodside,
CA) ; Somanchi; Aravind; (Redwood City, CA) ;
Wee; Janice; (San Mateo, CA) ; Rudenko; George;
(Mountain View, CA) ; Moseley; Jeffrey L.;
(Redwood City, CA) ; Rakitsky; Walter; (San Diego,
CA) ; Zhao; Xinhua; (Foster City, CA) ; Bhat;
Riyaz; (South San Francisco, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Corbion Biotech, Inc. |
South San Francisco |
CA |
US |
|
|
Assignee: |
Corbion Biotech, Inc.
|
Family ID: |
46601075 |
Appl. No.: |
16/125580 |
Filed: |
September 7, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14974983 |
Dec 18, 2015 |
10100341 |
|
|
16125580 |
|
|
|
|
13365253 |
Feb 2, 2012 |
9249436 |
|
|
14974983 |
|
|
|
|
61548616 |
Oct 18, 2011 |
|
|
|
61484458 |
May 10, 2011 |
|
|
|
61476691 |
Apr 18, 2011 |
|
|
|
61438969 |
Feb 2, 2011 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C10L 2290/26 20130101;
C10L 2290/30 20130101; C12N 9/16 20130101; C12N 9/0071 20130101;
C12P 7/6463 20130101; C12N 9/1029 20130101; C12N 15/52 20130101;
Y02E 50/13 20130101; C07C 69/52 20130101; C10L 2200/0476 20130101;
Y02E 50/10 20130101; C10L 1/02 20130101 |
International
Class: |
C12P 7/64 20060101
C12P007/64; C12N 15/52 20060101 C12N015/52; C12N 9/16 20060101
C12N009/16; C12N 9/10 20060101 C12N009/10; C10L 1/02 20060101
C10L001/02; C07C 69/52 20060101 C07C069/52; C12N 9/02 20060101
C12N009/02 |
Claims
1.-114. (canceled)
115. A method of producing a triglyceride oil, the method
comprising: a. cultivating a recombinant oleaginous microbe, the
microbe comprising an exogenous gene that encode a .beta.-ketoacyl
synthase II (KASII) peptide; b. recovering the triglyceride oil
from said recombinant oleaginous microbe; and wherein the
triglyceride oil is enriched in C18 fatty acids or reduced in C16
fatty acids.
116. The method of claim 115, wherein the triglyceride oil is
enriched in C18:0 and C18:1 fatty acids.
117. The method of claim 115, wherein the triglyceride is reduced
in C16:0 fatty acids.
118. The method of claim 115, wherein the triglyceride oil
comprises at least 60% C18:1.
119. The method of claim 115, wherein the recombinant oleaginous
microbe is microalgae.
120. The method of claim 119, wherein the microalgae is the genus
Prototheca or Chlorella.
121. The method of claim 120, wherein the microalgae is Prototheca
moriformis.
122. The method of claim 119, wherein the exogenous nucleic acids
are codon-optimized for expression in microalgae.
123. The method of claim 122, wherein the codon optimized nucleic
acids contains the most or second most preferred codon of Table 2
for at least 60% of the codons of the coding sequence.
124. The method of claim 115, wherein the recombinant oleaginous
microbe comprises a second exogenous gene, wherein the second
exogenous encodes a sucrose invertase.
125. A triglyceride oil produced by the method of claim 115.
126. A recombinant oleaginous microbial cell, the recombinant
microbial cell comprising an exogenous gene that encodes a
.beta.-ketoacyl synthase II (KASII) peptide, wherein fatty acids of
triglyceride oil produced by the recombinant microbial cell is
enriched in C18 fatty acids or reduced in C16 fatty acids.
127. The recombinant oleaginous microbial cell of claim 126,
wherein the triglyceride oil is enriched in C18:0 and C18:1 fatty
acids.
128. The recombinant oleaginous microbial cell of claim 127,
wherein the triglyceride oil comprises at least 60% C18:1.
129. The recombinant oleaginous microbial cell of claim 126,
wherein the recombinant oleaginous microbe is microalgae.
130. The recombinant oleaginous microbial cell of claim 129,
wherein the microalgae is the genus Prototheca or Chlorella.
131. The recombinant oleaginous microbial cell of claim 130,
wherein the microalgae is Prototheca moriformis.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 14/974,983, filed Dec. 18, 2015, which is a continuation of
U.S. application Ser. No. 13/365,253, filed Feb. 2, 2012, which
claims the benefit under 35 USC 119(e) of U.S. Provisional Patent
Application No. 61/438,969, filed Feb. 2, 2011, U.S. Provisional
Patent Application No. 61/476,691, filed Apr. 18, 2011, U.S.
Provisional Patent Application No. 61/484,458, filed May 10, 2011,
and U.S. Provisional Patent Application No. 61/548,616, filed Oct.
18, 2011. Each of these applications is incorporated herein by
reference in its entirety for all purposes.
REFERENCE TO A SEQUENCE LISTING
[0002] This application includes an electronic sequence listing in
a file named "473256-Sequence.txt", created on Dec. 18, 2015 and
containing 757,513 bytes, which is hereby incorporated by reference
in its entirety for all purposes.
FIELD OF THE INVENTION
[0003] The present invention relates to the production of oils,
fuels, and oleochemicals made from microorganisms. In particular,
the disclosure relates to oil-bearing microalgae, methods of
cultivating them for the production of useful compounds, including
lipids, fatty acid esters, fatty acids, aldehydes, alcohols, and
alkanes, and methods and reagents for genetically altering them to
improve production efficiency and alter the type and composition of
the oils produced by them.
BACKGROUND OF THE INVENTION
[0004] Fossil fuel is a general term for buried combustible
geologic deposits of organic materials, formed from decayed plants
and animals that have been converted to crude oil, coal, natural
gas, or heavy oils by exposure to heat and pressure in the earth's
crust over hundreds of millions of years. Fossil fuels are a
finite, non-renewable resource. Increased demand for energy by the
global economy has also placed increasing pressure on the cost of
hydrocarbons. Aside from energy, many industries, including
plastics and chemical manufacturers, rely heavily on the
availability of hydrocarbons as a feedstock for their manufacturing
processes. Cost-effective alternatives to current sources of supply
could help mitigate the upward pressure on energy and these raw
material costs.
[0005] PCT Pub. No. 2008/151149 describes methods and materials for
cultivating microalgae for the production of oil and particularly
exemplifies the production of diesel fuel from oil produced by the
microalgae Chlorella protothecoides. There remains a need for
improved methods for producing oil for fuel, chemicals, foods and
other uses, particularly for methods that produce oils with shorter
chain length and a higher degree of saturation and without
pigments, with greater yield and efficiency. The present invention
meets this need.
[0006] A polyurethane is a compound that comprises a carbamate
(urethane) linkage. Typically, a polyurethane is a polymer of
organic units. The polymer is prepared by the reaction of a first
organic unit comprising an isocyanate moiety
(C(O)N--R.sub.1--NC(O)) and a second organic unit comprising a
hydroxyl group (HO--R.sub.2--OH). A polyurethane can be represented
as --[C(O)NH--R.sub.1--NHC(O)--O--R.sub.2--O].sub.m--, wherein the
subscript m is a number that denotes the number of monomers
contained in the polymer. R.sub.1 and R.sub.2 can be the same or
different, but are typically different. Polyurethanes are used in
many different applications including both flexible and rigid
materials. Polyurethanes are used in shoes, automobiles, airplanes,
bushings, gaskets, adhesives, carpeting, spandex fibers, housing
for electronics and the like.
SUMMARY OF THE INVENTION
[0007] Illustrative embodiments of the present invention provide
oleaginous cells that produce altered glycerolipid profiles and
products produced from the cells. Examples of oleagninous cells
include microbial cells having a type II lipid biosynthesis
pathway. Embodiments also feature natural oils, which are
obtainable using the cells. Embodiments include recombinant cells
expressing exogenous genes encoding proteins such as fatty acyl-ACP
thioesterases. The present invention also provides methods of
making lipids and oil-based products, including fuels such as
biodiesel, renewable diesel and jet fuel, food oils and chemicals
from such cells.
[0008] In a first aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 3% C8:0. In
some cases, the lipid profile is at least 12% C8:0. In some
embodiments, the cell is a recombinant cell. In some cases, the
recombinant cell comprises an exogenous gene encoding an acyl-ACP
thioesterase protein that has hydrolysis activity towards fatty
acyl-ACP substrates of chain length C8. In some embodiments, the
exogenous gene encodes a Cuphea palustris acyl-ACP thioesterase. In
some cases, the cell is a Prototheca cell. In some cases, the cell
is of a microalgal genus or species selected from microalgae
identified in Table 1.
[0009] In a second aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 4% C10:0.
In some cases, the lipid profile is at least 18% C10:0. In some
cases, the lipid profile is at least 20% C10:0. In some cases, the
lipid content of the microalgal cell further comprises C12:0. In
some cases, the ratio of C10:0 to C12:0 is at least 3:1. In some
cases, the lipid content of the microalgal cell further comprises
C14:0. In some cases, the ratio of C10:0 to C14:0 is at least 10:1.
In some embodiments, the cell is a recombinant cell. In some cases,
the recombinant cell comprises an exogenous gene encoding a fatty
acyl-ACP thioesterase protein that has hydrolysis activity towards
fatty acyl-ACP substrates of chain length C10. In some embodiments,
the exogenous gene encodes a fatty acyl-ACP thioesterase protein
from a species selected from the group consisting of Cuphea
hookeriana and Ulmus americana. In some embodiments, the fatty
acyl-ACP thioesterase protein is from a species selected from the
group consisting of Cuphea hookeriana and Ulmus americana. In some
case, the fatty acyl-ACP thioesterase gene is selected from the
group consisting of a fatty acyl-ACP thioesterase gene from Cuphea
hookeriana and Ulmus americana that has hydrolysis activity towards
fatty acyl-ACP substrates of chain length C10.
[0010] In some cases, the cell is a Prototheca cell. In some
embodiments, the cell is of a microalgal genus or species selected
from microalgae identified in Table 1.
[0011] In a third aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 13% C12:0.
In some cases, the cell is a recombinant cell. In some embodiments,
the recombinant cell comprises an exogenous gene encoding a fatty
acyl-ACP thioesterase protein that has hydrolysis activity towards
fatty acyl-ACP substrates of chain length C12. In some embodiments,
the fatty acyl-ACP thioesterase protein is from a species selected
from the group consisting of Umbellularia californica and
Cinnamomum camphora. In some cases, the fatty acyl-ACP thioesterase
gene is selected from the group consisting of a fatty acyl-ACP
thioesterase gene from Umbellularia californica and Cinnamomum
camphora that has hydrolysis activity towards fatty acyl-ACP
substrates of chain length C12. In some embodiments, the cell is a
Prototheca cell.
[0012] In a fourth aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 10% C14:0.
In some cases, the lipid profile is at least 35% C14:0. In some
cases, the lipid content of the microalgal cell further comprises
C12:0. In some cases, the ratio of C14:0 to C12:0 is at least 3:1.
In some cases, the cell is a recombinant cell. In some embodiments,
the recombinant cell comprises an exogenous gene encoding a fatty
acyl-ACP thioesterase protein that has hydrolysis activity towards
fatty acyl-ACP substrates of chain length C14. In some embodiments,
the fatty acyl-ACP thioesterase protein is from a species selected
from the group consisting of Cinnamomum camphora and Ulmus
americana. In some cases, the fatty acyl-ACP thioesterase gene is
selected from the group consisting of a fatty acyl-ACP thioesterase
gene from Cinnamomum camphora and Ulmus americana that has
hydrolysis activity toward fatty acyl-ACP substrates of chain
length C14. In some cases, the cell is a Prototheca cell. In some
embodiments, the cell is of a microalgal genus or species selected
from microalgae identified in Table 1.
[0013] In a fifth aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 15% C16:0.
In some cases, the lipid profile is at least 39% C16:0. In some
cases, the lipid profile is at least 67% C16:0. In some cases, the
cell is a recombinant cell. In some embodiments, the recombinant
cell comprises an exogenous gene encoding a fatty acyl-ACP
thioesterase protein that has hydrolysis activity towards fatty
acyl-ACP substrates of chain length C16. In some embodiments, the
fatty acyl-ACP thioesterase protein is from a species selected from
Cuphea hookeriana and Ulmus Americana. In some embodiments, the
recombinant cell comprises an exogenous gene encoding a fatty
acyl-ACP thioesterase protein from a species selected from the
group consisting of Cuphea hookeriana and Ulmus americana that have
hydrolysis activity towards fatty acyl-ACP substrates of chain
length C16. In some cases, the cell is a Prototheca cell. In some
embodiments, the microalgal cell further comprises an endogenous
desaturase gene, wherein the endogenous desaturase gene has been
mutated to encode a desaturase that is inactive or less active than
the non-mutated desaturase, or wherein, said endogenous desaturase
has been deleted from the microalgal cell genome.
[0014] In a sixth aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 60%
saturated fatty acids. In some cases the microalgal cell has a
lipid profile that is at least 85% saturated fatty acids. In some
cases, the cell is a recombinant cell. In some embodiments, the
recombinant cell comprises an exogenous gene encoding a fatty
acyl-ACP thioesterase protein that has hydrolysis activity towards
fatty acyl-ACP substrates of chain lengths C10-C16. In some cases,
the cell is a Prototheca cell.
[0015] In a seventh aspect, the present invention provides a
microalgal cell having a lipid profile that is at least 19% C18:0.
In some cases, the lipid profile is at least 27% C18:0. In some
cases, the cell is a recombinant cell. In some embodiments, the
recombinant cell comprises an exogenous gene encoding a fatty
acyl-ACP thioesterase protein that has hydrolysis activity towards
fatty acyl-ACP substrates of chain length C18. In some embodiments,
the fatty acyl-ACP thioesterase protein is from a species selected
from Brassica napus. In some embodiments, the recombinant cell
comprises an exogenous gene encoding a fatty acyl-ACP thioesterase
protein from Brassica napus that has hydrolysis activity towards
fatty acyl-ACP substrates of chain length C16.
[0016] In an eighth aspect, the present invention provides a
microalgal cell comprising an exogenous gene encoding a fatty
acyl-ACP thioesterase protein from the group consisting of Cuphea
hookeriana, Umbellularia californica, Cinnamomun camphora, Cuphea
palustris, Cuphea lanceolata, Iris germanica, Myristica fragrans,
Garcinia mangostana, Elaeis guiniensis, Brassica napus, Ricinus
communis and Ulmus americana.
[0017] In an ninth aspect, the present invention provides a
microalgal cell comprising an expression construct wherein the
expression construct down-regulates the expression of an endogenous
gene selected from the methods consisting of the endogenous gene
has been mutated to encode a gene product that is inactive or less
active than the non-mutated gene product, the endogenous gene has
been deleted from the microalgal cell genome, and through a
RNA-induced mechanism. In some cases, the method is a RNA-induced
mechanism, such as RNAi, antisense and/or dsRNA. In some cases, the
endogenous gene is a desaturase gene. In some embodiments, the
desaturase gene is a delta 12 fatty acid desaturase gene. In some
cases, the cell is a Prototheca cell.
[0018] In an tenth aspect, the present invention provides a
microalgal cell as described in any of the above aspects, wherein
the microalgal cell is cultivated using stachyose, raffinose or
melibiose as a carbon source.
[0019] In an eleventh aspect, the present invention provides a
microalgal cell having a lipid profile that is no more than 2%
18:2. In some cases, the present invention provides a microalgal
cell having a lipid profile that is no more than 7% 18:2.
[0020] In a twelfth aspect, the present invention provides a method
of making lipid. In one embodiment, the method comprises (a)
cultivating a microalgal cell as discussed above until the cell is
at least 20% lipid by dry weight; and (b) separating the lipid from
water-soluble biomass components.
[0021] In a thirteenth aspect, the present invention provides
another method of making lipid. In one embodiment, the method
comprises (a) cultivating a microalgal cell containing two
different exogenous genes encoding two different acyl-ACP
thioesterases, and (b) separating the lipid from water-soluble
biomass components. In some cases, at least one of the exogenous
genes encodes a fatty acyl-ACP thioesterase selected from the group
consisting of the thioesterases identified in Table 4.
[0022] In a fourteenth aspect, the present invention provides a
method of making an oil-based product. In one embodiment, the
method comprises (a) cultivating a microalgal cell as discussed
above until the cell is at least 10% lipid by dry weight; (b)
separating the lipid from the microalgal cell; (c) subjecting the
lipid to at least one chemical reaction selected from the group
consisting of: saponification; metathesis; acid hydrolysis;
alkaline hydrolysis; enzymatic hydrolysis; catalytic hydrolysis;
hot-compressed water hydrolysis; a catalytic hydrolysis reaction
wherein the lipid is split into glycerol and fatty acids; an
amination reaction to produce fatty nitrogen compounds; an
ozonolysis reaction to produce mono- and dibasic-acids; a
triglyceride splitting reaction selected from the group consisting
of enzymatic splitting and pressure splitting; a condensation
reaction that follows a hydrolysis reaction; a hydroprocessing
reaction; a hydroprocessing reaction and a deoxygenation reaction
and/or a condensation reaction prior to or simultaneous with the
hydroprocessing reaction; a gas removal reaction; a deoxygenation
reaction selected from the group consisting of a hydrogenolysis
reaction, hydrogenation, a consecutive hydrogenation-hydrogenolysis
reaction, a consecutive hydrogenolysis-hydrogenation reaction, and
a combined hydrogenation-hydrogenolysis reaction; a condensation
reaction following a deoxygenation reaction; an esterification
reaction; an interestification reaction; a transesterification
reaction; a hydroxylation reaction; and a condensation reaction
following a hydroxylation reaction; and (d) optionally isolating a
product of the reaction from the other components, whereby an
oil-based product is produced.
[0023] In some cases, the oil-based product is selected from soap
or a fuel product. In some embodiments, the oil-based product is a
fuel product selected from the group consisting biodiesel,
renewable diesel, and jet fuel. In some cases, the fuel product is
biodiesel with one or more of the following attributes: (i)
0.025-0.3 mcg/g, preferably 0.05-0.244 mcg/g, total carotenoids;
(ii) less than 0.005 mcg/g, preferably less than 0.003 mcg/g,
lycopene; (iii) less than 0.005 mcg/g, preferably less than 0.003
mcg/g, beta carotene; (iv) 0.025-0.3 mcg/g, preferably 0.045-0.268
mcg/g, chlorophyll A; (v) 35-175 mcg/g, preferably 38.3-164 mcg/g,
gamma tocopherol; (vi) less than 0.25% brassicasterol, campesterol,
stignasterol, or beta-sitosterol; (vii) 225-350 mcg/g, preferably
249.6-325.3 mcg/g, total tocotrienols; (viii) 0.0025-0.05 mcg/g,
preferably 0.003-0.039 mcg/g, lutein; or (ix) 50-300 mcg/g,
preferably 60.8-261.7 mcg/g, tocopherols. In some cases, the fuel
product is renewable diesel that has a T10-T90 of at least
20.degree. C., 40.degree. C. or 60.degree. C. In some cases, the
fuel product is jet fuel that meets HRJ-5 and/or ASTM specification
D1655.
[0024] In a fifteenth aspect, the present invention provides a
triglyceride oil comprising (a) a lipid profile of at least 1-5%,
preferably at least 3%, C8:0, at least 2.5%, preferably at least
4%, C10:0, at least 10%, preferably at least 13%, C12:0, at least
10% C14:0, and/or at least 60% saturated fatty acids, and (b) one
or more of the following attributes: (i) 0.025-0.3 mcg/g,
preferably 0.05-0.244 mcg/g, total carotenoids; (ii) less than
0.005 mcg/g, preferably less than 0.003 mcg/g, lycopene; (iii) less
than 0.005 mcg/g, preferably less than 0.003 mcg/g, beta carotene;
(iv) 0.025-0.3 mcg/g, preferably 0.045-0.268 mcg/g, chlorophyll A;
(v) 35-175 mcg/g, preferably 38.3-164 mcg/g, gamma tocopherol; (vi)
less than 0.25% brassicasterol, campesterol, stignasterol, or
beta-sitosterol; (vii) 225-350 mcg/g, preferably 249.6-325.3 mcg/g,
total tocotrienols; (viii) 0.0025-0.05 mcg/g, preferably
0.003-0.039 mcg/g, lutein; or (ix) 50-300 mcg/g, preferably
60.8-261.7 mcg/g, tocopherols.
[0025] In a sixteenth aspect, the present invention provides a
triglyceride oil isolated from microalgae that has a C8:C10 fatty
acid ratio of at least 5:1. In some embodiments, the triglyceride
oil is isolated from microalgal cell (e.g., of the genus
Prototheca), wherein the microalgal cell comprises an exogenous
gene. In a related aspect, the present invention provides a
triglyceride oil isolated from microalgae with at least 60%
saturated fatty acids.
[0026] In another related aspect, the present invention provides a
triglyceride oil isolated from microalgae having a lipid profile
that has a C16:14 fatty acid ratio of about 2:1. In another related
aspect, the present invention provides a triglyceride oil produced
by a microalgal cell, wherein the microalgal cell comprises an
exogenous gene. In some cases, the microalgae is of the genus
Prototheca.
[0027] In another related aspect, the present invention provides a
triglyceride oil isolated from microalgae having a lipid profile
that has a C12:14 fatty acid ratio of about 3:1. In another related
aspect, the present invention provides a triglyceride oil produced
by a microalgal cell, wherein the microalgal cell comprises an
exogenous gene. In some cases, the microalgae is of the genus
Prototheca.
[0028] In a seventeenth aspect, the present invention provides a
triglyceride oil comprising (a) a lipid profile of less than
1%<C12; between 1%-10%, preferably 2%-7%, C14:0; between
20%-35%, preferably 23%-30%, C16:0; between 5%-20%, preferably
7%-15%, C18:0; between 35%-60%, preferably 40%-55%, C18:1; and
between 1%-20%, preferably 2%-15%, C18:2 fatty acids; and (b) one
or more of the following attributes: (i) 0.025-0.3 mcg/g,
preferably 0.05-0.244 mcg/g, total carotenoids; (ii) less than
0.005 mcg/g, preferably less than 0.003 mcg/g, lycopene; (iii) less
than 0.005 mcg/g, preferably less than 0.003 mcg/g, beta carotene;
(iv) 0.025-0.3 mcg/g, preferably 0.045-0.268 mcg/g, chlorophyll A;
(v) 35-175 mcg/g, preferably 38.3-164 mcg/g, gamma tocopherol; (vi)
less than 0.25% brassicasterol, campesterol, stignasterol, or
beta-sitosterol; (vii) 225-350 mcg/g, preferably 249.6-325.3 mcg/g,
total tocotrienols; (viii) 0.0025-0.05 mcg/g, preferably
0.003-0.039 mcg/g, lutein; or (ix) 50-300 mcg/g, preferably
60.8-261.7 mcg/g, tocopherols.
[0029] In some cases, the triglyceride oil is isolated from a
microbe comprising one or more exogenous gene. In some embodiments,
the one or more exogenous gene encodes a fatty acyl-ACP
thioesterase. In some cases, the fatty acyl-ACP thioesterase has
hydrolysis activity towards fatty acyl-ACP substrates of chain
length C14. In some embodiments, the microbe further comprising
expression construct wherein the expression construct
down-regulates the expression of an endogenous gene selected from
the methods consisting of the endogenous gene has been mutated to
encode a gene product that is inactive or less active than the
non-mutated gene product, the endogenous gene has been deleted from
the microalgal cell genome, and through a RNA-induced mechanism. In
some embodiments, the endogenous gene encodes a desaturase. In some
cases, the desaturase is a stearoyl-acyl carrier protein desaturase
(SAD) or a fatty acid desaturase (FAD).
[0030] In an eighteenth aspect, the present invention provides a
method of producing a triglyceride oil comprising a lipid profile
of less than 1%<C12; between 2%-7% C14:0; between 23%-30% C16:0;
between 7%-15% C18:0; between 40-55% C18:1; and between 2-15% C18:2
fatty acids, wherein the triglyceride oil is isolated from a
microbe comprising one or more exogenous gene. In some cases, the
triglyceride oil comprises a lipid profile of 3-5% C14:0; 25-27%
C16:0; 10-15% C18:0; and 40-45% C18:1. In some embodiments, the one
or more exogenous gene encodes a fatty acyl-ACP thioesterase. In
some cases, the fatty acyl-ACP thioesterase has hydrolysis activity
towards fatty acyl-ACP substrates of chain length C14.
[0031] In a nineteenth aspect, the present invention provides a
microbial cell that produces ricinoleic acid. In some cases, the
microbial cell is a microalgal cell. In some cases, the microbial
cell and the microalgal cell comprises an exogenous gene that
encodes a fatty acid hydroxylase. In some embodiments, the fatty
acid hydroxylase is an oleate 12-hydroxylase. In some cases, the
fatty acid hydroxylase is from Ricinus communis. In some cases, the
microbial cell is of the genus Prototheca, such as, for example
Prototheca moriformis.
[0032] In a twentieth aspect, the present invention provides a
microalgal cell comprising an exogenous gene that encodes an
alpha-galactosidase. In some cases, the microalgal cell comprising
an exogenous gene that encodes an alpha-galactosidase wherein the
alpha-galactosidase is secreted. In some embodiments, the exogenous
gene that encodes an alpha-galactosidase is from a genus selected
from the group consisting of Saccharomyces, Aspergillus and
Cyamopsis.
[0033] In a twentyfirst aspect, the present invention provides a
method of producing a lipid composition comprising the steps of:
(a) cultivating a microalgal cell under heterotrophic conditions in
the presence of a fixed carbon source, wherein the microalgal cell
comprises an exogenous gene encoding an alpha-galactosidase and the
fixed carbon source is selected from the group consisting of
raffinose, stachyose and melibiose; (b) separating the lipid from
the non-lipid components; thereby producing a lipid composition. In
some cases, the microalgal cell is of the genus Prototheca.
[0034] In a twentysecond aspect, the present invention provides a
microalgal cell comprising an exogenous gene that encodes a THIC
enzyme. In some cases, the THIC enzyme is from a genus selected
from the group consisting of Coccomyxa, Arabidopsis, and
Synechocystis.
[0035] In another aspect, the present invention provides a method
of cultivating a microalgal cell in the absence of thiamine
comprising expressing an exogenous gene that encodes a THIC enzyme.
In some cases, the THIC enzyme is from a genus selected from the
group consisting of Coccomyxa, Arabidopsis, and Synechocystis.
[0036] In other aspects, the present invention provides a
microalgal cell as described herein, wherein said microalgal cell
further comprises another exogenous gene selected from the group
consisting of a sucrose invertase, an alpha-galactosidase, and a
THIC enzyme.
[0037] Another aspect of this invention provides a hydroxylated oil
isolated from a microbial cell. In one aspect, the hydroxylated oil
is isolated from a microbial cell, wherein the microbial cell is a
microalgal cell (e.g., of the genus Prototheca). In a further
aspect, the hydroxylated oil is isolated from a Prototheca
moriformis cell. In one embodiment, the hydroxylated oil is a
hydroxylated triglyceride. The hydroxylated triglyceride may be
chemically similar or identical to castor oil.
[0038] A further aspect of the invention is a hydroxylated fatty
acid. One embodiment of the hydroxylated fatty acid is ricinoleic
acid.
[0039] In yet another aspect, the microbial hydroxylated oil or
hydroxylated fatty acid is further hydroxylated. When ricinoleic
acid is hydroxylated, a fatty acid containing two hydroxyl groups
is provided.
[0040] Yet another aspect of the invention provides a composition
prepared by reacting a hydroxylated oil and/or a hydroxylated fatty
acid with a compound that contains an isocyanate moiety to form a
polyurethane.
[0041] Another aspect of the invention provides a microalgal cell
having a lipid profile that is at least 20% C18:2. In some cases,
the microalgal cell has a lipid profile that is at least 30% C18:2.
In some cases, the microalgal cell has a lipid profile that is at
least 40% C18:2. In some cases, the microalgal cell has a lipid
profile that is at least 50% C18:2.
[0042] Another aspect of the invention provides a method of making
a lipid, comprising: (a) cultivating a microalgal cell in a culture
medium and monitoring the sugar concentration; (b) when the sugar
concentration of the culture medium reaches less than about 1 gram
per liter, adding a first sugar solution to the culture medium at a
continuous rate of between about 2 grams per hour per liter to
about 10 grams per hour per liter for about 2 to about 24 hours;
(c) adding a second sugar solution to the culture medium to
maintain the sugar concentration of the culture medium at about 15
to about 20 grams per liter; and (d) isolating the lipid from the
microalgal biomass. In some cases, the first sugar solution is
added to the culture medium at a rate of about 4 grams of sucrose
per hour per liter to about 6 grams of sucrose per hour per liter.
In some cases, the first sugar solution is added to the culture
medium at a rate of about 5.25 grams of sucrose per hour per liter.
In some cases, the sugar is sucrose or glucose.
[0043] Another aspect of the invention provides a microalgal cell
having a lipid profile that is at least 10% C18:3. In some cases,
the microalgal cell has a lipid profile that is at least 20% C18:3.
In some cases, the microalgal cell has a lipid profile that is at
least 30% C18:3. In some cases, the microalgal cell has a lipid
profile is at least 40% C18:3. In some cases, the microalgal cell
has a lipid profile is at least 50% C18:3.
[0044] Another aspect of the invention provides a microorganism
that produces a triglyceride comprising linoleic acid or linolenic
acid, wherein the microorganism comprises a recombinant nucleic
acid encoding a .beta.-ketoacyl-ACP synthase II (KAS II) enzyme. In
some cases, the microorganism further comprises a recombinant
nucleic acid encoding a stearoyl ACP desaturase (SAD) enzyme. In
some cases, the microorganism further comprises a recombinant
nucleic acid encoding an oleate-specific thioesterase enzyme. In
some cases, the microorganism further comprises a recombinant
nucleic acid encoding a fatty acid desaturase (FAD) enzyme. In some
cases, the microorganism further comprises a recombinant nucleic
acid encoding a glycerolipid desaturase.
[0045] In the engineered microorganisms discussed above, the KAS II
enzyme can comprise an amino acid sequence selected from the group
consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ
ID NO: 178 and SEQ ID NO: 179. In some cases, the SAD enzyme can
comprise an amino acid sequence selected from the group consisting
of SEQ ID NO: 172, SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198,
SEQ ID NO: 199, SEQ ID NO: 200, and SEQ ID NO: 201. In some cases,
the oleate-specific thioesterase enzyme can comprise an amino acid
sequence selected from the group consisting of SEQ ID NO: 195, SEQ
ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205, and SEQ
ID NO: 206. In some cases, the FAD enzyme can comprise an amino
acid sequence seleted from the group consisting of SEQ ID NO: 181,
SEQ ID NO: 182. SEQ ID NO: 183, SEQ ID NO: 184 and SEQ ID NO: 185.
In some cases, the FAD enzyme is a .DELTA.12 FAD enzyme comprising
an amino acid sequence selected from the group consisting of SEQ ID
NO: 207, SEQ ID NO: 208, SEQ ID NO: 209, SEQ ID NO: 210, SEQ ID NO:
211, and SEQ ID NO: 212. In some cases, the FAD enzyme is a
.DELTA.15 FAD enzyme comprising an amino acid sequence selected
from the group consisting of SEQ ID NO: 213, SEQ ID NO: 214, SEQ ID
NO: 215, SEQ ID NO: 216, SEQ ID NO: 217, SEQ ID NO: 218, SEQ ID NO:
219, SEQ ID NO: 220, and SEQ ID NO: 221. In some cases, the
glycerolipid desaturase is a .omega.-6 fatty acid desaturase, a
.omega.-3 fatty acid desaturase, or a .omega.-6 oleate
desaturase.
[0046] Any one of the engineered microorgansims discussed above can
further comprise a recombinant nucleic acid encoding a sucrose
utilization pathway enzyme. In some cases, the sucrose utilization
pathway enzyme is a sucrose invertase.
[0047] In any one of the engineered microorganisms discussed above,
the microorganism can be further engineered to increase the
proportion of linoleic acid or linolenic acid relative to other
fatty acids.
[0048] In any one of the engineered microorganisms discussed above,
the microorganism can be further engineered to overexpress a
thioesterase specific for or preferential to C18 substrates.
[0049] In any one of the engineered microorganisms discussed above,
the microorganism can be further engineered to decrease expression
of a thioesterase specific for or preferential to a C8-C16
substrate.
[0050] In any one of the engineered microorganisms discussed above,
the microorganism can be a microalgal cell. In some cases, the
microalgal cell is of the genus Prototheca. In some cases, the
microalgal cell is a Prototheca moriformis cell.
[0051] Another aspect of the invention provides an oil produced by
any one of the engineered microorganisms discussed above.
[0052] Another aspect of the invention provides methods of
producing the engineered microorganisms discussed above by
introducing into the microorganisms one or more of the recombinant
nucleic acids to produce triglycerides comprising linoleic acid or
linolenic acid.
[0053] Another aspect of the invention provides a method for
producing a natural oil comprising triacylglycerides, or a product
produced from the natural oil, in which the method comprises (i)
cultivating a cell of a recombinant microorganism, the cell
comprising recombinant nucleic acids operable to (a) decrease or
eliminate the expression of an enzyme encoded by one or more genes
that encode a .beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP
synthase II, stearoyl ACP desaturase, fatty acid desaturase, or
acyl-ACP thioesterase, and optionally wherein the cell comprises
recombinant nucleic acids operable to decrease or eliminate the
expression of two copies of a gene encoding a .beta.-ketoacyl-ACP
synthase I, .beta.-ketoacyl-ACP synthase II, stearoyl ACP
desaturase, or fatty acid desaturase, or acyl-ACP thioesterase; or
(b) express a product of an exogenous gene encoding an active
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP
thioesterase; or (c) decrease or eliminate the expression of an
enzyme encoded by one or more genes that encode a
.beta.-ketoacyl-ACP synthase I or .beta.-ketoacyl-ACP synthase II,
and express a product of an exogenous gene encoding an active
stearoyl ACP desaturase, fatty acid desaturase, or acyl-ACP
thioesterase; or (d) decrease or eliminate the expression of an
enzyme encoded by one or more genes that encode a stearoyl ACP
desaturase or fatty acid desaturase, and express a product of an
exogenous gene encoding an active .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, or acyl-ACP thioesterase; and (ii)
recovering the natural oil from the cell, and optionally further
processing the natural oil to produce a food, fuel, or chemical
product, wherein the natural oil has an altered fatty acid profile
due to the recombinant nucleic acids.
[0054] In some cases, the microorganism synthesizes fatty acids
through a type II fatty acid biosynthesis pathway. In some cases,
the microorganism is a microalga. In some cases, the microalga is
an obligate heterotroph. In some cases, the microalga is a species
of Prototheca or Chlorella. In some cases, the microalga is
Prototheca wickerhamii, Prototheca stagnora, Prototheca
portoricensis, Prototheca moriformis, or Prototheca zopfii. In some
cases, the microalga is Chlorella kessleri, Chlorella luteoviridis
Chlorella protothecoides, or Chlorella vulgaris. In some cases, the
cell is a recombinant cell expressing an active sucrose invertase.
In some cases, the cultivating is heterotrophic. In some cases, the
fatty acid desaturase is one or more of a .omega.-6 fatty acid
desaturase, a .omega.-3 fatty acid desaturase, or a .omega.-6
oleate desaturase, or a delta 12 fatty acid desaturase. In some
cases, the cell is cultivated so as to comprise between at least
50%, at least 60%, at least 70%, or 50 and 90% triglyceride by dry
cell weight. In some cases, the oil comprises less than 500, 50, or
5 ppm of colored molecules. In some cases, the recombinant nucleic
acids are stably integrated. In some cases, the recombinant nucleic
acids are stably integrated into the chromosome of the
microorganism. In some cases, the cell further comprises at least
one selectable marker.
[0055] In some cases, the cell comprises recombinant nucleic acids
operable to decrease or eliminate the expression of an enzyme
through expression of antisense, RNAi, or dsRNA targeting the
transcript of a gene encoding for the enzyme. In some cases, the
decrease or elimination of the expression of an enzyme encoded by
one or more genes that encode a .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty
acid desaturase is due to the interruption or replacement of the
one or more genes with one or more genes encoding an active
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP
thioesterase. In some cases, the recombinant cell further comprises
an exogenous gene encoding an oleate 12-hydroxylase, so as to
synthesize ricinoleic acid. In some cases, the recombinant cell
comprises nucleic acids operable to decrease or eliminate the
expression of a .beta.-ketoacyl-ACP synthase II encoded by a KASII
gene, and to express a product of an exogenous gene encoding an
acyl-ACP thioesterase. In some cases, the cell produces an oil with
a fatty acid profile characterized by having at least 40, 50, 60,
70, or 80% C16 fatty acids. In some cases, the cell produces an oil
with a fatty acid profile characterized by having at least 50-75%
C16:0. In some cases, the cell produces an oil with a fatty acid
profile further characterized by having at least 20-40% C18:1. In
some cases, the exogenous gene encoding an acyl-ACP thioesterase
produces an active acyl-ACP thioesterase having greater activity in
hydrolysis of C8-C16 fatty acyl chains than a native
acyl-ACP-thioestearase of the cell. In some cases, the exogenous
gene encoding an acyl-ACP thioesterase interrupts the KASII gene.
In some cases, the recombinant cell comprises nucleic acids
operable to decrease or eliminate the expression of an enzyme
encoded by one or more genes that encode a .beta.-ketoacyl-ACP
synthase I.
[0056] In some cases, the oil produced has a fatty acid profile
characterized by a shorter mean fatty acid chain length as a result
of the recombinant nucleic acids. In some cases, the recombinant
cell comprises nucleic acids operable to decrease or eliminate the
expression of a fatty acid destaurase encoded by at least one FAD
gene and express a product of a stearoyl-ACP desaturase exogenous
gene encoding an active stearoyl ACP desaturase. In some cases,
nucleic acids are operable to decrease or eliminate the expression
of a fatty acid destaurase encoded by multiple copies of a fatty
acid desaturase gene. In some cases, the Stearoyl-ACP desaturase
exogenous gene is recombined into a locus within the coding region
of the fatty acid desaturase gene. In some cases, the oil produced
has a fatty acid profile having elevated oleic acid. In some cases,
the oleic acid comprises at least 50, 60, 70, 80, or 90% of the
fatty acids. In some cases, the recombinant cell comprises nucleic
acids operable to express a product of a .beta.-ketoacyl-ACP
synthase II exogenous gene encoding an active .beta.-ketoacyl-ACP
synthase II. In some cases, the oil produced is characterized by a
fatty acid profile elevated in C18:1 fatty acids and reduced in C16
fatty acids as a result of the recombinant nucleic acids. In some
cases, the recombinant cell comprises nucleic acids operable to
decrease or eliminate the expression of an enzyme encoded by one or
more genes that encode a stearoyl ACP desaturase by RNA
interference. In some cases, the oil produced has a fatty acid
profile characterized by an increase in C18:0 fatty acids. In some
cases, the oil produced is characterized by a fatty acid profile
having at least 50, 60, 70, 80, or 90% C18:0. In some cases, the
oil produced is characterized by a fatty acid profile having at
least 50-75% C18:0. In some cases, the oil produced is further
characterized by a fatty acid profile having at least 20-40% C18:1.
In some cases, the cell comprises recombinant nucleic acids
operable to decrease or eliminate the expression of two copies of a
gene encoding a .beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP
synthase II, stearoyl ACP desaturase, or fatty acid desaturase. In
some cases, the nucleic acids are operable to express a product of
a fatty acid desaturase exogenous gene encoding an active a
.omega.-3 fatty acid desaturase and/or a .omega.-6 oleate
desaturase. In some cases, the oil produced has a fatty acid
profile characterized by an elevated level of linoleic acid,
linolenic acid, or both. In some cases, the fatty acid profile of
the oil is characterized by having at least 10, 20, 30, 40, or 50%
linoleic acid, linolenic acid, or both. In some cases, the further
processing of the oil comprises one or more of refining, bleaching,
deodorizing, metathesis, transesterification, hydrogenation,
hydrolysis, hydrogenation, deoxygenation, hydrocracking,
isomerization, hydrolxylation, interesterification, amidation,
sulfonation, and sulfurization. In some cases, the oil is processed
to create a food oil, fatty acids, a fatty alcohol, a lubricant, a
soap, a fatty acid ester, a fatty acid ethoxylate, a fatty amine,
an akyl chloride, a fatty alcohol ethoxylate, a fatty alcohol
sulfate, a fatty acid alkanolamide, a sulfonated oil, a sulfurized
oil, diesel fuel, jet fuel, gasoline, fuel blendstock, fuel
additive, lubricant additive, or coating.
[0057] Another aspect of the invention provides natural oil
obtainable by the methods discussed above.
[0058] Another aspect of the invention provides a product made from
the natural oil discussed above. In some cases, the product
comprises a food oil, fatty acids, a fatty alcohol, a lubricant, a
soap, a fatty acid ester, a fatty acid ethoxylate, a fatty amine,
an akyl chloride, a fatty alcohol ethoxylate, a fatty alcohol
sulfate, a fatty acid alkanolamide, a sulfonated oil, a sulfurized
oil, diesel fuel, jet fuel, gasoline, fuel blendstock, fuel
additive, chemical additive, or coating.
[0059] Another aspect of the invention provides a recombinant cell
comprising recombinant nucleic acids operable to (a) decrease or
eliminate the expression of an enzyme encoded by one or more genes
that encode a .beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP
synthase II, stearoyl ACP desaturase, fatty acid desaturase, or
acyl-ACP thioesterase, and optionally wherein the cell comprises
recombinant nucleic acids operable to decrease or eliminate the
expression of two copies of a gene encoding a .beta.-ketoacyl-ACP
synthase I, .beta.-ketoacyl-ACP synthase II, stearoyl ACP
desaturase, or fatty acid desaturase, or acyl-ACP thioesterase; or
(b) express a product of an exogenous gene encoding an active
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP
thioesterase; or (c) decrease or eliminate the expression of an
enzyme encoded by one or more genes that encode a
.beta.-ketoacyl-ACP synthase I or .beta.-ketoacyl-ACP synthase II,
and express a product of an exogenous gene encoding an active
stearoyl ACP desaturase, fatty acid desaturase, or acyl-ACP
thioesterase; or (d) decrease or eliminate the expression of an
enzyme encoded by one or more genes that encode a stearoyl ACP
desaturase or fatty acid desaturase, and express a product of an
exogenous gene encoding an active .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, or acyl-ACP thioesterase.
[0060] In some cases, the microorganism synthesizes fatty acids
through a type II fatty acid biosynthesis pathway. In some cases,
the microorganism is a microalga. In some cases, the microalga is
an obligate heterotroph. In some cases, the microalga is a species
of Prototheca or Chlorella. In some cases, the microalga is
Prototheca wickerhamii, Prototheca stagnora, Prototheca
portoricensis, Prototheca moriformis, or Prototheca zopfii. In some
cases, the microalga is Chlorella kessleri, Chlorella luteoviridis
Chlorella protothecoides, or Chlorella vulgaris. In some cases, the
cell is a recombinant cell expressing an active sucrose invertase.
In some cases, the cell is capable of heterotrophic growth. In some
cases, the fatty acid desaturase is one or more of a .omega.-6
fatty acid desaturase, a .omega.-3 fatty acid desaturase, or a
.omega.-6 oleate desaturase, or a delta 12 fatty acid desaturase.
In some cases, the cell is capable of being cultivated so as to
comprise between at least 50%, at least 60%, at least 70%, or 50
and 90% triglyceride by dry cell weight. In some cases, the
recombinant nucleic acids are stably integrated. In some cases, the
recombinant nucleic acids are stably integrated into the chromosome
of the microorganism. In some cases, the cell further comprises at
least one selectable marker. In some cases, the cell comprises
recombinant nucleic acids operable to decrease or eliminate the
expression of an enzyme through expression of antisense, RNAi, or
dsRNA targeting the transcript of a gene encoding for the enzyme.
In some cases, the decrease or elimination of the expression of an
enzyme encoded by one or more genes that encode a
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase is due to the
interruption or replacement of the one or more genes with one or
more genes encoding an active .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty
acid desaturase, or acyl-ACP thioesterase.
[0061] In some cases, the recombinant cell further comprises an
exogenous gene encoding an oleate 12-hydroxylase, so as to
synthesize ricinoleic acid. In some cases, the recombinant cell
comprises nucleic acids operable to decrease or eliminate the
expression of a .beta.-ketoacyl-ACP synthase II encoded by a KASII
gene, and to express a product of an exogenous gene encoding an
acyl-ACP thioesterase. In some cases, the cell produces an oil with
a fatty acid profile characterized by having at least 40, 50, 60,
70, or 80% C16 fatty acids. In some cases, the cell produces an oil
with a fatty acid profile characterized by having at least 50-75%
C16:0. In some cases, the cell produces an oil with a fatty acid
profile further characterized by having at least 20-40% C18:1. In
some cases, the exogenous gene encoding an acyl-ACP thioesterase
produces an active acyl-ACP thioesterase having greater activity in
hydrolysis of C8-C16 fatty acyl chains than a native
acyl-ACP-thioestearase of the cell. In some cases, the exogenous
gene encoding an acyl-ACP thioesterase interrupts the KASII gene.
In some cases, the recombinant cell comprises nucleic acids
operable to decrease or eliminate the expression of an enzyme
encoded by one or more genes that encode a .beta.-ketoacyl-ACP
synthase I. In some cases, the oil produced has a fatty acid
profile characterized by a shorter mean fatty acid chain length as
a result of the recombinant nucleic acids. In some cases, the
recombinant cell comprises nucleic acids operable to decrease or
eliminate the expression of a fatty acid destaurase encoded by at
least one FAD gene and express a product of a stearoyl-ACP
desaturase exogenous gene encoding an active stearoyl ACP
desaturase. In some cases, the nucleic acids are operable to
decrease or eliminate the expression of a fatty acid destaurase
encoded by multiple copies of a fatty acid desaturase gene. In some
cases, the Stearoyl-ACP desaturase exogenous gene is recombined
into a locus within the coding region of the fatty acid desaturase
gene.
[0062] In some cases, the oil produced has a fatty acid profile
having elevated oleic acid. In some cases, the oleic acid comprises
at least 50, 60, 70, 80, or 90% of the fatty acids. In some cases,
the recombinant cell comprises nucleic acids operable to express a
product of a .beta.-ketoacyl-ACP synthase II exogenous gene
encoding an active .beta.-ketoacyl-ACP synthase II. In some cases,
the oil produced is characterized by a fatty acid profile elevated
in C18:1 fatty acids and reduced in C16 fatty acids as a result of
the recombinant nucleic acids. In some cases, the recombinant cell
comprises nucleic acids operable to decrease or eliminate the
expression of an enzyme encoded by one or more genes that encode a
stearoyl ACP desaturase by RNA interference. In some cases, the oil
produced has a fatty acid profile characterized by an increase in
C18:0 fatty acids. In some cases, the oil produced is characterized
by a fatty acid profile having at least 50, 60, 70, 80, or 90%
C18:0. In some cases, the oil produced is characterized by a fatty
acid profile having at least 50-75% C18:0. In some cases, the oil
produced is further characterized by a fatty acid profile having at
least 20-40% C18:1. In some cases, the cell comprises recombinant
nucleic acids operable to decrease or eliminate the expression of
two copies of a gene encoding a .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty
acid desaturase. In some cases, the nucleic acids are operable to
express a product of a fatty acid desaturase exogenous gene
encoding an active a .omega.-3 fatty acid desaturase and/or a
.omega.-6 oleate desaturase. In some cases, the oil produced has a
fatty acid profile characterized by an elevated level of linoleic
acid, linolenic acid, or both. In some cases, the fatty acid
profile of the oil is characterized by having at least 10, 20, 30,
40, or 50% linoleic acid, linolenic acid, or both.
[0063] Another aspect of the invention provides a natural oil or
oil-containing product produced from the cells described above.
[0064] Another aspect of the invention provides a method for
producing a natural oil comprising triacylglycerides that comprise
ricinoleic acid, or a product produced from the natural oil, the
method comprising cultivating a cell of a recombinant
microorganism, the cell comprising recombinant nucleic acids
operable to express a product of an exogenous gene encoding an
active oleate 12-hydroxylase, so as to synthesize the ricinoleic
acid.
[0065] In some cases, the microorganism has a type II fatty acid
biosynthesis pathway. In some cases, the microorganism is a
microalga. In some cases, the microalga is an obligate heterotroph.
In some cases, the microalga is a species of Prototheca. In some
cases, the microalga is Prototheca wickerhamii, Prototheca
stagnora, Prototheca portoricensis, Prototheca moriformis, or
Prototheca zopfii. In some cases, the microalga is Chlorella
kessleri, Chlorella luteoviridis Chlorella protothecoides, or
Chlorella vulgaris. In some cases, the cell is a recombinant cell
expressing an active sucrose invertase. In some cases, the
cultivating is heterotrophic. In some cases, the cell produces at
least 40, 50, 60, 70, 80, or 90% oleic acid absent the recombinant
nucleic acids operable to express a product of an exogenous gene
encoding an active oleate 12-hydroxylase. In some cases, the cell
further comprises recombinant nucleic acids operable to enhance
oleic acid production so as to elevate the substrate levels for the
oleate 12-hydroxylase. In some cases, the cell comprises
recombinant nucleic acids operable to (a) express a product of an
exogenous gene encoding an active stearoyl ACP desaturase and
decrease or eliminate the expression of an enzyme encoded by one or
more genes that encode a fatty acid desaturase; or (b) express a
product of an exogenous gene encoding an active .beta.-ketoacyl-ACP
synthase I and express a product of an exogenous gene encoding an
active acyl-ACP thioesterase.
[0066] Another aspect of the invention provides a product produced
according to any of the methods discussed above.
[0067] Another aspect of the invention provides a microorganism
cell comprising recombinant nucleic acids operable to express a
product of an exogenous gene encoding an active oleate
12-hydroxylase, so as to synthesize ricinoleic acid.
[0068] In some cases, the microorganism has a type II fatty acid
biosynthesis pathway. In some cases, the microorganism is a
microalga. In some cases, the microalga is an obligate heterotroph.
In some cases, the microalga is a species of Prototheca. In some
cases, the microalga is Prototheca wickerhamii, Prototheca
stagnora, Prototheca portoricensis, Prototheca moriformis, or
Prototheca zopfii. In some cases, the microalga is Chlorella
kessleri, Chlorella luteoviridis Chlorella protothecoides, or
Chlorella vulgaris. In some cases, the cell is a recombinant cell
expressing an active sucrose invertase. In some cases, the cell is
capable of heterotrophic growth. In some cases, the cell produces
at least 40, 50, 60, 70, 80, or 90% oleic acid absent the
recombinant nucleic acids operable to express a product of an
exogenous gene encoding an active oleate 12-hydroxylase. In some
cases, the cell further comprises recombinant nucleic acids
operable to enhance oleic acid production so as to elevate the
substrate levels for the oleate 12-hydroxylase. In some cases, the
cell comprises recombinant nucleic acids operable to (a) express a
product of an exogenous gene encoding an active stearoyl ACP
desaturase and decrease or eliminate the expression of an enzyme
encoded by one or more genes that encode a fatty acid desaturase;
or (b) express a product of an exogenous gene encoding an active
.beta.-ketoacyl-ACP synthase I and express a product of an
exogenous gene encoding an active acyl-ACP thioesterase.
[0069] Another aspect of the present invention provides a food
comprising an oil as discussed above.
[0070] These and other aspects and embodiments of the invention are
described in the accompanying drawing, a brief description of which
immediately follows, the detailed description of the invention
below, and are exemplified in the examples below. Any or all of the
features discussed above and throughout the application can be
combined in various embodiments of the present invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0071] FIG. 1 shows a chromatogram of renewable diesel produced
from Prototheca triglyceride oil.
[0072] FIG. 2 shows GC retention times of a representative positive
transgenic clone compared to the ricinoleic acid standard and a
wildtype control.
[0073] FIG. 3 shows PstI restriction maps of Prototheca moriformis
FADc alleles with and without a targeted gene disruption, as
described in Example 18.
[0074] FIG. 4 shows the results of the Southern blot described in
Example 18.
DETAILED DESCRIPTION OF THE INVENTION
[0075] Illustrative embodiments of the present invention feature
oleaginous cells that produce altered glycerolipid profiles and
products produced from the cells. Examples of oleagninous cells
include microbial cells having a type II lipid biosynthesis
pathway. Embodiments include recombinant cells expressing one or
more exogenous genes encoding proteins such as fatty acyl-ACP
thioesterases, fatty acid desaturases, keto-acyl synthases and
optionally having one or more knockdowns of endogenous genes
encoding proteins with similar activities. As a result, some
embodiments feature natural oils never before obtainable. The
present invention also provides methods of making lipids and
oil-based products, including fuels such as biodiesel, renewable
diesel and jet fuel, food oils and chemicals from such cells.
[0076] The oils produced according to embodiments of the present
invention can be used in the transportation fuel, oleochemical,
and/or food and cosmetic industries, among other applications. For
example, transesterification of lipids can yield long-chain fatty
acid esters useful as biodiesel. Other enzymatic and chemical
processes can be tailored to yield fatty acids, aldehydes,
alcohols, alkanes, and alkenes. In some applications, renewable
diesel, jet fuel, or other hydrocarbon compounds are produced. The
present invention also provides methods of cultivating microalgae
for increased productivity and increased lipid yield, and/or for
more cost-effective production of the compositions described
herein.
[0077] An embodiment of the invention provides a method for
producing a natural oil comprising triacylglycerides, or for
producing a product produced from the natural oil. The natural oil
can be a non-plant or non-seed oil. The method comprises
cultivating a cell of a recombinant microorganism to produce a
tailored oil; i.e., one with an altered fatty acid profile due to
the presence of the recombinant nucleic acids in the cell. The
natural oil can then be further processed to produce a food, fuel,
or chemical product. The recombinant nucleic acids in the cell are
operable to (a) decrease or eliminate the expression of an enzyme
encoded by one or more genes that encode a .beta.-ketoacyl-ACP
synthase I, .beta.-ketoacyl-ACP synthase II, stearoyl ACP
desaturase, fatty acid desaturase, or acyl-ACP thioesterase.
Optionally the cell comprises recombinant nucleic acids operable to
decrease or eliminate the expression of two copies of a gene (e.g.,
two alleles in a diploid organism) encoding a .beta.-ketoacyl-ACP
synthase I, .beta.-ketoacyl-ACP synthase II, stearoyl ACP
desaturase, or fatty acid desaturase, or acyl-ACP thioesterase; or
(b) express a product of a exogenous gene encoding an active
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase, or acyl-ACP
thioesterase; or (c) decrease or eliminate the expression of an
enzyme encoded by one or more genes that encode a
.beta.-ketoacyl-ACP synthase I or .beta.-ketoacyl-ACP synthase II,
and express a product of a exogenous gene encoding an active
stearoyl ACP desaturase, fatty acid desaturase, or acyl-ACP
thioesterase; or (d) decrease or eliminate the expression of an
enzyme encoded by one or more genes that encode a stearoyl ACP
desaturase or fatty acid desaturase, and express a product of an
exogenous gene encoding an active .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, or acyl-ACP thioesterase.
[0078] Where a recombinant nucleic acid encoding one or more fatty
acid desaturases is present in the cell, the nucleic acid may
encode for one or more of a .omega.-6 fatty acid desaturase, a
.omega.-3 fatty acid desaturase, or a .omega.-6 oleate desaturase,
or a delta 12 fatty acid desaturase.
[0079] Where the cell comprises recombinant nucleic acids operable
to decrease or eliminate the expression of an enzyme, this may
occur through expression of antisense, RNAi, or dsRNA targeting the
transcript of a gene encoding for the enzyme, or by other suitable
means, including a directed mutation, complete deletion, or partial
deletion. Thus, the decrease or alimentation of the expression of
an enzyme encoded by one or more genes that encode a
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase can be due to the
interruption or replacement of the one or more genes with one or
more genes encoding an active .beta.-ketoacyl-ACP synthase I,
.beta.-ketoacyl-ACP synthase II, stearoyl ACP desaturase, or fatty
acid desaturase, or acyl-ACP thioesterase.
[0080] Preferably, the recombinant nucleic acids are stably
integrated into the cell; e.g., into the cells chromosome, or an
episome. The selection of cells with stably integrated nucleic
acids may be aided using a selectable marker such as sucrose
invertase, an antibiotic resistance gene, or thiamine auxotrophy
complementation, as described herein.
[0081] Preferably, the microorganism can be one that synthesizes
fatty acids through a type II fatty acid biosynthesis pathway. For
example, the microorganism can be a microalga, but can also be a
microorganism that normally possesses a type I fatty acid
biosynthetic pathway (e.g., an oil producing yeast) into which type
two genetic machinery has been introduced using genetic engineering
techniques. The microorganism can be a heterotroph, and in a
specific embodiment, an obligate heterotroph. Where the microalga
is used, the microalga may be a species of Prototheca or Chlorella.
Illustrative species include Prototheca wickerhamii, Prototheca
stagnora, Prototheca portoricensis, Prototheca moriformis,
Prototheca zopfii, Chlorella kessleri, Chlorella luteoviridis
Chlorella protothecoides, and Chlorella vulgaris. In order to be
able to use sucrose feedstocks such as sugar cane juice and others
described herein, the recombinant cell can include recombinant
nucleic acids that include a sucrose invertase gene so as to
express an active sucrose invertase. The sucrose invertase may be
secreted by the microorganism into the medium.
[0082] Cultivation can be heterotrophic; e.g., performed in a
bioreactor using a fixed carbon source such as glucose or sucrose.
The cultivation may be continued until the cell reaches at least
50%, at least 60%, at least 70%, or 50 to 90% triglyceride by dry
cell weight. This may entail cultivation using limiting nitrogen,
as described infra.
[0083] The oil produced by the cell can be extracted from the cell.
In an embodiment, the oil comprises less than 500, 50, or 5 ppm of
colored molecules. Optionally, the oil is analyzed for its fatty
acid profile; e.g., by LC-MS. The oil can also have one or more of
the properties of the oil of Example 19, tables 60-63.
[0084] In a specific embodiment, the recombinant cell comprises
nucleic acids operable to decrease or eliminate the expression of a
.beta.-ketoacyl-ACP synthase II encoded by a KASII gene, and to
express a product of an exogenous gene encoding an acyl-ACP
thioesterase. As a result, the cell can produce an oil with a fatty
acid profile characterized by having at least 40, 50, 60, or 70%
C16 fatty acids (e.g., palmitic acid). Thus, the oil can have a
fatty acid distribution shifted towards shorter chain lengths. The
shift in the fatty acid distribution can be characterized by a
reduced mean fatty acid length o9r other statistical
characterization of the distribution. For example, to calculate
mean fatty acid length, the percent of each detectable fatty acid
making up the triglycerides is multiplied by the number of carbons
in the fatty acid and the sum of the products is divided by 100.
The exogenous gene encoding the acyl-ACP thioesterase can produce
an active acyl-ACP thioesterase having greater activity in
hydrolysis of C8-C16 fatty acyl chains than a native
acyl-ACP-thioesterase of the cell. The exogenous gene encoding an
acyl-ACP thioesterase can interrupt the KASII gene. In this way,
the insertion of the acyl-ACP thioesterase can also eliminate
expression of the P.beta.-ketoacyl-ACP synthase II in one step. See
Examples 15 and 16.
[0085] In another specific embodiment, the recombinant cell
comprises nucleic acids operable to decrease or eliminate the
expression of an enzyme encoded by one or more genes that encode a
.beta.-ketoacyl-ACP synthase I. As a result, the oil produced has a
fatty acid profile characterized by a distribution of fatty acid
chain lengths that is shorter than a comparable cell lacking the
recombinant nucleic acids. This may be expressed as a reduced mean
fatty acid chain length. The recombinant cell can include nucleic
acids operable to decrease or eliminate the expression of a fatty
acid destaurase encoded by at least one FAD gene and to express a
product of a stearoyl-ACP desaturase exogenous gene encoding an
active stearoyl ACP desaturase. Optionally, the nucleic acids are
operable to decrease or eliminate the expression of a fatty acid
destaurase encoded by multiple copies (e.g., alleles) of a fatty
acid desaturase gene. In a specific embodiment, the stearoyl-ACP
desaturase exogenous gene is recombined into a locus within the
coding region of the fatty acid desaturase gene. As a result, the
oil produced can have an elevated level of oleic acid compared to
that produced by a comparable cell lacking the nucleic acids. The
oleic acid comprises at least 50, 60, 70, 80, or 90% of the fatty
acids in the fatty acid profile. See Example 10.
[0086] In another specific embodiment, the recombinant cell
comprises nucleic acids operable to express a product of a
.beta.-ketoacyl-ACP synthase II exogenous gene encoding an active
.beta.-ketoacyl-ACP synthase II. As a result, the oil produced can
be characterized by a fatty acid profile elevated in 18:1 fatty
acids and reduced in C16 fatty acids as a result of the recombinant
nucleic acids. See Example 13, in which overexpression of a KASII
gene increased the percentage of C18 fatty acids from about 68% in
the untransformed cells to about 84%. In related embodiments, the
increase is greater than 70%, from 75-85%, or from 70-90%.
[0087] In another specific embodiment, the recombinant cell
comprises nucleic acids operable to decrease or eliminate the
expression of an enzyme encoded by one or more genes that encode a
stearoyl ACP desaturase by RNA interference. As a result, the oil
produced can have a fatty acid profile characterized by an increase
in 18:0 fatty acids. The 18:0 fatty acids can be at least 50, 60,
70, 80, or 90% of the fatty acids in the profile. See Example
12.
[0088] In another specific embodiment, the cell comprises
recombinant nucleic acids operable to decrease or eliminate the
expression of two copies of a gene (e.g. two alleles) encoding a
.beta.-ketoacyl-ACP synthase I, .beta.-ketoacyl-ACP synthase II,
stearoyl ACP desaturase, or fatty acid desaturase. See Example 14,
in which an endogenous KASI allele was knocked out in Prototheca.
As a result, an increase was observed in the percentage of total
C14 fatty acids by about 35% to 400% and the percentage of C16
fatty acids by about 30 to 50% due to disruption of an endogenous
KASI.
[0089] In another specific embodiment, the cell comprises
recombinant nucleic acids operable to express a product of a fatty
acid desaturase exogenous gene encoding an active a .omega.-3 fatty
acid desaturase and/or a .omega.-6 oleate desaturase. As a result,
elevated levels of linoleic acid, linolenic acid, or both can be
produced by the cell, and detected in the fatty acid profile of the
cell lipids. For example, the cell can have at least 10, 20, 30,
40, or 50% linoleic acid, linolenic acid, or both. For example, a
recombinant A15 desaturase enzyme may be expressed as in Example
11. As a result, C18:3 fatty acids (i.e., linolenic acid), can be
increased from about 2 to 17 fold, or more.
[0090] In another embodiment, a cell of a recombinant microorganism
is cultivated. The cell includes recombinant nucleic acids that
operate to express a product of an exogenous gene encoding an
active oleate 12-hydroxylase, so as to synthesize the ricinoleic
acid. This gene may be present in any of the aforementioned
embodiments. See Example 7. A preferred substrate for
12-hydroxylase is oleic acid. Thus, in a preferred embodiment, a
higher yield of ricinoleic acid may be obtained by inclusion in the
cell of recombinant nucleic acids that operate to increase oleic
acid production. Without limitation, the cell comprises recombinant
nucleic acids operable to express a product of an exogenous gene
encoding an active stearoyl ACP desaturase and decrease or
eliminate the expression of an enzyme encoded by one or more genes
that encode a fatty acid desaturase; or express a product of an
exogenous gene encoding an active .beta.-ketoacyl-ACP synthase I
and express a product of an exogenous gene encoding an active
acyl-ACP thioesterase.
[0091] In accordance with any of the embodiments of the invention,
the oil can be extracted and further processed by one or more of
refining, bleaching, deodorizing, metathesis, transesterification,
hydrogenation, hydrolysis, hydrogenation, deoxygenation,
hydrocracking, isomerization, hydroxylation, interesterification,
amidation, sulfonation, and sulfurization. The oil may be
processed, for example, to create a food oil, fatty acids, a fatty
alcohol, a lubricant, a soap, a fatty acid ester, a fatty acid
ethoxylate, a fatty amine, an akyl chloride, a fatty alcohol
ethoxylate, a fatty alcohol sulfate, a fatty acid alkanolamide, a
sulfonated oil, or a sulfurized oil, diesel, jet gasoline, or a
blendstock or additive, a lubricant, or a paint.
[0092] Any of the embodiments mentioned herein can be useful as a
food or food oil. The whole organism can be incorporated into a
food. The organism can be intact, partly lysed, mostly lysed or
entirely lysed. Methods for preparing and using oleaginous
organisms in food is taught in WO2011/150411, WO2010/12093,
WO2011130578, and WO2011/130576. Alternately, the extracted and
optionally purified oil from the organism can be used as food oil,
including as a food oil ingredient in prepared foods such as
spreads, sauces, confections, and frozen confections. In a specific
embodiment, the oleaginous cells or food oil comprise 50-70% C18:0
and 20-40% 18:1 (e.g., oleate). In another specific embodiment, the
oleaginous cells or food oil comprises 50-70% C16:0 and 20-40% 18:1
(e.g., oleate).
[0093] This detailed description of the invention is divided into
sections for the convenience of the reader. Section I provides
definitions of terms used herein. Section II provides a description
of culture conditions useful in the methods of the invention.
Section III provides a description of genetic engineering methods
and materials. Section IV provides a description of genetic
engineering to enable sucrose utilization. Section V provides a
description of genetic engineering to modify lipid biosynthesis.
Section VI describes methods for making fuels and chemicals.
Section VII discloses examples and embodiments of the invention.
The detailed description of the invention is followed by examples
that illustrate the various aspects and embodiments of the
invention.
I. DEFINITIONS
[0094] Unless defined otherwise, all technical and scientific terms
used herein have the meaning commonly understood by a person
skilled in the art to which this invention belongs. As used herein,
the following terms have the meanings ascribed to them unless
specified otherwise.
[0095] "Active in microalgae" refers to a nucleic acid that is
functional in microalgae. For example, a promoter that has been
used to drive an antibiotic resistance gene to impart antibiotic
resistance to a transgenic microalgae is active in microalgae.
[0096] "Area Percent" refers to the area of peaks observed using
FAME GC/FID detection methods in which every fatty acid in the
sample is converted into a fatty acid methyl ester (FAME) prior to
detection. For example, a separate peak is observed for a fatty
acid of 14 carbon atoms with no unsaturation (C14:0) compared to
any other fatty acid such as C14:1. The peak area for each class of
FAME is directly proportional to its percent composition in the
mixture and is calculated based on the sum of all peaks present in
the sample (i.e. [area under specific peak/total area of all
measured peaks].times.100). When referring to lipid profiles of
oils and cells of the invention, "at least 4% C8-C14" means that at
least 4% of the total fatty acids in the cell or in the extracted
glycerolipid composition have a chain length that includes 8, 10,
12 or 14 carbon atoms.
[0097] "Axenic" is a culture of an organism free from contamination
by other living organisms.
[0098] "Biodiesel" is a biologically produced fatty acid alkyl
ester suitable for use as a fuel in a diesel engine.
[0099] "Biomass" is material produced by growth and/or propagation
of cells. Biomass may contain cells and/or intracellular contents
as well as extracellular material, includes, but is not limited to,
compounds secreted by a cell.
[0100] "Bioreactor" is an enclosure or partial enclosure in which
cells are cultured, optionally in suspension.
[0101] "Cellulosic material" is a biological material comprising
cellulose and optionally hemicellulose. As such it is digestible to
sugars such as glucose and xylose, and optionally may comprise
additional compounds such as disaccharides, oligosaccharides,
lignin, furfurals and other compounds. Nonlimiting examples of
sources of cellulosic material include sugar cane bagasses, sugar
beet pulp, corn stover, wood chips, sawdust and switchgrass.
[0102] "Co-culture", and variants thereof such as "co-cultivate"
and "co-ferment", refer to cultivating two or more types of cells
in the same bioreactor. The two or more types of cells may both be
microorganisms, such as microalgae, or may be a microalgal cell
cultured with a different cell type.
[0103] "Colored molecules" or "color generating impurities" as used
herein refer to any compound that imparts a color to the extracted
oil. "Colored molecules" or "color generating impurities" include
for example, chlorophyll a, chlorophyll b, lycopenes, tocopherols,
campesterols, tocotrienols, and carotenoids, such as beta carotene,
luteins, zeaxanthin, astaxanthin. These molecules are preferably
present in the microbial biomass or the extracted oil at a
concentration of no more than 500 ppm, no more than 250 ppm, no
more than 100 ppm, no more than 75 ppm, or no more than 25 ppm. In
other embodiments, the amount of chlorophyll that is present in the
microbial biomass or the extracted oil is less than 500 mg/kg, less
than 100 mg/kg, less than 10 mg/kg, less than 1 mgkg, less than 0.5
mg/kg, less than 0.1 mg/kg, less than 0.05 mg/kg, or less than 0.01
mg/kg.
[0104] "Cultivated", and variants thereof such as "cultured" and
"fermented", refer to the intentional fostering of growth
(increases in cell size, cellular contents, and/or cellular
activity) and/or propagation (increases in cell numbers) of one or
more cells by use of selected and/or controlled conditions. The
combination of both growth and propagation is termed
"proliferation." Examples of selected and/or controlled conditions
include the use of a defined medium (with known characteristics
such as pH, ionic strength, and carbon source), specified
temperature, oxygen tension, carbon dioxide levels, and growth in a
bioreactor. "Cultivated" does not refer to the growth or
propagation of microorganisms in nature or otherwise without human
intervention; for example, natural growth of an organism that
ultimately becomes fossilized to produce geological crude oil is
not cultivation.
[0105] "Desaturase" refers to an enzyme in the lipid synthesis
pathway responsible for the introduction of double bonds
(unsaturation) into the fatty acid chains of triacylglyceride
molecules. Examples include but are not limited to stearoyl-Acyl
carrier protein desaturase (SAD) and fatty acid desaturase (FAD),
also known as fatty acyl desaturase.
[0106] "Expression vector" or "expression construct" or "plasmid"
or "recombinant DNA construct" is a vehicle for introducing a
nucleic acid into a host cell. The nucleic acid can be one that has
been generated via human intervention, including by recombinant
means or direct chemical synthesis, with a series of specified
nucleic acid elements that permit transcription and/or translation
of a particular nucleic acid. The expression vector can be part of
a plasmid, virus, or nucleic acid fragment, or other suitable
vehicle. Typically, the expression vector includes a nucleic acid
to be transcribed operably linked to a promoter.
[0107] "Exogenous gene" is a nucleic acid that codes for the
expression of an RNA and/or protein that has been introduced into a
cell (e.g. by transformation/transfection), and is also referred to
as a "transgene". A cell comprising an exogenous gene may be
referred to as a recombinant cell, into which additional exogenous
gene(s) may be introduced. The exogenous gene may be from a
different species (and so heterologous), or from the same species
(and so homologous), relative to the cell being transformed. Thus,
an exogenous gene can include a homologous gene that occupies a
different location in the genome of the cell or is under different
control, relative to the endogenous copy of the gene. An exogenous
gene may be present in more than one copy in the cell. An exogenous
gene may be maintained in a cell as an insertion into the genome
(nuclear or plastid) or as an episomal molecule.
[0108] "Exogenously provided" refers to a molecule provided to the
culture media of a cell culture.
[0109] Depending on the context, "fatty acids" shall mean free
fatty acids, fatty acid salts, or fatty acyl moieties in a
glycerolipid.
[0110] "Fixed carbon source" is a molecule(s) containing carbon,
typically an organic molecule, that is present at ambient
temperature and pressure in solid or liquid form in a culture media
that can be utilized by a microorganism cultured therein.
Accordingly, carbon dioxide is not a fixed carbon source.
[0111] "Heterotrophic" as it pertains to culture conditions is
culturing in the substantial absence of light while utilizing or
metabolizing a fixed carbon source.
[0112] "Homogenate" is biomass that has been physically
disrupted.
[0113] "Hydrogen:carbon ratio" is the ratio of hydrogen atoms to
carbon atoms in a molecule on an atom-to-atom basis. The ratio may
be used to refer to the number of carbon and hydrogen atoms in a
hydrocarbon molecule. For example, the hydrocarbon with the highest
ratio is methane CH.sub.4 (4:1).
[0114] "Inducible promoter" is a promoter that mediates
transcription of an operably linked gene in response to a
particular stimulus. Examples of such promoters may be promoter
sequences that are induced in conditions of changing pH or nitrogen
levels.
[0115] "In operable linkage" is a functional linkage between two
nucleic acid sequences, such a control sequence (typically a
promoter) and the linked sequence (typically a sequence that
encodes a protein, also called a coding sequence). A promoter is in
operable linkage with an exogenous gene if it can mediate
transcription of the gene.
[0116] "Lipid modification enzyme" refers to an enzyme that alters
the covalent structure of a lipid or can otherwise lead to an
altered fatty acid profile in a cell. Examples of lipid
modification enzymes include a lipase, a fatty acyl-ACP
thioesterase, a fatty acyl-CoA/aldehyde reductase, a fatty acyl-CoA
reductase, a fatty aldehyde reductase, a desaturase, including a
stearoyl acyl carrier protein desaturase (SAD) and a fatty acyl
destaurase (FAD), and a fatty aldehyde decarbonylase.
[0117] "Lipid pathway enzyme" is any enzyme that plays a role in
lipid metabolism, i.e., either lipid synthesis, modification, or
degradation, and any proteins that chemically modify lipids, as
well as carrier proteins.
[0118] "Lipid profile" or "glycerolipid profile" refers to the
distribution of fatty acids in a cell or oil derived from a cell in
terms of chain length and/or saturation pattern. In this context
the saturation pattern can comprise a measure of saturated versus
unsaturated acid or a more detailed analysis of the distribution of
the positions of double bonds in the various fatty acids of a
cell.
[0119] "Lysis" is the breakage of the plasma membrane and
optionally the cell wall of a biological organism sufficient to
release at least some intracellular content, often by mechanical,
chemical, viral or osmotic mechanisms that compromise its
integrity.
[0120] "Lysing" is the process of lysis.
[0121] "Microalgae" is a microbial organism that contains a
chloroplast or plastid, and optionally that is capable of
performing photosynthesis, or a prokaryotic microbial organism
capable of performing photosynthesis. Microalgae include obligate
photoautotrophs, which cannot metabolize a fixed carbon source as
energy, as well as heterotrophs, which can live solely off of a
fixed carbon source. Microalgae include unicellular organisms that
separate from sister cells shortly after cell division, such as
Chlamydomonas, as well as microbes such as, for example, Volvox,
which is a simple multicellular photosynthetic microbe of two
distinct cell types. Microalgae include cells such as Chlorella,
Dunaliella, and Prototheca. Microalgae also include other microbial
photosynthetic organisms that exhibit cell-cell adhesion, such as
Agmenellum, Anabaena, and Pyrobotrys. Microalgae also include
obligate heterotrophic microorganisms that have lost the ability to
perform photosynthesis, such as certain dinoflagellate algae
species and species of the genus Prototheca.
[0122] "Mid chain", as used herein in the context of fatty acids,
refers to a C10-C16 fatty acid. "Short chain", in this context,
refers to C6-C10 fatty acids, while "long chain" refers to C17 or
longer fatty acids. These boundaries are not intended to be
precisely defined, unless otherwise indicated.
[0123] A "natural oil" shall mean a predominantly triglyceride oil
obtained from an organism, where the oil has not undergone blending
with another natural or synthetic oil, or fractionation so as to
substantially alter the fatty acid profile of the triglyceride.
Here, the term "fractionation" means removing material from the oil
in a way that changes its fatty acid profile relative to the
profile produced by the organism, however accomplished. A natural
oil encompasses such an oil obtained from an organism, where the
oil has undergone minimal processing, including refining, bleaching
and/or degumming, that does not substantially change its
triglyceride profile. A natural oil can also be a
"noninteresterified natural oil", which means that the natural oil
has not undergone a process in which fatty acids have been
redistributed in their acyl linkages to glycerol and remain
essentially in the same configuration as when recovered from the
organism.
[0124] "Naturally co-expressed" with reference to two proteins or
genes means that the proteins or their genes are co-expressed
naturally in a tissue or organism from which they are derived,
e.g., because the genes encoding the two proteins are under the
control of a common regulatory sequence or because they are
expressed in response to the same stimulus.
[0125] "Osmotic shock" is the rupture of cells in a solution
following a sudden reduction in osmotic pressure. Osmotic shock is
sometimes induced to release cellular components of such cells into
a solution.
[0126] "Polysaccharide-degrading enzyme" is any enzyme capable of
catalyzing the hydrolysis, or saccharification, of any
polysaccharide. For example, cellulases catalyze the hydrolysis of
cellulose.
[0127] "Polysaccharides" or "glycans" are carbohydrates made up of
monosaccharides joined together by glycosidic linkages. Cellulose
is a polysaccharide that makes up certain plant cell walls.
Cellulose can be depolymerized by enzymes to yield monosaccharides
such as xylose and glucose, as well as larger disaccharides and
oligosaccharides.
[0128] "Promoter" is a nucleic acid control sequence that directs
transcription of a nucleic acid. As used herein, a promoter
includes necessary nucleic acid sequences near the start site of
transcription, such as, in the case of a polymerase II type
promoter, a TATA element. A promoter also optionally includes
distal enhancer or repressor elements, which can be located as much
as several thousand base pairs from the start site of
transcription.
[0129] "Recombinant" is a cell, nucleic acid, protein or vector,
that has been modified due to the introduction of an exogenous
nucleic acid or the alteration of a native nucleic acid. Thus,
e.g., recombinant cells can express genes that are not found within
the native (non-recombinant) form of the cell or express native
genes differently than those genes are expressed by a
non-recombinant cell. Recombinant cells can, without limitation,
include recombinant nucleic acids that encode for a gene product or
for suppression elements such as mutations, knockouts, antisense,
interfering RNA (RNAi) or dsRNA that reduce the levels of active
gene product in a cell. A "recombinant nucleic acid" is a nucleic
acid originally formed in vitro, in general, by the manipulation of
nucleic acid, e.g., using polymerases, ligases, exonucleases, and
endonucleases, or otherwise is in a form not normally found in
nature. Recombinant nucleic acids may be produced, for example, to
place two or more nucleic acids in operable linkage. Thus, an
isolated nucleic acid or an expression vector formed in vitro by
ligating DNA molecules that are not normally joined in nature, are
both considered recombinant for the purposes of this invention.
Once a recombinant nucleic acid is made and introduced into a host
cell or organism, it may replicate using the in vivo cellular
machinery of the host cell; however, such nucleic acids, once
produced recombinantly, although subsequently replicated
intracellularly, are still considered recombinant for purposes of
this invention. Similarly, a "recombinant protein" is a protein
made using recombinant techniques, i.e., through the expression of
a recombinant nucleic acid.
[0130] "Renewable diesel" is a mixture of alkanes (such as C10:0,
C12:0, C14:0, C16:0 and C18:0) produced from a natural oil; e.g.,
through hydrogenation and deoxygenation of lipids.
[0131] "Saccharification" is a process of converting biomass,
usually cellulosic or lignocellulosic biomass, into monomeric
sugars, such as glucose and xylose. "Saccharified" or
"depolymerized" cellulosic material or biomass refers to cellulosic
material or biomass that has been converted into monomeric sugars
through saccharification.
[0132] "Species of furfural" is 2-furancarboxaldehyde or a
derivative that retains the same basic structural
characteristics.
[0133] In connection with transformation of a strain to create a
recombinant strain in accordance with embodiments herein (and not
necessarily to discussions of prior art), "stable" or "stably
integrated" shall mean that the recombinant nucleic acids are
retained by the cells of the strain for at least 10 generations.
For example, where a recombinant strain has a selectable marker
that enables cultivation in the presence of a selection pressure,
the recombinant nucleic acids are retained after 10 generations of
cultivation in the absence of the selection pressure.
[0134] "Sucrose utilization gene" is a gene that, when expressed,
aids the ability of a cell to utilize sucrose as an energy source.
Proteins encoded by a sucrose utilization gene are referred to
herein as "sucrose utilization enzymes" and include sucrose
transporters, sucrose invertases, and hexokinases such as
glucokinases and fructokinases.
II. CULTIVATION
[0135] The present invention generally relates to cultivation of
microorganisms, and particularly oleaginous microorganisms having a
type II fatty acid biosynthesis pathway, such as microalgae to
produce triglycerides. In an embodiment, the microorganisms are
obligate heterotrophs. The microorganisms may be recombinant
microorganims based, for example, of the genetic engineering
methods disclosed infra. For the convenience of the reader, this
section is subdivided into subsections. Subsection 1 describes
species and strains of microorganisms. Subsection 2 describes
bioreactors useful for cultivation. Subsection 3 describes media
for cultivation. Subsection 4 describes oil production in
accordance with illustrative cultivation methods of the
invention.
[0136] 1. Microogansim Species and Strains
[0137] Although the illustrative embodiments presented below are
applicable to numerous microorganisms, Prototheca is a preferred
microorganism for use in the production of lipid. Importantly, the
genetic engineering methods described herein with Prototheca as an
example are applicable to other microorganisms (e.g., Chlorella
sorokiniana, Chlorella vulgari,s Chlorella ellipsoidea, Chlorella
kessleri, Dunaliella tertiolecta, Volvox carteri, Haematococcus
pluvialis, Closterium peracerosum-strigosum-littorale complex,
Dunaliella viridis, Dunaliella salina, Gonium pectorale,
Phaeodactylum tricornutum, Chaetoceros, Cylindrotheca fusiformis,
Amphidinium sp., Symbiodinium microadriacticum, Nannochloropsis,
Cyclotella cryptica, Navicula saprophila, or Thalassiosira
pseudonana).
[0138] Lipid or oil obtained from an obligate heterotrophic
microalgae such as Prototheca can be generally low in pigment
(e.g., low to undetectable levels of chlorophyll and certain
carotenoids, for example less than 500, 50 or 5 ppm, of colored
molecules, color-generating impurities, or the sum of chlorophyll
and carotenoid concentrations) and in any event contains much less
pigment than lipid from other microalgae. Moreover, recombinant
Prototheca cells provided by the invention can be used to produce
lipid in greater yield and efficiency, and with reduced cost,
relative to the production of lipid from other microorganisms.
Illustrative Prototheca strains for use in the methods of the
invention include In addition, this microalgae grows
heterotrophically and can be genetically engineered as Prototheca
wickerhamnii, Prototheca stagnora (including UTEX 327), Prototheca
portoricensis, Prototheca moriformis (including UTEX strains 1441,
1435), and Prototheca zopfii. Species of the genus Prototheca are
obligate heterotrophs.
[0139] Considerations affecting the selection of microorganisms for
use in embodiments of the invention include, in addition to
production of suitable lipids or hydrocarbons for production of
oils, fuels, and oleochemicals: (1) high lipid content as a
percentage of cell weight; (2) ease of growth; (3) ease of genetic
engineering; and (4) ease of biomass processing. In particular
embodiments, the wild-type or genetically engineered microorganism
yields cells that are at least 40%, at least 45%, at least 50%, at
least 55%, at least 60%, at least 65%, or at least 70% or more
lipid. In other particular embodiments, the wild-type or
genetically engineered microorganism yields cells that comprise
between 40 and 80% or 50 and 90% triglyceride. Preferred organisms
grow heterotrophically (on sugars in the absence of light).
[0140] Examples of algae that can be used to practice the present
invention include, but are not limited to the following algae
listed in Table 1.
TABLE-US-00001 TABLE 1 Examples of algae. Achnanthes orientalis,
Agmenellum, Amphiprora hyaline, Amphora coffeiformis, Amphora
coffeiformis linea, Amphora coffeiformis punctata, Amphora
coffeiformis taylori, Amphora coffeiformis tenuis, Amphora
delicatissima, Amphora delicatissima capitata, Amphora sp.,
Anabaena, Ankistrodesmus, Ankistrodesmus falcatus, Boekelovia
hooglandii, Borodinella sp., Botryococcus braunii, Botryococcus
sudeticus, Carteria, Chaetoceros gracilis, Chaetoceros muelleri,
Chaetoceros muelleri subsalsum, Chaetoceros sp., Chlorella
anitrata, Chlorella Antarctica, Chlorella aureoviridis, Chlorella
candida, Chlorella capsulate, Chlorella desiccate, Chlorella
ellipsoidea, Chlorella emersonii, Chlorella fusca, Chlorella fusca
var. vacuolata, Chlorella glucotropha, Chlorella infusionum,
Chlorella infusionum var. actophila, Chlorella infusionum var.
auxenophila, Chlorella kessleri, Chlorella lobophora (strain SAG
37.88), Chlorella luteoviridis, Chlorella luteoviridis var.
aureoviridis, Chlorella luteoviridis var. lutescens, Chlorella
miniata, Chlorella minutissima, Chlorella mutabilis, Chlorella
nocturna, Chlorella parva, Chlorella photophila, Chlorella
pringsheimii, Chlorella protothecoides (including any of UTEX
strains 1806, 411, 264, 256, 255, 250, 249, 31, 29, 25, and CCAP
strains 211/17 and 211/8d), Chlorella protothecoides var.
acidicola, Chlorella regularis, Chlorella regularis var. minima,
Chlorella regularis var. umbricata, Chlorella reisiglii, Chlorella
saccharophila, Chlorella saccharophila var. ellipsoidea, Chlorella
salina, Chlorella simplex, Chlorella sorokiniana, Chlorella sp.,
Chlorella sphaerica, Chlorella stigmatophora, Chlorella vanniellii,
Chlorella vulgaris, Chlorella vulgaris, Chlorella vulgaris f.
tertia, Chlorella vulgaris var. autotrophica, Chlorella vulgaris
var. viridis, Chlorella vulgaris var. vulgaris, Chlorella vulgaris
var. vulgaris f. tertia, Chlorella vulgaris var. vulgaris f.
viridis, Chlorella xanthella, Chlorella zofingiensis, Chlorella
trebouxioides, Chlorella vulgaris, Chlorococcum infusionum,
Chlorococcum sp., Chlorogonium, Chroomonas sp., Chrysosphaera sp.,
Cricosphaera sp., Cryptomonas sp., Cyclotella cryptica, Cyclotella
meneghiniana, Cyclotella sp., Dunaliella sp., Dunaliella bardawil,
Dunaliella bioculata, Dunaliella granulate, Dunaliella maritime,
Dunaliella minuta, Dunaliella parva, Dunaliella peircei, Dunaliella
primolecta, Dunaliella salina, Dunaliella terricola, Dunaliella
tertiolecta, Dunaliella viridis, Dunaliella tertiolecta,
Eremosphaera viridis, Eremosphaera sp., Ellipsoidon sp., Euglena,
Franceia sp., Fragilaria crotonensis, Fragilaria sp., Gleocapsa
sp., Gloeothamnion sp., Hymenomonas sp., Isochrysis aff. galbana,
Isochrysis galbana, Lepocinclis, Micractinium, Micractinium (UTEX
LB 2614), Monoraphidium minutum, Monoraphidium sp., Nannochloris
sp., Nannochloropsis salina, Nannochloropsis sp., Navicula
acceptata, Navicula biskanterae, Navicula pseudotenelloides,
Navicula pelliculosa, Navicula saprophila, Navicula sp.,
Nephrochloris sp., Nephroselmis sp., Nitschia communis, Nitzschia
alexandrina, Nitzschia communis, Nitzschia dissipata, Nitzschia
frustulum, Nitzschia hantzschiana, Nitzschia inconspicua, Nitzschia
intermedia, Nitzschia microcephala, Nitzschia pusilla, Nitzschia
pusilla elliptica, Nitzschia pusilla monoensis, Nitzschia
quadrangular, Nitzschia sp., Ochromonas sp., Oocystis parva,
Oocystis pusilla, Oocystis sp., Oscillatoria limnetica,
Oscillatoria sp., Oscillatoria subbrevis, Pascheria acidophila,
Pavlova sp., Phagus, Phormidium, Platymonas sp., Pleurochrysis
carterae, Pleurochrysis dentate, Pleurochrysis sp., Prototheca
wickerhamii, Prototheca stagnora, Prototheca portoricensis,
Prototheca moriformis, Prototheca zopfii, Pyramimonas sp.,
Pyrobotrys, Sarcinoid chrysophyte, Scenedesmus armatus, Spirogyra,
Spirulina platensis, Stichococcus sp., Synechococcus sp.,
Tetraedron, Tetraselmis sp., Tetraselmis suecica, Thalassiosira
weissflogii, and Viridiella fridericiana
[0141] 2. Bioreactor
[0142] Microrganisms are cultured both for purposes of conducting
genetic manipulations and for production of hydrocarbons (e.g.,
lipids, fatty acids, aldehydes, alcohols, and alkanes). The former
type of culture is conducted on a small scale and initially, at
least, under conditions in which the starting microorganism can
grow. Culture for purposes of hydrocarbon production is usually
conducted on a large scale (e.g., 10,000 L, 40,000 L, 100,000 L or
larger bioreactors) in a bioreactor. Microalgae, including
Prototheca species are typically cultured in the methods of the
invention in liquid media within a bioreactor. Typically, the
bioreactor does not allow light to enter.
[0143] The bioreactor or fermentor is used to culture microalgal
cells through the various phases of their physiological cycle.
Bioreactors offer many advantages for use in heterotrophic growth
and propagation methods. To produce biomass, microalgae are
preferably fermented in large quantities in liquid, such as in
suspension cultures. Bioreactors such as steel fermentors can
accommodate very large culture volumes (40,000 liter and greater
capacity bioreactors are used in various embodiments of the
invention). Bioreactors also typically allow for the control of
culture conditions such as temperature, pH, oxygen tension, and
carbon dioxide levels. For example, bioreactors are typically
configurable, for example, using ports attached to tubing, to allow
gaseous components, like oxygen or nitrogen, to be bubbled through
a liquid culture. Other culture parameters, such as the pH of the
culture media, the identity and concentration of trace elements,
and other media constituents can also be more readily manipulated
using a bioreactor.
[0144] Bioreactors equipped with devices such as spinning blades
and impellers, rocking mechanisms, stir bars, means for pressurized
gas infusion can be used to subject cultures to mixing. Mixing may
be continuous or intermittent. For example, in some embodiments, a
turbulent flow regime of gas entry and media entry is not
maintained for reproduction of cells until a desired increase in
number of said cells has been achieved.
[0145] Bioreactor ports can be used to introduce, or extract,
gases, solids, semisolids, and liquids, into the bioreactor chamber
containing the microalgae. While many bioreactors have more than
one port (for example, one for media entry, and another for
sampling), it is not necessary that only one substance enter or
leave a port. For example, a port can be used to flow culture media
into the bioreactor and later used for sampling, gas entry, gas
exit, or other purposes. Preferably, a sampling port can be used
repeatedly without altering compromising the axenic nature of the
culture. A sampling port can be configured with a valve or other
device that allows the flow of sample to be stopped and started or
to provide a means of continuous sampling. Bioreactors typically
have at least one port that allows inoculation of a culture, and
such a port can also be used for other purposes such as media or
gas entry.
[0146] Bioreactors ports allow the gas content of the culture of
microalgae to be manipulated. To illustrate, part of the volume of
a bioreactor can be gas rather than liquid, and the gas inlets of
the bioreactor to allow pumping of gases into the bioreactor. Gases
that can be beneficially pumped into a bioreactor include air,
oxygen, air/CO.sub.2 mixtures, noble gases, such as argon, and
other gases. Bioreactors are can be equipped to enable the user to
control the rate of entry of a gas into the bioreactor. As noted
above, increasing gas flow into a bioreactor can be used to
increase mixing of the culture.
[0147] Increased gas flow affects the turbidity of the culture as
well. Turbulence can be achieved by placing a gas entry port below
the level of the aqueous culture media so that gas entering the
bioreactor bubbles to the surface of the culture. One or more gas
exit ports allow gas to escape, thereby preventing pressure buildup
in the bioreactor. Preferably a gas exit port leads to a "one-way"
valve that prevents contaminating microorganisms from entering the
bioreactor.
[0148] 3. Media
[0149] Microbial culture media typically contains components such
as a fixed nitrogen source, a fixed carbon source, trace elements,
optionally a buffer for pH maintenance, and phosphate (typically
provided as a phosphate salt). Other components can include salts
such as sodium chloride, particularly for seawater microalgae.
Nitrogen sources include organic and inorganic nitrogen sources,
including, for example, without limitation, molecular nitrogen,
nitrate, nitrate salts, ammonia (pure or in salt form, such as,
(NH.sub.4).sub.2SO.sub.4 and NH.sub.4OH), protein, soybean meal,
cornsteep liquor, and yeast extract. Examples of trace elements
include zinc, boron, cobalt, copper, manganese, and molybdenum in,
for example, the respective forms of ZnCl.sub.2, H.sub.3BO.sub.3,
CoCl.sub.2.6H.sub.2O, CuCl.sub.2.2H.sub.2O, MnCl.sub.2.4H.sub.2O
and (NH.sub.4).sub.6Mo.sub.7O.sub.24.4H.sub.2O.
[0150] Microorganisms useful in accordance with the methods of the
present invention are found in various locations and environments
throughout the world. As a consequence of their isolation from
other species and their resulting evolutionary divergence, the
particular growth medium for optimal growth and generation of lipid
and/or hydrocarbon constituents can be difficult to predict. In
some cases, certain strains of microorganisms may be unable to grow
on a particular growth medium because of the presence of some
inhibitory component or the absence of some essential nutritional
requirement required by the particular strain of microorganism.
[0151] Solid and liquid growth media are generally available from a
wide variety of sources, and instructions for the preparation of
particular media that is suitable for a wide variety of strains of
microorganisms can be found, for example, online at
http://www.utex.org/, a site maintained by the University of Texas
at Austin, 1 University Station A6700, Austin, Tex., 78712-0183,
for its culture collection of algae (UTEX). For example, various
fresh water and salt water media include those described in PCT
Pub. No. 2008/151149, incorporated herein by reference.
[0152] In a particular example, Proteose Medium is suitable for
axenic cultures, and a 1 L volume of the medium (pH .about.6.8) can
be prepared by addition of 1 g of proteose peptone to 1 liter of
Bristol Medium. Bristol medium comprises 2.94 mM NaNO.sub.3, 0.17
mM CaCl.sub.2.2H.sub.2O, 0.3 mM MgSO.sub.4.7H.sub.2O, 0.43 mM, 1.29
mM KH.sub.2PO.sub.4, and 1.43 mM NaCl in an aqueous solution. For
1.5% agar medium, 15 g of agar can be added to 1 L of the solution.
The solution is covered and autoclaved, and then stored at a
refrigerated temperature prior to use. Another example is the
Prototheca isolation medium (PIM), which comprises 10 g/L
postassium hydrogen phthalate (KHP), 0.9 g/L sodium hydroxide, 0.1
g/L magnesium sulfate, 0.2 g/L potassium hydrogen phosphate, 0.3
g/L ammonium chloride, 10 g/L glucose 0.001 g/L thiamine
hydrochloride, 20 g/L agar, 0.25 g/L 5-fluorocytosine, at a pH in
the range of 5.0 to 5.2 (see Pore, 1973, App. Microbiology, 26:
648-649). Other suitable media for use with the methods of the
invention can be readily identified by consulting the URL
identified above, or by consulting other organizations that
maintain cultures of microorganisms, such as SAG, CCAP, or CCALA.
SAG refers to the Culture Collection of Algae at the University of
Gottingen (Gottingen, Germany), CCAP refers to the culture
collection of algae and protozoa managed by the Scottish
Association for Marine Science (Scotland, United Kingdom), and
CCALA refers to the culture collection of algal laboratory at the
Institute of Botany (Trebofi, Czech Republic). Additionally, U.S.
Pat. No. 5,900,370 describes media formulations and conditions
suitable for heterotrophic fermentation of Prototheca species.
[0153] For oil production, selection of a fixed carbon source is
important, as the cost of the fixed carbon source must be
sufficiently low to make oil production economical. Thus, while
suitable carbon sources can include, for example, acetate,
floridoside, fructose, galactose, glucuronic acid, glucose,
glycerol, lactose, mannose, N-acetylglucosamine, rhamnose, sucrose,
and/or xylose, selection of feedstocks containing those compounds
is an important aspect of the methods of embodiments of the
invention. Suitable feedstocks useful in accordance with the
methods of the invention can include, for example, black liquor,
corn starch, depolymerized cellulosic material, milk whey,
molasses, potato, sorghum, sucrose, sugar beet, sugar cane, rice,
and wheat. Carbon sources can also be provided as a mixture, such
as a mixture of sucrose and depolymerized sugar beet pulp. The one
or more carbon source(s) can be supplied at a concentration of at
least about 50 .mu.M, at least about 100 .mu.M, at least about 500
.mu.M, at least about 5 mM, at least about 50 mM, and at least
about 500 mM, of one or more exogenously provided fixed carbon
source(s). Highly concentrated carbon sources as feedstock for
fermentation are preferred. For example, in some embodiments
glucose levels of at least 300 g/L, at least 400 g/L, at least 500
g/L, or at least 600 g/L or more of glucose level of the feedstock
prior to the cultivation step, is added to a fed batch cultivation,
in which the highly concentrated fixed carbon source is fed to the
cells over time as the cells grow and accumulate lipid. In other
embodiments, sucrose levels of at least 500 g/L, at least 600 g/L,
at least 700 g/L, at least 800 g/L or more of sucrose prior to the
cultivation is added to a fed batch cultivation, in which the
highly concentrated fixed carbon source is fed to the cells over
time as the cells grow and accumulate lipid. Non-limiting examples
of highly concentrated fixed carbon source such as sucrose include
thick cane juice, sugar cane juice, sugar beet juice and molasses.
Carbon sources of particular interest for purposes of the present
invention include cellulose (in a depolymerized form), glycerol,
sucrose, and sorghum, each of which is discussed in more detal
below.
[0154] In accordance with the present invention, microorganisms can
be cultured using depolymerized cellulosic biomass as a feedstock.
Cellulosic biomass (e.g., stover, such as corn stover) is
inexpensive and readily available; however, such feedstocks have
been found to be inhibitory to yeast growth, and yeast cannot use
the 5-carbon sugars produced from cellulosic materials (e.g.,
xylose from hemi-cellulose). By contrast, at least some microalgae
can grow on processed cellulosic material. Cellulosic materials
generally include about 40-60% cellulose; about 20-40%
hemicellulose; and 10-30% lignin.
[0155] Cellulosic materials include residues from herbaceous and
woody energy crops, as well as agricultural crops, i.e., the plant
parts, primarily stalks and leaves, not removed from the fields
with the primary food or fiber product. Examples include
agricultural wastes such as sugarcane bagasse, rice hulls, corn
fiber (including stalks, leaves, husks, and cobs), wheat straw,
rice straw, sugar beet pulp, citrus pulp, citrus peels; forestry
wastes such as hardwood and softwood thinnings, and hardwood and
softwood residues from timber operations; wood wastes such as saw
mill wastes (wood chips, sawdust) and pulp mill waste; urban wastes
such as paper fractions of municipal solid waste, urban wood waste
and urban green waste such as municipal grass clippings; and wood
construction waste. Additional cellulosics include dedicated
cellulosic crops such as switchgrass, hybrid poplar wood, and
miscanthus, fiber cane, and fiber sorghum. Five-carbon sugars that
are produced from such materials include xylose.
[0156] Cellulosic materials can be treated to increase the
efficiency with which the microbe can utilize the sugar(s)
contained within the materials. Embodiments of the invention
provide methods for the treatment of cellulosic materials after
acid explosion so that the materials are suitable for use in a
heterotrophic culture of microbes (e.g., microalgae and oleaginous
yeast). As discussed above, lignocellulosic biomass is comprised of
various fractions, including cellulose, a crystalline polymer of
beta 1,4 linked glucose (a six-carbon sugar), hemicellulose, a more
loosely associated polymer predominantly comprised of xylose (a
five-carbon sugar) and to a lesser extent mannose, galactose,
arabinose, lignin, a complex aromatic polymer comprised of sinapyl
alcohol and its derivatives, and pectins, which are linear chains
of an alpha 1,4 linked polygalacturonic acid. Because of the
polymeric structure of cellulose and hemicellulose, the sugars
(e.g., monomeric glucose and xylose) in them are not in a form that
can be efficiently used (metabolized) by many microbes. For such
microbes, further processing of the cellulosic biomass to generate
the monomeric sugars that make up the polymers can be very helpful
to ensuring that the cellulosic materials are efficiently utilized
as a feedstock (carbon source).
[0157] Celluose or cellulosic biomass is subjected to a process,
termed "explosion", in which the biomass is treated with dilute
sulfuric (or other) acid at elevated temperature and pressure. This
process conditions the biomass such that it can be efficiently
subjected to enzymatic hydrolysis of the cellulosic and
hemicellulosic fractions into glucose and xylose monomers. The
resulting monomeric sugars are termed cellulosic sugars. Cellulosic
sugars can subsequently be utilized by microorganisms to produce a
variety of metabolites (e.g., lipid). The acid explosion step
results in a partial hydrolysis of the hemicellulose fraction to
constitutent monosaccharides. These sugars can be completely
liberated from the biomass with further treatment. In some
embodiments, the further treatment is a hydrothermal treatment that
includes washing the exploded material with hot water, which
removes contaminants such as salts. This step is not necessary for
cellulosic ethanol fermentations due to the more dilute sugar
concentrations used in such processes. In other embodiments, the
further treatment is additional acid treatment. In still other
embodiments, the further treatment is enzymatic hydrolysis of the
exploded material. These treatments can also be used in any
combination. The type of treatment can affect the type of sugars
liberated (e.g., five carbon sugars versus six carbon sugars) and
the stage at which they are liberated in the process. As a
consequence, different streams of sugars, whether they are
predominantly five-carbon or six-carbon, can be created. These
enriched five-carbon or six-carbon streams can thus be directed to
specific microorganisms with different carbon utilization
cabilities.
[0158] The methods of the present invention can involve
fermentation to higher cell densities than what is typically
achieved in ethanol fermentation. Because of the higher densities
of the cultures for heterotrophic cellulosic oil production, the
fixed carbon source (e.g., the cellulosic derived sugar stream(s))
is preferably in a concentrated form. The glucose level of the
depolymerized cellulosic material is preferably at least 300
g/liter, at least 400 g/liter, at least 500 g/liter or at least 600
g/liter prior to the cultivation step, which is optionally a fed
batch cultivation in which the material is fed to the cells over
time as the cells grow and accumulate lipid. Thus, in order to
generate and sustain the very high cell densities during the
production of lignocellulosic oil, the carbon feedstock(s) can be
delivered into the heterotrophic cultures in a highly concentrated
form. However, any component in the feedstream that is not a
substrate for, and is not metabolized by, the oleaginous
microorganism will accumulate in the bioreactor, which can lead to
problems if the component is toxic or inhibitory to production of
the desired end product. While ligin and lignin-derived
by-products, carbohydrate-derived byproducts such as furfurals and
hydroxymethyl furfurals and salts derived from the generation of
the cellulosic materials (both in the explosion process and the
subsequent neutralization process), and even non-metabolized
pentose/hexose sugars can present problems in ethanolic
fermentations, these effects are amplified significantly in a
process in which their concentration in the initial feedstock is
high. To achieve sugar concentrations in the 300 g/L range (or
higher) for six-carbon sugars that may be used in large scale
production of lignocellulosic oil described in the present
invention, the concentration of these toxic materials can be 20
times higher than the concentrations typically present in ethanolic
fermentations of cellulosic biomass.
[0159] The explosion process treatment of the cellulosic material
utilizes significant amounts of sulfuric acid, heat and pressure,
thereby liberating by-products of carbohydrates, namely furfurals
and hydroxymethyl furfurals. Furfurals and hydroxymethyl furfurals
are produced during hydrolysis of hemicellulose through dehydration
of xylose into furfural and water. In some embodiments of the
present invention, these by-products (e.g., furfurals and
hydroxymethyl furfurals) are removed from the saccharified
lignocellulosic material prior to introduction into the bioreactor.
In certain embodiments of the present invention, the process for
removal of the by-products of carbohydrates is hydrothermal
treatment of the exploded cellulosic materials. In addition, the
present invention provides methods in which strains capable of
tolerating compounds such as furfurals or hydroxymethyl furfurals
are used for lignocellulosic oil production. In another embodiment,
the present invention also provides methods and microorganisms that
are not only capable of tolerating furfurals in the fermentation
media, but are actually able to metabolize these by-products during
the production of lignocellulosic oil.
[0160] The explosion process also generates significant levels of
salts. For example, typical conditions for explosion can result in
conductivites in excess of 5 mS/cm when the exploded cellulosic
biomass is resuspended at a ratio of 10:1 water:solids (dry
weight). In certain embodiments of the present invention, the
diluted exploded biomass is subjected to enzymatic
saccharification, and the resulting supernatant is concentrated up
to 25 fold for use in the bioreactor. The salt level (as measured
by conductivity) in the concentrated sugar stream(s) can be
unacceptably high (up to 1.5 M Na.sup.+ equivalents). Additional
salts are generated upon neutralization of the exploded materials
for the subsequent enzymatic saccharification process as well.
Embodiments of the present invention provides methods for removing
these salts so that the resulting concentrated cellulosic sugar
stream(s) can be used in heterotrophic processes for producing
lignocellulosic oil. In some embodiments, the method of removing
these salts is deionization with resins, such as, but not limited
to, DOWEX Marathon MR3. In certain embodiments, the deionization
with resin step occurs before sugar concentration or pH adjustment
and hydrothermal treatment of biomass prior to saccharification, or
any combination of the preceding; in other embodiments, the step is
conducted after one or more of these processes. In other
embodiments, the explosion process itself is changed so as to avoid
the generation of salts at unacceptably high levels. For example,
an alternative to sulfuric acid (or other acid) explosion of the
cellulosic biomass is mechanical pulping to render the cellulosic
biomass receptive to enzymatic hydrolysis (saccharification). In
still other embodiments, native strains of microorganisms resistant
to high levels of salts or genetically engineered strains with
resistance to high levels of salts are used.
[0161] A preferred embodiment for the process of preparing of
exploded cellulosic biomass for use in heterotrophic
lignocellulosic oil production using oleaginous microbes follows. A
first step comprises adjusting the pH of the resuspended exploded
cellulosic biomass to the range of 5.0-5.3 followed by washing the
cellulosic biomass three times. This washing step can be
accomplished by a variety of means including the use of desalting
and ion exchange resins, reverse omosis, hydrothermal treatment (as
described above), or just repeated resuspension and centrifugation
in deionized water. This wash step results in a cellulosic stream
whose conductivity is between 100-300 .mu.S/cm and the removal of
significant amounts of furfurals and hydroxymethyl furfurals.
Decants from this wash step can be saved to concentrate five-carbon
sugars liberated from the hemicellulose fraction. A second step
comprises enzymatic saccharification of the washed cellulosic
biomass. In a preferred embodiment, Accellerase (Genencor) is used.
A third step comprises the recovery of sugars via centrifugation or
decanting and rinsing of the saccharified biomass. The resulting
biomass (solids) is an energy dense, lignin rich component that can
be used as fuel or sent to waste. The recovered sugar stream in the
centrifugation/decanting and rinse process is collected. A fourth
step comprises microfiltration to remove contaminating solids with
recovery of the permeate. A fifth step comprises a concentration
step which can be accomplished using a vacuum evaporator. This step
can optionally include the addition of antifoam agents such as
P'2000 (Sigma/Fluka), which is sometimes necessary due to the
protein content of the resulting sugar feedstock.
[0162] In another embodiment of the methods of the invention, the
carbon source is glycerol, including acidulated and non-acidulated
glycerol byproduct from biodiesel transesterification. In one
embodiment, the carbon source includes glycerol and at least one
other carbon source. In some cases, all of the glycerol and the at
least one other fixed carbon source are provided to the
microorganism at the beginning of the fermentation. In some cases,
the glycerol and the at least one other fixed carbon source are
provided to the microorganism simultaneously at a predetermined
ratio. In some cases, the glycerol and the at least one other fixed
carbon source are fed to the microbes at a predetermined rate over
the course of fermentation.
[0163] Some microalgae undergo cell division faster in the presence
of glycerol than in the presence of glucose (see PCT Pub. No.
2008/151149). In these instances, two-stage growth processes, in
which cells are first fed glycerol to rapidly increase cell density
and are then fed glucose to accumulate lipids, can improve the
efficiency with which lipids are produced. The use of the glycerol
byproduct of the transesterification process can provide
significant economic advantages when put back into the production
process. Other feeding methods are provided as well, such as
mixtures of glycerol and glucose. Feeding such mixtures also
captures the same economic benefits. In addition, the invention
provides methods of feeding alternative sugars to microalgae such
as sucrose in various combinations with glycerol.
[0164] In another embodiment of the methods of the invention, the
carbon source is invert sugar. Invert sugar is less prone to
crystallization compared to sucrose and thus, can provide
advantages for storage and in fed batch fermentation, which in the
case of heterotrophic cultivation of microbes, including
microalgae, there is a need for concentrated carbon source. In one
embodiment, the carbon source is invert sugar, preferably in a
concentrated form, preferably at least 800 g/liter, at least 900
g/liter, at least 1000 g/liter or at least 1100 g/liter prior to
the cultivation step, which is optionally a fed batch cultivation.
The invert sugar, preferably in a concentrated form, is fed to the
cells over time as the cells grow and accumulate lipid.
[0165] In another embodiment of the methods of the invention, the
carbon source is sucrose, including a complex feedstock containing
sucrose, such as thick cane juice from sugar cane processing.
Because of the higher densities of the cultures for heterotrophic
oil production, the fixed carbon source (e.g., sucrose, glucose,
etc.) is preferably in a concentrated form, preferably at least 500
g/liter, at least 600 g/liter, at least 700 g/liter or at least 800
g/liter of the fixed carbon source prior to the cultivation step,
which is optionally a fed batch cultivation in which the material
is fed to the cells over time as the cells grow and accumulate
lipid. In some cases, the carbon source is sucrose in the form of
thick cane juice, preferably in a concentrated form, preferably at
least 60% solids or about 770 g/liter sugar, at least 70% solids or
about 925 g/liter sugar, or at least 80% solids or about 1125
g/liter sugar prior to the cultivation step, which is optionally a
fed batch cultivation. The concentrated thick cane juice is fed to
the cells over time as the cells grow and accumulate lipid.
[0166] In one embodiment, the culture medium further includes at
least one sucrose utilization enzyme. In some cases, the sucrose
utilization enzyme is a sucrose invertase. The sucrose invertase
enzyme can be a secrectable sucrose invertase enzyme encoded by an
exogenous sucrose invertase gene expressed by the population of
microorganisms. The secretable sucrose invertase can be secreted by
the microorganisms into the culture medium so as to convert sucrose
in the medium to glucose and fructose for use by the microorganism.
As described below, the sucrose invertase can be recombinant,
thereby imparting upon a microorganism the ability to use pure or
complex sucrose feedstocks as a fixed carbon source for growth or
oil production. In some cases, as described in more detail in
Section IV, below, the microalgae has been genetically engineered
to express a sucrose utilization enzyme, such as a sucrose
transporter, a sucrose invertase, a hexokinase, a glucokinase, or a
fructokinase.
[0167] Complex feedstocks containing sucrose include waste molasses
from sugar cane processing; the use of this low-value waste product
of sugar cane processing can provide significant cost savings in
the production of hydrocarbons and other oils. Another complex
feedstock containing sucrose that is useful in the methods of the
invention is sorghum, including sorghum syrup and pure sorghum.
Sorghum syrup is produced from the juice of sweet sorghum cane. Its
sugar profile consists of mainly glucose (dextrose), fructose and
sucrose.
[0168] 4. Oil Production
[0169] For the production of oil in accordance with the methods of
the invention, it is preferable to culture cells in the dark, as is
the case, for example, when using extremely large (40,000 liter and
higher) fermentors that do not allow light to strike the culture.
Heterotrophic species are grown and propagated for the production
of oil in a medium containing a fixed carbon source and in the
absence of light; such growth is known as heterotrophic growth.
[0170] As an example, an inoculum of lipid-producing microalgal
cells are introduced into the medium; there is a lag period (lag
phase) before the cells begin to propagate. Following the lag
period, the propagation rate increases steadily and enters the log,
or exponential, phase. The exponential phase is in turn followed by
a slowing of propagation due to decreases in nutrients such as
nitrogen, increases in toxic substances, and quorum sensing
mechanisms. After this slowing, propagation stops, and the cells
enter a stationary phase or steady growth state, depending on the
particular environment provided to the cells. For obtaining lipid
rich biomass, the culture is typically harvested well after then
end of the exponential phase, which may be terminated early by
allowing nitrogen or another key nutrient (other than carbon) to
become depleted, forcing the cells to convert the carbon sources,
present in excess, to lipid, an in particular, to triglcyeride.
Culture condition parameters can be manipulated to optimize total
oil production, the combination of lipid species produced, and/or
production of a specific oil.
[0171] Lipid production by cells disclosed herein can occur during
the log phase or thereafter, including the stationary phase wherein
nutrients are supplied, or still available, to allow the
continuation of lipid production in the absence of cell
division.
[0172] Preferably, microorganisms grown using conditions described
herein and/or known in the art comprise at least about 20-30%,
30-40%, 40-50%, 50-60%, 60-70%, or 80-90% by dry cell weight of
triglyceride. Process conditions can be adjusted to increase the
yield of lipids suitable for a particular use and/or to reduce
production cost. For example, in certain embodiments, a microalgae
is cultured in the presence of a limiting concentration of one or
more nutrients, such as, for example, nitrogen, phosphorous, or
sulfur, while providing an excess of fixed carbon energy such as
glucose. Nitrogen limitation tends to increase microbial lipid
yield (a measure of the amount of lipid produced per gram of dry
cell weight) over microbial lipid yield in a culture in which
nitrogen is provided in excess. In particular embodiments, the
increase in lipid yield is at least about: 10%, 50%, 100%, 200%, or
500%. The microbe can be cultured in the presence of a limiting
amount of a nutrient for a portion of the total culture period or
for the entire period. In particular embodiments, the nutrient
concentration is cycled between a limiting concentration and a
non-limiting concentration at least twice during the total culture
period. Lipid content of cells can be increased by continuing the
culture for increased periods of time while providing an excess of
carbon, but limiting or no nitrogen.
[0173] In another embodiment, lipid yield is increased by culturing
a lipid-producing microbe (e.g., microalgae) in the presence of one
or more cofactor(s) for a lipid pathway enzyme (e.g., a coenzyme or
prosthetic group of a fatty acid synthetic enzyme). Generally, the
concentration of the cofactor(s) is sufficient to increase
microbial lipid (e.g., fatty acid) yield over microbial lipid yield
in the absence of the cofactor(s). In a particular embodiment, the
cofactor(s) are provided to the culture by including in the culture
a microbe (e.g., microalgae) containing an exogenous gene encoding
the cofactor(s). Alternatively, cofactor(s) may be provided to a
culture by including a microbe (e.g., microalgae) containing an
exogenous gene that encodes a protein that participates in the
synthesis of the cofactor. In certain embodiments, suitable
cofactors include any vitamin required by a lipid pathway enzyme,
such as, for example: biotin or pantothenate. Genes encoding
cofactors suitable for use in the invention or that participate in
the synthesis of such cofactors are well known and can be
introduced into microbes (e.g., microalgae), using constructs and
techniques such as those described above.
[0174] The specific examples of bioreactors, culture conditions,
and heterotrophic growth and propagation methods described herein
can be combined in any suitable manner to improve efficiencies of
microbial growth and lipid and/or protein production.
[0175] Microalgal biomass with a high percentage of oil/lipid
accumulation by dry weight has been generated using different
methods of culture, which are known in the art (see PCT Pub. No.
2008/151149). Microalgal biomass generated by the culture methods
described herein and useful in accordance with the present
invention comprises at least 10% microalgal oil by dry weight. In
some embodiments, the microalgal biomass comprises at least 25%,
50%, 60%, 70% or at least 80% microalgal oil by dry weight. In some
embodiments, the microalgal biomass contains from 10-90% microalgal
oil, from 25-75% microalgal oil, from 40-75% microalgal oil,
75-85%, or from 50-70% microalgal oil by dry weight.
[0176] The microalgal oil of the biomass described herein, or
extracted from the biomass for use in the methods and compositions
of the present invention can comprise glycerolipids with one or
more distinct fatty acid ester side chains. Glycerolipids are
comprised of a glycerol molecule esterified to one, two or three
fatty acid molecules, which can be of varying lengths and have
varying degrees of saturation. The length and saturation
characteristics of the fatty acid molecules (and the microalgal
oils) can be manipulated to modify the properties or proportions of
the fatty acid molecules in microalgal oils of embodiments of the
present invention via culture conditions or via lipid pathway
engineering, as described in more detail in Section IV, below.
Particular modifications of properties and proportions include
alteration of the fatty acid distribution of the microbial
triglycerides such as changes in chain length profile, saturation
profile, and hydroxylation of fatty acids. The oils so produced can
comprise a natural oil. Alternately, specific blends of microbial
oil can be prepared either within a single species of algae by
mixing together the biomass or algal oil from two or more species
of microalgae, or by blending algal oil of the invention with oils
from other sources such as soy, rapeseed, canola, palm, palm
kernel, coconut, corn, waste vegetable, Chinese tallow, olive,
sunflower, cottonseed, chicken fat, beef tallow, porcine tallow,
microalgae, macroalgae, microbes, Cuphea, flax, peanut, choice
white grease, lard, Camelina sativa, mustard seed, cashew nut,
oats, lupine, kenaf, calendula, help, coffee, linseed (flax),
hazelnut, euphorbia, pumpkin seed, coriander, camellia, sesame,
safflower, rice, tung tree, cocoa, copra, pium poppy, castor beans,
pecan, jojoba, macadamia, Brazil nuts, avocado, petroleum, or a
distillate fraction of any of the preceding oils.
[0177] The oil composition, i.e., the properties and proportions of
the fatty acid constituents of the glycerolipids, can also be
manipulated by combining biomass or oil from at least two distinct
species of microorganism. In some embodiments, at least two of the
distinct species of microalgae have different glycerolipid
profiles. The distinct species of microalgae can be cultured
together or separately as described herein, preferably under
heterotrophic conditions, to generate the respective oils.
Different species of microalgae can contain different percentages
of distinct fatty acid constituents in the cell's
glycerolipids.
[0178] Generally, Prototheca strains have very little or no fatty
acids with the chain length C8-C14. For example, Prototheca
moriformis (UTEX 1435), Prototheca krugani (UTEX 329), Prototheca
stagnora (UTEX 1442) and Prototheca zopfii (UTEX 1438) contains no
(or undectable amounts) C8 fatty acids, between 0-0.01% C10 fatty
acids, between 0.03-2.1% C12 fatty acids and between 1.0-1.7% C14
fatty acids.
[0179] In some cases, the microbial strains containing a transgene
encoding a fatty acyl-ACP thioesterase that has activity towards
fatty acyl-ACP substrate of chain lengths C8 or C8-10 has at least
1.5%, at least 3.0%, at least 10%, at least 12% or more fatty acids
of chain length C8. In other instances, the microbial strains
containing a transgene encoding a fatty acyl ACP thioesterase that
has activity towards fatty acyl-ACP substrate of chain lengths C10
has at least at least 5.0%, at least 10.0%, at least 24%, at least
29% or more fatty acids of chain length C10. In other instances,
the microbial strains containing a transgene encoding a fatty
acyl-ACP thioesterase that has activity towards fatty acyl-ACP
substrate of chain length C12 has at least 5%, at least 15%, at
least 34%, at least 50% or more fatty acids of the chain length
C12. In other cases, the microbial strains containing a transgene
encoding a fatty acyl-ACP thioesterase that has activity towards
fatty acyl-ACP substrate of chain length C14 has at least 2.0%, at
least 7%, at least 10%, at least 15%, at least 30%, at least 43% or
more fatty acids of the chain length C14. In other cases, the
microbial strains containing a transgene encoding a fatty acyl-ACP
thioesterase that has activity towards fatty acyl-ACP substrate of
chain length C16 has at least 30%, at least 40%, at least 66% or
more fatty acids of the chain length C16. In still other cases, the
microbial strains containing a transgene encoding a fatty acyl-ACP
thioesterase that has activity towards fatty acyl-ACP substrate of
chain length C18 and specifically for C18:0, has at least 5%, at
least 10%, at least 26%, at least 40% or more C18:0 fatty acid
levels. In any of these examples the microbe can be a microalgae,
such as Prototheca.
[0180] In non-limiting examples, a microbial strain containing a
transgene encoding a fatty acyl-ACP thioesterase that has activity
towards fatty acyl-ACP substrate of chain length C8 has between
1-20%, preferably between 1.8-13%, fatty acids of chain length C8.
In other non-limiting examples, a microbial strain containing a
transgene encoding a fatty acyl-ACP thioesterase that has activity
towards fatty acyl-ACP substrate of chain length C10 has between
1-40%, preferably between 1.91-30%, fatty acids of chain length
C10. In other non-limiting examples, microbial strains containing a
transgene encoding a fatty acyl-ACP thioesterase that has activity
towards fatty acyl-ACP substrate of chain length C12 has between
10-60%, preferably between 13.55-55%, fatty acids of the chain
length C12. In other non-limiting examples, microbial strains
containing a transgene encoding a fatty acyl-ACP thioesterase that
has activity towards fatty acyl-ACP substrate of chain length C14
has between 1-50%, preferably between 2.59-43.27%, fatty acids of
the chain length C14. In other non-limiting examples, microbial
strains containing a transgene encoding a fatty acyl-ACP
thioesterase that has broad specificity towards fatty acyl-ACP
substrates of varying carbon chain length has up to 70% fatty acids
of the chain length C16. In other cases, microbial strains
containing a transgene encoding a fatty acyl-ACP thioesterase that
has activity towards fatty acyl-ACP substrate of chain length C16
has up to 75%, preferably up to 67.42%, fatty acids of the chain
length C16. In some cases, the microbial strains containing a
transgene encoding a fatty acyl-ACP thioesterase that has activity
towards fatty acyl-ACP substrate of chain lengths between C8 and
C14 have between 1-790%, or between about 2-80%, (C8-C14) fatty
acids. In some cases, the microbial strains containing a transgene
encoding a fatty acyl-ACP thioesterase that has activity towards
fatty acyl-ACP substrates of chain lengths between C12 and C14 have
at least 50% or 60%, C12-C14 fatty acids. In some instances,
keeping the transgenic microbial strains under constant and high
selective pressure to retain exogenous genes is advantageous due to
the increase in the desired fatty acid of a specific chain length.
High levels of exogenous gene retention can also be achieved by
inserting exogenous genes into the nuclear chromosomes of the cells
using homologous recombination vectors and methods disclosed
herein. Recombinant cells containing exogenous genes integrated
into nuclear chromosomes are an object of the invention. In any of
these examples the microbe can be a microalgae, such as
Prototheca.
[0181] Optionally, the microbial oil can also include other
constituents produced by the microalgae, or incorporated into the
microalgal oil from the culture medium. These other constituents
can be present in varying amount depending on the culture
conditions used to culture the microalgae, the species of
microalgae, the extraction method used to recover microalgal oil
from the biomass and other factors that may affect microalgal oil
composition. Non-limiting examples of such constituents include
carotenoids, present from 0.025-0.3 mcg/g, preferably from 0.05 to
0.244 micrograms/gram, of oil; chlorophyll A present from 0.025-0.3
mcg/g, preferably from 0.045 to 0.268 micrograms/gram, of oil;
total chlorophyll of less than 0.03 mcg/g, preferably less than
0.025 micrograms/gram, of oil; gamma tocopherol present from 35-175
mcg/g, preferably from 38.3-164 micrograms/gram, of oil; total
tocopherols present from 50-300 mcg/g, preferably from 60.8 to
261.7 microgram/gram, of oil; less than 0.5%, preferably less than
0.25%, brassicasterol, campesterol, stigmasterol, or
betasitosterol; total tocotrienols less than 300 micrograms/gram of
oil; and total tocotrienols present from 225-350 mcg/g, preferably
from 249.6 to 325.3 micrograms/gram, of oil.
[0182] The other constituents can include, without limitation,
phospholipids, tocopherols, tocotrienols, carotenoids (e.g.,
alpha-carotene, beta-carotene, lycopene, etc.), xanthophylls (e.g.,
lutein, zeaxanthin, alpha-cryptoxanthin and beta-crytoxanthin), and
various organic or inorganic compounds. In some cases, the oil
extracted from Prototheca species comprises between 0.001 to 0.05,
preferably from 0.003 to 0.039, microgram lutein/gram of oil, less
than 0.005, preferably less than 0.003, micrograms lycopene/gram of
oil; and less than 0.005, preferably less than 0.003, microgram
beta carotene/gram of oil.
III. GENETIC ENGINEERING METHODS AND MATERIALS
[0183] The present invention provides methods and materials for
genetically modifying Prototheca cells and recombinant host cells
useful in the methods of the present invention, including but not
limited to recombinant Prototheca moriformis, Prototheca zopfii,
Prototheca krugani, and Prototheca stagnora host cells. The
description of these methods and materials is divided into
subsections for the convenience of the reader. In subsection 1,
transformation methods are described. In subsection 2, genetic
engineering methods using homologous recombination are described.
In subsection 3, expression vectors and components are
described.
[0184] 1. Engineering Methods--Transformation
[0185] Cells can be transformed by any suitable technique
including, e.g., biolistics, electroporation (see Maruyama et al.
(2004), Biotechnology Techniques 8:821-826), glass bead
transformation and silicon carbide whisker transformation. Another
method that can be used involves forming protoplasts and using
CaCl.sub.2 and polyethylene glycol (PEG) to introduce recombinant
DNA into microalgal cells (see Kim et al. (2002), Mar. Biotechnol.
4:63-73, which reports the use of this method for the
transformation of Chorella ellipsoidea). Co-transformation of
microalgae can be used to introduce two distinct vector molecules
into a cell simultaneously (see for example Protist 2004 December;
155(4):381-93).
[0186] Biolistic methods (see, for example, Sanford, Trends In
Biotech. (1988) 6:299 302, U.S. Pat. No. 4,945,050; electroporation
(Fromm et al., Proc. Nat'l. Acad. Sci. (USA) (1985) 82:5824 5828);
use of a laser beam, microinjection or any other method capable of
introducing DNA into a microalgae can also be used for
transformation of a Prototheca cell.
[0187] 2. Engineering Methods--Homologous Recombination
[0188] Homologous recombination is the ability of complementary DNA
sequences to align and exchange regions of homology. Transgenic DNA
("donor") containing sequences homologous to the genomic sequences
being targeted ("template") is introduced into the organism and
then undergoes recombination into the genome at the site of the
corresponding genomic homologous sequences.
[0189] The ability to carry out homologous recombination in a host
organism has many practical implications for what can be carried
out at the molecular genetic level and is useful in the generation
of an oleaginous microbe that can produced tailored oils. By its
very nature homologous recombination is a precise gene targeting
event, hence, most transgenic lines generated with the same
targeting sequence will be essentially identical in terms of
phenotype, necessitating the screening of far fewer transformation
events. Homologous recombination also targets gene insertion events
into the host chromosome, potentially resulting in excellent
genetic stability, even in the absence of genetic selection.
Because different chromosomal loci will likey impact gene
expression, even from heterologous promoters/UTRs, homologous
recombination can be a method of querying loci in an unfamiliar
genome environment and to assess the impact of these environments
on gene expression.
[0190] A particularly useful genetic engineering approach using
homologous recombination is to co-opt specific host regulatory
elements such as promoters/UTRs to drive heterologous gene
expression in a highly specific fashion. For example, ablation or
knockout of desaturase genes/gene families with a heterologous gene
encoding a selective marker might be expected to increase the
overall percentage of saturated fatty acids produced in the host
cell. Example 6 describes the homologous recombination targeting
constructs and a working example of such desaturase gene ablations
or knockouts generated in Prototheca moriformis. Another approach
to decreasing expression of an endogenous gene is to use an
RNA-induced downregulation or silencing of gene expression
including, but not limited to an RNAi or antisense approach, as
well as a dsRNA approach. Antisense, RNAi, dsRNA approaches are
well known in the art and include the introduction of an expression
construct that when expressed as mRNA would lead to the formation
of hairpin RNA or an expression construct containing a portion of
the target gene that would be transcribed in the antisense
orientation. All three approaches would result in the decreased
expression of the target gene. Example 6 also describes expression
constructs and a working example of the down-regulation of an
endogenous Prototheca moriformis delta 12 desaturase gene (FADc) by
an RNAi and antisense approach.
[0191] Because homologous recombination is a precise gene targeting
event, it can be used to precisely modify any nucleotide(s) within
a gene or region of interest, so long as sufficient flanking
regions have been identified. Therefore, homologous recombination
can be used as a means to modify regulatory sequences impacting
gene expression of RNA and/or proteins. It can also be used to
modify protein coding regions in an effort to modify enzyme
activities such as substrate specificity, affinities and Km, and
thus affecting the desired change in metabolism of the host cell.
Homologous recombination provides a powerful means to manipulate
the host genome resulting in gene targeting, gene conversion, gene
deletion, gene duplication, gene inversion and exchanging gene
expression regulatory elements such as promoters, enhancers and
3'UTRs.
[0192] Homologous recombination can be achieve by using targeting
constructs containing pieces of endogenous sequences to "target"
the gene or region of interest within the endogenous host cell
genome. Such targeting sequences can either be located 5' of the
gene or region of interest, 3' of the gene/region of interest or
even flank the gene/region of interest. Such targeting constructs
can be transformed into the host cell either as a supercoiled
plasmid DNA with additional vector backbone, a PCR product with no
vector backbone, or as a linearized molecule. In some cases, it may
be advantageous to first expose the homologous sequences within the
transgenic DNA (donor DNA) with a restriction enzyme. This step can
increase the recombination efficiency and decrease the occurrence
of undesired events. Other methods of increasing recombination
efficiency include using PCR to generate transforming transgenic
DNA containing linear ends homologous to the genomic sequences
being targeted.
[0193] For purposes of non-limiting illustration, regions of donor
DNA sequences that are useful for homologous recombination include
the KE858 region of DNA in Prototheca moriformis. KE858 is a 1.3
kb, genomic fragment that encompasses part of the coding region for
a protein that shares homology with the transfer RNA (tRNA) family
of proteins. Southern blots have shown that the KE858 sequence is
present in a single copy in the Prototheca moriformis (UTEX 1435)
genome. This region and Examples of using this region for
homologous recombination targeting has been described in PCT
Application No. PCT/US2009/066142. Another region of donor DNA that
is useful is the genomic sequence denoted here as "6S" (donor
sequences at SEQ ID NO: 82, SEQ ID NO: 84). Note that the 6S
sequence is not the 6S rRNA sequence. The use of this sequence in
homologous recombination in Prototheca moriformis are described
below in the Examples.
[0194] 3. Vectors and Vector Components
[0195] Vectors for transformation of microorganisms in accordance
with the present invention can be prepared by known techniques
familiar to those skilled in the art in view of the disclosure
herein. A vector typically contains one or more genes, in which
each gene codes for the expression of a desired product (the gene
product) and is operably linked to one or more control sequences
that regulate gene expression or target the gene product to a
particular location in the recombinant cell. To aid the reader,
this subsection is divided into subsections. Subsection A describes
control sequences typically contained on vectors as well as novel
control sequences provided by the present invention. Subsection B
describes genes typically contained in vectors as well as novel
codon optimization methods and genes prepared using them provided
by the invention.
[0196] A. Control Sequences
[0197] Control sequences are nucleic acids that regulate the
expression of a coding sequence or direct a gene product to a
particular location in or outside a cell. Control sequences that
regulate expression include, for example, promoters that regulate
transcription of a coding sequence and terminators that terminate
transcription of a coding sequence. Another control sequence is a
3' untranslated sequence located at the end of a coding sequence
that encodes a polyadenylation signal. Control sequences that
direct gene products to particular locations include those that
encode signal peptides, which direct the protein to which they are
attached to a particular location in or outside the cell.
[0198] Thus, an exemplary vector design for expression of an
exogenous gene in a microalgae contains a coding sequence for a
desired gene product (for example, a selectable marker, a lipid
pathway modification enzyme, or a sucrose utilization enzyme) in
operable linkage with a promoter active in microalgae.
Alternatively, if the vector does not contain a promoter in
operable linkage with the coding sequence of interest, the coding
sequence can be transformed into the cells such that it becomes
operably linked to an endogenous promoter at the point of vector
integration. The promoterless method of transformation has been
proven to work in microalgae (see for example Plant Journal 14:4,
(1998), pp. 441-447).
[0199] Many promoters are active in microalgae, including promoters
that are endogenous to the algae being transformed, as well as
promoters that are not endogenous to the algae being transformed
(i.e., promoters from other algae, promoters from higher plants,
and promoters from certain plant viruses or algae viruses).
Illustrative exogenous and/or endogenous promoters that are active
in microalgae (as well as antibiotic resistance genes functional in
microalgae) are described in PCT Pub. No. 2008/151149 and
references cited therein).
[0200] The promoter used to express an exogenous gene can be the
promoter naturally linked to that gene or can be a heterologous
promoter. Some promoters are active in more than one species of
microalgae. Other promoters are species-specific. Illustrative
promoters include promoters such as .beta.-tubulin from
Chlamydomonas reinhardtii, used in the Examples below, and viral
promoters, such as cauliflower mosaic virus (CMV) and chlorella
virus, which have been shown to be active in multiple species of
microalgae (see for example Plant Cell Rep. 2005 March;
23(10-11):727-35; J Microbiol. 2005 August; 43(4):361-5; Mar
Biotechnol (NY). 2002 January; 4(1):63-73). Another promoter that
is suitable for use for expression of exogenous genes in Prototheca
is the Chlorella sorokiniana glutamate dehydrogenase
promoter/5'UTR. Optionally, at least 10, 20, 30, 40, 50, or 60
nucleotides or more of these sequences containing a promoter are
used. Illustrative promoters useful for expression of exogenous
genes in Prototheca are listed in the sequence listing of this
application, such as the promoter of the Chlorella HUP1 gene (SEQ
ID NO: 1) and the Chlorella ellipsoidea nitrate reductase promoter
(SEQ ID NO:2). Chlorella virus promoters can also be used to
express genes in Prototheca, such as SEQ ID NOs: 1-7 of U.S. Pat.
No. 6,395,965. Additional promoters active in Prototheca can be
found, for example, in Biochem Biophys Res Commun. 1994 Oct. 14;
204(1):187-94; Plant Mol Biol. 1994 October; 26(1):85-93; Virology.
2004 Aug. 15; 326(1):150-9; and Virology. 2004 Jan. 5;
318(1):214-23. Other useful promoters are described in detail in
the Examples below.
[0201] A promoter can generally be characterized as either
constitutive or inducible. Constitutive promoters are generally
active or function to drive expression at all times (or at certain
times in the cell life cycle) at the same level. Inducible
promoters, conversely, are active (or rendered inactive) or are
significantly up- or down-regulated only in response to a stimulus.
Both types of promoters find application in the methods of the
invention. Inducible promoters useful in the invention include
those that mediate transcription of an operably linked gene in
response to a stimulus, such as an exogenously provided small
molecule (e.g, glucose, as in SEQ ID NO:1), temperature (heat or
cold), lack of nitrogen in culture media, etc. Suitable promoters
can activate transcription of an essentially silent gene or
upregulate, preferably substantially, transcription of an operably
linked gene that is transcribed at a low level. Examples below
describe additional inducible promoters that are useful in
Prototheca cells.
[0202] Inclusion of termination region control sequence is
optional, and if employed, then the choice is be primarily one of
convenience, as the termination region is relatively
interchangeable. The termination region may be native to the
transcriptional initiation region (the promoter), may be native to
the DNA sequence of interest, or may be obtainable from another
source. See, for example, Chen and Orozco, Nucleic Acids Res.
(1988) 16:8411.
[0203] The present invention also provides control sequences and
recombinant genes and vectors containing them that provide for the
directing a gene product of interest to a particular cell
compartment such as chloroplasts, plastids, mitochondria, or
endoplasmic reticulum. In addition, embodiments of the present
invention include control sequences and recombinant genes and
vectors containing them that provide for the secretion of a protein
outside the cell.
[0204] Proteins expressed in the nuclear genome of Prototheca can
be targeted to the plastid using plastid targeting signals. Plastid
targeting sequences endogenous to Chlorella are known, such as
genes in the Chlorella nuclear genome that encode proteins that are
targeted to the plastid; see for example GenBank Accession numbers
AY646197 and AF499684, and in one embodiment, such control
sequences are used in the vectors of the present invention to
target expression of a protein to a Prototheca plastid.
[0205] The Examples below describe the use of algal plastid
targeting sequences to target heterologous proteins to the correct
compartment in the host cell. cDNA libraries were made using
Prototheca moriformis and Chlorella protothecodies cells and are
described in PCT Application No. PCT/US2009/066142.
[0206] In another embodiment of the present invention, the
expression of a polypeptide in Prototheca is targeted to the
endoplasmic reticulum. The inclusion of an appropriate retention or
sorting signal in an expression vector ensure that proteins are
retained in the endoplasmic reticulum (ER) and do not go downstream
into Golgi. For example, the IMPACTVECTOR1.3 vector, from
Wageningen UR-Plant Research International, includes the well known
KDEL retention or sorting signal. With this vector, ER retention
has a practical advantage in that it has been reported to improve
expression levels 5-fold or more. The main reason for this appears
to be that the ER contains lower concentrations and/or different
proteases responsible for post-translational degradation of
expressed proteins than are present in the cytoplasm. ER retention
signals functional in green microalgae are known. For example, see
Proc Natl Acad Sci USA. 2005 Apr. 26; 102(17):6225-30.
[0207] In another embodiment of the present invention, a
polypeptide is targeted for secretion outside the cell into the
culture media. See Hawkins et al., Current Microbiology Vol. 38
(1999), pp. 335-341 for examples of secretion signals active in
Chlorella that can be used, in accordance with the methods of the
invention, in Prototheca.
[0208] B. Genes and Codon Optimization
[0209] Typically, a gene includes a promoter, coding sequence, and
termination control sequences. When assembled by recombinant DNA
technology, a gene may be termed an expression cassette and may be
flanked by restriction sites for convenient insertion into a vector
that is used to introduce the recombinant gene into a host cell.
The expression cassette can be flanked by DNA sequences from the
genome or other nucleic acid target to facilitate stable
integration of the expression cassette into the genome by
homologous recombination. Alternatively, the vector and its
expression cassette may remain unintegrated (e.g., an episome), in
which case, the vector typically includes an origin of replication,
which is capable of providing for replication of the heterologous
vector DNA.
[0210] A common gene present on a vector is a gene that codes for a
protein, the expression of which allows the recombinant cell
containing the protein to be differentiated from cells that do not
express the protein. Such a gene, and its corresponding gene
product, is called a selectable marker or selection marker. Any of
a wide variety of selectable markers can be employed in a transgene
construct useful for transforming Prototheca. Examples of suitable
selectable markers include the G418 resistance gene, the nitrate
reductase gene (see Dawson et al. (1997), Current Microbiology
35:356-362), the hygromycin phosphotransferase gene (HPT; see Kim
et al. (2002), Mar. Biotechnol. 4:63-73), the neomycin
phosphotransferase gene, and the ble gene, which confers resistance
to phleomycin (Huang et al. (2007), Appl. Microbiol. Biotechnol.
72:197-205). Methods of determining sensitivity of microalgae to
antibiotics are well known. For example, Mol Gen Genet. 1996 Oct.
16; 252(5):572-9, sucrose invertase, as described herein, and
thiamine auxotrophy complementation, as also described herein.
[0211] Other selectable markers that are not antibiotic-based can
alsobe employed in a transgene construct useful for transforming
microalgae in general, including Prototheca species. Genes that
confers the ability to utilize certain carbon sources that were
previously unable to be utilized by the microalgae can also be used
as a selectable marker. By way of illustration, Prototheca
moriformis strains typically grow poorly, if at all, on sucrose.
Using a construct containing a sucrose invertase gene can confer
the ability of positive transformants to grow on sucrose as a
carbon substrate. Additional details on using sucrose utilization
as a selectable marker along with other selectable markers are
discussed in Section IV below.
[0212] For purposes of the present invention, the expression vector
used to prepare a recombinant host cell of the invention will
include at least two, and often three, genes, if one of the genes
is a selectable marker. For example, a genetically engineered
Prototheca of the invention can be made by transformation with
vectors of the invention that comprise, in addition to a selectable
marker, one or more exogenous genes, such as, for example, sucrose
invertase gene or acyl ACP-thioesterase gene. One or both genes can
be expressed using an inducible promoter, which allows the relative
timing of expression of these genes to be controlled to enhance the
lipid yield and conversion to fatty acid esters. Expression of the
two or more exogenous genes may be under control of the same
inducible promoter or under control of different inducible (or
constitutive) promoters. In the latter situation, expression of a
first exogenous gene can be induced for a first period of time
(during which expression of a second exogenous gene may or may not
be induced) and expression of a second exogenous gene can be
induced for a second period of time (during which expression of a
first exogenous gene may or may not be induced).
[0213] In other embodiments, the two or more exogenous genes (in
addition to any selectable marker) are: a fatty acyl-ACP
thioesterase and a fatty acyl-CoA/aldehyde reductase, the combined
action of which yields an alcohol product. Further provided are
other combinations of exogenous genes, including without
limitation, a fatty acyl-ACP thioesterase and a fatty acyl-CoA
reductase to generate aldehydes. In one embodiment, the vector
provides for the combination of a fatty acyl-ACP thioesterase, a
fatty acyl-CoA reductase, and a fatty aldehyde decarbonylase to
generate alkanes. In each of these embodiments, one or more of the
exogenous genes can be expressed using an inducible promoter.
[0214] Other illustrative vectors of the invention that express two
or more exogenous genes include those encoding both a sucrose
transporter and a sucrose invertase enzyme and those encoding both
a selectable marker and a secreted sucrose invertase. The
recombinant Prototheca transformed with either type of vector
produce lipids at lower manufacturing cost due to the engineered
ability to use sugar cane (and sugar cane-derived sugars) as a
carbon source. Insertion of the two exogenous genes described above
can be combined with the disruption of polysaccharide biosynthesis
through directed and/or random mutagenesis, which steers ever
greater carbon flux into lipid production. Individually and in
combination, trophic conversion, engineering to alter lipid
production and treatment with exogenous enzymes alter the lipid
composition produced by a microorganism. The alteration can be a
change in the amount of lipids produced, the amount of one or more
hydrocarbon species produced relative to other lipids, and/or the
types of lipid species produced in the microorganism. For example,
microalgae can be engineered to produce a higher amount and/or
percentage of TAGs (triacylglycerides).
[0215] For optimal expression of a recombinant protein, it is
beneficial to employ coding sequences that produce mRNA with codons
preferentially used by the host cell to be transformed. Thus,
proper expression of transgenes can require that the codon usage of
the transgene matches the specific codon bias of the organism in
which the transgene is being expressed. The precise mechanisms
underlying this effect are many, but include the proper balancing
of available aminoacylated tRNA pools with proteins being
synthesized in the cell, coupled with more efficient translation of
the transgenic messenger RNA (mRNA) when this need is met. When
codon usage in the transgene is not optimized, available tRNA pools
are not sufficient to allow for efficient translation of the
heterologous mRNA resulting in ribosomal stalling and termination
and possible instability of the transgenic mRNA.
[0216] The present invention provides codon-optimized nucleic acids
useful for the successful expression of recombinant proteins in
Prototheca. Codon usage in Prototheca species was analyzed by
studying cDNA sequences isolated from Prototheca moriformis. This
analysis represents the interrogation over 24,000 codons and
resulted in Table 2 below.
TABLE-US-00002 TABLE 2 Preferred codon usage in Prototheca strains.
Ala GCG 345 (0.36) Asn AAT 8 (0.04) GCA 66 (0.07) AAC 201 (0.96)
GCT 101 (0.11) Pro CCG 161 (0.29) GCC 442 (0.46) CCA 49 (0.09) Cys
TGT 12 (0.10) CCT 71 (0.13) TGC 105 (0.90) CCC 267 (0.49) Asp GAT
43 (0.12) Gln CAG 226 (0.82) GAC 316 (0.88) CAA 48 (0.18) Glu GAG
377 (0.96) Arg AGG 33 (0.06) GAA 14 (0.04) AGA 14 (0.02) Phe TTT 89
(0.29) CGG 102 (0.18) TTC 216 (0.71) CGA 49 (0.08) Gly GGG 92
(0.12) CGT 51 (0.09) GGA 56 (0.07) CGC 331 (0.57) GGT 76 (0.10) Ser
AGT 16 (0.03) GGC 559 (0.71) AGC 123 (0.22) His CAT 42 (0.21) TCG
152 (0.28) CAC 154 (0.79) TCA 31 (0.06) Ile ATA 4 (0.01) TCT 55
(0.10) ATT 30 (0.08) TCC 173 (0.31) ATC 338 (0.91) Thr ACG 184
(0.38) Lys AAG 284 (0.98) ACA 24 (0.05) AAA 7 (0.02) ACT 21 (0.05)
Leu TTG 26 (0.04) ACC 249 (0.52) TTA 3 (0.00) Val GTG 308 (0.50)
CTG 447 (0.61) GTA 9 (0.01) CTA 20 (0.03) GTT 35 (0.06) CTT 45
(0.06) GTC 262 (0.43) CTC 190 (0.26) Trp TGG 107 (1.00) Met ATG 191
(1.00) Tyr TAT 10 (0.05) TAC 180 (0.95) Stop TGA/TAG/TAA
[0217] In other embodiments, the gene in the recombinant vector has
been codon-optimized with reference to a microalgal strain other
than a Prototheca strain. For example, methods of recoding genes
for expression in microalgae are described in U.S. Pat. No.
7,135,290. Additional information for codon optimization is
available, e.g., at the codon usage database of GenBank.
[0218] In connection with embodiments having codon optimized genes,
the optimized genes are preferably optimized so as to increase
expression of the gene product of the gene being optimized by at
least 10% and more preferably by at least 20, 40, 60, 80, 100, or
200%.
[0219] While the methods and materials of the invention allow for
the introduction of any exogenous gene into Prototheca, genes
relating to sucrose utilization and lipid pathway modification are
of particular interest, as discussed in the following sections.
IV. SELECTABLE MARKERS
[0220] 1. Sucrose Utilization
[0221] In an embodiment, the recombinant cell of the invention
further contains one or more exogenous sucrose utilization genes.
In various embodiments, the one or more genes encode one or more
proteins selected from the group consisting of a fructokinase, a
glucokinase, a hexokinase, a sucrose invertase, a sucrose
transporter. For example, expression of a sucrose transporter and a
sucrose invertase allows Prototheca to transport sucrose into the
cell from the culture media and hydrolyze sucrose to yield glucose
and fructose. Optionally, a fructokinase can be expressed as well
in instances where endogenous hexokinase activity is insufficient
for maximum phosphorylation of fructose. Examples of suitable
sucrose transporters are Genbank accession numbers CAD91334,
CAB92307, and CAA53390. Examples of suitable fructokinases are
Genbank accession numbers P26984, P26420 and CAA43322.
[0222] In one embodiment, the present invention provides a host
cell that secretes a sucrose invertase. Secretion of a sucrose
invertase obviates the need for expression of a transporter that
can transport sucrose into the cell. This is because a secreted
invertase catalyzes the conversion of a molecule of sucrose into a
molecule of glucose and a molecule of fructose, both of which can
be transported and utilized by microbes provided by the invention.
For example, expression of a sucrose invertase (such as SEQ ID
NO:3) with a secretion signal (such as that of SEQ ID NO: 4 (from
yeast), SEQ ID NO: 5 (from higher plants), SEQ ID NO: 6 (eukaryotic
consensus secretion signal), and SEQ ID NO: 7 (combination of
signal sequence from higher plants and eukaryotic consensus)
generates invertase activity outside the cell. Expression of such a
protein, as enabled by the genetic engineering methodology
disclosed herein, allows cells already capable of utilizing
extracellular glucose as an energy source to utilize sucrose as an
extracellular energy source.
[0223] Prototheca species expressing an invertase in media
containing sucrose are a preferred microalgal species for the
production of oil. The expression and extracellular targeting of
this fully active protein allows the resulting host cells to grow
on sucrose, whereas their non-transformed counterparts cannot.
Thus, embodiments of the present invention provide recombinant
microalgae (including Prototheca) cells with a codon-optimized
invertase gene, including but not limited to the yeast invertase
gene, integrated into their genome such that the invertase gene is
expressed as assessed by invertase activity and sucrose hydrolysis.
Invertase genes are useful as selectable markers in the recombinant
cells, as such cells are able to grow on sucrose, while their
non-transformed counterparts cannot; and methods for selecting
recombinant host cells using an invertase as a powerful, selectable
marker for algal molecular genetics.
[0224] The successful expression of a sucrose invertase in
Prototheca also illustrates another aspect of the present invention
in that it demonstrates that heterologous (recombinant) proteins
can be expressed in the algal cell and successfully transit outside
of the cell and into the culture medium in a fully active and
functional form. Thus, embodiments of the present invention provide
methods and reagents for expressing a wide and diverse array of
heterologous proteins in microalgae and secreting them outside of
the host cell. Such proteins include, for example, industrial
enzymes such as, for example, lipases, proteases, cellulases,
pectinases, amylases, esterases, oxidoreductases, transferases,
lactases, isomerases, and invertases, as well as therapeutic
proteins such as, for example, growth factors, cytokines, full
length antibodies comprising two light and two heavy chains, Fabs,
scFvs (single chain variable fragment), camellid-type antibodies,
antibody fragments, antibody fragment-fusions, antibody-receptor
fusions, insulin, interferons, and insulin-like growth factors.
[0225] The successful expression of a sucrose invertase in
Prototheca also illustrates another aspect of the present invention
in that it provides methods and reagents for the use of fungal
transit peptides in algae to direct secretion of proteins in
Prototheca; and methods and reagents for determining if a peptide
can function, and the ability of it to function, as a transit
peptide in Prototheca cells. The methods and reagents of the
invention can be used as a tool and platform to identify other
transit peptides that can successfully traffic proteins outside of
a cell, and that the yeast invertase has great utility in these
methods. As demonstrated in this example, removal of the endogenous
yeast invertase transit peptide and its replacement by other
transit peptides, either endogenous to the host algae or from other
sources (eukaryotic, prokaryotic and viral), can identify whether
any peptide of interest can function as a transit peptide in
guiding protein egress from the cell.
[0226] Examples of suitable sucrose invertases include those
identified by Genbank accession numbers CAB95010, NP_012104 and
CAA06839. Non-limiting examples of suitable invertases are listed
below in Table 3. Amino acid sequences for each listed invertase
are included in the Sequence Listing below. In some cases, the
exogenous sucrose utilization gene suitable for use in the methods
and vectors of the invention encodes a sucrose invertase that has
at least 40, 50, 60, 75, or 90% or higher amino acid identity with
a sucrose invertase selected from Table 3.
TABLE-US-00003 TABLE 3 Sucrose invertases. GenBank Description
Organism Accession No. SEQ ID NO: Invertase Chicorium intybus
Y11124 SEQ ID NO: 20 Invertase Schizosaccharomyces AB011433 SEQ ID
NO: 21 pombe beta- Pichia anomala X80640 SEQ ID NO: 22 fructo-
furanosidase (invertase) Invertase Debaryomyces X17604 SEQ ID NO:
23 occidentalis Invertase Oryza sativa AF019113 SEQ ID NO: 24
Invertase Allium cepa AJ006067 SEQ ID NO: 25 Invertase Beta
vulgaris subsp. AJ278531 SEQ ID NO: 26 Vulgaris beta-
Bifidobacterium breve AAT28190 SEQ ID NO: 27 fructo- UCC2003
furanosidase (invertase) Invertase Saccharomyces NP_012104 SEQ ID
NO: 8 cerevisiae (nucleotide) SEQ ID NO: 28 (amino acid) Invertase
A Zymomonas mobilis AAO38865 SEQ ID NO: 29
[0227] The secretion of an invertase to the culture medium by
Prototheca enable the cells to grow as well on waste molasses from
sugar cane processing as they do on pure reagent-grade glucose; the
use of this low-value waste product of sugar cane processing can
provide significant cost savings in the production of lipids and
other oils. Thus, the present invention provides a microbial
culture containing a population of Prototheca microorganisms, and a
culture medium comprising (i) sucrose and (ii) a sucrose invertase
enzyme. In various embodiments the sucrose in the culture comes
from sorghum, sugar beet, sugar cane, molasses, or depolymerized
cellulosic material (which may optionally contain lignin). In
another aspect, the methods and reagents of the invention
significantly increase the number and type of feedstocks that can
be utilized by recombinant microalgae or other microbes. While the
microbes exemplified here are altered such that they can utilize
sucrose, the methods and reagents of the invention can be applied
so that feedstocks such as cellulosics are utilizable by an
engineered host microbe of the invention with the ability to
secrete cellulases, pectinases, isomerases, or the like, such that
the breakdown products of the enzymatic reactions are no longer
just simply tolerated but rather utilized as a carbon source by the
host. An example of this is described below and in the Examples of
microbes engineered to express a secretable .alpha.-galactosidase,
conferring the ability to hydrolyze .alpha.-galactosyl bonds in
oligosaccharides such as those contained in raffinose and stachyose
which are two oligosaccharides found in agricultural waste
streams.
[0228] 2. Alpha-Galactosidase Expression
[0229] While the expression of a sucrose invertase, as described
above, confers the ability for Prototheca cells to more efficiently
utilize sucrose as a carbon source (via the enzyme hydrolyzing the
.alpha.-linkage between fructose and glucose molecules in the
disaccharide sucrose), the expression of other enzymes that
hydrolyze other types of .alpha.-linkages in oligosaccharides can
confer the ability for Prototheca cells to utilize other carbon
sources. The expression of these enzymes (and the resulting ability
to utilize carbon sources that Prototheca and other microalgal
cells ordinarily would not be able to) can be used as a selectable
marker for these transgenic Prototheca cells by allowing for the
selection of positive clones that are able to grow on these carbon
sources.
[0230] In an embodiment, the recombinant Prototheca cell of the
invention further contains one or more exogenous genes encoding
polysaccharide-degrading enzymes. In various embodiments, the one
or more genes encoding a polysaccharide-degrading enzyme is a gene
encoding a secreted .alpha.-galactosidase. The expression of an
exogenous secreted .alpha.-galactosidase in a Prototheca cell
confers the ability of such transformed strains to grow on sugars
(carbon sources) containing D-galactosyl linkages, such as
.alpha.-linkages between galactose and glucose monosaccharide
units. Prototheca strains expressing an exogenous, secreted
.alpha.-galactosidase will be able to utilize disaccharides such as
melibiose (disaccharide composed of
.alpha.-D-galactose-glucose).
[0231] Sugars such as raffinose (a trisaccharide comprised of
.alpha.-linked galactose-glucose-fructose) and stachyose (a
tetrasaccharide composed to two .alpha.-linked D-galactose units,
followed by .alpha.-linked glucose and fructose) are present in
significant proportions in agricultural waste streams such as beet
pulp (raffinose) and soybean meal (stachyose). Such agricultural
residues represent a significant untapped carbon source for the
conversion into oil by microbes (including Prototheca) capable of
utilizing them.
[0232] Prototheca strains are unable to utilize oligosaccharides
such as raffinose and stachyose in any significant quantity or at
all. In the case of raffinose and stachyose, although transgenic
strains expressing a sucrose invertase (as described above) have
the ability to hydrolyze the .alpha.-linkage between fructose and
glucose in .alpha.-galactosyl derivatives of sucrose, but the
remainder of the oligosaccharide remains unutilized, as sucrose
invertase will not cleave the remaining .alpha.-linkages in such
sugars and the resulting disaccharides are not utilizable. In
another embodiment, the recombinant Prototheca cell of the
invention comprises both an exogenous gene encoding a sucrose
invertase and an exogenous gene encoding an .alpha.-galactosidase.
Thus, strains expressing both a sucrose invertase and an
.alpha.-galactosidase will be capable of fully hydrolyzing
oligosaccharides such as raffinose and stachyose, enabling the
consumption of the component monomers. In addition,
.alpha.-galactosidase encoding genes may be used as a selectable
marker for transformation. Clones containing the exogenous
.alpha.-galactosidase gene will have the ability to grow on
melibiose. Examples of suitable .alpha.-galactosidase genes for use
in Prototheca strains include the MEL1 gene from Saccharomyces
carlbergensis, the AglC gene from Aspergillus niger. Interestingly,
not all .alpha.-galactosidase genes have been found to be
functional in Prototheca species, even if the genes are optimized
according to the preferred codon usage in Prototheca strains. The
Examples below demonstrates the ability of transgenic Prototheca
cells to grow on melibiose when transformed with codon-optimized
MEL1 gene from S. carlbergensis and the AglC gene from A. niger,
but not an .alpha.-galactosidase encoding gene from the higher
plant, Cyamopsis tetragonobola (Guar bean).
[0233] 3. Thiamine Auxotrophy Complementation
[0234] Prototheca strains including Prototheca moriformis are known
to be thiamine auxotrophic (See, for example, Ciferri, O. (1956)
Nature, v. 178, pp. 1475-1476), meaning that these strains require
thiamine in the nutrient media for growth. Thiamine auxotrophy can
be the result of mutations or lack of expression of enzymes in the
thiamine biosynthetic pathway. Complemented transgenic strains
expressing the missing enzyme(s) in the thiamine biosynthetic
pathway can then be grown without added thiamine, thus reducing the
cost of the nutrient media as well as rendering the resulting
microalgal biomass more desireable for use as an animal feed.
Complementation with a thiamine biosynthetic pathway enzyme can
also be used as a selectable marker as the transgenic gene confers
the ability to grow on plates/media that does not contain
thiamine.
[0235] In an embodiment, the recombinant Prototheca cell of the
invention further contains one or more exogenous genes encoding
thiamine biosynthetic pathway enzyme. In another embodiment, the
recombinant Prototheca cell of the invention comprises an exogenous
gene encoding hydroxymethylpyrimidine phosphate synthases from
algal, plant or cyanobacterial sources. In still other embodiments,
the hydroxymethylpyrimidine phosphate synthase is encoded by a THIC
gene. In still other embodiments, the THIC gene the Coccomyxa C-169
THIC, Arabidopsis thaliana THIC, or the Synechocystis sp. PCC 6803
thiC. The Examples below details the engineering of Prototheca
moriformis UTEX 1435 with restored thiamine prototrophy.
V. LIPID PATHWAY ENGINEERING
[0236] In addition to altering the ability of microalgae or other
microbes to utilize feedstocks such as sucrose-containing
feedstocks, the present invention also provides recombinant
microalgae or other microbes that have been modified to alter the
properties and/or proportions of lipids produced. The pathway can
further, or alternatively, be modified to alter the properties
and/or proportions of various lipid molecules produced through
enzymatic processing of lipids and intermediates in the fatty acid
pathway. In various embodiments, the recombinant Prototheca cells
of the invention have, relative to their untransformed
counterparts, optimized lipid yield per unit volume and/or per unit
time, carbon chain length (e.g., for renewable diesel production or
for industrial chemicals applications requiring lipid feedstock),
reduced or increased number and/or position of double bonds,
optionally to zero, hydroxylation of fatty acids, and increasing
the hydrogen:carbon ratio of a particular species of lipid or of a
population of distinct lipid.
[0237] In particular embodiments, one or more key enzymes that
control branch points in metabolism to fatty acid synthesis have
been up-regulated or down-regulated to improve lipid production.
Up-regulation can be achieved, for example, by transforming cells
with expression constructs in which a gene encoding the enzyme of
interest is expressed, e.g., using a strong promoter and/or
enhancer elements that increase transcription. Such constructs can
include a selectable marker such that the transformants can be
subjected to selection, which can result in gene maintenance, and
possibly amplification of the construct and an increase in the
expression level of the encoded enzyme. Examples of enzymes
suitable for up-regulation according to the methods of the
invention include pyruvate dehydrogenase, which plays a role in
converting pyruvate to acetyl-CoA (examples, some from microalgae,
include Genbank accession numbers NP_415392; AAA53047; Q1XDM1; and
CAF05587). Up-regulation of pyruvate dehydrogenase can increase
production of acetyl-CoA, and thereby increase fatty acid
synthesis. Acetyl-CoA carboxylase catalyzes the initial step in
fatty acid synthesis. Accordingly, this enzyme can be up-regulated
to increase production of fatty acids (examples, some from
microalgae, include Genbank accession numbers BAA94752; AAA75528;
AAA81471; YP_537052; YP_536879; NP_045833; and BAA57908). Fatty
acid production can also be increased by up-regulation of acyl
carrier protein (ACP), which carries the growing acyl chains during
fatty acid synthesis (examples, some from microalgae, include
Genbank accession numbers A0T0F8; P51280; NP_849041; YP_874433).
Glycerol-3-phosphate acyltransferase catalyzes the rate-limiting
step of fatty acid synthesis. Up-regulation of this enzyme can
increase fatty acid production (examples, some from microalgae,
include Genbank accession numbers AAA74319; AAA33122; AAA37647;
P44857; and AB094442).
[0238] Up- and/or down-regulation of genes can be applied to global
regulators controlling the expression of the genes of the fatty
acid biosynthetic pathways. Accordingly, one or more global
regulators of fatty acid synthesis can be up- or down-regulated, as
appropriate, to inhibit or enhance, respectively, the expression of
a plurality of fatty acid synthetic genes and, ultimately, to
increase lipid production. Examples include sterol regulatory
element binding proteins (SREBPs), such as SREBP-1a and SREBP-1c
(for examples see Genbank accession numbers NP_035610 and
Q9WTN3).
[0239] The present invention also provides recombinant Prototheca
cells that have been modified to contain one or more exogenous
genes encoding lipid modification enzymes such as, for example,
fatty acyl-ACP thioesterases (see Table 4), fatty acyl-CoA/aldehyde
reductases (see Table 6), fatty acyl-CoA reductases (see Table 7),
fatty aldehyde decarbonylase (see Table 8), fatty aldehyde
reductases, desaturases (such as stearoyl-ACP desaturases and fatty
acyl desaturases and squalene synthases (see GenBank Accession
number AF205791). Although fatty acyl-ACP thioesterases typically
do not directly chemically modify the lipids, their manipulation in
accordance with embodiments of the invention can alter the fatty
acid profile of a cell, especially in terms of chain length and
double bond distribution. In some embodiments, genes encoding a
fatty acyl-ACP thioesterase and a naturally co-expressed acyl
carrier protein are transformed into a Prototheca or other
microalgal or microbial cell, optionally with one or more genes
encoding other lipid modification enzymes. In other embodiments,
the ACP and the fatty acyl-ACP thioesterase may have an affinity
for one another that imparts an advantage when the two are used
together in the microbes and methods of the present invention,
irrespective of whether they are or are not naturally co-expressed
in a particular tissue or organism. Thus, embodiments of the
present invention contemplate both naturally co-expressed pairs of
these enzymes as well as those that share an affinity for
interacting with one another to facilitate cleavage of a
length-specific carbon chain from the ACP.
[0240] In still other embodiments, an exogenous gene encoding a
desaturase is transformed into the microalgal or other microbial
cell in conjunction with one or more genes encoding other lipid
modification enzymes to provide modifications with respect to lipid
saturation. In other embodiments, an endogenous desaturase gene is
overexpressed (e.g., through the introduction of additional copies
off the gene) in a microalgal or other microbial cell. Stearoyl-ACP
desaturase (see, e.g., GenBank Accession numbers AAF15308;
ABM45911; and AAY86086), for example, catalyzes the conversion of
stearoyl-ACP to oleoyl-ACP. Up-regulation of this gene can increase
the proportion of monounsaturated fatty acids produced by a cell;
whereas down-regulation can reduce the proportion of
monounsaturates. For illustrative purposes, stearoyl-ACP
desaturases (SAD) are responsible for the synthesis of C18:1 fatty
acids from C18:0 precursors. Another family of desaturases are the
fatty acyl desaturases (FAD), including delta 12 fatty acid
desaturases (.DELTA.12 FAD). These desaturases also provide
modifications with respect to lipid saturation. For illustrative
purposes, delta 12 fatty acid desaturases are responsible for the
synthesis of C18:2 fatty acids from C18:1 precursors. Similarly,
the expression of one or more glycerolipid desaturases can be
controlled to alter the ratio of unsaturated to saturated fatty
acids such as .omega.-6 fatty acid desaturase, .omega.-3 fatty acid
desaturase, or .omega.-6-oleate desaturase. In some embodiments,
the desaturase can be selected with reference to a desired carbon
chain length, such that the desaturase is capable of making
location specific modifications within a specified carbon-length
substrate, or substrates having a carbon-length within a specified
range. In another embodiment, if the desired fatty acid profile is
an increase in monounsaturates (such as C16:1 and/or C18:1)
overexpression of a SAD or expression of a heterologous SAD can be
coupled with the silencing or inactivation (e.g., through mutation,
RNAi, antisense, or knockout of an endogenous desaturase gene,
etc.) of a fatty acyl desaturase (FAD) or another desaturase
gene.
[0241] In other embodiments, the microalgal or other microbial cell
has been modified to have a mutated endogenous desaturase gene,
wherein the mutation renders the gene or desaturase enzyme
inactive. In some cases, the mutated endogenous desaturase gene is
a fatty acid desaturase (FAD). In other cases, the mutated
endogenous desaturase gene is a stearoyl Acyl carrier protein
desaturase (SAD). Example 6 below describes the targeted ablation
or knockout of stearoyl-ACP desaturases and delta 12 fatty acid
desaturases in Prototheca. Example 6 also describes the use of RNAi
or antisense constructs to decrease the expression of an endogenous
desaturase gene.
[0242] In some cases, it may be advantageous to pair one or more of
the genetic engineering techniques in order to achieve a trangenic
cell that produces the desired lipid profile. In one embodiment, a
microalgal or other microbial cell comprises a mutated endogenous
desaturase gene and one or more exogenous gene. In non-limiting
examples, a microalgal or other microbial cell with a mutated
endogenous desaturase gene can also express an exogenous fatty
acyl-ACP thioesterase gene and/or a sucrose invertase gene. Example
6 below describes a transgenic Prototheca cell containing a
targeted ablation or knockout of an endogenous SAD and also
expresses a Cinnamomum camphora C14-preferring thioesterase and a
sucrose invertase. In this case, the transgenic Prototheca cell
produces a lipid profile that closely approximates the lipid
profile found in tallow. Tallow is typically derived from rendered
beef or mutton fat, is solid at room temperature and is utilized in
a variety of applications in the food, cosmetics, and chemicals
industries. The fatty acid profile of tallow is: 4% C14:0; 26%
C16:0; 3% C16:1; 14% C18:0; 41% C18:1; 3% C18:2; and 1% C18:3. As
is shown in Example 6 below, clones of transgenic Prototheca cells
with a targeted ablation or knockout of an endogenous SAD and
expressing a C. camphora C14-preferring thioesterase have lipid
profiles of: less than 1% C12 and shorter carbon chain length fatty
acids; 2.74% to 6.13% C14:0; 23.07% to 25.69% C16:0; 7.02% to
11.08% C18:0; 42.03% to 51.21% C18:1; and 9.37% to 13.45% C18:2
(expressed in area percent). In some cases, the transgenic
Prototheca cells have lipid profiles of: 3-5% C14:0; 25-27% C16:0;
10-15% C18:0; and 40-45% C18:1.
[0243] In particular embodiments, microbes of the present invention
are genetically engineered to express one or more exogenous genes
selected from an acyl-ACP thioesterase, an acyl-CoA/aldehyde
reductase, a fatty acyl-CoA reductase, a fatty aldehyde reductase,
a fatty aldehyde decarbonylase, or a naturally co-expressed acyl
carrier protein. Suitable expression methods are described above
with respect to the expression of a lipase gene, including, among
other methods, inducible expression and compartmentalized
expression. A fatty acyl-ACP thioesterase cleaves a fatty acid from
an acyl carrier protein (ACP) during lipid synthesis. Through
further enzymatic processing, the cleaved fatty acid is then
combined with a coenzyme to yield an acyl-CoA molecule. This
acyl-CoA is the substrate for the enzymatic activity of a fatty
acyl-CoA reductase to yield an aldehyde, as well as for a fatty
acyl-CoA/aldehyde reductase to yield an alcohol. The aldehyde
produced by the action of the fatty acyl-CoA reductase identified
above is the substrate for further enzymatic activity by either a
fatty aldehyde reductase to yield an alcohol, or a fatty aldehyde
decarbonylase to yield an alkane or alkene.
[0244] In some embodiments, fatty acids, glycerolipids, or the
corresponding primary alcohols, aldehydes, alkanes or alkenes,
generated by the methods described herein, contain 8, 10, 12, or 14
carbon atoms. Preferred fatty acids for the production of diesel,
biodiesel, renewable diesel, or jet fuel, or the corresponding
primary alcohols, aldehydes, alkanes and alkenes, for industrial
applications contain 8 to 14 carbon atoms. In certain embodiments,
the above fatty acids, as well as the other corresponding
hydrocarbon molecules, are saturated (with no carbon-carbon double
or triple bonds); mono unsaturated (single double bond); poly
unsturated (two or more double bonds); are linear (not cyclic) or
branched. For fuel production, greater saturation is preferred.
[0245] The enzymes described directly above have a preferential
specificity for hydrolysis of a substrate containing a specific
number of carbon atoms. For example, a fatty acyl-ACP thioesterase
may have a preference for cleaving a fatty acid having 12 carbon
atoms from the ACP. In some embodiments, the ACP and the
length-specific thioesterase may have an affinity for one another
that makes them particularly useful as a combination (e.g., the
exogenous ACP and thioesterase genes may be naturally co-expressed
in a particular tissue or organism from which they are derived).
Therefore, in various embodiments, the recombinant Prototheca cell
of the invention can contain an exogenous gene that encodes a
protein with specificity for catalyzing an enzymatic activity
(e.g., cleavage of a fatty acid from an ACP, reduction of an
acyl-CoA to an aldehyde or an alcohol, or conversion of an aldehyde
to an alkane) with regard to the number of carbon atoms contained
in the substrate. The enzymatic specificity can, in various
embodiments, be for a substrate having from 8 to 34 carbon atoms,
preferably from 8 to 18 carbon atoms, and more preferably from 8 to
14 carbon atoms. A preferred specificity is for a substrate having
fewer, i.e., 12, rather than more, i.e., 18, carbon atoms.
[0246] Other fatty acyl-ACP thioesterases suitable for use with the
microbes and methods of the invention include, without limitation,
those listed in Table 4.
TABLE-US-00004 TABLE 4 Fatty acyl-ACP thioesterases and GenBank
accession numbers. Umbellularia californica fatty acyl-ACP
thioesterase (GenBank #AAC49001) Cinnamomum camphora fatty acyl-ACP
thioesterase (GenBank #Q39473) Umbellularia californica fatty
acyl-ACP thioesterase (GenBank #Q41635) Myristica fragrans fatty
acyl-ACP thioesterase (GenBank #AAB71729) Myristica fragrans fatty
acyl-ACP thioesterase (GenBank #AAB71730) Elaeis guineensis fatty
acyl-ACP thioesterase (GenBank #ABD83939) Elaeis guineensis fatty
acyl-ACP thioesterase (GenBank #AAD42220) Elaeis guineensis fatty
acyl-ACP thioesterase (GenBank#AAD42220.2) Populus tomentosa fatty
acyl-ACP thioesterase (GenBank #ABC47311) Arabidopsis thaliana
fatty acyl-ACP thioesterase (GenBank #NP_172327) Arabidopsis
thaliana fatty acyl-ACP thioesterase (GenBank #CAA85387)
Arabidopsis thaliana fatty acyl-ACP thioesterase (GenBank
#CAA85388) Gossypium hirsutum fatty acyl-ACP thioesterase (GenBank
#Q9SQI3) Cuphea lanceolata fatty acyl-ACP thioesterase (GenBank
#CAA54060) Cuphea hookeriana fatty acyl-ACP thioesterase (GenBank
#AAC72882) Cuphea calophylla subsp. mesostemon fatty acyl-ACP
thioesterase (GenBank #ABB71581) Cuphea lanceolata fatty acyl-ACP
thioesterase (GenBank #CAC19933) Elaeis guineensis fatty acyl-ACP
thioesterase (GenBank #AAL15645) Cuphea hookeriana fatty acyl-ACP
thioesterase (GenBank #Q39513) Cuphea hookeriana fatty acyl-ACP
thioesterase (GenBank#Q39513.1) Gossypium hirsutum fatty acyl-ACP
thioesterase (GenBank #AAD01982) Vitis vinifera fatty acyl-ACP
thioesterase (GenBank #CAN81819) Garcinia mangostana fatty acyl-ACP
thioesterase (GenBank #AAB51525) Garcinia mangostana fatty acyl-ACP
thioestease (GenBank#AAB51525.1) Brassica juncea fatty acyl-ACP
thioesterase (GenBank #ABI18986) Madhuca longifolia fatty acyl-ACP
thioesterase (GenBank #AAX51637) Brassica napus fatty acyl-ACP
thioesterase (GenBank #ABH11710) Brassica napus fatty acyl-ACP
thioesterase (GenBank#CAA52070.1) Oryza sativa (indica
cultivar-group) fatty acyl-ACP thioesterase (GenBank #EAY86877)
Oryza sativa (japonica cultivar-group) fatty acyl-ACP thioesterase
(GenBank #NP_001068400) Oryza sativa (indica cultivar-group) fatty
acyl-ACP thioesterase (GenBank #EAY99617) Cuphea hookeriana fatty
acyl-ACP thioesterase (GenBank #AAC49269) Ulmus Americana fatty
acyl-ACP thioesterase (GenBank #AAB71731) Cuphea lanceolata fatty
acyl-ACP thioesterase (GenBank #CAB60830) Cuphea palustris fatty
acyl-ACP thioesterase (GenBank #AAC49180) Iris germanica fatty
acyl-ACP thioesterase (GenBank #AAG43858) Iris germanica fatty
acyl-ACP thioesterase (GenBank #AAG43858.1) Cuphea palustris fatty
acyl-ACP thioesterase (GenBank #AAC49179) Myristica fragrans fatty
acyl-ACP thioesterase (GenBank# AAB71729) Myristica fragrans fatty
acyl-ACP thioesterase (GenBank# AAB717291.1) Cuphea hookeriana
fatty acyl-ACP thioesterase (GenBank #U39834) Umbelluaria
californica fatty acyl-ACP thioesterase (GenBank # M94159)
Cinnamomum camphora fatty acyl-ACP thioesterase (GenBank #U31813)
Ricinus communis fatty acyl-ACP thioesterase
(GenBank#ABS30422.1)
[0247] Examples below describe the successful targeting and
expression of heterologous fatty acyl-ACP thioesterases from Cuphea
hookeriana, Umbellularia californica, Cinnamomun camphora, Cuphea
palustris, Cuphea lanceolata, Iris germanica, Myristica fragrans,
Garcinia mangostana, Elaeis guiniensis, Brassica napus, Ricinus
communis and Ulmus americana in Prototheca species. Additionally,
alterations in fatty acid profiles were confirmed in the host cells
expressing these heterologous fatty acyl-ACP thioesterases. As
shown in the Examples, the expression of these heterologous
thioesterases in Prototheca generates a transgenic microalgae that
is able to produce oil/lipids with truly unique fatty acid profiles
that are currently not available from commercial seed crops, even
through the blending of several seed crop oils. Table 5 shows the
fatty acid profiles of common commercial seed oils. All commercial
seed oil data below were compiled from the US Pharmacopeias Food
and Chemicals Codes, 7.sup.th Ed. 2010-2011. Tallow data is from
the National Research Council: Fat Content and Composition of
Animal Products (1976).
TABLE-US-00005 TABLE 5 Lipid profiles of commercial seed oils.
C18:0- C18:1- C8:0 C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 diOH OH
C18:2 C18:3 .alpha. R. communis 0 0 0 0 0.9-1.6 1.0-1.8 3.7-6.7
0.4-1.3 83.6-89.0 0 0.2-0.6 (Castor oil) C. nucifera 5.0-9.0
4.0-8.0 44-52 15-21 8.0-11.0 1.0-4.0 5.0-8.0 0 0 0-2.5 0 (Coconut
oil) Z. mays 0 0 0 <1.0 8.0-19.0 0.5-4.0 19-50 0 0 38-65 <2.0
(Corn oil) G. barbadense 0 0 <0.1 0.5-2.0 17-29 1.0-4.0 13-44 0
0 40-63 0.1-2.1 (Cottonseed oil) B. rapa, B 0 0 <0.1 <0.2
<6.0 <2.5 >50 0 0 <40 <14 napus, B. juncea (Canola)
O. europea 0 0 0 <0.1 6.5-20.0 0.5-5.0 56-85 0 0 3.5-20.0
<1.2 (Olive) A. hypogaea 0 0 <0.1 <0.2 7.0-16.0 1.3-6.5
35-72 0 0 13.0-43 <0.6 (Peanut) E. guineensis 3.0-5.0 2.5-6.0
40-52 14.0-18.0 7.0-10.0 1.0-3.0 11.0-19.0 0 0 0.5-4.0 0 (Palm
kernel) E. guineensis 0 0 0 0.5-5.9 32.0-47.0 2.0-8.0 34-44 0 0
7.2-12.0 0 (Palm) C. tinctorus 0 0 <0.1 <0.1 2.0-10.0
1.0-10.0 7.0-16.0 0 0 72-81 <1.5 (Safflower) H. annus 0 0
<0.1 <0.5 3.0-10.0 1.0-10.0 14-65 0 0 20-75 <0.5
(Sunflower) G. max 0 0 <0.1 <0.5 7.0-12.0 2.0-5.5 19-30 0 0
48-65 5.0-10.0 (Soybean) L. 0 0 <0.1 <0.5 2.0-9.0 2.0-5.0
8.0-60 0 0 40-80 <5.0 usitatissimum (Solin-Flax) B. parkii 0 0 0
0 3.8-4.1 41.2-56.8 34.0-46.9 0 0 3.7-6.5 0 (Sheanut) Tallow 4 26
14 41 3 1
[0248] As an example, none of these common seed oils contain high
amounts of C8 or C10 fatty acids, with coconut oil and palm kernel
oil being the largest sources, but both having a ratio of about 1:1
(C8:C10 fatty acids). As shown in the Examples, Prototheca
transformed with Cuphea palustris C:8 preferring thioesterase was
able to achieve not only a C8 fatty acid levels of over 12%, but
also, the ratio of C8:C10 fatty acids was about 5:1. Changes in
fatty acid levels are useful for producing oils containing a
tailored fatty acid profile for a variety of commercial
applications. Additionally, changes of ratios between different
fatty acid chain lengths is something has not been available
commercially in oils that have not undergone further costly
chemical processes (such as esterification, distillation,
fractionation, and re-esterification). As another example, palm oil
is the highest C16:0 fatty acid (32-47%) containing oil, but palm
oil has very little C14:0 fatty acids. Prototheca containing the U.
americana thioesterase achieved about 33-38% C16:0 fatty acids and
about a 10-16% C14:0 fatty acids (about a 2:1 C16:0 to C14:0
ratio). This fatty acid profile has been commercially impractical
through blending of existing oils at a commercial level because the
seed oils that are high in 16:0 fatty acids usually do not contain
much 14:0 fatty acids.
[0249] The Examples below also describe, the successful targeting
and expression of at least two fatty acyl-ACP thioesterases in one
clone. The alterations in the fatty acid profiles were confirmed in
these clones and depending on which two thioesterases were
co-expressed in one clone, the fatty acid profiles were impacted in
different ways. As an example, from Table 5 above, both coconut oil
and palm kernel oil have C12:C14 ratios of roughly 3:1. As
described in the Examples below, a Prototheca transformant
containing two heterologous thioesterase genes was able to produce
C12:C14 fatty acid levels at a ratio of roughly 5:1. This kind of
ratio of C12:C14 fatty acids has been commercially impractical
(i.e., through blending of seed oils).
[0250] Another novel aspect of the oils produced by transgenic
microalgae is the degree of saturation of the fatty acids. Palm oil
is currently the largest source of saturated oil, with a total
saturates to unsaturates of 52% to 48%. As shown in the Examples
below, Prototheca with heterologous thioesterases from U. americana
and C. camphora achieved total saturates levels of over 60% in the
oil that it produced. Also shown in the Examples below, Prototheca
with heterologous thioesterase from U. americana achieved total
saturates level of over 86% in the oil that it produced.
[0251] Fatty acyl-CoA/aldehyde reductases suitable for use with the
microbes and methods of the invention include, without limitation,
those listed in Table 6.
TABLE-US-00006 TABLE 6 Fatty acyl-CoA/aldehyde reductases listed by
GenBank accession numbers. AAC45217, YP_047869, BAB85476,
YP_001086217, YP_580344, YP_001280274, YP_264583, YP_436109,
YP_959769, ZP_01736962, ZP_01900335, ZP_01892096, ZP_01103974,
ZP_01915077, YP_924106, YP_130411, ZP_01222731, YP_550815,
YP_983712, YP_001019688, YP_524762, YP_856798, ZP_01115500,
YP_001141848, NP_336047, NP_216059, YP_882409, YP_706156,
YP_001136150, YP_952365, ZP_01221833, YP_130076, NP_567936,
AAR88762, ABK28586, NP_197634, CAD30694, NP_001063962, BAD46254,
NP_001030809, EAZ10132, EAZ43639, EAZ07989, NP_001062488, CAB88537,
NP_001052541, CAH66597, CAE02214, CAH66590, CAB88538, EAZ39844,
AAZ06658, CAA68190, CAA52019, and BAC84377
[0252] Fatty acyl-CoA reductases suitable for use with the microbes
and methods of the invention include, without limitation, those
listed in Table 7.
TABLE-US-00007 TABLE 7 Fatty acyl-CoA reductases listed by GenBank
accession numbers. NP_187805, ABO14927, NP_001049083, CAN83375,
NP_191229, EAZ42242, EAZ06453, CAD30696, BAD31814, NP_190040,
AAD38039, CAD30692, CAN81280, NP_197642, NP_190041, AAL15288, and
NP_190042
[0253] Fatty aldehyde decarbonylases suitable for use with the
microbes and methods of the invention include, without limitation,
those listed in Table 8.
TABLE-US-00008 TABLE 8 Fatty aldehyde decarbonylases listed by
GenBank accession numbers. NP_850932, ABN07985, CAN60676, AAC23640,
CAA65199, AAC24373, CAE03390, ABD28319, NP_181306, EAZ31322,
CAN63491, EAY94825, EAY86731, CAL55686, XP_001420263, EAZ23849,
NP_200588, NP_001063227, CAN83072, AAR90847, and AAR97643
[0254] Combinations of naturally co-expressed fatty acyl-ACP
thioesterases and acyl carrier proteins are suitable for use with
the microbes and methods of the invention.
[0255] Additional examples of hydrocarbon or lipid modification
enzymes include amino acid sequences contained in, referenced in,
or encoded by nucleic acid sequences contained or referenced in,
any of the following U.S. Pat. Nos. 6,610,527; 6,451,576;
6,429,014; 6,342,380; 6,265,639; 6,194,185; 6,114,160; 6,083,731;
6,043,072; 5,994,114; 5,891,697; 5,871,988; 6,265,639, and further
described in GenBank Accession numbers: AAO18435; ZP_00513891;
Q38710; AAK60613; AAK60610; AAK60611; NP_113747; CAB75874;
AAK60612; AAF20201; BAA11024; AF205791; and CAA03710.
[0256] Other enzymes in the lipid biosynthetic pathways are also
suitable for use with microbes and methods of the invention. For
example, keto acyl-ACP synthase (Kas) enzymes work in conjunction
with some of the above listed enzymes in the lipid biosynthetic
pathway. There different classes of Kas enzymes: Kas I participates
in successive condensation steps between the ever-growing acyl ACP
chains and malonyl-ACP. Kas II typically participates in the final
condensation step leading from C16:0-ACP to C18:0-ACP incorporating
malonyl-ACP. As such, in higher plants and some microalgae
species/strains that synthesize predominantly C16-C18:0 fatty acids
(and their unsaturated derivatives), Kas II enzymes interact with
products of FatA genes (acyl-ACP thioesterases).
[0257] Acyl-ACP liberate growing fatty acid chains from ACP during
fatty acid biosynthesis, and in most plant species, this is carried
out by members of the FatA gene family, whose role is to terminate
elongation at the C16:0 to C18:0 stage. In species that synthesize
shorter chain fatty acids (such as Cuphea, Elaeis, Myristica, or
Umbellularia), a different group of acyl-ACP thioesterases encoded
by FatB genes carry out this termination step. The interaction
between Kas II enzymes and acyl-Acp thioesterases is important for
the correct termination of fatty acid chain elongation. As a
consequence, in higher plant species (and microalgal species) that
have evolved FatB genes capable of shorter chain lipid
biosynthesis, there has been a corresponding co-evolution of an
additional class of Kas genes, termed Kas IV genes. Kas IV genes
are responsible for chain length elongation of a specific size
range of fatty acids, 4-14 carbons in length.
[0258] Other suitable enzymes for use with the microbes and the
methods of the invention include those that have at least 70% amino
acid identity with one of the proteins listed in Tables 4, 6-8, and
that exhibit the corresponding desired enzymatic activity (e.g.,
cleavage of a fatty acid from an acyl carrier protein, reduction of
an acyl-CoA to an aldehyde or an alcohol, or conversion of an
aldehyde to an alkane). In additional embodiments, the enzymatic
activity is present in a sequence that has at least about 75%, at
least about 80%, at least about 85%, at least about 90%, at least
about 95%, or at least about 99% identity with one of the above
described sequences, all of which are hereby incorporated by
reference as if fully set forth.
[0259] By selecting the desired combination of exogenous genes to
be expressed, one can tailor the product generated by the microbe,
which may then be extracted from the aqueous biomass. For example,
the microbe can contain one or more of (i) an exogenous gene
encoding a fatty acyl-ACP thioesterase; and, optionally, (ii) a
naturally co-expressed acyl carrier protein or an acyl carrier
protein otherwise having affinity for the fatty acyl-ACP
thioesterase (or conversely); and, optionally, (iii) an exogenous
gene encoding a fatty acyl-CoA/aldehyde reductase or a fatty
acyl-CoA reductase; and, optionally, (iv) an exogenous gene
encoding a fatty aldehyde reductase or a fatty aldehyde
decarbonylase. The microbe can also contain one or more of an
exogenous stearoil ACP desturase, fatty acid destaurase,
.beta.-ketoacyl-ACP synthase I (e.g. as encoded by a KASI gene), a
.beta.-ketoacyl-ACP synthase II (e.g. as encoded by a KASII gene),
or oleate-12 hydroxylase. The microbe, under culture conditions
described herein, synthesizes a fatty acid linked to an ACP and the
fatty acyl-ACP thioesterase catalyzes the cleavage of the fatty
acid from the ACP to yield, through further enzymatic processing, a
fatty acyl-CoA molecule. When present, the fatty acyl-CoA/aldehyde
reducatase catalyzes the reduction of the acyl-CoA to an alcohol.
Similarly, the fatty acyl-CoA reductase, when present, catalyzes
the reduction of the acyl-CoA to an aldehyde. In those embodiments
in which an exogenous gene encoding a fatty acyl-CoA reductase is
present and expressed to yield an aldehyde product, a fatty
aldehyde reductase, encoded by the third exogenous gene, catalyzes
the reduction of the aldehyde to an alcohol. Similarly, a fatty
aldehyde decarbonylase catalyzes the conversion of the aldehyde to
an alkane or an alkene, when present.
[0260] In another embodiment, the microbe can contain: (i) an
exogenous gene encoding a fatty acyl-ACP thioesterase; (ii)
optionally, a naturally co-expressed acyl carrier protein or an
acyl carrier protein having affinity for the fatty acid acyl-ACP
thioesterase; (iii) a mutated endogenous desaturase gene, wherein
the mutation renders the desaturase gene or desaturase protein
inactive, such as a desaturase knockout or a desturase suppression
element such as a targeted RNAi, antisense or dsRNA construct; (iv)
overexpression of an endogenous stearoyl acyl carrier protein
desaturase or the expression of a heterologous SAD; and (v) any
combination of the foregoing.
[0261] Genes encoding such enzymes, such as fatty acyl ACP
thioesterases, can be obtained from cells already known to exhibit
significant lipid production such as Chlorella protothecoides.
Genes already known to have a role in lipid production, e.g., a
gene encoding an enzyme that saturates double bonds, can be
transformed individually into recipient cells. However, to practice
the invention it is not necessary to make a priori assumptions as
to which genes are required. Methods for identifying genes that can
alter (improve) lipid production in microalgae are described in PCT
Pub. No. 2008/151149.
[0262] Thus, the present invention provides a Prototheca cell that
has been genetically engineered to express a lipid pathway enzyme
at an altered level compared to a wild-type cell of the same
species. In some cases, the cell produces more lipid compared to
the wild-type cell when both cells are grown under the same
conditions. In some cases, the cell has been genetically engineered
and/or selected to express a lipid pathway enzyme at a higher level
or a lower level than the wild-type cell. In some cases, the lipid
pathway enzyme is selected from the group consisting of pyruvate
dehydrogenase, acetyl-CoA carboxylase, acyl carrier protein, and
glycerol-3 phosphate acyltransferase. In some cases, the cell has
been genetically engineered and/or selected to express a lipid
pathway enzyme at a lower level than the wild-type cell. In at
least one embodiment in which the cell expresses the lipid pathway
enzyme at a lower level, the lipid pathway enzyme comprises citrate
synthase.
[0263] In some embodiments, the cell has been genetically
engineered and/or selected to express a global regulator of fatty
acid synthesis at an altered level compared to the wild-type cell,
whereby the expression levels of a plurality of fatty acid
synthetic genes are altered compared to the wild-type cell. In some
cases, the lipid pathway enzyme comprises an enzyme that modifies a
fatty acid. In some cases, the lipid pathway enzyme is selected
from a stearoyl-ACP desaturase and a glycerolipid desaturase. In
some cases, the cell has been genetically engineered and/or
selected to express a lower level of a lipid pathway enzyme, or not
to express a specific lipid pathway enzyme at all (i.e., wherein a
lipid pathway enzyme has been knockout, replaced with an exogenous
gene, or expression has been reduced using RNAi or antisense
methods). In another embodiment, the lipid pathway enzyme is the
heterologous expression of a desaturase gene, including but not
limited to a stearoyl-ACP desaturase or a fatty acid desaturase
(FAD). Example 6 describes the expression of a heterologous
stearoyl-ACP from Olea europaea in a Prototheca moriformis genetic
background.
[0264] In other embodiments, the present invention is directed to
an oil-producing microbe containing one or more exogenous genes,
wherein the exogenous genes encode protein(s) selected from the
group consisting of a fatty acyl-ACP thioesterase, a fatty acyl-CoA
reductase, a fatty aldehyde reductase, a fatty acyl-CoA/aldehyde
reductase, a fatty aldehyde decarbonylase, a desaturase, and an
acyl carrier protein. In another embodiment, an endogenous
desaturase gene is overexpressed in a microbe containing one or
more of the above exogenous genes. In one embodiment, the exogenous
gene is in operable linkage with a promoter, which is inducible or
repressible in response to a stimulus. In some cases, the stimulus
is selected from the group consisting of an exogenously provided
small molecule, heat, cold, and limited or no nitrogen in the
culture media. In some cases, the exogenous gene is expressed in a
cellular compartment. In some embodiments, the cellular compartment
is selected from the group consisting of a chloroplast, a plastid
and a mitochondrion. In some embodiments the microbe is Prototheca
moriformis, Prototheca krugani, Prototheca stagnora or Prototheca
zopfii.
[0265] In one embodiment, the exogenous gene encodes a fatty acid
acyl-ACP thioesterase. In some cases, the thioesterase encoded by
the exogenous gene catalyzes the cleavage of an 8 to 18-carbon
fatty acid from an acyl carrier protein (ACP). In some cases, the
thioesterase encoded by the exogenous gene catalyzes the cleavage
of a 10 to 14-carbon fatty acid from an ACP. In one embodiment, the
thioesterase encoded by the exogenous gene catalyzes the cleavage
of a 12-carbon fatty acid from an ACP.
[0266] In one embodiment, the exogenous gene encodes a fatty
acyl-CoA/aldehyde reductase. In some cases, the reductase encoded
by the exogenous gene catalyzes the reduction of an 8 to 18-carbon
fatty acyl-CoA to a corresponding primary alcohol. In some cases,
the reductase encoded by the exogenous gene catalyzes the reduction
of a 10 to 14-carbon fatty acyl-CoA to a corresponding primary
alcohol. In one embodiment, the reductase encoded by the exogenous
gene catalyzes the reduction of a 12-carbon fatty acyl-CoA to
dodecanol.
[0267] The present invention also provides a recombinant Prototheca
or other cell containing two exogenous genes, wherein a first
exogenous gene encodes a fatty acyl-ACP thioesterase and a second
exogenous gene encodes a protein selected from the group consisting
of a fatty acyl-CoA reductase, a fatty acyl-CoA/aldehyde reductase,
and an acyl carrier protein. In some cases, the two exogenous genes
are each in operable linkage with a promoter, which is inducible in
response to a stimulus. In some cases, each promoter is inducible
in response to an identical stimulus, such as limited or no
nitrogen in the culture media. Limitation or complete lack of
nitrogen in the culture media stimulates oil production in some
microorganisms such as Prototheca species, and can be used as a
trigger to induce oil production to high levels. When used in
combination with the genetic engineering methods disclosed herein,
the lipid as a percentage of dry cell weight can be pushed to high
levels such as at least 30%, at least 40%, at least 50%, at least
60%, at least 70% at least 75%, at least 80%, at least 85% or
between 75 to 90%; methods disclosed herein provide for cells with
these levels of lipid, wherein the lipid is at least 4% C8-C14, at
least 0.3% C8, at least 2% C10, at least 2% C12, and at least 2%
C14. In some embodiments the cells are over 25% lipid by dry cell
weight and contain lipid that is at least 10% C8-C14, at least 20%
C8-C14, at least 30% C8-C14, 10-30% C8-C14 and 20-30% C8-C14.
[0268] The novel oils disclosed herein are distinct from other
naturally occurring oils that are high in mid-chain fatty acids,
such as palm oil, palm kernel oil, and coconut oil. For example,
levels of contaminants such as carotenoids are far higher in palm
oil and palm kernel oil than in the oils of the invention. Palm and
palm kernel oils in particular contain alpha and beta carotenes and
lycopene in much higher amounts than is in the oils of the
invention. In addition, over 20 different carotenoids are found in
palm and palm kernel oil, whereas the Examples demonstrate that the
oils of the invention contain very few carotenoids species and very
low levels. In addition, the levels of vitamin E compounds such as
tocotrienols are far higher in palm, palm kernel, and coconut oil
than in the oils of the invention.
[0269] In one embodiment, the thioesterase encoded by the first
exogenous gene catalyzes the cleavage of an 8 to 18-carbon fatty
acid from an ACP. In some embodiments, the second exogenous gene
encodes a fatty acyl-CoA/aldehyde reductase which catalyzes the
reduction of an 8 to 18-carbon fatty acyl-CoA to a corresponding
primary alcohol. In some cases, the thioesterase encoded by the
first exogenous gene catalyzes the cleavage of a 10 to 14-carbon
fatty acid from an ACP, and the reductase encoded by the second
exogenous gene catalyzes the reduction of a 10 to 14-carbon fatty
acyl-CoA to the corresponding primary alcohol, wherein the
thioesterase and the reductase act on the same carbon chain length.
In one embodiment, the thioesterase encoded by the first exogenous
gene catalyzes the cleavage of a 12-carbon fatty acid from an ACP,
and the reductase encoded by the second exogenous gene catalyzes
the reduction of a 12-carbon fatty acyl-CoA to dodecanol. In some
embodiments, the second exogenous gene encodes a fatty acyl-CoA
reductase which catalyzes the reduction of an 8 to 18-carbon fatty
acyl-CoA to a corresponding aldehyde. In some embodiments, the
second exogenous gene encodes an acyl carrier protein that is
naturally co-expressed with the fatty acyl-ACP thioesterase.
[0270] In some embodiments, the second exogenous gene encodes a
fatty acyl-CoA reductase, and the microbe further contains a third
exogenous gene encoding a fatty aldehyde decarbonylase. In some
cases, the thioesterase encoded by the first exogenous gene
catalyzes the cleavage of an 8 to 18-carbon fatty acid from an ACP,
the reductase encoded by the second exogenous gene catalyzes the
reduction of an 8 to 18-carbon fatty acyl-CoA to a corresponding
fatty aldehyde, and the decarbonylase encoded by the third
exogenous gene catalyzes the conversion of an 8 to 18-carbon fatty
aldehyde to a corresponding alkane, wherein the thioesterase, the
reductase, and the decarbonylase act on the same carbon chain
length.
[0271] In some embodiments, the second exogenous gene encodes an
acyl carrier protein, and the microbe further contains a third
exogenous gene encoding a protein selected from the group
consisting of a fatty acyl-CoA reductase and a fatty
acyl-CoA/aldehyde reductase. In some cases, the third exogenous
gene encodes a fatty acyl-CoA reductase, and the microbe further
contains a fourth exogenous gene encoding a fatty aldehyde
decarbonylase.
[0272] The present invention also provides methods for producing an
alcohol comprising culturing a population of recombinant Prototheca
cells in a culture medium, wherein the cells contain (i) a first
exogenous gene encoding a fatty acyl-ACP thioesterase, and (ii) a
second exogenous gene encoding a fatty acyl-CoA/aldehyde reductase,
and the cells synthesize a fatty acid linked to an acyl carrier
protein (ACP), the fatty acyl-ACP thioesterase catalyzes the
cleavage of the fatty acid from the ACP to yield, through further
processing, a fatty acyl-CoA, and the fatty acyl-CoA/aldehyde
reductase catalyzes the reduction of the acyl-CoA to an
alcohol.
[0273] The present invention also provides methods of producing a
lipid molecule in a Prototheca cell. In one embodiment, the method
comprises culturing a population of Prototheca cells in a culture
medium, wherein the cells contain (i) a first exogenous gene
encoding a fatty acyl-ACP thioesterase, and (ii) a second exogenous
gene encoding a fatty acyl-CoA reductase, and wherein the microbes
synthesize a fatty acid linked to an acyl carrier protein (ACP),
the fatty acyl-ACP thioesterase catalyzes the cleavage of the fatty
acid from the ACP to yield, through further processing, a fatty
acyl-CoA, and the fatty acyl-CoA reductase catalyzes the reduction
of the acyl-CoA to an aldehyde.
[0274] The present invention also provides methods of producing a
fatty acid molecule having a specified carbon chain length in a
Prototheca cell. In one embodiment, the method comprises culturing
a population of lipid-producing Prototheca cells in a culture
medium, wherein the microbes contain an exogenous gene encoding a
fatty acyl-ACP thioesterase having an activity specific or
preferential to a certain carbon chain length, such as 8, 10, 12 or
14 carbon atoms, and wherein the microbes synthesize a fatty acid
linked to an acyl carrier protein (ACP) and the thioesterase
catalyzes the cleavage of the fatty acid from the ACP when the
fatty acid has been synthesized to the specific carbon chain
length.
[0275] In the various embodiments described above, the Prototheca
cell can contain at least one exogenous gene encoding a lipid
pathway enzyme or a suppression element such as an RNA interference
element that suppresses expression of the gene product. In some
cases, the lipid pathway enzyme is selected from the group
consisting of a stearoyl-ACP desaturase, a glycerolipid desaturase,
a pyruvate dehydrogenase, an acetyl-CoA carboxylase, an acyl
carrier protein, and a glycerol-3 phosphate acyltransferase. In
other cases, the Prototheca cell contains a lipid modification
enzyme selected from the group consisting of a fatty acyl-ACP
thioesterase, a fatty acyl-CoA/aldehyde reductase, a fatty acyl-CoA
reductase, a fatty aldehyde reductase, a fatty aldehyde
decarbonylase, and/or an acyl carrier protein.
[0276] The present invention also provides for a microbial cell
that contains a heterologous gene that encodes a hydroxylase that
generates a hydroxylated fatty acid. The microbial cell may
comprise a type II fatty acid synthesis pathway. For example, the
microbial cell may be a microalgal cell. In some embodiments, the
microalgal cell is selected from the microalgal cells listed in
Table 1 above. In other embodiments the microalgal cell is of the
genus Prototheca. In still other embodiments, the microalgal cell
is Prototheca moriformis. Hydroxylases are enzymes that adds a
hydroxyl group (--OH) onto a substrate. Fatty acid hydroxylases are
naturally occurring enzymes found in some higher plants. A
non-limiting example of a naturally occurring hydroxylase found in
a higher plant is the oleate 12-hydroxylase from Ricinus communis
which is responsible for the production of ricinoleic acid. Example
7 describes an example of the heterologous expression of a
hydroxylase in Prototheca cells, specifically, the expression of
Ricinus communis oleate 12-hydroxlase in Prototheca moriformis
cells.
VI. FUELS AND CHEMICALS PRODUCTION
[0277] For the production of fuel in accordance with the methods of
the invention lipids produced by cells of the invention are
harvested, or otherwise collected, by any convenient means. Lipids
can be isolated by whole cell extraction. The cells are first
disrupted, and then intracellular and cell membrane/cell
wall-associated lipids as well as extracellular hydrocarbons can be
separated from the cell mass, such as by use of centrifugation as
described above. Intracellular lipids produced in microorganisms
are, in some embodiments, extracted after lysing the cells of the
microorganism. Once extracted, the lipids are further refined to
produce oils, fuels, or oleochemicals.
[0278] After completion of culturing, the microorganisms can be
separated from the fermentation broth. Optionally, the separation
is effected by centrifugation to generate a concentrated paste.
Centrifugation does not remove significant amounts of intracellular
water from the microorganisms and is not a drying step. The biomass
can then optionally be washed with a washing solution (e.g., DI
water) to get rid of the fermentation broth and debris. Optionally,
the washed microbial biomass may also be dried (oven dried,
lyophilized, etc.) prior to cell disruption. Alternatively, cells
can be lysed without separation from some or all of the
fermentation broth when the fermentation is complete. For example,
the cells can be at a ratio of less than 1:1 v:v cells to
extracellular liquid when the cells are lysed.
[0279] Microorganisms containing a lipid can be lysed to produce a
lysate. As detailed herein, the step of lysing a microorganism
(also referred to as cell lysis) can be achieved by any convenient
means, including heat-induced lysis, adding a base, adding an acid,
using enzymes such as proteases and polysaccharide degradation
enzymes such as amylases, using ultrasound, mechanical lysis, using
osmotic shock, infection with a lytic virus, and/or expression of
one or more lytic genes. Lysis is performed to release
intracellular molecules which have been produced by the
microorganism. Each of these methods for lysing a microorganism can
be used as a single method or in combination simultaneously or
sequentially. The extent of cell disruption can be observed by
microscopic analysis. Using one or more of the methods described
herein, typically more than 70% cell breakage is observed.
Preferably, cell breakage is more than 80%, more preferably more
than 90% and most preferred about 100%.
[0280] In particular embodiments, the microorganism is lysed after
growth, for example to increase the exposure of cellular lipid
and/or hydrocarbon for extraction or further processing. The timing
of lipase expression (e.g., via an inducible promoter) or cell
lysis can be adjusted to optimize the yield of lipids and/or
hydrocarbons. Below are described a number of lysis techniques.
These techniques can be used individually or in combination.
[0281] In one embodiment of the present invention, the step of
lysing a microorganism comprises heating of a cellular suspension
containing the microorganism. In this embodiment, the fermentation
broth containing the microorganisms (or a suspension of
microorganisms isolated from the fermentation broth) is heated
until the microorganisms, i.e., the cell walls and membranes of
microorganisms degrade or breakdown. Typically, temperatures
applied are at least 50.degree. C. Higher temperatures, such as, at
least 30.degree. C. at least 60.degree. C., at least 70.degree. C.,
at least 80.degree. C., at least 90.degree. C., at least
100.degree. C., at least 110.degree. C., at least 120.degree. C.,
at least 130.degree. C. or higher are used for more efficient cell
lysis. Lysing cells by heat treatment can be performed by boiling
the microorganism. Alternatively, heat treatment (without boiling)
can be performed in an autoclave. The heat treated lysate may be
cooled for further treatment. Cell disruption can also be performed
by steam treatment, i.e., through addition of pressurized steam.
Steam treatment of microalgae for cell disruption is described, for
example, in U.S. Pat. No. 6,750,048. In some embodiments, steam
treatment may be achieved by sparging steam into the fermentor and
maintaining the broth at a desired temperature for less than about
90 minutes, preferably less than about 60 minutes, and more
preferably less than about 30 minutes.
[0282] In another embodiment of the present invention, the step of
lysing a microorganism comprises adding a base to a cellular
suspension containing the microorganism. The base should be strong
enough to hydrolyze at least a portion of the proteinaceous
compounds of the microorganisms used. Bases which are useful for
solubilizing proteins are known in the art of chemistry. Exemplary
bases which are useful in the methods of the present invention
include, but are not limited to, hydroxides, carbonates and
bicarbonates of lithium, sodium, potassium, calcium, and mixtures
thereof. A preferred base is KOH. Base treatment of microalgae for
cell disruption is described, for example, in U.S. Pat. No.
6,750,048.
[0283] In another embodiment of the present invention, the step of
lysing a microorganism comprises adding an acid to a cellular
suspension containing the microorganism. Acid lysis can be effected
using an acid at a concentration of 10-500 mN or preferably 40-160
nM. Acid lysis is preferably performed at above room temperature
(e.g., at 40-160.degree., and preferably a temperature of 50-1300.
For moderate temperatures (e.g., room temperature to 100.degree. C.
and particularly room temperature to 650, acid treatment can
usefully be combined with sonication or other cell disruption
methods.
[0284] In another embodiment of the present invention, the step of
lysing a microorganism comprises lysing the microorganism by using
an enzyme. Preferred enzymes for lysing a microorganism are
proteases and polysaccharide-degrading enzymes such as
hemicellulase (e.g., hemicellulase from Aspergillus niger; Sigma
Aldrich, St. Louis, Mo.; #H2125), pectinase (e.g., pectinase from
Rhizopus sp.; Sigma Aldrich, St. Louis, Mo.; #P2401), Mannaway 4.0
L (Novozymes), cellulase (e.g., cellulose from Trichoderma viride;
Sigma Aldrich, St. Louis, Mo.; #C9422), and driselase (e.g.,
driselase from Basidiomycetes sp.; Sigma Aldrich, St. Louis, Mo.;
#D9515.
[0285] In other embodiments of the present invention, lysis is
accomplished using an enzyme such as, for example, a cellulase such
as a polysaccharide-degrading enzyme, optionally from Chlorella or
a Chlorella virus, or a proteases, such as Streptomyces griseus
protease, chymotrypsin, proteinase K, proteases listed in
Degradation of Polylactide by Commercial Proteases, Oda Y et al.,
Journal of Polymers and the Environment, Volume 8, Number 1,
January 2000, pp. 29-32(4), Alcalase 2.4 FG (Novozymes), and
Flavourzyme 100 L (Novozymes). Any combination of a protease and a
polysaccharide-degrading enzyme can also be used, including any
combination of the preceding proteases and polysaccharide-degrading
enzymes.
[0286] In another embodiment, lysis can be performed using an
expeller press. In this process, biomass is forced through a
screw-type device at high pressure, lysing the cells and causing
the intracellular lipid to be released and separated from the
protein and fiber (and other components) in the cell.
[0287] In another embodiment of the present invention, the step of
lysing a microorganism is performed by using ultrasound, i.e.,
sonication. Thus, cells can also by lysed with high frequency
sound. The sound can be produced electronically and transported
through a metallic tip to an appropriately concentrated cellular
suspension. This sonication (or ultrasonication) disrupts cellular
integrity based on the creation of cavities in cell suspension.
[0288] In another embodiment of the present invention, the step of
lysing a microorganism is performed by mechanical lysis. Cells can
be lysed mechanically and optionally homogenized to facilitate
hydrocarbon (e.g., lipid) collection. For example, a pressure
disrupter can be used to pump a cell containing slurry through a
restricted orifice valve. High pressure (up to 1500 bar) is
applied, followed by an instant expansion through an exiting
nozzle. Cell disruption is accomplished by three different
mechanisms: impingement on the valve, high liquid shear in the
orifice, and sudden pressure drop upon discharge, causing an
explosion of the cell. The method releases intracellular molecules.
Alternatively, a ball mill can be used. In a ball mill, cells are
agitated in suspension with small abrasive particles, such as
beads. Cells break because of shear forces, grinding between beads,
and collisions with beads. The beads disrupt the cells to release
cellular contents. Cells can also be disrupted by shear forces,
such as with the use of blending (such as with a high speed or
Waring blender as examples), the french press, or even
centrifugation in case of weak cell walls, to disrupt cells.
[0289] In another embodiment of the present invention, the step of
lysing a microorganism is performed by applying an osmotic
shock.
[0290] In another embodiment of the present invention, the step of
lysing a microorganism comprises infection of the microorganism
with a lytic virus. A wide variety of viruses are known to lyse
microorganisms suitable for use in the present invention, and the
selection and use of a particular lytic virus for a particular
microorganism is within the level of skill in the art. For example,
paramecium bursaria chlorella virus (PBCV-1) is the prototype of a
group (family Phycodnaviridae, genus Chlorovirus) of large,
icosahedral, plaque-forming, double-stranded DNA viruses that
replicate in, and lyse, certain unicellular, eukaryotic
chlorella-like green algae. Accordingly, any susceptible microalgae
can be lysed by infecting the culture with a suitable chlorella
virus. Methods of infecting species of Chlorella with a chlorella
virus are known. See for example Adv. Virus Res. 2006; 66:293-336;
Virology, 1999 Apr. 25; 257(1):15-23; Virology, 2004 Jan. 5;
318(1):214-23; Nucleic Acids Symp. Ser. 2000; (44):161-2; J. Virol.
2006 March; 80(5):2437-44; and Annu. Rev. Microbiol. 1999;
53:447-94.
[0291] In another embodiment of the present invention, the step of
lysing a microorganism comprises autolysis. In this embodiment, a
microorganism according to the invention is genetically engineered
to produce a lytic protein that will lyse the microorganism. This
lytic gene can be expressed using an inducible promoter so that the
cells can first be grown to a desirable density in a fermentor,
followed by induction of the promoter to express the lytic gene to
lyse the cells. In one embodiment, the lytic gene encodes a
polysaccharide-degrading enzyme. In certain other embodiments, the
lytic gene is a gene from a lytic virus. Thus, for example, a lytic
gene from a Chlorella virus can be expressed in an algal cell; see
Virology 260, 308-315 (1999); FEMS Microbiology Letters 180 (1999)
45-53; Virology 263, 376-387 (1999); and Virology 230, 361-368
(1997). Expression of lytic genes is preferably done using an
inducible promoter, such as a promoter active in microalgae that is
induced by a stimulus such as the presence of a small molecule,
light, heat, and other stimuli.
[0292] Various methods are available for separating lipids from
cellular lysates produced by the above methods. For example, lipids
and lipid derivatives such as fatty aldehydes, fatty alcohols, and
hydrocarbons such as alkanes can be extracted with a hydrophobic
solvent such as hexane (see Frenz et al. 1989, Enzyme Microb.
Technol., 11:717). Lipids and lipid derivatives can also be
extracted using liquefaction (see for example Sawayama et al. 1999,
Biomass and Bioenergy 17:33-39 and Inoue et al. 1993, Biomass
Bioenergy 6(4):269-274); oil liquefaction (see for example Minowa
et al. 1995, Fuel 74(12):1735-1738); and supercritical CO.sub.2
extraction (see for example Mendes et al. 2003, Inorganica Chimica
Acta 356:328-334). Miao and Wu describe a protocol of the recovery
of microalgal lipid from a culture of Chlorella prototheocoides in
which the cells were harvested by centrifugation, washed with
distilled water and dried by freeze drying. The resulting cell
powder was pulverized in a mortar and then extracted with n-hexane.
Miao and Wu, Biosource Technology (2006) 97:841-846.
[0293] Thus, lipids, lipid derivatives and hydrocarbons generated
by the microorganisms of the present invention can be recovered by
extraction with an organic solvent. In some cases, the preferred
organic solvent is hexane. Typically, the organic solvent is added
directly to the lysate without prior separation of the lysate
components. In one embodiment, the lysate generated by one or more
of the methods described above is contacted with an organic solvent
for a period of time sufficient to allow the lipid and/or
hydrocarbon components to form a solution with the organic solvent.
In some cases, the solution can then be further refined to recover
specific desired lipid or hydrocarbon components. Hexane extraction
methods are well known in the art.
[0294] Lipids and lipid derivatives such as fatty aldehydes, fatty
alcohols, and hydrocarbons such as alkanes produced by cells as
described herein can be modified by the use of one or more enzymes,
including a lipase, as described above. When the hydrocarbons are
in the extracellular environment of the cells, the one or more
enzymes can be added to that environment under conditions in which
the enzyme modifies the hydrocarbon or completes its synthesis from
a hydrocarbon precursor. Alternatively, the hydrocarbons can be
partially, or completely, isolated from the cellular material
before addition of one or more catalysts such as enzymes. Such
catalysts are exogenously added, and their activity occurs outside
the cell or in vitro.
[0295] Thus, lipids and hydrocarbons produced by cells in vivo, or
enzymatically modified in vitro, as described herein can be
optionally further processed by conventional means. The processing
can include "cracking" to reduce the size, and thus increase the
hydrogen:carbon ratio, of hydrocarbon molecules. Catalytic and
thermal cracking methods are routinely used in hydrocarbon and
triglyceride oil processing. Catalytic methods involve the use of a
catalyst, such as a solid acid catalyst. The catalyst can be
silica-alumina or a zeolite, which result in the heterolytic, or
asymmetric, breakage of a carbon-carbon bond to result in a
carbocation and a hydride anion. These reactive intermediates then
undergo either rearrangement or hydride transfer with another
hydrocarbon. The reactions can thus regenerate the intermediates to
result in a self-propagating chain mechanism. Hydrocarbons can also
be processed to reduce, optionally to zero, the number of
carbon-carbon double, or triple, bonds therein. Hydrocarbons can
also be processed to remove or eliminate a ring or cyclic structure
therein. Hydrocarbons can also be processed to increase the
hydrogen:carbon ratio. This can include the addition of hydrogen
("hydrogenation") and/or the "cracking" of hydrocarbons into
smaller hydrocarbons.
[0296] Thermal methods involve the use of elevated temperature and
pressure to reduce hydrocarbon size. An elevated temperature of
about 800.degree. C. and pressure of about 700 kPa can be used.
These conditions generate "light," a term that is sometimes used to
refer to hydrogen-rich hydrocarbon molecules (as distinguished from
photon flux), while also generating, by condensation, heavier
hydrocarbon molecules which are relatively depleted of hydrogen.
The methodology provides homolytic, or symmetrical, breakage and
produces alkenes, which may be optionally enzymatically saturated
as described above.
[0297] Catalytic and thermal methods are standard in plants for
hydrocarbon processing and oil refining. Thus hydrocarbons produced
by cells as described herein can be collected and processed or
refined via conventional means. See Hillen et al. (Biotechnology
and Bioengineering, Vol. XXIV: 193-205 (1982)) for a report on
hydrocracking of microalgae-produced hydrocarbons. In alternative
embodiments, the fraction is treated with another catalyst, such as
an organic compound, heat, and/or an inorganic compound. For
processing of lipids into biodiesel, a transesterification process
is used as described below in this Section.
[0298] Hydrocarbons produced via methods of the present invention
are useful in a variety of industrial applications. For example,
the production of linear alkylbenzene sulfonate (LAS), an anionic
surfactant used in nearly all types of detergents and cleaning
preparations, utilizes hydrocarbons generally comprising a chain of
10-14 carbon atoms. See, for example, U.S. Pat. Nos. 6,946,430;
5,506,201; 6,692,730; 6,268,517; 6,020,509; 6,140,302; 5,080,848;
and 5,567,359. Surfactants, such as LAS, can be used in the
manufacture of personal care compositions and detergents, such as
those described in U.S. Pat. Nos. 5,942,479; 6,086,903; 5,833,999;
6,468,955; and 6,407,044.
[0299] Increasing interest is directed to the use of hydrocarbon
components of biological origin in fuels, such as biodiesel,
renewable diesel, and jet fuel, since renewable biological starting
materials that may replace starting materials derived from fossil
fuels are available, and the use thereof is desirable. There is an
urgent need for methods for producing hydrocarbon components from
biological materials. The present invention fulfills this need by
providing methods for production of biodiesel, renewable diesel,
and jet fuel using the lipids generated by the methods described
herein as a biological material to produce biodiesel, renewable
diesel, and jet fuel.
[0300] Traditional diesel fuels are petroleum distillates rich in
paraffinic hydrocarbons. They have boiling ranges as broad as
370.degree. to 780.degree. F., which are suitable for combustion in
a compression ignition engine, such as a diesel engine vehicle. The
American Society of Testing and Materials (ASTM) establishes the
grade of diesel according to the boiling range, along with
allowable ranges of other fuel properties, such as cetane number,
cloud point, flash point, viscosity, aniline point, sulfur content,
water content, ash content, copper strip corrosion, and carbon
residue. Technically, any hydrocarbon distillate material derived
from biomass or otherwise that meets the appropriate ASTM
specification can be defined as diesel fuel (ASTM D975), jet fuel
(ASTM D1655), or as biodiesel if it is a fatty acid methyl ester
(ASTM D6751).
[0301] After extraction, lipid and/or hydrocarbon components
recovered from the microbial biomass described herein can be
subjected to chemical treatment to manufacture a fuel for use in
diesel vehicles and jet engines.
[0302] Biodiesel is a liquid which varies in color--between golden
and dark brown--depending on the production feedstock. It is
practically immiscible with water, has a high boiling point and low
vapor pressure. Biodiesel refers to a diesel-equivalent processed
fuel for use in diesel-engine vehicles. Biodiesel is biodegradable
and non-toxic. An additional benefit of biodiesel over conventional
diesel fuel is lower engine wear. Typically, biodiesel comprises
C14-C18 alkyl esters. Various processes convert biomass or a lipid
produced and isolated as described herein to diesel fuels. A
preferred method to produce biodiesel is by transesterification of
a lipid as described herein. A preferred alkyl ester for use as
biodiesel is a methyl ester or ethyl ester.
[0303] Biodiesel produced by a method described herein can be used
alone or blended with conventional diesel fuel at any concentration
in most modern diesel-engine vehicles. When blended with
conventional diesel fuel (petroleum diesel), biodiesel may be
present from about 0.1% to about 99.9%. Much of the world uses a
system known as the "B" factor to state the amount of biodiesel in
any fuel mix. For example, fuel containing 20% biodiesel is labeled
B20. Pure biodiesel is referred to as B100.
[0304] Biodiesel can also be used as a heating fuel in domestic and
commercial boilers. Existing oil boilers may contain rubber parts
and may require conversion to run on biodiesel. The conversion
process is usually relatively simple, involving the exchange of
rubber parts for synthetic parts due to biodiesel being a strong
solvent. Due to its strong solvent power, burning biodiesel will
increase the efficiency of boilers. Biodiesel can be used as an
additive in formulations of diesel to increase the lubricity of
pure Ultra-Low Sulfur Diesel (ULSD) fuel, which is advantageous
because it has virtually no sulfur content. Biodiesel is a better
solvent than petrodiesel and can be used to break down deposits of
residues in the fuel lines of vehicles that have previously been
run on petrodiesel.
[0305] Biodiesel can be produced by transesterification of
triglycerides contained in oil-rich biomass. Thus, in another
aspect of the present invention a method for producing biodiesel is
provided. In a preferred embodiment, the method for producing
biodiesel comprises the steps of (a) cultivating a lipid-containing
microorganism using methods disclosed herein (b) lysing a
lipid-containing microorganism to produce a lysate, (c) isolating
lipid from the lysed microorganism, and (d) transesterifying the
lipid composition, whereby biodiesel is produced. Methods for
growth of a microorganism, lysing a microorganism to produce a
lysate, treating the lysate in a medium comprising an organic
solvent to form a heterogeneous mixture and separating the treated
lysate into a lipid composition have been described above and can
also be used in the method of producing biodiesel.
[0306] The lipid profile of the biodiesel is usually highly similar
to the lipid profile of the feedstock oil. Other oils provided by
the methods and compositions of the invention can be subjected to
transesterification to yield biodiesel with lipid profiles
including (a) at least 4% C8-C14; (b) at least 0.3% C8; (c) at
least 2% C10; (d) at least 2% C12; and (3) at least 30% C8-C14.
[0307] Lipid compositions can be subjected to transesterification
to yield long-chain fatty acid esters useful as biodiesel.
Preferred transesterification reactions are outlined below and
include base catalyzed transesterification and transesterification
using recombinant lipases. In a base-catalyzed transesterification
process, the triacylglycerides are reacted with an alcohol, such as
methanol or ethanol, in the presence of an alkaline catalyst,
typically potassium hydroxide. This reaction forms methyl or ethyl
esters and glycerin (glycerol) as a byproduct.
[0308] Animal and plant oils are typically made of triglycerides
which are esters of free fatty acids with the trihydric alcohol,
glycerol. In transesterification, the glycerol in a
triacylglyceride (TAG) is replaced with a short-chain alcohol such
as methanol or ethanol. A typical reaction scheme is as
follows:
##STR00001##
[0309] In this reaction, the alcohol is deprotonated with a base to
make it a stronger nucleophile. Commonly, ethanol or methanol is
used in vast excess (up to 50-fold). Normally, this reaction will
proceed either exceedingly slowly or not at all. Heat, as well as
an acid or base can be used to help the reaction proceed more
quickly. The acid or base are not consumed by the
transesterification reaction, thus they are not reactants but
catalysts. Almost all biodiesel has been produced using the
base-catalyzed technique as it requires only low temperatures and
pressures and produces over 98% conversion yield (provided the
starting oil is low in moisture and free fatty acids).
[0310] Transesterification has also been carried out, as discussed
above, using an enzyme, such as a lipase instead of a base.
Lipase-catalyzed transesterification can be carried out, for
example, at a temperature between the room temperature and
80.degree. C., and a mole ratio of the TAG to the lower alcohol of
greater than 1:1, preferably about 3:1. Lipases suitable for use in
transesterification include, but are not limited to, those listed
in Table 9. Other examples of lipases useful for
transesterification are found in, e.g. U.S. Pat. Nos. 4,798,793;
4,940,845 5,156,963; 5,342,768; 5,776,741 and WO89/01032. Such
lipases include, but are not limited to, lipases produced by
microorganisms of Rhizopus, Aspergillus, Candida, Mucor,
Pseudomonas, Rhizomucor, Candida, and Humicola and pancreas
lipase.
TABLE-US-00009 TABLE 9 Lipases suitable for use in
transesterification. Aspergillus niger lipase ABG73614, Candida
antarctica lipase B (novozym-435) CAA83122, Candida cylindracea
lipase AAR24090, Candida lipolytica lipase (Lipase L; Amano
Pharmaceutical Co., Ltd.), Candida rugosa lipase (e.g., Lipase-OF;
Meito Sangyo Co., Ltd.), Mucor miehei lipase (Lipozyme IM 20),
Pseudomonas fluorescens lipase AAA25882, Rhizopus japonicas lipase
(Lilipase A-10FG) Q7M4U7_1, Rhizomucor miehei lipase B34959,
Rhizopus oryzae lipase (Lipase F) AAF32408, Serratia marcescens
lipase (SM Enzyme) ABI13521, Thermomyces lanuginosa lipase
CAB58509, Lipase P (Nagase ChemteX Corporation), and Lipase QLM
(Meito Sangyo Co., Ltd., Nagoya, Japan)
[0311] One challenge to using a lipase for the production of fatty
acid esters suitable for biodiesel is that the price of lipase is
much higher than the price of sodium hydroxide (NaOH) used by the
strong base process. This challenge has been addressed by using an
immobilized lipase, which can be recycled. However, the activity of
the immobilized lipase must be maintained after being recycled for
a minimum number of cycles to allow a lipase-based process to
compete with the strong base process in terms of the production
cost. Immobilized lipases are subject to poisoning by the lower
alcohols typically used in transesterification. U.S. Pat. No.
6,398,707 (issued Jun. 4, 2002 to Wu et al.) describes methods for
enhancing the activity of immobilized lipases and regenerating
immobilized lipases having reduced activity. Some suitable methods
include immersing an immobilized lipase in an alcohol having a
carbon atom number not less than 3 for a period of time, preferably
from 0.5-48 hours, and more preferably from 0.5-1.5 hours. Some
suitable methods also include washing a deactivated immobilized
lipase with an alcohol having a carbon atom number not less than 3
and then immersing the deactivated immobilized lipase in a
vegetable oil for 0.5-48 hours.
[0312] In particular embodiments, a recombinant lipase is expressed
in the same microorganisms that produce the lipid on which the
lipase acts. Suitable recombinant lipases include those listed
above in Table 9 and/or having GenBank Accession numbers listed
above in Table 9, or a polypeptide that has at least 70% amino acid
identity with one of the lipases listed above in Table 9 and that
exhibits lipase activity. In additional embodiments, the enzymatic
activity is present in a sequence that has at least about 75%, at
least about 80%, at least about 85%, at least about 90%, at least
about 95%, or at least about 99% identity with one of the above
described sequences, all of which are hereby incorporated by
reference as if fully set forth. DNA encoding the lipase and
selectable marker is preferably codon-optimized cDNA. Methods of
recoding genes for expression in microalgae are described in U.S.
Pat. No. 7,135,290.
[0313] The common international standard for biodiesel is EN 14214.
ASTM D6751 is the most common biodiesel standard referenced in the
United States and Canada. Germany uses DIN EN 14214 and the UK
requires compliance with BS EN 14214. Basic industrial tests to
determine whether the products conform to these standards typically
include gas chromatography, HPLC, and others. Biodiesel meeting the
quality standards is very non-toxic, with a toxicity rating
(LD.sub.50) of greater than 50 mL/kg.
[0314] Although biodiesel that meets the ASTM standards has to be
non-toxic, there can be contaminants which tend to crystallize
and/or precipitate and fall out of solution as sediment. Sediment
formation is particularly a problem when biodiesel is used at lower
temperatures. The sediment or precipitates may cause problems such
as decreasing fuel flow, clogging fuel lines, clogging filters,
etc. Processes are well-known in the art that specifically deal
with the removal of these contaminants and sediments in biodiesel
in order to produce a higher quality product. Examples for such
processes include, but are not limited to, pretreatment of the oil
to remove contaiminants such as phospholipids and free fatty acids
(e.g., degumming, caustic refining and silica adsorbant filtration)
and cold filtration. Cold filtration is a process that was
developed specifically to remove any particulates and sediments
that are present in the biodiesel after production. This process
cools the biodiesel and filters out any sediments or precipitates
that might form when the fuel is used at a lower temperature. Such
a process is well known in the art and is described in US Patent
Application Publication No. 2007-0175091. Suitable methods may
include cooling the biodiesel to a temperature of less than about
38.degree. C. so that the impurities and contaminants precipitate
out as particulates in the biodiesel liquid. Diatomaceous earth or
other filtering material may then added to the cooled biodiesel to
form a slurry, which may then filtered through a pressure leaf or
other type of filter to remove the particulates. The filtered
biodiesel may then be run through a polish filter to remove any
remaining sediments and diatomaceous earth, so as to produce the
final biodiesel product.
[0315] Example 9 describes the production of biodiesel using
triglyceride oil from Prototheca moriformis. The Cold Soak
Filterability by the ASTM D6751 A1 method of the biodiesel produced
in Example 9 was 120 seconds for a volume of 300 ml. This test
involves filtration of 300 ml of B100, chilled to 40.degree. F. for
16 hours, allowed to warm to room temp, and filtered under vacuum
using 0.7 micron glass fiber filter with stainless steel support.
Oils of the invention can be transesterified to generate biodiesel
with a cold soak time of less than 120 seconds, less than 100
seconds, and less than 90 seconds.
[0316] Subsequent processes may also be used if the biodiesel will
be used in particularly cold temperatures. Such processes include
winterization and fractionation. Both processes are designed to
improve the cold flow and winter performance of the fuel by
lowering the cloud point (the temperature at which the biodiesel
starts to crystallize). There are several approaches to winterizing
biodiesel. One approach is to blend the biodiesel with petroleum
diesel. Another approach is to use additives that can lower the
cloud point of biodiesel. Another approach is to remove saturated
methyl esters indiscriminately by mixing in additives and allowing
for the crystallization of saturates and then filtering out the
crystals. Fractionation selectively separates methyl esters into
individual components or fractions, allowing for the removal or
inclusion of specific methyl esters. Fractionation methods include
urea fractionation, solvent fractionation and thermal
distillation.
[0317] Another valuable fuel provided by the methods of the present
invention is renewable diesel, which comprises alkanes, such as
C10:0, C12:0, C14:0, C16:0 and C18:0 and thus, are distinguishable
from biodiesel. High quality renewable diesel conforms to the ASTM
D975 standard. The lipids produced by the methods of the present
invention can serve as feedstock to produce renewable diesel. Thus,
in another aspect of the present invention, a method for producing
renewable diesel is provided. Renewable diesel can be produced by
at least three processes: hydrothermal processing (hydrotreating);
hydroprocessing; and indirect liquefaction. These processes yield
non-ester distillates. During these processes, triacylglycerides
produced and isolated as described herein, are converted to
alkanes.
[0318] In one embodiment, the method for producing renewable diesel
comprises (a) cultivating a lipid-containing microorganism using
methods disclosed herein (b) lysing the microorganism to produce a
lysate, (c) isolating lipid from the lysed microorganism, and (d)
deoxygenating and hydrotreating the lipid to produce an alkane,
whereby renewable diesel is produced. Lipids suitable for
manufacturing renewable diesel can be obtained via extraction from
microbial biomass using an organic solvent such as hexane, or via
other methods, such as those described in U.S. Pat. No. 5,928,696.
Some suitable methods may include mechanical pressing and
centrifuging.
[0319] In some methods, the microbial lipid is first cracked in
conjunction with hydrotreating to reduce carbon chain length and
saturate double bonds, respectively. The material is then
isomerized, also in conjunction with hydrotreating. The naptha
fraction can then be removed through distillation, followed by
additional distillation to vaporize and distill components desired
in the diesel fuel to meet an ASTM D975 standard while leaving
components that are heavier than desired for meeting the D975
standard. Hydrotreating, hydrocracking, deoxygenation and
isomerization methods of chemically modifying oils, including
triglyceride oils, are well known in the art. See for example
European patent applications EP1741768 (A1); EP1741767 (A1);
EP1682466 (A1); EP1640437 (A1); EP1681337 (A1); EP1795576 (A1); and
U.S. Pat. Nos. 7,238,277; 6,630,066; 6,596,155; 6,977,322;
7,041,866; 6,217,746; 5,885,440; 6,881,873.
[0320] In one embodiment of the method for producing renewable
diesel, treating the lipid to produce an alkane is performed by
hydrotreating of the lipid composition. In hydrothermal processing,
typically, biomass is reacted in water at an elevated temperature
and pressure to form oils and residual solids. Conversion
temperatures are typically 300.degree. to 660.degree. F., with
pressure sufficient to keep the water primarily as a liquid, 100 to
170 standard atmosphere (atm). Reaction times are on the order of
15 to 30 minutes. After the reaction is completed, the organics are
separated from the water. Thereby a distillate suitable for diesel
is produced.
[0321] In some methods of making renewable diesel, the first step
of treating a triglyceride is hydroprocessing to saturate double
bonds, followed by deoxygenation at elevated temperature in the
presence of hydrogen and a catalyst. In some methods, hydrogenation
and deoxygenation occur in the same reaction. In other methods
deoxygenation occurs before hydrogenation. Isomerization is then
optionally performed, also in the presence of hydrogen and a
catalyst. Naphtha components are preferably removed through
distillation. For examples, see U.S. Pat. No. 5,475,160
(hydrogenation of triglycerides); U.S. Pat. No. 5,091,116
(deoxygenation, hydrogenation and gas removal); U.S. Pat. No.
6,391,815 (hydrogenation); and U.S. Pat. No. 5,888,947
(isomerization).
[0322] One suitable method for the hydrogenation of triglycerides
includes preparing an aqueous solution of copper, zinc, magnesium
and lanthanum salts and another solution of alkali metal or
preferably, ammonium carbonate. The two solutions may be heated to
a temperature of about 20.degree. C. to about 85.degree. C. and
metered together into a precipitation container at rates such that
the pH in the precipitation container is maintained between 5.5 and
7.5 in order to form a catalyst. Additional water may be used
either initially in the precipitation container or added
concurrently with the salt solution and precipitation solution. The
resulting precipitate may then be thoroughly washed, dried,
calcined at about 300.degree. C. and activated in hydrogen at
temperatures ranging from about 100.degree. C. to about 400.degree.
C. One or more triglycerides may then be contacted and reacted with
hydrogen in the presence of the above-described catalyst in a
reactor. The reactor may be a trickle bed reactor, fixed bed
gas-solid reactor, packed bubble column reactor, continuously
stirred tank reactor, a slurry phase reactor, or any other suitable
reactor type known in the art. The process may be carried out
either batchwise or in continuous fashion. Reaction temperatures
are typically in the range of from about 170.degree. C. to about
250.degree. C. while reaction pressures are typically in the range
of from about 300 psig to about 2000 psig. Moreover, the molar
ratio of hydrogen to triglyceride in the process of the present
invention is typically in the range of from about 20:1 to about
700:1. The process is typically carried out at a weight hourly
space velocity (WHSV) in the range of from about 0.1 hr.sup.1 to
about 5 hr.sup.1. One skilled in the art will recognize that the
time period required for reaction will vary according to the
temperature used, the molar ratio of hydrogen to triglyceride, and
the partial pressure of hydrogen. The products produced by the such
hydrogenation processes include fatty alcohols, glycerol, traces of
paraffins and unreacted triglycerides. These products are typically
separated by conventional means such as, for example, distillation,
extraction, filtration, crystallization, and the like.
[0323] Petroleum refiners use hydroprocessing to remove impurities
by treating feeds with hydrogen. Hydroprocessing conversion
temperatures are typically 300.degree. to 700.degree. F. Pressures
are typically 40 to 100 atm. The reaction times are typically on
the order of 10 to 60 minutes. Solid catalysts are employed to
increase certain reaction rates, improve selectivity for certain
products, and optimize hydrogen consumption.
[0324] Suitable methods for the deoxygenation of an oil includes
heating an oil to a temperature in the range of from about
350.degree. F. to about 550.degree. F. and continuously contacting
the heated oil with nitrogen under at least pressure ranging from
about atmospeheric to above for at least about 5 minutes.
[0325] Suitable methods for isomerization include using alkali
isomerization and other oil isomerization known in the art.
[0326] Hydrotreating and hydroprocessing ultimately lead to a
reduction in the molecular weight of the triglyceride feed. The
triglyceride molecule is reduced to four hydrocarbon molecules
under hydroprocessing conditions: a propane molecule and three
heavier hydrocarbon molecules, typically in the C8 to C18
range.
[0327] Thus, in one embodiment, the product of one or more chemical
reaction(s) performed on lipid compositions of the invention is an
alkane mixture that comprises ASTM D975 renewable diesel.
Production of hydrocarbons by microorganisms is reviewed by Metzger
et al. Appl Microbiol Biotechnol (2005) 66: 486-496 and A Look Back
at the U.S. Department of Energy's Aquatic Species Program:
Biodiesel from Algae, NREL/TP-580-24190, John Sheehan, Terri
Dunahay, John Benemann and Paul Roessler (1998).
[0328] The distillation properties of a diesel fuel is described in
terms of T10-T90 (temperature at 10% and 90%, respectively, volume
distilled). Renewable diesel was produced from Prototheca
moriformis triglyceride oil and is described in Example 9. The
T10-T90 of the material produced in Example 9 was 57.9.degree. C.
Methods of hydrotreating, isomerization, and other covalent
modification of oils disclosed herein, as well as methods of
distillation and fractionation (such as cold filtration) disclosed
herein, can be employed to generate renewable diesel compositions
with other T10-T90 ranges, such as 20, 25, 30, 35, 40, 45, 50, 60
and 65.degree. C. using triglyceride oils produced according to the
methods disclosed herein.
[0329] The T10 of the material produced in Example 9 was
242.1.degree. C. Methods of hydrotreating, isomerization, and other
covalent modification of oils disclosed herein, as well as methods
of distillation and fractionation (such as cold filtration)
disclosed herein, can be employed to generate renewable diesel
compositions with other T10 values, such as T10 between 180 and
295, between 190 and 270, between 210 and 250, between 225 and 245,
and at least 290.
[0330] The T90 of the material produced in Example 9 was
300.degree. C. Methods of hydrotreating, isomerization, and other
covalent modification of oils disclosed herein, as well as methods
of distillation and fractionation (such as cold filtration)
disclosed herein can be employed to generate renewable diesel
compositions with other T90 values, such as T90 between 280 and
380, between 290 and 360, between 300 and 350, between 310 and 340,
and at least 290.
[0331] The FBP of the material produced in Example 9 was
300.degree. C. Methods of hydrotreating, isomerization, and other
covalent modification of oils disclosed herein, as well as methods
of distillation and fractionation (such as cold filtration)
disclosed herein, can be employed to generate renewable diesel
compositions with other FBP values, such as FBP between 290 and
400, between 300 and 385, between 310 and 370, between 315 and 360,
and at least 300.
[0332] Other oils provided by the methods and compositions of the
invention can be subjected to combinations of hydrotreating,
isomerization, and other covalent modification including oils with
lipid profiles including (a) at least 4% C8-C14; (b) at least 0.3%
C8; (c) at least 2% C10; (d) at least 2% C12; and (3) at least 30%
C8-C14.
[0333] A traditional ultra-low sulfur diesel can be produced from
any form of biomass by a two-step process. First, the biomass is
converted to a syngas, a gaseous mixture rich in hydrogen and
carbon monoxide. Then, the syngas is catalytically converted to
liquids. Typically, the production of liquids is accomplished using
Fischer-Tropsch (FT) synthesis. This technology applies to coal,
natural gas, and heavy oils. Thus, in yet another preferred
embodiment of the method for producing renewable diesel, treating
the lipid composition to produce an alkane is performed by indirect
liquefaction of the lipid composition.
[0334] The present invention also provides methods to produce jet
fuel. Jet fuel is clear to straw colored. The most common fuel is
an unleaded/paraffin oil-based fuel classified as Aeroplane A-1,
which is produced to an internationally standardized set of
specifications. Jet fuel is a mixture of a large number of
different hydrocarbons, possibly as many as a thousand or more. The
range of their sizes (molecular weights or carbon numbers) is
restricted by the requirements for the product, for example,
freezing point or smoke point. Kerosone-type Aeroplane fuel
(including Jet A and Jet A-1) has a carbon number distribution
between about 8 and 16 carbon numbers. Wide-cut or naphta-type
Aeroplane fuel (including Jet B) typically has a carbon number
distribution between about 5 and 15 carbons.
[0335] Both Aeroplanes (Jet A and Jet B) may contain a number of
additives. Useful additives include, but are not limited to,
antioxidants, antistatic agents, corrosion inhibitors, and fuel
system icing inhibitor (FSII) agents. Antioxidants prevent gumming
and usually, are based on alkylated phenols, for example, AO-30,
AO-31, or AO-37. Antistatic agents dissipate static electricity and
prevent sparking. Stadis 450 with dinonylnaphthylsulfonic acid
(DINNSA) as the active ingredient, is an example. Corrosion
inhibitors, e.g., DCI-4A is used for civilian and military fuels
and DCI-6A is used for military fuels. FSII agents, include, e.g.,
Di-EGME.
[0336] In one embodiment of the invention, a jet fuel is produced
by blending algal fuels with existing jet fuel. The lipids produced
by the methods of the present invention can serve as feedstock to
produce jet fuel. Thus, in another aspect of the present invention,
a method for producing jet fuel is provided. Herewith two methods
for producing jet fuel from the lipids produced by the methods of
the present invention are provided: fluid catalytic cracking (FCC);
and hydrodeoxygenation (HDO).
[0337] Fluid Catalytic Cracking (FCC) is one method which is used
to produce olefins, especially propylene from heavy crude
fractions. The lipids produced by the method of the present
invention can be converted to olefins. The process involves flowing
the lipids produced through an FCC zone and collecting a product
stream comprised of olefins, which is useful as a jet fuel. The
lipids produced are contacted with a cracking catalyst at cracking
conditions to provide a product stream comprising olefins and
hydrocarbons useful as jet fuel.
[0338] In one embodiment, the method for producing jet fuel
comprises (a) cultivating a lipid-containing microorganism using
methods disclosed herein, (b) lysing the lipid-containing
microorganism to produce a lysate, (c) isolating lipid from the
lysate, and (d) treating the lipid composition, whereby jet fuel is
produced. In one embodiment of the method for producing a jet fuel,
the lipid composition can be flowed through a fluid catalytic
cracking zone, which, in one embodiment, may comprise contacting
the lipid composition with a cracking catalyst at cracking
conditions to provide a product stream comprising C.sub.2-C.sub.5
olefins.
[0339] In certain embodiments of this method, it may be desirable
to remove any contaminants that may be present in the lipid
composition. Thus, prior to flowing the lipid composition through a
fluid catalytic cracking zone, the lipid composition is pretreated.
Pretreatment may involve contacting the lipid composition with an
ion-exchange resin. The ion exchange resin is an acidic ion
exchange resin, such as Amberlyst.TM.-15 and can be used as a bed
in a reactor through which the lipid composition is flowed, either
upflow or downflow. Other pretreatments may include mild acid
washes by contacting the lipid composition with an acid, such as
sulfuric, acetic, nitric, or hydrochloric acid. Contacting is done
with a dilute acid solution usually at ambient temperature and
atmospheric pressure.
[0340] The lipid composition, optionally pretreated, is flowed to
an FCC zone where the hydrocarbonaceous components are cracked to
olefins. Catalytic cracking is accomplished by contacting the lipid
composition in a reaction zone with a catalyst composed of finely
divided particulate material. The reaction is catalytic cracking,
as opposed to hydrocracking, and is carried out in the absence of
added hydrogen or the consumption of hydrogen. As the cracking
reaction proceeds, substantial amounts of coke are deposited on the
catalyst. The catalyst is regenerated at high temperatures by
burning coke from the catalyst in a regeneration zone.
Coke-containing catalyst, referred to herein as "coked catalyst",
is continually transported from the reaction zone to the
regeneration zone to be regenerated and replaced by essentially
coke-free regenerated catalyst from the regeneration zone.
Fluidization of the catalyst particles by various gaseous streams
allows the transport of catalyst between the reaction zone and
regeneration zone. Methods for cracking hydrocarbons, such as those
of the lipid composition described herein, in a fluidized stream of
catalyst, transporting catalyst between reaction and regeneration
zones, and combusting coke in the regenerator are well known by
those skilled in the art of FCC processes. Exemplary FCC
applications and catalysts useful for cracking the lipid
composition to produce C.sub.2-C.sub.5 olefins are described in
U.S. Pat. Nos. 6,538,169, 7,288,685, which are incorporated in
their entirety by reference.
[0341] Suitable FCC catalysts generally comprise at least two
components that may or may not be on the same matrix. In some
embodiments, both two components may be circulated throughout the
entire reaction vessel. The first component generally includes any
of the well-known catalysts that are used in the art of fluidized
catalytic cracking, such as an active amorphous clay-type catalyst
and/or a high activity, crystalline molecular sieve. Molecular
sieve catalysts may be preferred over amorphous catalysts because
of their much-improved selectivity to desired products. IN some
preferred embodiments, zeolites may be used as the molecular sieve
in the FCC processes. Preferably, the first catalyst component
comprises a large pore zeolite, such as an Y-type zeolite, an
active alumina material, a binder material, comprising either
silica or alumina and an inert filler such as kaolin.
[0342] In one embodiment, cracking the lipid composition of the
present invention, takes place in the riser section or,
alternatively, the lift section, of the FCC zone. The lipid
composition is introduced into the riser by a nozzle resulting in
the rapid vaporization of the lipid composition. Before contacting
the catalyst, the lipid composition will ordinarily have a
temperature of about 149.degree. C. to about 316.degree. C.
(300.degree. F. to 600.degree. F.). The catalyst is flowed from a
blending vessel to the riser where it contacts the lipid
composition for a time of abort 2 seconds or less.
[0343] The blended catalyst and reacted lipid composition vapors
are then discharged from the top of the riser through an outlet and
separated into a cracked product vapor stream including olefins and
a collection of catalyst particles covered with substantial
quantities of coke and generally referred to as "coked catalyst."
In an effort to minimize the contact time of the lipid composition
and the catalyst which may promote further conversion of desired
products to undesirable other products, any arrangement of
separators such as a swirl arm arrangement can be used to remove
coked catalyst from the product stream quickly. The separator, e.g.
swirl arm separator, is located in an upper portion of a chamber
with a stripping zone situated in the lower portion of the chamber.
Catalyst separated by the swirl arm arrangement drops down into the
stripping zone. The cracked product vapor stream comprising cracked
hydrocarbons including light olefins and some catalyst exit the
chamber via a conduit which is in communication with cyclones. The
cyclones remove remaining catalyst particles from the product vapor
stream to reduce particle concentrations to very low levels. The
product vapor stream then exits the top of the separating vessel.
Catalyst separated by the cyclones is returned to the separating
vessel and then to the stripping zone. The stripping zone removes
adsorbed hydrocarbons from the surface of the catalyst by
counter-current contact with steam.
[0344] Low hydrocarbon partial pressure operates to favor the
production of light olefins. Accordingly, the riser pressure is set
at about 172 to 241 kPa (25 to 35 psia) with a hydrocarbon partial
pressure of about 35 to 172 kPa (5 to 25 psia), with a preferred
hydrocarbon partial pressure of about 69 to 138 kPa (10 to 20
psia). This relatively low partial pressure for hydrocarbon is
achieved by using steam as a diluent to the extent that the diluent
is 10 to 55 wt-% of lipid composition and preferably about 15 wt-%
of lipid composition. Other diluents such as dry gas can be used to
reach equivalent hydrocarbon partial pressures.
[0345] The temperature of the cracked stream at the riser outlet
will be about 510.degree. C. to 621.degree. C. (950.degree. F. to
1150.degree. F.). However, riser outlet temperatures above
566.degree. C. (1050.degree. F.) make more dry gas and more
olefins. Whereas, riser outlet temperatures below 566.degree. C.
(1050.degree. F.) make less ethylene and propylene. Accordingly, it
is preferred to run the FCC process at a preferred temperature of
about 566.degree. C. to about 630.degree. C., preferred pressure of
about 138 kPa to about 240 kPa (20 to 35 psia). Another condition
for the process is the catalyst to lipid composition ratio which
can vary from about 5 to about 20 and preferably from about 10 to
about 15.
[0346] In one embodiment of the method for producing a jet fuel,
the lipid composition is introduced into the lift section of an FCC
reactor. The temperature in the lift section will be very hot and
range from about 700.degree. C. (1292.degree. F.) to about
760.degree. C. (1400.degree. F.) with a catalyst to lipid
composition ratio of about 100 to about 150. It is anticipated that
introducing the lipid composition into the lift section will
produce considerable amounts of propylene and ethylene.
[0347] In another embodiment of the method for producing a jet fuel
using the lipid composition or the lipids produced as described
herein, the structure of the lipid composition or the lipids is
broken by a process referred to as hydrodeoxygenation (HDO). HDO
means removal of oxygen by means of hydrogen, that is, oxygen is
removed while breaking the structure of the material. Olefinic
double bonds are hydrogenated and any sulphur and nitrogen
compounds are removed. Sulphur removal is called
hydrodesulphurization (HDS). Pretreatment and purity of the raw
materials (lipid composition or the lipids) contribute to the
service life of the catalyst.
[0348] Generally in the HDO/HDS step, hydrogen is mixed with the
feed stock (lipid composition or the lipids) and then the mixture
is passed through a catalyst bed as a co-current flow, either as a
single phase or a two phase feed stock. After the HDO/MDS step, the
product fraction is separated and passed to a separate isomerzation
reactor. An isomerization reactor for biological starting material
is described in the literature (FI 100 248) as a co-current
reactor.
[0349] The process for producing a fuel by hydrogenating a
hydrocarbon feed, e.g., the lipid composition or the lipids herein,
can also be performed by passing the lipid composition or the
lipids as a co-current flow with hydrogen gas through a first
hydrogenation zone, and thereafter the hydrocarbon effluent is
further hydrogenated in a second hydrogenation zone by passing
hydrogen gas to the second hydrogenation zone as a counter-current
flow relative to the hydrocarbon effluent. Exemplary HDO
applications and catalysts useful for cracking the lipid
composition to produce C.sub.2-C.sub.5 olefins are described in
U.S. Pat. No. 7,232,935, which is incorporated in its entirety by
reference.
[0350] Typically, in the hydrodeoxygenation step, the structure of
the biological component, such as the lipid composition or lipids
herein, is decomposed, oxygen, nitrogen, phosphorus and sulphur
compounds, and light hydrocarbons as gas are removed, and the
olefinic bonds are hydrogenated. In the second step of the process,
i.e. in the so-called isomerization step, isomerzation is carried
out for branching the hydrocarbon chain and improving the
performance of the paraffin at low temperatures.
[0351] In the first step, i.e. HDO step, of the cracking process,
hydrogen gas and the lipid composition or lipids herein which are
to be hydrogenated are passed to a HDO catalyst bed system either
as co-current or counter-current flows, said catalyst bed system
comprising one or more catalyst bed(s), preferably 1-3 catalyst
beds. The HDO step is typically operated in a co-current manner. In
case of a HDO catalyst bed system comprising two or more catalyst
beds, one or more of the beds may be operated using the
counter-current flow principle. In the HDO step, the pressure
varies between 20 and 150 bar, preferably between 50 and 100 bar,
and the temperature varies between 200 and 500.degree. C.,
preferably in the range of 300-400.degree. C. In the HDO step,
known hydrogenation catalysts containing metals from Group VII
and/or VIB of the Periodic System may be used. Preferably, the
hydrogenation catalysts are supported Pd, Pt, Ni, NiMo or a CoMo
catalysts, the support being alumina and/or silica. Typically,
NiMo/Al.sub.2O.sub.3 and CoMo/Al.sub.2O.sub.3 catalysts are
used.
[0352] Prior to the HDO step, the lipid composition or lipids
herein may optionally be treated by prehydrogenation under milder
conditions thus avoiding side reactions of the double bonds. Such
prehydrogenation is carried out in the presence of a
prehydrogenation catalyst at temperatures of 50-400.degree. C. and
at hydrogen pressures of 1-200 bar, preferably at a temperature
between 150 and 250.degree. C. and at a hydrogen pressure between
10 and 100 bar. The catalyst may contain metals from Group VIII
and/or VIB of the Periodic System. Preferably, the prehydrogenation
catalyst is a supported Pd, Pt, Ni, NiMo or a CoMo catalyst, the
support being alumina and/or silica.
[0353] A gaseous stream from the HDO step containing hydrogen is
cooled and then carbon monoxide, carbon dioxide, nitrogen,
phosphorus and sulphur compounds, gaseous light hydrocarbons and
other impurities are removed therefrom. After compressing, the
purified hydrogen or recycled hydrogen is returned back to the
first catalyst bed and/or between the catalyst beds to make up for
the withdrawn gas stream. Water is removed from the condensed
liquid. The liquid is passed to the first catalyst bed or between
the catalyst beds.
[0354] After the HDO step, the product is subjected to an
isomerization step. It is substantial for the process that the
impurities are removed as completely as possible before the
hydrocarbons are contacted with the isomerization catalyst. The
isomerization step comprises an optional stripping step, wherein
the reaction product from the HDO step may be purified by stripping
with water vapour or a suitable gas such as light hydrocarbon,
nitrogen or hydrogen. The optional stripping step is carried out in
counter-current manner in a unit upstream of the isomerization
catalyst, wherein the gas and liquid are contacted with each other,
or before the actual isomerization reactor in a separate stripping
unit utilizing counter-current principle.
[0355] After the stripping step the hydrogen gas and the
hydrogenated lipid composition or lipids herein, and optionally an
n-paraffin mixture, are passed to a reactive isomerization unit
comprising one or several catalyst bed(s). The catalyst beds of the
isomerization step may operate either in co-current or
counter-current manner.
[0356] It is important for the process that the counter-current
flow principle is applied in the isomerization step. In the
isomerization step this is done by carrying out either the optional
stripping step or the isomerization reaction step or both in
counter-current manner. In the isomerzation step, the pressure
varies in the range of 20-150 bar, preferably in the range of
20-100 bar, the temperature being between 200 and 500.degree. C.,
preferably between 300 and 400.degree. C. In the isomerization
step, isomerization catalysts known in the art may be used.
Suitable isomerization catalysts contain molecular sieve and/or a
metal from Group VII and/or a carrier. Preferably, the
isomerization catalyst contains SAPO-11 or SAPO41 or ZSM-22 or
ZSM-23 or ferrierite and Pt, Pd or Ni and Al.sub.2O.sub.3 or
SiO.sub.2. Typical isomerization catalysts are, for example,
Pt/SAPO-11/Al.sub.2O.sub.3, Pt/ZSM-22/Al.sub.2O.sub.3,
Pt/ZSM-23/Al.sub.2O.sub.3 and Pt/SAPO-11/SiO.sub.2. The
isomerization step and the HDO step may be carried out in the same
pressure vessel or in separate pressure vessels. Optional
prehydrogenation may be carried out in a separate pressure vessel
or in the same pressure vessel as the HDO and isomerization
steps.
[0357] Thus, in one embodiment, the product of one or more chemical
reactions is an alkane mixture that comprises HRJ-5. In another
embodiment, the product of the one or more chemical reactions is an
alkane mixture that comprises ASTM D1655 jet fuel. In some
embodiments, the composition comforming to the specification of
ASTM 1655 jet fuel has a sulfur content that is less than 10 ppm.
In other embodiments, the composition conforming to the
specification of ASTM 1655 jet fuel has a T10 value of the
distillation curve of less than 205.degree. C. In another
embodiment, the composition conforming to the specification of ASTM
1655 jet fuel has a final boiling point (FBP) of less than
300.degree. C. In another embodiment, the composition conforming to
the specification of ASTM 1655 jet fuel has a flash point of at
least 38.degree. C. In another embodiment, the composition
conforming to the specification of ASTM 1655 jet fuel has a density
between 775K/M.sup.3 and 840K/M.sup.3. In yet another embodiment,
the composition conforming to the specification of ASTM 1655 jet
fuel has a freezing point that is below -47.degree. C. In another
embodiment, the composition conforming to the specification of ASTM
1655 jet fuel has a net Heat of Combustion that is at least 42.8
MJ/K. In another embodiment, the composition conforming to the
specification of ASTM 1655 jet fuel has a hydrogen content that is
at least 13.4 mass %. In another embodiment, the composition
conforming to the specification of ASTM 1655 jet fuel has a thermal
stability, as tested by quantitative gravimetric JFTOT at
260.degree. C., that is below 3 mm of Hg. In another embodiment,
the composition conforming to the specification of ASTM 1655 jet
fuel has an existent gum that is below 7 mg/dl.
[0358] Thus, the present invention discloses a variety of methods
in which chemical modification of microalgal lipid is undertaken to
yield products useful in a variety of industrial and other
applications. Examples of processes for modifying oil produced by
the methods disclosed herein include, but are not limited to,
hydrolysis of the oil, hydroprocessing of the oil, and
esterification of the oil. Other chemical modification of
microalgal lipid include, without limitation, epoxidation,
oxidation, hydrolysis, sulfations, sulfonation, ethoxylation,
propoxylation, amidation, and saponification. The modification of
the microalgal oil produces basic oleochemicals that can be further
modified into selected derivative oleochemicals for a desired
function. In a manner similar to that described above with
reference to fuel producing processes, these chemical modifications
can also be performed on oils generated from the microbial cultures
described herein. Examples of basic oleochemicals include, but are
not limited to, soaps, fatty acids, fatty esters, fatty alcohols,
fatty nitrogen compounds, fatty acid methyl esters, and glycerol.
Examples of derivative oleochemicals include, but are not limited
to, fatty nitriles, esters, dimer acids, quats, surfactants, fatty
alkanolamides, fatty alcohol sulfates, resins, emulsifiers, fatty
alcohols, olefins, drilling muds, polyols, polyurethanes,
polyacrylates, rubber, candles, cosmetics, metallic soaps, soaps,
alpha-sulphonated methyl esters, fatty alcohol sulfates, fatty
alcohol ethoxylates, fatty alcohol ether sulfates, imidazolines,
surfactants, detergents, esters, quats, ozonolysis products, fatty
amines, fatty alkanolamides, ethoxysulfates, monoglycerides,
diglycerides, triglycerides (including medium chain triglycerides),
lubricants, hydraulic fluids, greases, dielectric fluids, mold
release agents, metal working fluids, heat transfer fluids, other
functional fluids, industrial chemicals (e.g., cleaners, textile
processing aids, plasticizers, stabilizers, additives), surface
coatings, paints and lacquers, electrical wiring insulation, and
higher alkanes.
[0359] Hydrolysis of the fatty acid constituents from the
glycerolipids produced by the methods of the invention yields free
fatty acids that can be derivatized to produce other useful
chemicals. Hydrolysis occurs in the presence of water and a
catalyst which may be either an acid or a base. The liberated free
fatty acids can be derivatized to yield a variety of products, as
reported in the following: U.S. Pat. No. 5,304,664 (Highly sulfated
fatty acids); U.S. Pat. No. 7,262,158 (Cleansing compositions);
U.S. Pat. No. 7,115,173 (Fabric softener compositions); U.S. Pat.
No. 6,342,208 (Emulsions for treating skin); U.S. Pat. No.
7,264,886 (Water repellant compositions); U.S. Pat. No. 6,924,333
(Paint additives); U.S. Pat. No. 6,596,768 (Lipid-enriched ruminant
feedstock); and U.S. Pat. No. 6,380,410 (Surfactants for detergents
and cleaners).
[0360] With regard to hydrolysis, in one embodiment of the
invention, a triglyceride oil is optionally first hydrolyzed in a
liquid medium such as water or sodium hydroxide so as to obtain
glycerol and soaps. There are various suitable triglyceride
hydrolysis methods, including, but not limited to, saponification,
acid hydrolysis, alkaline hydrolysis, enzymatic hydrolysis
(referred herein as splitting), and hydrolysis using hot-compressed
water. One skilled in the art will recognize that a triglyceride
oil need not be hydrolyzed in order to produce an oleochemical;
rather, the oil may be converted directly to the desired
oleochemical by other known process. For example, the triglyceride
oil may be directly converted to a methyl ester fatty acid through
esterification.
[0361] In some embodiments, catalytic hydrolysis of the oil
produced by methods disclosed herein occurs by splitting the oil
into glycerol and fatty acids. As discussed above, the fatty acids
may then be further processed through several other modifications
to obtained derivative oleochemicals. For example, in one
embodiment the fatty acids may undergo an amination reaction to
produce fatty nitrogen compounds. In another embodiment, the fatty
acids may undergo ozonolysis to produce mono- and
dibasic-acids.
[0362] In other embodiments hydrolysis may occur via the, splitting
of oils produced herein to create oleochemicals. In some preferred
embodiments of the invention, a triglyceride oil may be split
before other processes is performed. One skilled in the art will
recognize that there are many suitable triglyceride splitting
methods, including, but not limited to, enzymatic splitting and
pressure splitting.
[0363] Generally, enzymatic oil splitting methods use enzymes,
lipases, as biocatalysts acting on a water/oil mixture. Enzymatic
splitting then splits the oil or fat, respectively, is into
glycerol and free fatty acids. The glycerol may then migrates into
the water phase whereas the organic phase enriches with free fatty
acids.
[0364] The enzymatic splitting reactions generally take place at
the phase boundary between organic and aqueous phase, where the
enzyme is present only at the phase boundary. Triglycerides that
meet the phase boundary then contribute to or participate in the
splitting reaction. As the reaction proceeds, the occupation
density or concentration of fatty acids still chemically bonded as
glycerides, in comparison to free fatty acids, decreases at the
phase boundary so that the reaction is slowed down. In certain
embodiments, enzymatic splitting may occur at room temperature. One
of ordinary skill in the art would know the suitable conditions for
splitting oil into the desired fatty acids.
[0365] By way of example, the reaction speed can be accelerated by
increasing the interface boundary surface. Once the reaction is
complete, free fatty acids are then separated from the organic
phase freed from enzyme, and the residue which still contains fatty
acids chemically bonded as glycerides is fed back or recycled and
mixed with fresh oil or fat to be subjected to splitting. In this
manner, recycled glycerides are then subjected to a further
enzymatic splitting process. In some embodiments, the free fatty
acids are extracted from an oil or fat partially split in such a
manner. In that way, if the chemically bound fatty acids
(triglycerides) are returned or fed back into the splitting
process, the enzyme consumption can be drastically reduced.
[0366] The splitting degree is determined as the ratio of the
measured acid value divided by the theoretically possible acid
value which can be computed for a given oil or fat. Preferably, the
acid value is measured by means of titration according to standard
common methods. Alternatively, the density of the aqueous glycerol
phase can be taken as a measure for the splitting degree.
[0367] In one embodiment, the slitting process as described herein
is also suitable for splitting the mono-, di- and triglyceride that
are contained in the so-called soap-stock from the alkali refining
processes of the produced oils. In this manner, the soap-stock can
be quantitatively converted without prior saponification of the
neutral oils into the fatty acids. For this purpose, the fatty
acids being chemically bonded in the soaps are released, preferably
before splitting, through an addition of acid. In certain
embodiments, a buffer solution is used in addition to water and
enzyme for the splitting process.
[0368] In one embodiment, oils produced in accordance with the
methods of the invention can also be subjected to saponification as
a method of hydrolysis. Animal and plant oils are typically made of
triacylglycerols (TAGs), which are esters of fatty acids with the
trihydric alcohol, glycerol. In an alkaline hydrolysis reaction,
the glycerol in a TAG is removed, leaving three carboxylic acid
anions that can associate with alkali metal cations such as sodium
or potassium to produce fatty acid salts. In this scheme, the
carboxylic acid constituents are cleaved from the glycerol moiety
and replaced with hydroxyl groups. The quantity of base (e.g., KOH)
that is used in the reaction is determined by the desired degree of
saponification. If the objective is, for example, to produce a soap
product that comprises some of the oils originally present in the
TAG composition, an amount of base insufficient to convert all of
the TAGs to fatty acid salts is introduced into the reaction
mixture. Normally, this reaction is performed in an aqueous
solution and proceeds slowly, but may be expedited by the addition
of heat. Precipitation of the fatty acid salts can be facilitated
by addition of salts, such as water-soluble alkali metal halides
(e.g., NaCl or KCl), to the reaction mixture. Preferably, the base
is an alkali metal hydroxide, such as NaOH or KOH. Alternatively,
other bases, such as alkanolamines, including for example
triethanolamine and aminomethylpropanol, can be used in the
reaction scheme. In some cases, these alternatives may be preferred
to produce a clear soap product. In one embodiment the lipid
composition subjected to saponification is a tallow mimetic (i.e.,
lipid composition similar to that of tallow) produced as described
herein, or a blend of a tallow mimetic with another triglyceride
oil.
[0369] In some methods, the first step of chemical modification may
be hydroprocessing to saturate double bonds, followed by
deoxygenation at elevated temperature in the presence of hydrogen
and a catalyst. In other methods, hydrogenation and deoxygenation
may occur in the same reaction. In still other methods
deoxygenation occurs before hydrogenation. Isomerization may then
be optionally performed, also in the presence of hydrogen and a
catalyst. Finally, gases and naphtha components can be removed if
desired. For example, see U.S. Pat. No. 5,475,160 (hydrogenation of
triglycerides); U.S. Pat. No. 5,091,116 (deoxygenation,
hydrogenation and gas removal); U.S. Pat. No. 6,391,815
(hydrogenation); and U.S. Pat. No. 5,888,947 (isomerization).
[0370] In some embodiments of the invention, the triglyceride oils
are partially or completely deoxygenated. The deoxygenation
reactions form desired products, including, but not limited to,
fatty acids, fatty alcohols, polyols, ketones, and aldehydes. In
general, without being limited by any particular theory, the
deoxygenation reactions involve a combination of various different
reaction pathways, including without limitation: hydrogenolysis,
hydrogenation, consecutive hydrogenation-hydrogenolysis,
consecutive hydrogenolysis-hydrogenation, and combined
hydrogenation-hydrogenolysis reactions, resulting in at least the
partial removal of oxygen from the fatty acid or fatty acid ester
to produce reaction products, such as fatty alcohols, that can be
easily converted to the desired chemicals by further processing.
For example, in one embodiment, a fatty alcohol may be converted to
olefins through FCC reaction or to higher alkanes through a
condensation reaction.
[0371] One such chemical modification is hydrogenation, which is
the addition of hydrogen to double bonds in the fatty acid
constituents of glycerolipids or of free fatty acids. The
hydrogenation process permits the transformation of liquid oils
into semi-solid or solid fats, which may be more suitable for
specific applications.
[0372] Hydrogenation of oil produced by the methods described
herein can be performed in conjunction with one or more of the
methods and/or materials provided herein, as reported in the
following: U.S. Pat. No. 7,288,278 (Food additives or medicaments);
U.S. Pat. No. 5,346,724 (Lubrication products); U.S. Pat. No.
5,475,160 (Fatty alcohols); U.S. Pat. No. 5,091,116 (Edible oils);
U.S. Pat. No. 6,808,737 (Structural fats for margarine and
spreads); U.S. Pat. No. 5,298,637 (Reduced-calorie fat
substitutes); U.S. Pat. No. 6,391,815 (Hydrogenation catalyst and
sulfur adsorbent); U.S. Pat. Nos. 5,233,099 and 5,233,100 (Fatty
alcohols); U.S. Pat. No. 4,584,139 (Hydrogenation catalysts); U.S.
Pat. No. 6,057,375 (Foam suppressing agents); and U.S. Pat. No.
7,118,773 (Edible emulsion spreads).
[0373] One skilled in the art will recognize that various processes
may be used to hydrogenate carbohydrates. One suitable method
includes contacting the carbohydrate with hydrogen or hydrogen
mixed with a suitable gas and a catalyst under conditions
sufficient in a hydrogenation reactor to form a hydrogenated
product. The hydrogenation catalyst generally can include Cu, Re,
Ni, Fe, Co, Ru, Pd, Rh, Pt, Os, Ir, and alloys or any combination
thereof, either alone or with promoters such as W, Mo, Au, Ag, Cr,
Zn, Mn, Sn, B, P, Bi, and alloys or any combination thereof. Other
effective hydrogenation catalyst materials include either supported
nickel or ruthenium modified with rhenium. In an embodiment, the
hydrogenation catalyst also includes any one of the supports,
depending on the desired functionality of the catalyst. The
hydrogenation catalysts may be prepared by methods known to those
of ordinary skill in the art.
[0374] In some embodiments the hydrogenation catalyst includes a
supported Group VIII metal catalyst and a metal sponge material
(e.g., a sponge nickel catalyst). Raney nickel provides an example
of an activated sponge nickel catalyst suitable for use in this
invention. In other embodiment, the hydrogenation reaction in the
invention is performed using a catalyst comprising a nickel-rhenium
catalyst or a tungsten-modified nickel catalyst. One example of a
suitable catalyst for the hydrogenation reaction of the invention
is a carbon-supported nickel-rhenium catalyst.
[0375] In an embodiment, a suitable Raney nickel catalyst may be
prepared by treating an alloy of approximately equal amounts by
weight of nickel and aluminum with an aqueous alkali solution,
e.g., containing about 25 weight % of sodium hydroxide. The
aluminum is selectively dissolved by the aqueous alkali solution
resulting in a sponge shaped material comprising mostly nickel with
minor amounts of aluminum. The initial alloy includes promoter
metals (i.e., molybdenum or chromium) in the amount such that about
1 to 2 weight % remains in the formed sponge nickel catalyst. In
another embodiment, the hydrogenation catalyst is prepared using a
solution of ruthenium(III) nitrosylnitrate, ruthenium (III)
chloride in water to impregnate a suitable support material. The
solution is then dried to form a solid having a water content of
less than about 1% by weight. The solid may then be reduced at
atmospheric pressure in a hydrogen stream at 300.degree. C.
(uncalcined) or 400.degree. C. (calcined) in a rotary ball furnace
for 4 hours. After cooling and rendering the catalyst inert with
nitrogen, 5% by volume of oxygen in nitrogen is passed over the
catalyst for 2 hours.
[0376] In certain embodiments, the catalyst described includes a
catalyst support. The catalyst support stabilizes and supports the
catalyst. The type of catalyst support used depends on the chosen
catalyst and the reaction conditions. Suitable supports for the
invention include, but are not limited to, carbon, silica,
silica-alumina, zirconia, titania, ceria, vanadia, nitride, boron
nitride, heteropolyacids, hydroxyapatite, zinc oxide, chromia,
zeolites, carbon nanotubes, carbon fullerene and any combination
thereof.
[0377] The catalysts used in this invention can be prepared using
conventional methods known to those in the art. Suitable methods
may include, but are not limited to, incipient wetting, evaporative
impregnation, chemical vapor deposition, wash-coating, magnetron
sputtering techniques, and the like.
[0378] The conditions for which to carry out the hydrogenation
reaction will vary based on the type of starting material and the
desired products. One of ordinary skill in the art, with the
benefit of this disclosure, will recognize the appropriate reaction
conditions. In general, the hydrogenation reaction is conducted at
temperatures of 80.degree. C. to 250.degree. C., and preferably at
90.degree. C. to 200.degree. C., and most preferably at 100.degree.
C. to 150.degree. C. In some embodiments, the hydrogenation
reaction is conducted at pressures from 500 KPa to 14000 KPa.
[0379] The hydrogen used in the hydrogenolysis reaction of the
current invention may include external hydrogen, recycled hydrogen,
in situ generated hydrogen, and any combination thereof. As used
herein, the term "external hydrogen" refers to hydrogen that does
not originate from the biomass reaction itself, but rather is added
to the system from another source.
[0380] In some embodiments of the invention, it is desirable to
convert the starting carbohydrate to a smaller molecule that will
be more readily converted to desired higher hydrocarbons. One
suitable method for this conversion is through a hydrogenolysis
reaction. Various processes are known for performing hydrogenolysis
of carbohydrates. One suitable method includes contacting a
carbohydrate with hydrogen or hydrogen mixed with a suitable gas
and a hydrogenolysis catalyst in a hydrogenolysis reactor under
conditions sufficient to form a reaction product comprising smaller
molecules or polyols. Here, the term "smaller molecules or polyols"
includes any molecule that has a smaller molecular weight, which
can include a lesser number of carbon atoms or oxygen atoms than
the starting carbohydrate. In an embodiment, the reaction products
include smaller molecules that include polyols and alcohols.
Someone of ordinary skill in the art would be able to choose the
appropriate method by which to carry out the hydrogenolysis
reaction.
[0381] In some embodiments, a 5 and/or 6 carbon sugar or sugar
alcohol may be converted to propylene glycol, ethylene glycol, and
glycerol using a hydrogenolysis catalyst. The hydrogenolysis
catalyst may include Cr, Mo, W, Re, Mn, Cu, Cd, Fe, Co, Ni, Pt, Pd,
Rh, Ru, Ir, Os, and alloys or any combination thereof, either alone
or with promoters such as Au, Ag, Cr, Zn, Mn, Sn, Bi, B, O, and
alloys or any combination thereof. The hydrogenolysis catalyst may
also include a carbonaceous pyropolymer catalyst containing
transition metals (e.g., chromium, molybdemum, tungsten, rhenium,
manganese, copper, cadmium) or Group VIII metals (e.g., iron,
cobalt, nickel, platinum, palladium, rhodium, ruthenium, iridium,
and osmium). In certain embodiments, the hydrogenolysis catalyst
may include any of the above metals combined with an alkaline earth
metal oxide or adhered to a catalytically active support. In
certain embodiments, the catalyst described in the hydrogenolysis
reaction may include a catalyst support as described above for the
hydrogenation reaction.
[0382] The conditions for which to carry out the hydrogenolysis
reaction will vary based on the type of starting material and the
desired products. One of ordinary skill in the art, with the
benefit of this disclosure, will recognize the appropriate
conditions to use to carry out the reaction. In general, they
hydrogenolysis reaction is conducted at temperatures of 110.degree.
C. to 300.degree. C., and preferably at 170.degree. C. to
220.degree. C., and most preferably at 200.degree. C. to
225.degree. C. In some embodiments, the hydrogenolysis reaction is
conducted under basic conditions, preferably at a pH of 8 to 13,
and even more preferably at a pH of 10 to 12. In some embodiments,
the hydrogenolysis reaction is conducted at pressures in a range
between 60 KPa and 16500 KPa, and preferably in a range between
1700 KPa and 14000 KPa, and even more preferably between 4800 KPa
and 11000 KPa.
[0383] The hydrogen used in the hydrogenolysis reaction of the
current invention can include external hydrogen, recycled hydrogen,
in situ generated hydrogen, and any combination thereof.
[0384] In some embodiments, the reaction products discussed above
may be converted into higher hydrocarbons through a condensation
reaction in a condensation reactor. In such embodiments,
condensation of the reaction products occurs in the presence of a
catalyst capable of forming higher hydrocarbons. While not
intending to be limited by theory, it is believed that the
production of higher hydrocarbons proceeds through a stepwise
addition reaction including the formation of carbon-carbon, or
carbon-oxygen bond. The resulting reaction products include any
number of compounds containing these moieties, as described in more
detail below.
[0385] In certain embodiments, suitable condensation catalysts
include an acid catalyst, a base catalyst, or an acid/base
catalyst. As used herein, the term "acid/base catalyst" refers to a
catalyst that has both an acid and a base functionality. In some
embodiments the condensation catalyst can include, without
limitation, zeolites, carbides, nitrides, zirconia, alumina,
silica, aluminosilicates, phosphates, titanium oxides, zinc oxides,
vanadium oxides, lanthanum oxides, yttrium oxides, scandium oxides,
magnesium oxides, cerium oxides, barium oxides, calcium oxides,
hydroxides, heteropolyacids, inorganic acids, acid modified resins,
base modified resins, and any combination thereof. In some
embodiments, the condensation catalyst can also include a modifier.
Suitable modifiers include La, Y, Sc, P, B, Bi, Li, Na, K, Rb, Cs,
Mg, Ca, Sr, Ba, and any combination thereof. In some embodiments,
the condensation catalyst can also include a metal. Suitable metals
include Cu, Ag, Au, Pt, Ni, Fe, Co, Ru, Zn, Cd, Ga, In, Rh, Pd, Ir,
Re, Mn, Cr, Mo, W, Sn, Os, alloys, and any combination thereof.
[0386] In certain embodiments, the catalyst described in the
condensation reaction may include a catalyst support as described
above for the hydrogenation reaction. In certain embodiments, the
condensation catalyst is self-supporting. As used herein, the term
"self-supporting" means that the catalyst does not need another
material to serve as support. In other embodiments, the
condensation catalyst in used in conjunction with a separate
support suitable for suspending the catalyst. In an embodiment, the
condensation catalyst support is silica.
[0387] The conditions under which the condensation reaction occurs
will vary based on the type of starting material and the desired
products. One of ordinary skill in the art, with the benefit of
this disclosure, will recognize the appropriate conditions to use
to carry out the reaction. In some embodiments, the condensation
reaction is carried out at a temperature at which the
thermodynamics for the proposed reaction are favorable. The
temperature for the condensation reaction will vary depending on
the specific starting polyol or alcohol. In some embodiments, the
temperature for the condensation reaction is in a range from
80.degree. C. to 500.degree. C., and preferably from 125.degree. C.
to 450.degree. C., and most preferably from 125.degree. C. to
250.degree. C. In some embodiments, the condensation reaction is
conducted at pressures in a range between 0 Kpa to 9000 KPa, and
preferably in a range between 0 KPa and 7000 KPa, and even more
preferably between 0 KPa and 5000 KPa.
[0388] The higher alkanes formed by the invention include, but are
not limited to, branched or straight chain alkanes that have from 4
to 30 carbon atoms, branched or straight chain alkenes that have
from 4 to 30 carbon atoms, cycloalkanes that have from 5 to 30
carbon atoms, cycloalkenes that have from 5 to 30 carbon atoms,
aryls, fused aryls, alcohols, and ketones. Suitable alkanes
include, but are not limited to, butane, pentane, pentene,
2-methylbutane, hexane, hexene, 2-methylpentane, 3-methylpentane,
2,2,-dimethylbutane, 2,3-dimethylbutane, heptane, heptene, octane,
octene, 2,2,4-trimethylpentane, 2,3-dimethyl hexane,
2,3,4-trimethylpentane, 2,3-dimethylpentane, nonane, nonene,
decane, decene, undecane, undecene, dodecane, dodecene, tridecane,
tridecene, tetradecane, tetradecene, pentadecane, pentadecene,
nonyldecane, nonyldecene, eicosane, eicosene, uneicosane,
uneicosene, doeicosane, doeicosene, trieicosane, trieicosene,
tetraeicosane, tetraeicosene, and isomers thereof. Some of these
products may be suitable for use as fuels.
[0389] In some embodiments, the cycloalkanes and the cycloalkenes
are unsubstituted. In other embodiments, the cycloalkanes and
cycloalkenes are mono-substituted. In still other embodiments, the
cycloalkanes and cycloalkenes are multi-substituted. In the
embodiments comprising the substituted cycloalkanes and
cycloalkenes, the substituted group includes, without limitation, a
branched or straight chain alkyl having 1 to 12 carbon atoms, a
branched or straight chain alkylene having 1 to 12 carbon atoms, a
phenyl, and any combination thereof. Suitable cycloalkanes and
cycloalkenes include, but are not limited to, cyclopentane,
cyclopentene, cyclohexane, cyclohexene, methyl-cyclopentane,
methyl-cyclopentene, ethyl-cyclopentane, ethyl-cyclopentene,
ethyl-cyclohexane, ethyl-cyclohexene, isomers and any combination
thereof.
[0390] In some embodiments, the aryls formed are unsubstituted. In
another embodiment, the aryls formed are mono-substituted. In the
embodiments comprising the substituted aryls, the substituted group
includes, without limitation, a branched or straight chain alkyl
having 1 to 12 carbon atoms, a branched or straight chain alkylene
having 1 to 12 carbon atoms, a phenyl, and any combination thereof.
Suitable aryls for the invention include, but are not limited to,
benzene, toluene, xylene, ethyl benzene, para xylene, meta xylene,
and any combination thereof.
[0391] The alcohols produced in the invention have from 4 to 30
carbon atoms. In some embodiments, the alcohols are cyclic. In
other embodiments, the alcohols are branched. In another
embodiment, the alcohols are straight chained. Suitable alcohols
for the invention include, but are not limited to, butanol,
pentanol, hexanol, heptanol, octanol, nonanol, decanol, undecanol,
dodecanol, tridecanol, tetradecanol, pentadecanol, hexadecanol,
heptyldecanol, octyldecanol, nonyldecanol, eicosanol, uneicosanol,
doeicosanol, trieicosanol, tetraeicosanol, and isomers thereof.
[0392] The ketones produced in the invention have from 4 to 30
carbon atoms. In an embodiment, the ketones are cyclic. In another
embodiment, the ketones are branched. In another embodiment, the
ketones are straight chained. Suitable ketones for the invention
include, but are not limited to, butanone, pentanone, hexanone,
heptanone, octanone, nonanone, decanone, undecanone, dodecanone,
tridecanone, tetradecanone, pentadecanone, hexadecanone,
heptyldecanone, octyldecanone, nonyldecanone, eicosanone,
uneicosanone, doeicosanone, trieicosanone, tetraeicosanone, and
isomers thereof.
[0393] Another such chemical modification is interesterification.
Naturally produced glycerolipids do not have a uniform distribution
of fatty acid constituents. In the context of oils,
interesterification refers to the exchange of acyl radicals between
two esters of different glycerolipids. The interesterification
process provides a mechanism by which the fatty acid constituents
of a mixture of glycerolipids can be rearranged to modify the
distribution pattern. Interesterification is a well-known chemical
process, and generally comprises heating (to about 200.degree. C.)
a mixture of oils for a period (e.g, 30 minutes) in the presence of
a catalyst, such as an alkali metal or alkali metal alkylate (e.g.,
sodium methoxide). This process can be used to randomize the
distribution pattern of the fatty acid constituents of an oil
mixture, or can be directed to produce a desired distribution
pattern. This method of chemical modification of lipids can be
performed on materials provided herein, such as microbial biomass
with a percentage of dry cell weight as lipid at least 20%.
[0394] Directed interesterification, in which a specific
distribution pattern of fatty acids is sought, can be performed by
maintaining the oil mixture at a temperature below the melting
point of some TAGs which might occur. This results in selective
crystallization of these TAGs, which effectively removes them from
the reaction mixture as they crystallize. The process can be
continued until most of the fatty acids in the oil have
precipitated, for example. A directed interesterification process
can be used, for example, to produce a product with a lower calorie
content via the substitution of longer-chain fatty acids with
shorter-chain counterparts. Directed interesterification can also
be used to produce a product with a mixture of fats that can
provide desired melting characteristics and structural features
sought in food additives or products (e.g., margarine) without
resorting to hydrogenation, which can produce unwanted trans
isomers.
[0395] Interesterification of oils produced by the methods
described herein can be performed in conjunction with one or more
of the methods and/or materials, or to produce products, as
reported in the following: U.S. Pat. No. 6,080,853 (Nondigestible
fat substitutes); U.S. Pat. No. 4,288,378 (Peanut butter
stabilizer); U.S. Pat. No. 5,391,383 (Edible spray oil); U.S. Pat.
No. 6,022,577 (Edible fats for food products); U.S. Pat. No.
5,434,278 (Edible fats for food products); U.S. Pat. No. 5,268,192
(Low calorie nut products); U.S. Pat. No. 5,258,197 (Reduce calorie
edible compositions); U.S. Pat. No. 4,335,156 (Edible fat product);
U.S. Pat. No. 7,288,278 (Food additives or medicaments); U.S. Pat.
No. 7,115,760 (Fractionation process); U.S. Pat. No. 6,808,737
(Structural fats); U.S. Pat. No. 5,888,947 (Engine lubricants);
U.S. Pat. No. 5,686,131 (Edible oil mixtures); and U.S. Pat. No.
4,603,188 (Curable urethane compositions).
[0396] In one embodiment in accordance with the invention,
transesterification of the oil, as described above, is followed by
reaction of the transesterified product with polyol, as reported in
U.S. Pat. No. 6,465,642, to produce polyol fatty acid polyesters.
Such an esterification and separation process may comprise the
steps as follows: reacting a lower alkyl ester with polyol in the
presence of soap; removing residual soap from the product mixture;
water-washing and drying the product mixture to remove impurities;
bleaching the product mixture for refinement; separating at least a
portion of the unreacted lower alkyl ester from the polyol fatty
acid polyester in the product mixture; and recycling the separated
unreacted lower alkyl ester.
[0397] Transesterification can also be performed on microbial
biomass with short chain fatty acid esters, as reported in U.S.
Pat. No. 6,278,006. In general, transesterification may be
performed by adding a short chain fatty acid ester to an oil in the
presence of a suitable catalyst and heating the mixture. In some
embodiments, the oil comprises about 5% to about 90% of the
reaction mixture by weight. In some embodiments, the short chain
fatty acid esters can be about 10% to about 50% of the reaction
mixture by weight. Non-limiting examples of catalysts include base
catalysts, sodium methoxide, acid catalysts including inorganic
acids such as sulfuric acid and acidified clays, organic acids such
as methane sulfonic acid, benzenesulfonic acid, and toluenesulfonic
acid, and acidic resins such as Amberlyst 15. Metals such as sodium
and magnesium, and metal hydrides also are useful catalysts.
[0398] Another such chemical modification is hydroxylation, which
involves the addition of water to a double bond resulting in
saturation and the incorporation of a hydroxyl moiety. The
hydroxylation process provides a mechanism for converting one or
more fatty acid constituents of a glycerolipid to a hydroxy fatty
acid. Hydroxylation can be performed, for example, via the method
reported in U.S. Pat. No. 5,576,027. Hydroxylated fatty acids,
including castor oil and its derivatives, are useful as components
in several industrial applications, including food additives,
surfactants, pigment wetting agents, defoaming agents, water
proofing additives, plasticizing agents, cosmetic emulsifying
and/or deodorant agents, as well as in electronics,
pharmaceuticals, paints, inks, adhesives, and lubricants. One
example of how the hydroxylation of a glyceride may be performed is
as follows: fat may be heated, preferably to about 30-50.degree. C.
combined with heptane and maintained at temperature for thirty
minutes or more; acetic acid may then be added to the mixture
followed by an aqueous solution of sulfuric acid followed by an
aqueous hydrogen peroxide solution which is added in small
increments to the mixture over one hour; after the aqueous hydrogen
peroxide, the temperature may then be increased to at least about
60.degree. C. and stirred for at least six hours; after the
stirring, the mixture is allowed to settle and a lower aqueous
layer formed by the reaction may be removed while the upper heptane
layer formed by the reaction may be washed with hot water having a
temperature of about 60.degree. C.; the washed heptane layer may
then be neutralized with an aqueous potassium hydroxide solution to
a pH of about 5 to 7 and then removed by distillation under vacuum;
the reaction product may then be dried under vacuum at 100.degree.
C. and the dried product steam-deodorized under vacuum conditions
and filtered at about 50.degree. to 60.degree. C. using
diatomaceous earth.
[0399] Hydroxylation of microbial oils produced by the methods
described herein can be performed in conjunction with one or more
of the methods and/or materials, or to produce products, as
reported in the following: U.S. Pat. No. 6,590,113 (Oil-based
coatings and ink); U.S. Pat. No. 4,049,724 (Hydroxylation process);
U.S. Pat. No. 6,113,971 (Olive oil butter); U.S. Pat. No. 4,992,189
(Lubricants and lube additives); U.S. Pat. No. 5,576,027
(Hydroxylated milk); and U.S. Pat. No. 6,869,597 (Cosmetics). The
hydroxylation of ricinoleic acid provides a polyol.
[0400] Hydroxylated glycerolipids can be converted to estolides.
Estolides consist of a glycerolipid in which a hydroxylated fatty
acid constituent has been esterified to another fatty acid
molecule. Conversion of hydroxylated glycerolipids to estolides can
be carried out by warming a mixture of glycerolipids and fatty
acids and contacting the mixture with a mineral acid, as described
by Isbell et al., JAOCS 71(2): 169-174 (1994). Estolides are useful
in a variety of applications, including without limitation those
reported in the following: U.S. Pat. No. 7,196,124 (Elastomeric
materials and floor coverings); U.S. Pat. No. 5,458,795 (Thickened
oils for high-temperature applications); U.S. Pat. No. 5,451,332
(Fluids for industrial applications); U.S. Pat. No. 5,427,704 (Fuel
additives); and U.S. Pat. No. 5,380,894 (Lubricants, greases,
plasticizers, and printing inks).
[0401] Another such chemical modification is olefin metathesis. In
olefin metathesis, a catalyst severs the alkylidene carbons in an
alkene (olefin) and forms new alkenes by pairing each of them with
different alkylidine carbons. The olefin metathesis reaction
provides a mechanism for processes such as truncating unsaturated
fatty acid alkyl chains at alkenes by ethenolysis, cross-linking
fatty acids through alkene linkages by self-metathesis, and
incorporating new functional groups on fatty acids by
cross-metathesis with derivatized alkenes.
[0402] In conjunction with other reactions, such as
transesterification and hydrogenation, olefin metathesis can
transform unsaturated glycerolipids into diverse end products.
These products include glycerolipid oligomers for waxes;
short-chain glycerolipids for lubricants; homo- and
hetero-bifunctional alkyl chains for chemicals and polymers;
short-chain esters for biofuel; and short-chain hydrocarbons for
jet fuel. Olefin metathesis can be performed on triacylglycerols
and fatty acid derivatives, for example, using the catalysts and
methods reported in U.S. Pat. No. 7,119,216, US Patent Pub. No.
2010/0160506, and U.S. Patent Pub. No. 2010/0145086.
[0403] Olefin metathesis of bio-oils generally comprises adding a
solution of Ru catalyst at a loading of about 10 to 250 ppm under
inert conditions to unsaturated fatty acid esters in the presence
(cross-metathesis) or absence (self-metathesis) of other alkenes.
The reactions are typically allowed to proceed from hours to days
and ultimately yield a distribution of alkene products. One example
of how olefin metathesis may be performed on a fatty acid
derivative is as follows: A solution of the first generation Grubbs
Catalyst
(dichloro[2(1-methylethoxy-.alpha.-O)phenyl]methylene-.alpha.-C]
(tricyclohexyl-phosphine) in toluene at a catalyst loading of 222
ppm may be added to a vessel containing degassed and dried methyl
oleate. Then the vessel may be pressurized with about 60 psig of
ethylene gas and maintained at or below about 30.degree. C. for 3
hours, whereby approximately a 50% yield of methyl 9-decenoate may
be produced.
[0404] Olefin metathesis of oils produced by the methods described
herein can be performed in conjunction with one or more of the
methods and/or materials, or to produce products, as reported in
the following: Patent App. PCT/US07/081427 (.alpha.-olefin fatty
acids) and U.S. patent application Ser. No. 12/281,938 (petroleum
creams), Ser. No. 12/281,931 (paintball gun capsules), Ser. No.
12/653,742 (plasticizers and lubricants), Ser. No. 12/422,096
(bifunctional organic compounds), and Ser. No. 11/795,052 (candle
wax).
[0405] Other chemical reactions that can be performed on microbial
oils include reacting triacylglycerols with a cyclopropanating
agent to enhance fluidity and/or oxidative stability, as reported
in U.S. Pat. No. 6,051,539; manufacturing of waxes from
triacylglycerols, as reported in U.S. Pat. No. 6,770,104; and
epoxidation of triacylglycerols, as reported in "The effect of
fatty acid composition on the acrylation kinetics of epoxidized
triacylglycerols", Journal of the American Oil Chemists' Society,
79:1, 59-63, (2001) and Free Radical Biology and Medicine, 37:1,
104-114 (2004).
[0406] The generation of oil-bearing microbial biomass for fuel and
chemical products as described above results in the production of
delipidated biomass meal. Delipidated meal is a byproduct of
preparing algal oil and is useful as animal feed for farm animals,
e.g., ruminants, poultry, swine and aquaculture. The resulting
meal, although of reduced oil content, still contains high quality
proteins, carbohydrates, fiber, ash, residual oil and other
nutrients appropriate for an animal feed. Because the cells are
predominantly lysed by the oil separation process, the delipidated
meal is easily digestible by such animals. Delipidated meal can
optionally be combined with other ingredients, such as grain, in an
animal feed. Because delipidated meal has a powdery consistency, it
can be pressed into pellets using an extruder or expander or
another type of machine, which are commercially available.
[0407] Castor oil is a naturally occurring oil isolated from castor
beans. Hydrolysis of castor oil yields ricinoleic acid. The
production of castor oil from castor beans is difficult because
castor beans contain high amounts of ricin. Ricin is an extremely
dangerous toxin listed as a schedule 1 compound in the Chemical
Weapons Convention. Great care must therefore be taken in the
production of castor oil from castor beans. A hydroxylated oil
isolated from a microalgal cell is provided by an embodiment of the
invention. In this way, ricinoleic acid can be produced. In one
embodiment, the hydroxylated oil is a hydroxylated triglyceride.
The hydroxylated triglyceride of the present invention may be
chemically similar to castor oil. As shown in Example 7, the
invention provides a hydroxylated microbial oil. The oil of Example
7, when analyzed by GC/MS, showed that the inventors have produced
ricinoleic acid (12-hydroxy-9-cis-octadecenoic acid).
[0408] A fatty acid in accordance with an embodiment of the
invention is a hydroxylated fatty acid. One embodiment of the
hydroxylated fatty acid is ricinoleic acid.
[0409] The microbial hydroxylated oil or hydroxylated fatty acid
can be further hydroxylated. When ricinoleic acid is further
hydroxylated, a fatty acid containing two hydroxyl groups, a
polyol, is provided.
[0410] The invention provides a composition prepared by reacting a
polyol (e.g., hydroxylated oil and/or a hydroxylated fatty acid)
with a compound that contains an isocyanate moiety. Polyurethanes
using castor oil and an isocyanate have been produced.
Polyurethanes are ubiquitous in the products we use today.
Polyurethanes are found in automobiles, toys, athletic equipment,
consumer electronics, shoes, mattresses, cushions, adhesives,
construction materials, and the like. Currently, polyurethanes made
with castor oil are commercially available from BASF, Itoh Oil and
others. Polyurethanes made with hydroxylated soybean oil are
commercially available from Cargill, Dow, Bayer and others.
[0411] In an embodiment, ricinoleic acid produced by the microbial
cells may be further processed into an oleochemical product,
including a ricinoleic ester, ricinoleic amide, polyurethane,
polyurethane foam, or polyurethane part according to methods known
in the art. See, for example, U.S. Pat. Nos. 6,194,475, 4,266,617,
6,403,664, and 4,058,492, and US Patent Application No.
20100227151.
[0412] The invention, having been described in detail above, is
exemplified in the following examples, which are offered to
illustrate, but not to limit, the claimed invention.
VII. EXAMPLES
Example 1: Methods for Culturing Prototheca
[0413] Prototheca strains were cultivated to achieve a high
percentage of oil by dry cell weight. Cryopreserved cells were
thawed at room temperature and 500 ul of cells were added to 4.5 ml
of medium (4.2 g/L K.sub.2HPO.sub.4, 3.1 g/L NaH.sub.2PO.sub.4,
0.24 g/L MgSO.sub.4.7H.sub.2O, 0.25 g/L Citric Acid monohydrate,
0.025 g/L CaCl.sub.2 2H.sub.2O, 2 g/L yeast extract) plus 2%
glucose and grown for 7 days at 28.degree. C. with agitation (200
rpm) in a 6-well plate. Dry cell weights were determined by
centrifuging 1 ml of culture at 14,000 rpm for 5 min in a
pre-weighed Eppendorf tube. The culture supernatant was discarded
and the resulting cell pellet washed with 1 ml of deionized water.
The culture was again centrifuged, the supernatant discarded, and
the cell pellets placed at -80.degree. C. until frozen. Samples
were then lyophilized for 24 hrs and dry cell weights calculated.
For determination of total lipid in cultures, 3 ml of culture was
removed and subjected to analysis using an Ankom system (Ankom
Inc., Macedon, N.Y.) according to the manufacturer's protocol.
Samples were subjected to solvent extraction with an Amkom XT10
extractor according to the manufacturer's protocol. Total lipid was
determined as the difference in mass between acid hydrolyzed dried
samples and solvent extracted, dried samples. Percent oil dry cell
weight measurements are shown in Table 10.
TABLE-US-00010 TABLE 10 Percent oil by dry cell weight Species
Strain % Oil Prototheca stagnora UTEX 327 13.14 Prototheca
moriformis UTEX 1441 18.02 Prototheca moriformis UTEX 1435
27.17
[0414] Microalgae samples from multiple strains from the genus
Prototheca were genotyped. Genomic DNA was isolated from algal
biomass as follows. Cells (approximately 200 mg) were centrifuged
from liquid cultures 5 minutes at 14,000.times.g. Cells were then
resuspended in sterile distilled water, centrifuged 5 minutes at
14,000.times.g and the supernatant discarded. A single glass bead
.about.2 mm in diameter was added to the biomass and tubes were
placed at -80.degree. C. for at least 15 minutes. Samples were
removed and 150 .mu.l of grinding buffer (1% Sarkosyl, 0.25 M
Sucrose, 50 mM NaCl, 20 mM EDTA, 100 mM Tris-HCl, pH 8.0, RNase A
0.5 ug/ul) was added. Pellets were resuspended by vortexing
briefly, followed by the addition of 40 ul of 5M NaCl. Samples were
vortexed briefly, followed by the addition of 66 .mu.l of 5% CTAB
(Cetyl trimethylammonium bromide) and a final brief vortex. Samples
were next incubated at 65.degree. C. for 10 minutes after which
they were centrifuged at 14,000.times.g for 10 minutes. The
supernatant was transferred to a fresh tube and extracted once with
300 .mu.l of Phenol:Chloroform:Isoamyl alcohol 12:12:1, followed by
centrifugation for 5 minutes at 14,000.times.g. The resulting
aqueous phase was transferred to a fresh tube containing 0.7 vol of
isopropanol (.about.190 .mu.l), mixed by inversion and incubated at
room temperature for 30 minutes or overnight at 4.degree. C. DNA
was recovered via centrifugation at 14,000.times.g for 10 minutes.
The resulting pellet was then washed twice with 70% ethanol,
followed by a final wash with 100% ethanol. Pellets were air dried
for 20-30 minutes at room temperature followed by resuspension in
50 .mu.l of 10 mM TrisCl, 1 mM EDTA (pH 8.0).
[0415] Five .mu.l of total algal DNA, prepared as described above,
was diluted 1:50 in 10 mM Tris, pH 8.0. PCR reactions, final volume
20 .mu.l, were set up as follows. Ten .mu.l of 2.times. iProof HF
master mix (BIO-RAD) was added to 0.4 .mu.l primer SZ02613
(5'-TGTTGAAGAATGAGCCGGCGAC-3' (SEQ ID NO:9) at 10 mM stock
concentration). This primer sequence runs from position 567-588 in
Gen Bank accession no. L43357 and is highly conserved in higher
plants and algal plastid genomes. This was followed by the addition
of 0.4 .mu.l primer SZ02615 (5'-CAGTGAGCTATTACGCACTC-3' (SEQ ID
NO:10) at 10 mM stock concentration). This primer sequence is
complementary to position 1112-1093 in Gen Bank accession no.
L43357 and is highly conserved in higher plants and algal plastid
genomes. Next, 5 .mu.l of diluted total DNA and 3.2 .mu.l dH.sub.2O
were added. PCR reactions were run as follows: 98.degree. C., 45'';
98.degree. C., 8''; 53.degree. C., 12''; 72.degree. C., 20'' for 35
cycles followed by 72.degree. C. for 1 min and holding at
25.degree. C. For purification of PCR products, 20 .mu.l of 10 mM
Tris, pH 8.0, was added to each reaction, followed by extraction
with 40 .mu.l of Phenol:Chloroform:isoamyl alcohol 12:12:1,
vortexing and centrifuging at 14,000.times.g for 5 minutes. PCR
reactions were applied to S-400 columns (GE Healthcare) and
centrifuged for 2 minutes at 3,000.times.g. Purified PCR products
were subsequently TOPO cloned into PCR8/GW/TOPO and positive clones
selected for on LB/Spec plates. Purified plasmid DNA was sequenced
in both directions using M13 forward and reverse primers. In total,
twelve Prototheca strains were selected to have their 23 S rRNA DNA
sequenced and the sequences are listed in the Sequence Listing. A
summary of the strains and Sequence Listing Numbers is included
below. The sequences were analyzed for overall divergence from the
UTEX 1435 (SEQ ID NO: 15) sequence. Two pairs emerged (UTEX
329/UTEX 1533 and UTEX 329/UTEX 1440) as the most divergent. In
both cases, pairwise alignment resulted in 75.0% pairwise sequence
identity. The percent sequence identity to UTEX 1435 is also
included below:
TABLE-US-00011 Species Strain % nt identity SEQ ID NO. Prototheca
kruegani UTEX 329 75.2 SEQ ID NO: 11 Prototheca wickerhamii UTEX
1440 99 SEQ ID NO: 12 Prototheca stagnora UTEX 1442 75.7 SEQ ID NO:
13 Prototheca moriformis UTEX 288 75.4 SEQ ID NO: 14 Prototheca
moriformis UTEX 1439; 100 SEQ ID NO: 15 1441; 1435; 1437 Prototheca
wikerhamii UTEX 1533 99.8 SEQ ID NO: 16 Prototheca moriformis UTEX
1434 75.9 SEQ ID NO: 17 Prototheca zopfii UTEX 1438 75.7 SEQ ID NO:
18 Prototheca moriformis UTEX 1436 88.9 SEQ ID NO: 19
[0416] Lipid samples from a subset of the above-listed strains were
analyzed for lipid profile using HPLC. Results are shown below in
Table 11. Alternatively, lipid profiles can be determined using the
procedure outlines in Example 11.
TABLE-US-00012 TABLE 11 Diversity of lipid chains in Prototheca
species Strain C14:0 C16:0 C16:1 C18:0 C18:1 C18:2 C18:3 C20:0
C20:1 UTEX 0 12.01 0 0 50.33 17.14 0 0 0 327 UTEX 1.41 29.44 0.70
3.05 57.72 12.37 0.97 0.33 0 1441 UTEX 1.09 25.77 0 2.75 54.01
11.90 2.44 0 0 1435
[0417] Oil extracted from Prototheca moriformis UTEX 1435 (via
solvent extraction or using an expeller press was analyzed for
carotenoids, chlorophyll, tocopherols, other sterols and
tocotrienols. The results are summarized below in Table 12.
TABLE-US-00013 TABLE 12 Carotenoid, chlorophyll, tocopherol/sterols
and tocotrienol analysis in oil extracted from Prototheca
moriformis (UTEX 1435). Pressed oil Solvent extracted (mcg/ml) oil
(mcg/ml) cis-Lutein 0.041 0.042 trans-Lutein 0.140 0.112
trans-Zeaxanthin 0.045 0.039 cis-Zeaxanthin 0.007 0.013
t-alpha-Crytoxanthin 0.007 0.010 t-beta-Crytoxanthin 0.009 0.010
t-alpha-Carotene 0.003 0.001 c-alpha-Carotene none detected none
detected t-beta-Carotene 0.010 0.009 9-cis-beta-Carotene 0.004
0.002 Lycopene none detected none detected Total Carotenoids 0.267
0.238 Chlorophyll <0.01 mg/kg <0.01 mg/kg Tocopherols and
Sterols gamma Tocopherol 0.49 0.49 Campesterol 6.09 6.05
Stigmasterol 47.6 47.8 Beta-sitosterol 11.6 11.5 Other sterols 445
446 Tocotrienols alpha Tocotrienol 0.26 0.26 beta Tocotrienol
<0.01 <0.01 gamma Tocotrienol 0.10 0.10 detal Tocotrienol
<0.01 <0.01 Total Tocotrienols 0.36 0.36
[0418] Oil extracted from Prototheca moriformis, from four separate
lots, were refined and bleached using standard vegetable oil
processing methods. Briefly, crude oil extracted from Prototheca
moriformis was clarified in a horizontal decanter, where the solids
were separated from the oil. The clarified oil was then transferred
to a tank with citric acid and water and left to settle for
approximately 24 hours. After 24 hours, the mixture in the tank
formed 2 separate layers. The bottom layer was composed of water
and gums that were then removed by decantation prior to
transferring the degummed oil into a bleaching tank. The oil was
then heated along with another dose of citric acid. Bleaching clay
was then added to the bleaching tank and the mixture was further
heated under vacuum in order to evaporate off any water that was
present. The mixture was then pumped through a leaf filter in order
to remove the bleaching clay. The filtered oil was then passed
through a final 5 .mu.m polishing filter and then collected for
storage until use. The refined and bleached (RB) oil was then
analyzed for carotenoids, chlorophyll, sterols, tocotrienols and
tocopherols. The results of these analyses are summarized in Table
13 below. "Nd" denotes none detected and the sensitivity of
detection is listed below:
[0419] Sensitivity of Detection [0420] Carotenoids (mcg/g)
nd=<0.003 mcg/g [0421] Chlorophyll (mcg/g) nd=<0.03 mcg/g
[0422] Sterols (%) nd=0.25% [0423] Tocopherols (mcg/g); nd=3
mcg/g
TABLE-US-00014 [0423] TABLE 13 Carotenoid, chlorophyll, sterols,
tocotrienols and tocopherol analysis from refined and bleached
Prototheca moriformis oil. Lot A Lot B Lot C Lot D Carotenoids
(mcg/g) Lutein 0.025 0.003 nd 0.039 Zeaxanthin nd nd nd nd
cis-Lutein/Zeaxanthin nd nd nd nd trans-alpha-Cryptoxanthin nd nd
nd nd trans-beta-Cryptoxanthin nd nd nd nd trans-alpha-Carotene nd
nd nd nd cis-alpha-Carotene nd nd nd nd trans-beta-Carotene nd nd
nd nd cis-beta-Carotene nd nd nd nd Lycopene nd nd nd nd
Unidentified 0.219 0.066 0.050 0.026 Total Carotenoids 0.244 0.069
0.050 0.065 Chlorophyll (mcg/g) Chlorophyll A 0.268 0.136 0.045
0.166 Chlorophyll B nd nd nd nd Total Chlorophyll 0.268 0.136 0.045
0.166 Sterols (%) Brassicasterol nd nd nd nd Campesterol nd nd nd
nd Stigmasterol nd nd nd nd beta-Sitosterol nd nd nd nd Total
Sterols nd nd nd nd Tocopherols (mcg/g) alpha-Tocopherol 23.9 22.8
12.5 8.2 beta-Tocopherol 3.72 nd nd nd gamma-Tocopherol 164 85.3
43.1 38.3 delta-Tocopherol 70.1 31.1 18.1 14.3 Total Tocopherols
262 139.2 73.7 60.8 Tocotrienols (mcg/g) alpha-Tocotrienol 190 225
253 239 beta-Tocotrienol nd nd nd nd gamma-Tocotrienol 47.3 60.4
54.8 60.9 delta-Tocotrienol 12.3 16.1 17.5 15.2 Total Tocotrienols
250 302 325 315
[0424] The same four lots of Prototheca moriformis oil was also
analyzed for trace elements and the results are summarized below in
Table 14.
TABLE-US-00015 TABLE 14 Elemental analysis of refined and bleached
Prototheca moriformis oil. Lot A Lot B Lot C Lot D Elemental
Analysis (ppm) Calcium 0.08 0.07 <0.04 0.07 Phosphorous <0.2
0.38 <0.2 0.33 Sodium <0.5 0.55 <0.5 <0.5 Potassium
1.02 1.68 <0.5 0.94 Magnesium <0.04 <0.04 <0.04 0.07
Manganese <0.05 <0.05 <0.05 <0.05 Iron <0.02
<0.02 <0.02 <0.02 Zinc <0.02 <0.02 <0.02 <0.02
Copper <0.05 <0.05 <0.05 <0.05 Sulfur 2.55 4.45 2.36
4.55 Lead <0.2 <0.2 <0.2 <0.2 Silicon 0.37 0.41 0.26
0.26 Nickel <0.2 <0.2 <0.2 <0.2 Organic chloride
<1.0 <1.0 <1.0 2.2 Inorganic chloride <1.0 <1.0
<1.0 <1.0 Nitrogen 4.4 7.8 4.2 6.9 Lithium <0.02 <0.02
<0.02 <0.02 Boron 0.07 0.36 0.09 0.38 Aluminum -- <0.2
<0.2 <0.2 Vanadium <0.05 <0.05 <0.05 <0.05
Lovibond Color (.degree.L) Red 5.0 4.3 3.2 5.0 Yellow 70.0 70.0
50.0 70.0 Mono & Diglycerides by HPLC (%) Diglycerides 1.68
2.23 1.25 1.61 Monoglycerides 0.03 0.04 0.02 0.03 Free fatty acids
(FFA) 1.02 1.72 0.86 0.83 Soaps 0 0 0 Oxidized and Polymerized
Triglycerides Oxidized Triglycerides (%) 3.41 2.41 4.11 1.00
Polymerized Triglycerides 1.19 0.45 0.66 0.31 (%) Peroxide Value
(meg/kg) 0.75 0.80 0.60 1.20 p-Anisidine value 5.03 9.03 5.44 20.1
(dimensionless) Water and Other Impurities (%) Karl Fisher Moisture
0.8 0.12 0.07 0.18 Total polar compounds 5.02 6.28 4.54 5.23
Unsaponificable matter 0.92 1.07 0.72 1.04 Insoluble impurities
<0.01 <0.01 0.01 <0.01 Total oil (%) Neutral oil 98.8 98.2
99.0 98.9
Example 2: General Methods for Biolistic Transforming
Prototheca
[0425] Seashell Gold Microcarriers 550 nanometers were prepared
according to the protocol from manufacturer. Plasmid (20 .mu.g) was
mixed with 50 .mu.l of binding buffer and 60 .mu.l (30 mg) of S550d
gold carriers and incubated in ice for 1 min. Precipitation buffer
(100 .mu.l) was added, and the mixture was incubated in ice for
another 1 min. After vortexing, DNA-coated particles were pelleted
by spinning at 10,000 rpm in an Eppendorf 5415C microfuge for 10
seconds. The gold pellet was washed once with 500 .mu.l of cold
100% ethanol, pelleted by brief spinning in the microfuge, and
resuspended with 50 .mu.l of ice-cold ethanol. After a brief (1-2
sec) sonication, 10 .mu.l of DNA-coated particles were immediately
transferred to the carrier membrane.
[0426] Prototheca strains were grown in proteose medium (2 g/L
yeast extract, 2.94 mM NaNO3, 0.17 mM CaCl2*2H2O, 0.3 mM
MgSO4.7H2O, 0.4 mM K2HPO4, 1.28 mM KH2PO4, 0.43 mM NaCl) with 2%
glucose on a gyratory shaker until it reaches a cell density of
2.times.10.sup.6 cells/ml. The cells were harvested, washed once
with sterile distilled water, and resuspended in 50 .mu.l of
medium. 1.times.10.sup.7 cells were spread in the center third of a
non-selective proteose media plate. The cells were bombarded with
the PDS-1000/He Biolistic Particle Delivery system (Bio-Rad).
Rupture disks (1350 psi) were used, and the plates are placed 6 cm
below the screen/macrocarrier assembly. The cells were allowed to
recover at 25.degree. C. for 12-24 h. Upon recovery, the cells were
scraped from the plates with a rubber spatula, mixed with 100 .mu.l
of medium and spread on plates containing the appropriate
antibiotic selection. After 7-10 days of incubation at 25.degree.
C., colonies representing transformed cells were visible on the
plates. Colonies were picked and spotted on selective (either
antibiotic or carbon source) agar plates for a second round of
selection.
Example 3: Expression of Various Thioesterases in Prototheca
[0427] Methods and effects of expressing a heterologous
thioesterase gene in Prototheca species have been previously
described in PCT Application No. PCT/US2009/066142, hereby
incorporated by reference. The effect of other thioesterase
genes/gene products from higher plants species was further
investigated. These thioesterases include thioesterases from the
following higher plants:
TABLE-US-00016 GenBank Species Accession No. Specificity SEQ ID NO:
Cinnamomum Q39473 C14 SEQ ID NOs: 30-31 camphora Umbellularia
Q41635 C10-C12 SEQ ID NOs: 34-35 californica Cuphea hookeriana
AAC49269 C8-C10 SEQ ID NOs: 32-33 Cuphea palustris AAC49179 C8 SEQ
ID NOs: 36-37 Cuphea lanceolata CAB60830 C10 SEQ ID NOs: 38-39 Iris
germanica AAG43858.1 C14 SEQ ID NOs: 40-41 Myristica fragrans
AAB717291.1 C14 SEQ ID NOs: 42-43 Cuphea palustris AAC49180 C14 SEQ
ID NOs: 44-45 Ulmus americana AAB71731 broad SEQ ID NOs: 46-47
Myristica fragrans AAB71729 broad SEQ ID NOs: 145-146 Garcinia
AAB51525.1 C16 SEQ ID NOs: 147-148 mangostana Cuphea hookeriana
Q39513.1 C16 SEQ ID NOs: 149-150 Elaeis guiniensis AAD42220.2 C16
SEQ ID NO: 151-152 Brassica napus CAA52070.1 C18 SEQ ID NO: 153-154
Ricinus communis AB530422.1 C18:1 SEQ ID NO: 155-156
[0428] In all cases, each of the above thioesterase constructs was
transformed in to Prototheca moriformis (UTEX 1435) using biolistic
particle bombardment. Other transformation methods including
homologous recombination as disclosed in PCT Application No.
PCT/US2009/066142, would also be suitable for heterologous
expression of genes of interest. Transformation of Prototheca
moriformis (UTEX 1435) with each of the above thioesterase
constructs was performed using the methods described in Example 2.
Each of the constructs contained a NeoR gene and selection for
positive clones was carried out using 100 .mu.g/ml G418. All coding
regions were codon optimized to reflect the codon bias inherent in
Prototheca moriformis UTEX 1435 (see Table 2) nuclear genes. Both
amino acid sequences and the cDNA sequences for the construct used
are listed in the sequence identity listing. Unless otherwise
specified, the transit peptide for each of the higher plant
thioesterase was replaced with an algal codon optimized transit
peptide from Prototheca moriformis delta 12 fatty acid desaturase
(SEQ ID NO: 48)) or from Chlorella protothecoides stearoyl ACP
desaturase (SEQ ID NO: 49). All thioesterase constructs were driven
by the Chlamydomanas reinhardtii beta-tubulin promoter/5'UTR.
Growth and lipid production of selected positive clones were
compared to wildtype (untransformed) Prototheca moriformis (UTEX
1435). Wildtype and selected positive clones were grown on 2%
glucose G418 plates. Lipid profiles analysis on selected positive
clones for each construct is summarized below (expressed in Area %)
in Table 15.
TABLE-US-00017 TABLE 15 Lipid profiles of Prototheca moriformis
expressing various heterologous thioesterases. UTEX Thioesterase
Fatty 1435 U. C. palustris C. palustris U. Acid wt californica C.
camphora I. germanica M. fragrans C8:0 C. hookeriana C. lanceolata
C14:0 americana C8:0 0 0 0 0 3.1 1.8 0 0 .09 C10:0 0.02 .07 .02 .01
.09 .56 6.85 1.91 .01 2.85 C12:0 0.05 14 1.82 .09 .05 .25 .2 .29
.06 .74 C14:0 1.65 3 17.3 2.59 5.31 1.45 1.8 1.83 2.87 10.45 C16:0
28.0 21.4 24.3 26.52 31.08 22.84 23.9 25.55 27.23 33.3 C18:0 2.9
2.9 2.7 3.11 2.71 3.24 2.8 3.26 3.62 3.47 C18:1 53.8 45.2 41.3
49.96 39.77 56.62 49.8 55.43 51.04 38.71 C18:2 10.95 10 9.7 11.86
14.17 8.24 9.7 8.17 10.81 7.38 C18:3 .alpha. 0.8 .86 .8 .40 .64 .61
.9 .58 .97 .52 Total 32.62 44.97 46.14 32.32 39.24 31.44 37.35
32.84 33.79 50.9 saturates (area %)
[0429] The results show that all of the thioesterases expressed
impacted fatty acid profiles to some level. Looking at the "Total
saturates" row, the degree of saturation was profoundly impacted by
the expression of several of the thioesterases, including those
from U. californica, C. camphora, and most notably, U. americana.
These changes in the percentage of total saturates were unexpected
in that the heterologous expression of thioesterases from higher
plants can apparently impact more than just lipid chain lengths; it
can also impact other attributes of lipid profiles produced by
microalgae, namely the degree of saturation of the fatty acids.
[0430] Selected clones transformed with C. palustris C8
thioesterase, C. hookeriana thioesterase, U. californica and C.
camphora thioesterase were further grown in varying amounts of G418
(from 25 mg/L to 50 mg/L) and at varying temperatures (from
22.degree. C. to 25.degree. C.) and the lipid profile was
determined for these clones. Table 16 summarizes the lipid profile
(in Area %) of representative clones containing each thioesterase.
A second construct containing the U. americana thioesterase was
constructed and transformed into Prototheca moriformis (UTEX 1435)
using the biolistic methods described above. This second construct
was introduced into the cell via homologous recombination. Methods
of homologous recombination in Prototheca species were described
previously in PCT Application No. PCT/US2009/66142. The homologous
DNA that was used was from the 6S genomic DNA sequence from
Prototheca moriformis UTEX 1435 (donor sequences given in SEQ ID 92
and SEQ ID 84) The selection agent was the ability to grow on
sucrose, using a codon optimized suc2 gene from S. cereveisiae
driven by the C. reinhardtii beta tubulin promoter. The native U.
americana transit peptide was replaced by the Chlorella
protothecoides (UTEX 250) stearoyl ACP desaturase transit peptide.
The cDNA of this construct is listed in the Sequence Listing as SEQ
ID NO: 50. Selection of positive clones was performed on 2% sucrose
plates and the resulting cultures for lipid profile determination
was also grown on 2% sucrose containing medium. A representative
lipid profile for this Prototheca moriformis strain containing a
homologously recombined heterologous U. americana thioesterase is
summarized in Table 16.
TABLE-US-00018 TABLE 16 Lipid profiles of Prototheca moriformis
strains containing heterologous thioesterase genes. C. palustris U.
americana C8 C. hookeriana C. camphora 2 C8:0 12.28 2.37 0 0 C10:0
2.17 12.09 0.02 4.69 C12:0 0.34 0.33 3.81 1.02 C14:0 1.59 2.08
32.73 16.21 C16:0 15.91 20.07 24.03 38.39 C18:0 1.59 1.57 1.21 2.83
C18:1 50.64 41.80 18.64 27.22 C18:2 13.02 16.37 16.57 7.65 C18:3
.alpha. 1.52 1.75 1.66 0.74 Total 33.88 38.51 61.80 63.14
saturates
[0431] As with the clones described above, all transformants
containing a heterologous thioesterase gene showed impacted fatty
acid profiles to some level, and the total percent of saturated
fatty acids were also changed, as compared to wildtype
(untransformed) Prototheca moriformis. The Prototheca moriformis
containing the U. americana thioesterase introduced by homologous
recombination had the greatest increase in total saturates.
[0432] Additionally, transgenic clones containing the exogenous C.
hookeriana, C. camphora, U. californica or U. americana
thioesterase were assessed for novel lipid profiles. The C.
hookeriana thioesterase containing clone achieved the following
lipid profile when grown in 2% glucose, 25 mg/ml G418 at 22.degree.
C.: 5.10% C8:0; 18.28% C10:0; 0.41% C12:0; 1.76% C14:0; 16.31%
C16:0; 1.40% C18:0; 40.49% C18:1; and 13.16% C18:2. The C. camphora
thioesterase-containing clone (also containing an exogenous sucrose
invertase) achieved the following lipid profile when grown in 2%
sucrose at 25.degree. C.: 0.04% C10:0; 6.01% C12:0; 35.98% C14:0;
19.42 C16:0; 1.48% C18:0; 25.44% C18:1; and 9.34% C18:2. The U.
calfornica thioesterase containing clone achieved the following
lipid profile when grown in 2% glucose, 25-100 mg/ml G418 at
22.degree. C.: 0% C8:0; 0.11% C10:0; 34.01% C12:0; 5.75% C14:0;
14.02% C16:0; 1.10% C18:0; 28.93% C18:1; and 13.01% C18:2. The U.
americana thioesterase containing clone achieved the following
lipid profile when grown in 2% glucose at 28.degree. C.: 1.54%
C10:0; 0.43% C12:0; 7.56% C14:0; 39.45% C16:0; 2.49% C18:0; 38.49%
C18:1; and 7.88% C18:2.
[0433] Additional thioesterases from higher plants were also
introduced into a Prototheca moriformis UTEX 1435 genetic
background, and the codon-optimized cDNA sequences and amino acid
sequences are listed in the Sequence Listing as specified above.
These additional thioesterases include a broad specificity
thioesterase (C14:0-C18:0) from Myristica fragrans, a
C16:0-preferring thioesterase from Garcinia mangostana, a
C16:0-preferring thioesterase from Cuphea hookeriana, a
C16:0-preferring thioesterase from Elaeis guiniensis, a
C18:0-preferring thioesterase from Brassica napus, and a
C18:1-preferring thioesterase from Ricinus communis. Details of the
expression constructs and the resulting transgenic clones from each
of the above transgene/transformations are described below.
[0434] A broad specificity thioesterase (C14:0-C18:0) thioesterase
from Myristica fragrans was introduced into a Prototheca moriformis
UTEX 1435 genetic background using methods described above. Two
different expression constructs were tested, each containing a
different plastid targeting sequences. In both constructs, the S.
cerevisiae sucrose invertase gene suc2 was utilized as a selectable
marker, conferring to positive transformants the ability to grow on
plates with sucrose as the sole carbon source. Both expression
constructs, pSZ1318 and pSZ1317 contained a 5' (SEQ ID NO: 82) and
3' (SEQ ID NO: 84) homologous recombination targeting sequences
(flanking the construct) to the 6S genomic region for integration
into the nuclear genome and a S. cerevisiae suc2 sucrose invertase
coding region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159. pSZ1318 contained the M. fragrans thioesterase coding region
with the native transit peptide replaced with the transit peptide
from Prototheca moriformis delta 12 FAD (SEQ ID NO: 48) under the
control of the Prototheca moriformis Amt03 promoter (SEQ ID NO: 89)
and the C. vulgaris nitrate reductase 3'UTR. The codon-optimized M.
fragrans thioesterase with the transit peptide from Prototheca
moriformis delta 12 FAD is listed as SEQ ID NO: 145. pSZ1317
contained the M. fragrans coding region with the native transit
peptide replaced with the transit peptide from Chlorella
protothecoides stearoyl ACP desaturase (SEQ ID NO: 49) under the
control of the Prototheca moriformis Amt03 promoter (SEQ ID NO: 89)
and the C. vulgaris nitrate reductase 3' UTR. The codon-optimized
M. fragrans thioesterase with the transit peptide from C.
protothecoides stearoyl ACP desaturase is listed as SEQ ID NO: 158.
Both expression constructs, pSZ1318 and pSZ1317 were transformed
into Prototheca cells and selection was carried out on plates where
sucrose was the sole-carbon source. Positive clones were selected
from each transformation and grown in medium with sucrose as the
sole carbon source under nitrogen-limited conditions for lipid
production. Lipid profiles of a subset of the positive clones
selected were determined using direct transesterification methods
described above and are summarized in Table 17.
TABLE-US-00019 TABLE 17 Lipid profiles of Myristica fragrans broad
specificity thioesterase transgenic Prototheca cells. Strain C10:0
C12:0 C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.01 0.03 1.17 25.86
2.84 58.33 9.16 pSZ1318 0.03 0.23 16.09 37.72 6.11 27.39 9.98 clone
A pSZ1318 0.03 0.22 15.74 37.17 6.23 28.16 9.94 clone B pSZ1318
0.03 0.22 14.97 36.05 5.87 30.48 9.86 clone C pSZ1317 0.02 0.21
15.23 36.62 5.11 31.83 8.76 clone A pSZ1317 0.03 0.27 18.06 38.88
5.64 26.11 8.90 clone B pSZ1317 0.02 0.24 16.19 37.02 5.61 29.52
9.19 clone C
[0435] The positive clones containing a Myristica fragrans
thioesterase transgene displayed altered lipid profiles. However,
the above summarized results showed an unexpected result; in higher
plants, the Myristica fragrans thioesterase exhibits significant
activity on C16:0 fatty acyl-ACPs (Voelker et al., 1997), whereas,
in Prototheca cells, the Myristica fragrans thioesterase seem to
have a gradation of impact on C14:0>C18:0>C16:0 and is more
broad based than just C16:0.
[0436] A C16:0-preferring thioesterase from Garcinia mangostana was
introduced into a Prototheca moriformis UTEX 1435 genetic
background, and the codon-optimized cDNA sequences and amino acid
sequences are listed in the Sequence Listing as specified above.
The expression construct contained a 5' (SEQ ID NO: 82) and 3' (SEQ
ID NO: 84) homologous recombination targeting sequences (flanking
the construct) to the 6S genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. The G. manogstana coding
region was under the control of the Prototheca moriformis Amt03
promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase
3'UTR. The G. manogstana native transit peptide was also replaced
with the transit peptide from C. protothecoides stearoyl desaturase
(SEQ ID NO: 49) and the cDNA sequence of the thioesterase with the
replaced transit peptide is listed as SEQ ID NO: 147. The entire
Garcinia mangostana expression cassette was termed pSZ1452 and
transformed into a Prototheca moriformis genetic background.
Positive clones were screened on plates with sucrose as the sole
carbon source. A subset of the positive clones were selected and
grown under lipid production conditions and lipid profiles were
determined using direct transesterification methods as described
above. The lipid profiles of the selected clones are summarized in
Table 18 below.
TABLE-US-00020 TABLE 18 Lipid profiles of Garcinia mangostana
C16:0-preferring thioesterase transgenic Prototheca cells. Strain
C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.01 0.03 1.17
25.86 2.84 58.33 9.16 pSZ1452 0.02 0.07 5.52 62.77 4.36 18.99 6.29
clone A pSZ1452 0.02 0.08 5.69 61.66 4.76 19.28 6.54 clone B
pSZ1452 0.01 0.05 3.44 57.97 4.21 24.76 7.38 clone C
[0437] The results show that transformants with the G. mangostana
thioesterase transgene have significantly impacted C16:0 fatty acid
levels and to a lesser extent, impacted C14:0 and C18:0 fatty acid
levels, along with a sharp decrease in C18:1 fatty acid levels as
compared to wildtype.
[0438] A C16:0-preferring thioesterase from Cuphea hookeriana was
introduced into a Prototheca moriformis UTEX 1435 genetic
background. Two expression constructs were created, one with the
native Cuphea hookeriana C16-preferring thioesterase transit
peptide sequence, termed pSZ1417, and a second where the native
transit peptide sequence was replaced with the transit peptide from
C. protothecoides stearoyl-ACP desaturase (SEQ ID NO: 49), termed
pSZ1462. The coding sequence of the C. hookeriana thioesterase with
the native transit peptide is listed as SEQ ID NO: 149 and the
coding sequence of the C. hookeriana thioesterase with the replaced
transit peptide is listed as SEQ ID NO: 160. Both expression
constructs contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84)
homologous recombination targeting sequences (flanking the
construct) to the 6S genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. In both constructs, the C.
hookeriana coding region was under the control of the Prototheca
moriformis Amt03 promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris
nitrate reductase 3'UTR. Both constructs were transformed into a
Prototheca moriformis genetic background and positive clones were
screened on plates with sucrose as the sole carbon source. A subset
of the positive clones were selected and grown under lipid
production conditions and lipid profiles were determined using
direct transesterification methods as described above. The lipid
profiles of the selected clones are summarized in Table 19
below.
TABLE-US-00021 TABLE 19 Lipid profiles of Cuphea hookeriana C16:0
preferring thioesterase transgenic Prototheca cells. Strain C10:0
C12:0 C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.01 0.03 1.17 25.86
2.84 58.33 9.16 pSZ1417 0.02 0.06 4.21 55.29 2.59 26.87 9.02 clone
A pSZ1417 0.02 0.06 4.12 54.57 2.31 26.43 10.45 clone B pSZ1417
0.01 0.05 3.59 53.18 2.60 29.02 9.48 clone C pSZ1462 0.02 0.11
10.62 67.42 2.18 12.95 5.13 clone A pSZ1462 0.03 0.11 8.88 66.83
2.30 15.32 5.16 clone B pSZ1462 0.03 0.11 9.28 66.65 2.27 15.19
5.14 clone C pSZ1462 0.02 0.09 8.30 66.36 2.27 16.52 5.01 clone
D
[0439] The results show that transformants with either of the
Cuphea hookeriana C16:0-preferring thioesterase constructs have
significantly impacted C16:0 fatty acid levels and to a lesser
extent an impacted C14:0 fatty acid levels, along with a sharp
decrease in C18:1 fatty acid levels as compared to wildtype. The
difference in transit peptides in the two constructs may account
for the increased C16:0 fatty acid levels in the pSZ1462
transformants compared to the pSZ1417 transformants.
[0440] Two C16:0-preferring thioesterases from Elaeis guiniensis
(African oil palm) corresponding to the amino acid sequence in
Genbank Accession Nos. AAD422220.2 (SEQ ID NO: 152) and ABD83939
(SEQ ID NO: 162), termed E. guiniensis palmitoyl-ACP thioesterase
and E. guiniensis palmitoyl-ACP thioesterase PATE, respectively,
was introduced into a Prototheca moriformis UTEX 1435 genetic
background. The codon-optimized cDNA sequences and amino acid
sequences are listed in the Sequence Listing as specified above.
The two thioesterases share a significant level of amino acid
identity (over 94%), but their respective roles in the African oil
palm plant is still unclear. The construct encoding the E.
guiniensis palmitoyl-ACP thioesterase was termed pSZ1437, and the
construct encoding the E. guiniensis palmitoyl-ACP thioesterase
PATE was termed pSZ1436. Both expression constructs contained a 5'
(SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination
targeting sequences (flanking the construct) to the 6S genomic
region for integration into the nuclear genome and a S. cerevisiae
suc2 sucrose invertase coding region under the control of C.
reinhardtii .beta.-tubulin promoter/5'UTR and Chlorella vulgaris
nitrate reductase 3' UTR. This S. cerevisiae suc2 expression
cassette is listed as SEQ ID NO: 159 and served as a selection
marker. In both constructs, the E. guiniensis thioesterase coding
region was under the control of the Prototheca moriformis Amt03
promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase
3'UTR. Both constructs were transformed into a Prototheca
moriformis genetic background and positive clones were screened on
plates with sucrose as the sole carbon source. A subset of the
positive clones were selected and grown under lipid production
conditions and lipid profiles were determined using direct
transesterification methods as described above. The lipid profiles
of the selected clones are summarized in Table 20 below.
TABLE-US-00022 TABLE 20 Lipid profiles of Elaeis guiniensis C16:0
preferring thioesterase transgenic Prototheca cells. Strain C10:0
C12:0 C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.01 0.03 1.17 25.86
2.84 58.33 9.16 pSZ1437 0.02 0.07 3.82 55.86 3.12 24.47 10.48 clone
A pSZ1437 0.02 0.05 3.01 53.23 3.47 28.70 9.26 clone B pSZ1437 0.02
0.06 3.33 53.20 3.30 26.64 11.19 clone C pSZ1437 0.02 0.05 3.08
52.88 3.60 27.94 10.16 clone D pSA1437 0.02 0.05 3.01 52.84 3.48
28.46 9.87 clone E pSZ1436 0.01 0.04 1.48 29.54 3.33 52.26 10.58
clone A pSZ1436 0.01 0.04 1.48 29.43 3.33 52.11 10.76 clone B
pSZ1436 0.01 0.04 1.50 29.25 3.38 52.07 10.89 clone C pSZ1436 0.01
0.04 1.51 29.18 3.41 51.80 11.17 clone D pSZ1436 0.01 0.04 1.54
29.14 3.56 51.43 11.42 clone E
[0441] The E. guiniensis C16:0-preferring thioesterase encoded by
pSZ1437 had a significant impact on the C16:0 fatty acid levels, to
a lesser extend, the C14:0 fatty acid levels, and a sharp decrease
in the C18:1 fatty acid levels when compared to wildtype.
Surprising, the E. guiniensis C16:0-preferring thioesterase PATE
encoded by pSZ1436, despite the significant level of amino acid
identity to the thioesterase encoded by pSZ1436, had relatively
little activity with regard to C16:0 or C14:0 fatty acid
levels.
[0442] A C18:0-preferring thioesterase from Brassica napus was
introduced into a Prototheca moriformis UTEX 1435 genetic
background, and the codon-optimized cDNA sequences and amino acid
sequences are listed in the Sequence Listing as specified above.
The expression construct contained a 5' (SEQ ID NO: 82) and 3' (SEQ
ID NO: 84) homologous recombination targeting sequences (flanking
the construct) to the 6S genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. The B. napus coding region
was under the control of the Prototheca moriformis Amt03
promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase
3'UTR. The entire Brassica napus expression cassette was termed
pSZ1358 and transformed into a Prototheca moriformis genetic
background. Positive clones were screened on plates with sucrose as
the sole carbon source. A subset of the positive clones were
selected and grown under lipid production conditions and lipid
profiles were determined using direct transesterification methods
as described above. The lipid profiles of the selected clones are
summarized in Table 21 below.
TABLE-US-00023 TABLE 21 Lipid profiles of Brassica napus
C18:0-preferring thioesterase transgenic Prototheca cells. Strain
C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.00 0.04 1.18
25.44 3.42 57.97 6.98 pSZ1358 0.07 0.31 1.51 33.27 27.26 27.37 7.50
clone A pSZ1358 0.07 0.33 1.60 34.73 26.71 26.52 7.32 clone B
[0443] The results show that transformants with the Brassica napus
C18:0-preferring thioesterase transgene have significantly impacted
C18:0 fatty acid levels and to a lesser extent, impacted C16:0
fatty acid levels, along with a sharp decrease in C18:1 fatty acid
levels as compared to wildtype.
[0444] A fatty acyl-ACP thioesterase from Ricinus communis was
introduced into a Prototheca moriformis UTEX 1435 genetic
background, and the codon-optimized cDNA sequences and amino acid
sequences are listed in the Sequence Listing as specified above.
The expression construct contained a 5' (SEQ ID NO: 82) and 3' (SEQ
ID NO: 84) homologous recombination targeting sequences (flanking
the construct) to the 6S genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. The R. communis coding region
was under the control of the Prototheca moriformis Amt03
promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase
3'UTR. The Ricinus communis native transit peptide was also
replaced with the transit peptide from C. protothecoides stearoyl
desaturase (SEQ ID NO: 49) and the cDNA sequence of the
thioesterase with the replaced transit peptide is listed as SEQ ID
NO: 155. The entire Ricinus communis expression cassette was termed
pSZ1375 and transformed into a Prototheca moriformis genetic
background. Positive clones were screened on plates with sucrose as
the sole carbon source. A subset of the positive clones were
selected and grown under lipid production conditions and lipid
profiles were determined using direct transesterification methods
as described above. The lipid profiles of the selected clones are
summarized in Table 22 below.
TABLE-US-00024 TABLE 22 Lipid profiles of Ricinus communis
ACP-thioesterase transgenic Prototheca cells. Strain C10:0 C12:0
C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.01 0.03 0.98 24.65 3.68
62.48 6.26 pSZ1375 0.01 0.03 0.91 18.34 2.55 67.93 8.35 clone A
pSZ1375 0.01 0.03 0.97 18.51 2.47 67.83 8.25 clone B pSZ1375 0.01
0.03 0.93 18.65 2.84 67.58 7.90 clone C pSZ1375 0.01 0.03 0.92
18.90 2.30 67.48 8.37 clone D
[0445] The results show that transformants with the Ricinus
communis thioesterase transgene have impacted levels of C16:0 fatty
acids and to a lesser extent, C18:0 fatty acid levels. Also, there
was a concomitant increase in the C18:1 fatty acid level when
compared to the wildtype level.
Example 4: Transformation of Prototheca with Multiple Exogenous
Heterologous Thioesterase Genes
[0446] Microalgae strain Prototheca moriformis (UTEX 1435) was
transformed using the above disclosed methods to express multiple
thioesterases in a single clone. The expression of multiple
thioesterases in a single clone allows the microaglae to produce
oils with fatty acid profiles completely different from those
elaborated when any single thioesterase is expressed alone (as
demonstrated in the preceding Examples). Prototheca moriformis
(UTEX 1435) was first transformed with the Cinnamomum camphora
thioesterase (a C14 preferring thioesterase) along with a sucrose
invertase gene, the suc2 from S. cerevisiae (selection was the
ability to grow on sucrose) using homologous recombination. The DNA
used for this homologous recombination construct is from the KE858
region of Prototheca moriformis genomic DNA as described in the
Section III above. The relevant portion of this construct is listed
in the Sequence Listing as SEQ ID NO: 51. Positive clones were
screened on sucrose-containing plates. A positive clone was then
re-transformed with one of three cassettes, each encoding
resistance to the antibiotic G418 as well as an additional
thioesterase: (1) thioesterase gene from Cuphea hookeriana (C8-10
preferring), SEQ ID NO: 52; (2) thioesterase gene from Umbellularia
californica (C12 preferring), SEQ ID NO: 53; or thioesterase from
Ulmus americana (broad; C10-C16 preferring), SEQ ID NO: 54.
Included in the Sequence Listing is the sequence of the relevant
portion of each construct. Clones expressing both thioesterase
genes were screened on sucrose containing medium with 50 .mu.g/ml
G418. Positive clones were selected and growth and lipid profile
were assayed. Table 23 summarizes the lipid profile of
representative positive clones (expressed in Area %).
TABLE-US-00025 TABLE 23 Lipid profiles of Prototheca moriformis
transformed with multiple thioesterases. UTEX 1435 + C. camphora TE
genetic background Fatty UTEX UTEX 1435 + +C. hookeriana +U.
californica +U. americana Acid 1435 C. camphora TE TE TE TE C8:0 0
0 0.19 0 0.06 C10:0 0.02 0.02 2.16 0.07 1.87 C12:0 0.05 0.66 0.53
13.55 1.61 C14:0 1.65 10.52 7.64 8.0 14.58 C16:0 28.0 22.56 22.31
19.98 29.53 C18:0 2.9 6.67 3.23 2.24 2.93 C18:1 53.8 47.78 48.54
42.55 37.3 C18:2 10.95 12.3 11.76 10.13 8.9 C18:3 .alpha. 0.8 0.93
0.91 0.91 0.76 Total 32.62 40.43 36.06 43.84 50.58 saturates (Area
%)
[0447] Additionally, a double thioesterase clone with C. camphora
and U. californica thioesterases was grown in 2% sucrose containing
medium with 50 mg/L G418 at 22.degree. C. The fatty acid profile
obtained from this strain under these growth conditions was: C8:0
(0); C10:0 (0.10); C12:0 (31.03); C14:0 (7.47); C16:0 (15.20);
C18:0 (0.90); C18:1 (30.60); C18:2 (12.44); and C18:3a (1.38), with
a total saturates of 54.7.
[0448] Double thioesterase clones with two homologous recombination
constructs (one targeting the 6S region and the other targeting the
KE858 region) containing the C. camphora thioestease were produced.
A positive representative clone had a fatty acid profile of: 0%
C8:0; 0.06% C10:0; 5.91% C12:0; 43.27% C14:0; 19.63% C16:0; 0.87%
C18:0; 13.96% C18:1; and 13.78% C18:2, with a total saturates at
69.74%. This clone had a C12-C14 level at over 49%, which is over
37 times the C12-C14 level in wildtype cells.
[0449] The above data shows that multiple thioesterases can be
successfully co-expressed in microalgae. The co-expression of
multiple thioesterases results in altered fatty acid profiles that
differ significantly not only from the wild type strain, but also
from the fatty acid profile obtained by the expression of any one
of the individual thioesterases. The expression of multiple
thioesterases with overlapping chain length specificity can result
in cumulative increases in those specific fatty acids.
[0450] The expression of heterologous thioesterases (either alone
or in combination) in Prototheca moriformis not only alters the
fatty acid/lipid profiles in the host strain, but when compared to
oils currently available from a variety of seed crops (Table 5),
these profiles are of truly unique oils found in no other currently
available system. Not only do the transgenic strains show
significant differences from the untransformed wildtype strain,
they have remarkably different profiles from any of the commercial
oils that are shown in Table 5. As an example, both coconut and
palm kernel oils have levels of C8-C10 fatty acids ranging from
5.5-17%. Transgenic strain expressing the C. palustris
C8-preferring thioesterase or the C. hookeriana C10-preferring
thioesterase accumulates anywhere from 3.66 to 8.65%, respectively.
These C8-C10 fatty acid levels are similar to coconut oil and palm
kernel, however, the transgenic algal strains lack the
significantly higher C12:0 fatty acids, and they have extremely
high C16:0 (23% in transgenics versus 11-16% in coconut or palm
kernel oil, respectively and/or 18:1 (50-57% in transgenics
versus-8-19% in coconut or palm kernel oil, respectively.
[0451] Generation of Laurate and Myristate Rich Oils in Strain
UTEX1435 by the Expression of Cuphea wrightii Thioesterases:
[0452] Seeds of Cuphea wrightii have been shown to accumulate oil
containing over 25% C10:0 and over 65% C12:0 fatty acids. Two FatB
thioesterases, CwFatB1 (Gen Bank Accession no. U56103) and CwFatB2
(Gen Bank Accession no. U56104), have been cloned from Cuphea
wrightii (as described in Leonard et al., Plant Mol. Biol.
34(4):669-79 (1997)) and expressed in Arabidopsis thaliana (as
described in Leonard et al., Plant J. 13(5):621-8 (1998)). Fatty
acid profiles of A. thaliana transgenic lines expressing CwFatB1
and CwFatB2 show increased C12:0 fatty acid species up to 16% to
25% (Leonard et al, 1998, supra). Here we demonstrate the ability
to generate laurate and myristate rich oils by expressing the
Cuphea wrightii thioesterases, CwFatB1 and CwFatB2, in strain
UTEX1435. In the example described here, transgenic strains
expressing CwFatB1 and CwFatB2 were generated using the
transformation methodology described before.
[0453] Amino acid sequences of CwFatB1 and CwFatB2 are shown below
with the predicted chloroplast targeting sequences underlined.
These primary amino acid sequences were used to synthesize the
corresponding genes for transformation constructs. The nucleotide
sequences of the two genes were optimized for expression in strain
UTEX 1435 utilizing its preferred codon usage as previously
described.
TABLE-US-00026 CwFatB1 (U56103): (SEQ ID NO: 186)
MVAAAASSAFFSVPTPGTSPKPGKFGNWPSSLSVPFKPDNGGFVKANASA
HPKANGSAVNLKSGSLETPPRSFINQLPDLSMLLSKITTVFGAAEKQWKR
PGMLVEPFGVDRIFQDGVFFRQSFSIRSYEIGVDRTASIETLMNIFQETS
LNHCKSIGLLNDGFGRTPEMCKRDLIWVVTKIQVEVNRYPTWGDTIEVNT
WVSESGKNGMGRDWLISDCRTGEILIRATSVWAMMNQNTRRLSKFPYEVR
QEIAPHFVDSAPVIEDDRKLHKLDVKTGDSIRDGLTPRWNDLDVNQHVNN
VKYIGWILKSVPIEVFETQELCGVTLEYRRECGRDSVLESVTTMDPAKEG
DRCVYQHLLRLEDGADITIGRTEWRPKNAGANGAISSGKTSNGNSVS CwFatB2 (U56104):
(SEQ ID NO: 187) MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVK
ANVSPHPKANGSAVSLKSGSLNTLEDPPSSPPPRTFLNQLPDWSRLRTAI
TTVFVAAEKQFTRLDRKSKRPDMLVDWFGSETIVQDGLVFRERFSIRSYE
IGADRTASIETLMNHLQDTSLNHCKSVGLLNDGFGRTPEMCTRDLIWVLT
KMQIVVNRYPTWGDTVEINSWFSQSGKIGMGREWLISDCNTGEILVRATS
AWAMMNQKTRRFSKLPCEVRQEIAPHFVDAPPVIEDNDRKLHKFDVKTGD
SICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYR
RECGRESVVESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNA GTNRAIST
[0454] Transformation of UTEX1435 with C. wrightii
Thioesterases:
[0455] In this example, UTEX 1435 strain was used as the recipient
strain into which cassettes expressing the C. wrightii FatB1 and
FatB2 thioesterases were introduced. The transformation constructs
contain a cassette allowing for selection on sucrose (the
Saccharomyces cerevesiae suc2 gene) along with the thioesterases.
Cells were transformed as previously described using biolistics.
Cells were transformed directly on media containing 2% sucrose.
Transformation constructs were made such that the expression of the
thioesterases were driven either by the C. reinhardtii
.beta.-tubulin promoter or by the endogenous UTEX 1435 Amt3
promoter.
[0456] Additional versions of the thioesterase cassettes were made
in which the native, higher plant transit peptides were replaced by
algal transit peptides. The transit peptides used in these
constructs are designated as follows: TP1 encodes a transit peptide
for Stearoyl ACP desaturase derived from UTEX250; TP2 encodes a
transit peptide for Stearoyl ACP desaturase from derived from UTEX
1435; TP3 encodes a transit peptide of delta 12 Fatty Acid
desaturase derived from UTEX 1435; and TP4 encodes a transit
peptide of isopentenyl diphosphate synthase derived from UTEX 1435.
The constructs used in this example are listed in Table 24
below.
TABLE-US-00027 TABLE 24 TE constructs. Construct Description Const.
1 6S-CrbTub_suc2_nr::CrbTub_CwFatB1_nr-6S Const. 2
6S-CrbTub_suc2_nr::CrbTub_CwFatB2_nr-6S Const. 3
6S-CrbTub_suc2_nr::Amt3_CwFatB1_nr-6S Const. 4
6S-CrbTub_suc2_nr::Amt3_CwFatB2_nr-6S Const. 5
6S-CrbTub_suc2_nr::CrbTub_TP1-CwFatB1_nr-6S Const. 6
6S-CrbTub_suc2_nr::CrbTub_TP2-CwFatB1_nr-6S Const. 7
6S-CrbTub_suc2_nr::CrbTub_TP3-CwFatB1_nr-6S Const. 8
6S-CrbTub_suc2_nr::CrbTub_TP4-CwFatB1_nr-6S Const. 9
6S-CrbTub_suc2_nr::CrbTub_TP1-CwFatB2_nr-6S Const. 10
6S-CrbTub_suc2_nr::CrbTub_TP2-CwFatB2_nr-6S Const. 11
6S-CrbTub_suc2_nr::CrbTub_TP3-CwFatB2_nr-6S Const. 12
6S-CrbTub_suc2_nr::CrbTub_TP4-CwFatB2_nr-6S
[0457] Transforming DNA expressing suc2 and the C. wrightii FatB1
thioesterase (Const. 1):
[0458] The sequence of the transforming construct,
6S-CrbTub_suc2_nr::CrbTub_CwFatB1_nr-6S, designated as Const. 1 is
given below. Relevant restriction sites are indicated in lowercase,
bold and underlining and are 5'-3' SapI, KpnI, AscI, Mfe, BamHI,
EcoRI, SpeI, AscI, XhoI, SacI and SapI, respectively. SapI sites
delimit the 5' and 3' ends of the transforming DNA. Underlined
sequences at the 5' and 3' flanks of the construct represent
genomic DNA from UTEX1435 that permit targeted integration of the
transforming DNA via homologous recombination (6S region).
Proceeding in the 5' to 3' direction, the C. reinhardtii
.beta.-tubulin promoter driving the expression of S. cerevisiae
suc2 gene (encoding sucrose hydrolyzing activity thereby permitting
the strain to grow on sucrose) is indicated by lowercase, boxed
text. The initiator ATG and terminator TGA for suc2 are indicated
by uppercase, bold italics while the coding region is indicated in
lowercase italics. The Chlorella vulgaris nitrate reductase 3' UTR
is indicated by lowercase bold text followed by a spacer region.
The C. reinhardtii .beta.-tubulin promoter, driving expression of
the C. wrightii TE (CwFatB1) is indicated by boxed text. The
initiator ATG and terminator TGA of the thioesterase (CwFatB1) are
indicated in uppercase, bold italicized text while the remainder of
the coding region is indicated in lowercase italics. The predicted
plastid targeting sequence of the thioesterase lies between the
initiator ATG and the AscI site in the sequence. The C. vulgaris
nitrate reductase 3'UTR is indicated by bold text.
TABLE-US-00028 Constuct 1: (SEQ ID NO: 188)
gctcttcgccgccgccactcctgctcgagcgcgcccgcgcgtgcgccgccagcgccttggccttttcgccgcgc-
tcgtgcgcgtcg
ctgatgtccatcaccaggtccatgaggtctgccttgcgccggctgagccactgcttcgtccgggcggccaagag-
gagcatgaggga
ggactcctggtccagggtcctgacgtggtcgcggctctgggagcgggccagcatcatctggctctgccgcaccg-
aggccgcctcca
actggtcctccagcagccgcagtcgccgccgaccctggcagaggaagacaggtgaggggggtatgaattgtaca-
gaacaaccacg
agccttgtctaggcagaatccctaccagtcatggctttacctggatgacggcctgcgaacagctgtccagcgac-
cctcgctgccgccg
cttctcccgcacgcttctttccagcaccgtgatggcgcgagccagcgccgcacgctggcgctgcgcttcgccga-
tctgaggacagtc
ggggaactctgatcagtctaaacccccttgcgcgttagtgttgccatcctttgcagaccggtgagagccgactt-
gttgtgcgccacccc
ccacaccacctcctcccagaccaattctgtcacctttttggcgaaggcatcggcctcggcctgcagagaggaca-
gcagtgcccagcc ##STR00002## ##STR00003## ##STR00004## ##STR00005##
##STR00006##
accgccccctggtgcacttcacccccaacaagggctggatgaacgaccccaacggcctgtggtacgacgagaag-
gacgccaa
gtggcacctgtacttccagtacaacccgaacgacaccgtctgggggacgcccttgttctggggccacgccacgt-
ccgacgacctg
accaactgggaggaccagcccatcgccatcgccccgaagcgcaacgactccggcgccttctccggctccatggt-
ggtggactac
aacaacacctccggcttcttcaacgacaccatcgacccgcgccagcgctgcgtggccatctggacctacaacac-
cccggagtcc
gaggagcagtacatctcctacagcctggacggcggctacaccttcaccgagtaccagaagaaccccgtgctggc-
cgccaactcc
acccagttccgcgacccgaaggtcttctggtacgagccctcccagaagtggatcatgaccgcggccaagtccca-
ggactacaag
atcgagatctactcctccgacgacctgaagtcctggaagctggagtccgcgttcgccaacgagggcttcctcgg-
ctaccagtacg
agtgccccggcctgatcgaggtccccaccgagcaggaccccagcaagtcctactgggtgatgttcatctccatc-
aaccccggcgc
cccggccggcggctccttcaaccagtacttcgtcggcagcttcaacggcacccacttcgaggccttcgacaacc-
agtcccgcgtg
gtggacttcggcaaggactactacgccctgcagaccttcttcaacaccgacccgacctacgggagcgccctggg-
catcgcgtgg
gcctccaactgggagtactccgccttcgtgcccaccaacccctggcgctcctccatgtccctcgtgcgcaagtt-
ctccctcaacacc
gagtaccaggccaacccggagacggagctgatcaacctgaaggccgagccgatcctgaacatcagcaacgccgg-
cccctgg
agccggttcgccaccaacaccacgttgacgaaggccaacagctacaacgtcgacctgtccaacagcaccggcac-
cctggagtt
cgagctggtgtacgccgtcaacaccacccagacgatctccaagtccgtgttcgcggacctctccctctggttca-
agggcctggagg
accccgaggagtacctccgcatgggcttcgaggtgtccgcgtcctccttcttcctggaccgcgggaacagcaag-
gtgaagttcgtg
aaggagaacccctacttcaccaaccgcatgagcgtgaacaaccagcccttcaagagcgagaacgacctgtccta-
ctacaaggt
gtacggcttgctggaccagaacatcctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctact-
tcatgaccaccg
ggaacgccctgggctccgtgaacatgacgacgggggtggacaacctgttctacatcgacaagttccaggtgcgc-
gaggtcaag ##STR00007##
gccttgacctgtgaatatccctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttt-
tgcgagttgctagc
tgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcgcttgcatcccaaccgcaa-
cttatctacgctg
tcctgctatccctcagcgctgctcctgctcctgctcactgcccctcgcacagccttggtttgggctccgcctgt-
attctcctggtact
gcaacctgtaaaccagcactgcaatgctgatgcacgggaagtagtgggatgggaacacaaatggaggatcccgc-
gtctcgaa
cagagcgcgcagaggaacgctgaaggtctcgcctctgtcgcacctcagcgcggcatacaccacaataaccacct-
gacgaatgcgct
tggttcttcgtccattagcgaagcgtccggttcacacacgtgccacgttggcgaggtggcaggtgacaatgatc-
ggtggagctgatggt ##STR00008## ##STR00009## ##STR00010## ##STR00011##
##STR00012##
gcccagcagcctgagcgtgcccttcaagcccgacaacggcggcttccacgtgaaggccaacgccagcgcccacg-
ggcgcgcc
cccaaggccaacggcagcgccgtgaacctgaagtccggcagcctggagacccccccccgcagcttcatcaacca-
gctgcccg
acctgagcatgctgctgagcaagatcaccaccgtgttcggcgccgccgagaagcagtggaagcgccccggcatg-
ctggtggag
cccttcggcgtggaccgcatcttccaggacggcgtgttcttccgccagagcttcagcatccgcagctacgagat-
cggcgtggaccg
caccgccagcatcgagaccctgatgaacatcttccaggagaccagcctgaaccactgcaagagcatcggcctgc-
tgaacgacg
gcttcggccgcacccccgagatgtgcaagcgcgacctgatctgggtggtgaccaagatccaggtggaggtgaac-
cgctacccca
cctggggcgacaccatcgaggtgaacacctgggtgagcgagagcggcaagaacggcatgggccgcgactggctg-
atcagcg
actgccgcaccggcgagatcctgatccgcgccaccagcgtgtgggccatgatgaaccagaacacccgccgcctg-
agcaagttc
ccctacgaggtgcgccaggagatcgccccccacttcgtggacagcgcccccgtgatcgaggacgaccgcaagct-
gcacaagct
ggacgtgaagaccggcgacagcatccgcgacggcctgaccccccgctggaacgacctggacgtgaaccagcacg-
tgaacaa
cgtgaagtacatcggctggattctgaagtccgtgcccatcgaggtgttcgagacccaggagctgtgcggcgtga-
ccctggagtac
cgccgcgagtgcggccgcgacagcgtgctggagagcgtgaccaccatggaccccgccaaggagggcgaccgctg-
cgtgtacc
agcacctgctgcgcctggaggacggcgccgacatcaccatcggccgcaccgagtggcgccccaagaacgccggc-
gccaacg ##STR00013##
atcgacacactctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatatcc-
ctgccgctttta
tcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagctgcttgtgctatttgcga-
ataccacccccag
catccccttccctcgtttcatatcgcttgcatcccaaccgcaacttatctacgctgtcctgctatccctcagcg-
ctgctcctgctcct
gctcactgcccctcgcacagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaaccagca-
ctgcaatgctg
atgcacgggaagtagtgggatgggaacacaaatggaaagcttgagctcttgttttccagaaggagttgctcctt-
gagcctttcattc
tcagcctcgataacctccaaagccgctctaattgtggagggggttcgaatttaaaagcttggaatgttggttcg-
tgcgtctggaacaagc
ccagacttgttgctcactgggaaaaggaccatcagctccaaaaaacttgccgctcaaaccgcgtacctctgctt-
tcgcgcaatctgccct
gttgaaatcgccaccacattcatattgtgacgcttgagcagtctgtaattgcctcagaatgtggaatcatctgc-
cccctgtgcgagcccat
gccaggcatgtcgcgggcgaggacacccgccactcgtacagcagaccattatgctacctcacaatagttcataa-
cagtgaccatatttc
tcgaagctccccaacgagcacctccatgctctgagtggccaccccccggccctggtgcttgcggagggcaggtc-
aaccggcatggg
gctaccgaaatccccgaccggatcccaccacccccgcgatgggaagaatctctccccgggatgtgggcccacca-
ccagcacaacct
gtccgaagcaggggttgctagggatcgctccgagtccgcaaacccttgtcgcgtggcggggcttgttcgagctt-
gaagagc
[0459] Transforming DNA Expressing Suc2 and the C. wrightii FatB2
Thioesterase (Const. 2):
[0460] The transforming construct,
6S-CrbTub_suc2_nr::CrbTub_CwFatB2_nr-6S, designated as Const. 2,
was generated by replacing the CwFatB1 gene from Const. 1 with the
codon optimized CwFatB2 gene utilizing the SpeI and AscI
restriction sites, which are indicated in lowercase, in bold and
underlined. The initiator ATG and terminator TGA of the
thioesterase (CwFatB2) are indicated in uppercase, bold italicized
text while the remainder of the coding region is indicated in
lowercase italics. The predicted plastid targeting sequence of the
thioesterase lies between the initiator ATG and the AscI site in
the sequence.
TABLE-US-00029 Construct 2 (partial): (SEQ ID NO: 189) actagt
gtggtggccgccgccgccagcagcgccttcttccccgtgcc
cgccccccgccccacccccaagcccggcaagttcggcaactggcccagcag
cctgagccagcccttcaagcccaagagcaaccccaacggccgcttccaggt
gaaggccaacgtgagcccccacg cccaaggccaacggcagcg
ccgtgagcctgaagtccggcagcctgaacaccctggaggacccccccagca
gcccccccccccgcaccttcctgaaccagctgcccgactggagccgcctgc
gcaccgccatcaccaccgtgttcgtggccgccgagaagcagttcacccgcc
tggaccgcaagagcaagcgccccgacatgctggtggactggttcggcagcg
agaccatcgtgcaggacggcctggtgttccgcgagcgcttcagcatccgca
gctacgagatcggcgccgaccgcaccgccagcatcgagaccctgatgaacc
acctgcaggacaccagcctgaaccactgcaagagcgtgggcctgctgaacg
acggcttcggccgcacccccgagatgtgcacccgcgacctgatctgggtgc
tgaccaagatgcagatcgtggtgaaccgctaccccacctggggcgacaccg
tggagatcaacagctggttcagccagagcggcaagatcggcatgggccgcg
agtggctgatcagcgactgcaacaccggcgagatcctggtgcgcgccacca
gcgcctgggccatgatgaaccagaagacccgccgcttcagcaagctgccct
gcgaggtgcgccaggagatcgccccccacttcgtggacgccccccccgtga
tcgaggacaacgaccgcaagctgcacaagttcgacgtgaagaccggcgaca
gcatctgcaagggcctgacccccggctggaacgacttcgacgtgaaccagc
acgtgagcaacgtgaagtacatcggctggattctggagagcatgcccaccg
aggtgctggagacccaggagctgtgcagcctgaccctggagtaccgccgcg
agtgcggccgcgagagcgtggtggagagcgtgaccagcatgaaccccagca
aggtgggcgaccgcagccagtaccagcacctgctgcgcctggaggacggcg
ccgacatcatgaagggccgcaccgagtggcgccccaagaacgccggcacca
accgcgccatcagcacc ttaattaactcgag
[0461] Transforming DNA expressing suc2 and the C. wrightii FatB1
and FatB2 thioesterases driven by amt3 promoter (Const. 3 &
4):
[0462] The transforming constructs
6S-CrbTub_suc2_nr::Amt3_CwFatB1_nr-6S, designated as Const. 3, and
6S-CrbTub_suc2_nr::Amt3_CwFatB2_nr-6S, designated as Const. 4 were
generated by replacing the CrbTub promoter driving the
thioesterases, from Const. 1 and Const. 2, with the Amt3 promoter
derived from UTEX1435 as an EcoRI and SpeI restriction fragment,
indicated below in lowercase, bold and underlined. The Amt3
promoter region is indicated by lowercase boxed text.
TABLE-US-00030 Constructs 3 and 4 (partial): (SEQ ID NO: 190)
##STR00014## ##STR00015## ##STR00016## ##STR00017## ##STR00018##
##STR00019## ##STR00020## ##STR00021## ##STR00022## ##STR00023##
##STR00024## ##STR00025## ##STR00026## ##STR00027## ##STR00028##
##STR00029##
[0463] Transforming DNA Expressing C. wrightii FatB1 Thioesterase
Under the Control of Algal Transit Peptides:
[0464] The transforming constructs
6S-CrbTub_suc2_nr::CrbTub_TP1-CwFatB1_nr-6S, designated as Const.
5; construct 6S-CrbTub_suc2_nr::CrbTub_TP2-CwFatB1_nr-6S,
designated as Const. 6; construct
6S-CrbTub_suc2_nr::CrbTub_TP3-CwFatB1_nr-6S, designated as Const. 7
and construct 6S-CrbTub_suc2_nr::CrbTub_TP4-CwFatB1_nr-6S,
designated as Const. 8 were generated by replacing the native
transit peptide of CwFatB1 from Const. 1 with the corresponding
algal transit peptides shown below as SpeI and AscI restriction
fragments, which are indicated in lowercase, bold and underlining.
The resulting algal transit peptide sequences lie between the
initiator ATG and the AscI site in the sequences below.
TABLE-US-00031 Constructs 5-12 (partial): TP1 (UTEX250 Stearoyl ACP
Desaturase transit peptide sequence) (SEQ ID NO: 191) actagt
gccaccgcatccactttctcggcgttcaatgcccgctgcg
gcgacctgcgtcgctcggcgggctccgggccccggcgcccagcgaggcc
cctccccgtgcgcgggcgcgcc TP2 (UTEX1435 Stearoyl ACP Desaturase
transit peptide sequence) (SEQ ID NO: 192) actagt
gcttccgcggcattcaccatgtcggcgtgccccgcgatga
ctggcagggcccctggggcacgtcgctccggacggccagtcgccacccg cctgagggggcgcgcc
TP3 (UTEX1435 Deltal2 Fatty Acid Desaturase transit peptide
sequence) (SEQ ID NO: 193) actagt
gctatcaagacgaacaggcagcctgtggagaagcctccgt
tcacgatcgggacgctgcgcaaggccatccccgcgcactgtttcgagcg
ctcggcgcttcgtgggcgcgcc TP4 (UTEX1435 Isopentenyl Diphospate
Synthase transit peptide sequence) (SEQ ID NO: 194) actagt
acgttcggggtcgccctcccggccatgggccgcggtgtct
cccttccccggcccagggtcgcggtgcgcgcccagtcggcgagtcaggt
tttggagagcgggcgcgcc
[0465] Transforming DNA expressing C. wrightii FatB2 thioesterase
under the control of algal transit peptides: The transforming
constructs 6S-CrbTub_suc2_nr::CrbTub_TP1-CwFatB2_nr-6S, designated
as Const. 9; construct 6S-CrbTub_suc2_nr::CrbTub_TP2-CwFatB2_nr-6S,
designated as Const. 10; construct
6S-CrbTub_suc2_nr::CrbTub_TP3-CwFatB2_nr-6S, designated as Const.
11 and construct 6S-CrbTub_suc2_nr::CrbTub_TP4-CwFatB2_nr-6S,
designated as Const. 12 were generated by replacing the native
transit peptide of CwFatB2 from Const. 2 with the corresponding
algal transit peptides shown above as SpeI and AscI restriction
fragments, which are indicated in lowercase, bold and underlining.
The algal transit peptide sequence lies between the initiator ATG
and the AscI site in the sequences above.
[0466] Fatty Acid Profiles Resulting from Strains Expressing Cuphea
wrightii Thioesterases:
[0467] Strains transformed with the constructs described above were
grown under conditions allowing for the production of oil as
previously described. Wild type UTEX 1435 was grown on glucose
while all the transgenic lines generated by transformation of UTEX
1435 were grown on sucrose. For each construct tested, four
transformants were analyzed for impacts on fatty acid profiles. The
fatty acid profiles for transgenic strains are shown in Tables 25
to 28 below.
[0468] Transgenic lines of A. thaliana expressing CwFatB1 and
CwFatB2 (Table 25) show a significant impact on the accumulation of
C16:0 fatty acids along with accumulation of C14:0 and C12:0 fatty
acids (from Leonard et al, 1998, supra).
[0469] As can be seen from Table 26, transgenic UTEX 1435 lines
expressing CwFatB1 (Const. 1 & Const. 3) with the native,
higher plant transit peptide, show an impact primarily on C14:0
fatty acid accumulation and to a lesser extent on C12:0 fatty acid
accumulation. The transgenic UTEX1435 lines expressing CwFatB2
(Const. 2 & Const. 4) with the native higher plant transit
peptide, show significant impact on C12:0 and C14:0 fatty acid
accumulation, with the impact on C12:0 being higher than on C14:0.
A comparison between the two promoters, CrbTub (Const. 1 &
Const. 2) and Amt3 (Const. 3 & Const. 4) demonstrates that
transgenic lines expressing CwFatB1 & CwFatB2 show
significantly higher impacts on C10:0, C12:0, C14:0 and C16:0 fatty
acids when driven by the Amt3 promoter.
[0470] Analysis of transgenic lines wherein the expression of
CwFatB1 thioesterase is driven by the four different algal
chloroplast targeting sequences (Const. 5, 6, 7, and 8) shows that
any of the algal transit peptides targets the thioesterase to the
plastid more efficiently than the native higher plant transit
peptide (compare the C12:0 and C14:0 levels in constructs 5-8,
Table 27, with those in construct 1, Table 26). Further analysis of
these transgenic lines reveals that of the four algal transit
peptides TP2 (UTEX1435 Stearoyl ACP Desaturase chloroplast
targeting sequence) and TP3 (UTEX 1435 Delta 12 Fatty Acid
Desaturase chloroplast targeting sequence) show a greater impact on
C12:0 and C14:0 accumulation. It appears that these two transit
peptides (TP1 & TP2) are better at targeting the CwFatB1 to the
plastid in UTEX 1435.
[0471] Analysis of transgenic lines wherein the expression of
CwFatB2 thioesterase is driven by the four different algal
chloroplast targeting sequences (Const. 9, 10, 11, and 12)
demonstrates that only one of the algal transit peptides gives
superior performance to the native, higher plant transit peptide,
namely TP-1, as can be seen higher impact on the C12:0 and C14:0
fatty acids (compare Const 9 to Const. 2).
[0472] The impact of these C. wrightii thioesterases when expressed
in UTEX 1435 is significantly different than when expressed in
Arabidopsis. Transgenic lines of A. thaliana expressing CwFatB1 and
CwFatB2 (Table 25) show a significant impact on the accumulation of
C16:0 fatty acids along with accumulation of C14:0 and C12:0 fatty
acids. CwFatB1 and CwFatB2 expressed in UTEX 1435, however, do not
show the same level of impact on C16:0 fatty acids. The C12:C14
ratios in all the UTEX 1435 transgenic lines, expressing CwFatB1,
and some expressing CwFatB2 (Const. 10, 11, 12) are similar to the
A. thaliana transgenic lines expressing this thioesterase (Table
29). However, the UTEX 1435 transgenic lines show a significantly
lower C14:C16 ratio compared to the A. thaliana transgenic lines
(Table 29). The C12:C14 and C14:C16 ratios in the UTEX 1435
transgenic lines generated with Const. 2, 4, 9 are significantly
different than the A. thaliana transgenic lines expressing the same
thioesterase (Table 29). Thus, the expression of CwFatB1 and
CwFatB2, in UTEX 1435 generated an oil profile that is
significantly different than that generated in transgenic lines of
Arabidopsis expressing the same thioesterases. The oil profile in
these UTEX 1435 transgenic lines is also distinctly different from
that in wild type UTEX 1435.
[0473] Finally, the modified oils produced by the transgenic lines
described in this Example are also significantly different than the
laurate rich oils generated in transgenic UTEX 1435 lines
expressing a C12:0 specific thioesterase from Umbellularia
californica (described previously).
[0474] Taken together, these data indicate that: (1) expression of
Cuphea wrightii thioesterases in UTEX 1435 has a significant impact
on fatty acid profiles and generates unique oils; (2) the
expression of CwFatB1 thioesterase in the strain UTEX 1435 results
in the generation of an oil rich in myristate; (3) the expression
of CwFatB2 thioestease in UTEX 1435 results in the generation of an
oil rich in both laurate and myristate; and (4) the expression of
CwFatB1 and FatB2 in algae generates profiles quite distinct from
those generated in a model higher plant system, both in terms of
the absolute levels of mid-chain fatty acids produced and in their
relative ratios to one another.
TABLE-US-00032 TABLE 25 Fatty acid profiles (expressed as area %)
in UTEX1435, A. thaliana wild type (Ath) and A. thaliana transgenic
lines expressing CwFatB1 (CwFatB1-Ath) and CwFatB2 (CwFatB2-Ath)
thioesterases. Sample ID C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 C18:2
C18:3 C20:0 C20:1 UTEX1435 0.01 0.03 0.93 23.83 3.27 61.85 8.08
0.53 0.31 0.08 Ath 0.00 0.00 0.00 8.40 3.80 13.00 29.20 20.10 2.40
19.30 CwFatB1-Ath 0.00 7.10 24.40 22.80 3.30 4.50 14.10 12.90 3.00
6.00 CwFatB2-Ath 4.40 16.40 15.30 18.10 3.90 4.90 13.90 13.60 2.80
5.70
TABLE-US-00033 TABLE 26 Fatty acid profiles (expressed as area %)
in UTEX1435 transgenic lines expressing Const. 1; Const. 2; Const.
3 and Const. 4. Construct Sample ID C10:0 C12:0 C14:0 C16:0 C18:0
C18:1 C18:2 C18:3 C20:0 C20:1 Const. 1 1A 0.01 0.43 3.17 19.84 1.66
60.34 12.38 0.45 0.23 0.02 1B 0.01 0.52 3.45 19.81 2.03 60.65 11.42
0.42 0.26 0.02 1C 0.01 0.59 3.62 20.53 2.24 59.64 11.29 0.42 0.26
0.02 1D 0.01 0.67 3.92 21.97 1.96 58.62 10.82 0.44 0.24 0.02 Const.
2 2A 0.63 7.47 5.64 18.74 2.36 52.11 10.98 0.49 0.28 0.02 2B 0.82
7.77 5.83 19.84 2.62 51.98 9.24 0.50 0.24 0.02 2C 0.82 9.57 6.31
18.64 1.66 50.89 10.42 0.43 0.21 0.01 2D 0.90 10.04 7.11 17.99 2.34
49.03 10.63 0.47 0.26 0.02 Const. 3 3A 0.04 2.85 12.09 28.04 2.69
39.02 12.35 1.05 0.25 0.05 3B 0.03 2.90 13.39 28.01 2.02 41.47
10.01 0.71 0.21 0.05 3C 0.04 3.30 14.10 27.91 2.09 40.50 9.92 0.71
0.21 0.04 3D 0.04 3.71 15.10 27.88 2.01 39.56 9.62 0.68 0.21 0.06
Const. 4 4A 1.43 11.78 8.87 19.67 2.04 43.80 10.28 0.77 0.21 0.06
4B 1.39 12.26 9.29 16.88 1.48 44.20 12.18 0.86 0.19 0.08 4C 1.73
13.42 9.55 18.93 2.05 41.92 10.30 0.81 0.21 0.04 4D 1.82 14.18
10.07 18.56 1.93 41.22 10.21 0.78 0.19 0.05
TABLE-US-00034 TABLE 27 Fatty acid profiles (expressed as area %)
in UTEX1435 transgenic lines expressing Const. 5; Const. 6; Const.
7 and Const. 8. Construct Sample ID C10:0 C12:0 C14:0 C16:0 C18:0
C18:1 C18:2 C18:3 C20:0 C20:1 Const. 5 5A 0.02 0.62 4.33 23.30 2.00
57.43 10.00 0.59 0.26 0.09 5B 0.02 0.78 5.11 25.06 2.45 55.65 8.76
0.58 0.26 0.07 5C 0.02 1.20 7.41 24.48 1.87 52.65 10.18 0.60 0.24
0.08 5D 0.02 1.33 7.56 24.55 1.87 52.59 9.90 0.54 0.26 0.09 Const.
6 6A 0.02 0.56 4.01 24.23 2.50 57.04 9.32 0.57 0.28 0.08 6B 0.02
0.69 4.97 23.41 1.92 55.59 10.98 0.61 0.25 0.09 6C 0.02 1.14 7.07
25.05 2.11 53.23 9.23 0.60 0.23 0.07 6D 0.05 5.10 19.88 21.43 1.29
40.40 9.89 0.63 0.20 0.08 Const. 7 7A 0.02 1.39 8.36 25.39 2.00
51.37 9.37 0.55 0.22 0.07 7B 0.02 1.42 7.59 24.77 2.12 53.17 8.87
0.47 0.23 0.08 7C 0.02 1.49 7.82 24.87 2.10 52.45 9.14 0.53 0.24
0.08 7D 0.03 2.15 11.01 25.64 1.85 47.35 9.92 0.51 0.23 0.08 Const.
8 8A 0.02 0.81 5.28 23.38 2.03 56.10 10.14 0.54 0.26 0.09 8B 0.02
0.88 5.77 23.58 1.91 54.91 10.58 0.57 0.24 0.09 8C 0.02 1.27 7.57
24.28 1.93 52.95 9.88 0.54 0.24 0.08 8D 0.02 1.43 5.02 21.52 2.63
58.32 9.14 0.52 0.28 0.09
TABLE-US-00035 TABLE 28 Fatty acid profiles (expressed as area %)
in UTEX1435 transgenic lines expressing Const. 9; Const. 10; Const.
11 and Const. 12. Construct Sample ID C10:0 C12:0 C14:0 C16:0 C18:0
C18:1 C18:2 C18:3 C20:0 C20:1 Const. 9 9A 0.90 8.96 6.59 19.24 2.20
51.17 8.91 0.56 0.24 0.08 9B 1.00 9.07 6.31 19.55 2.21 51.43 8.47
0.53 0.25 0.07 9C 1.06 12.08 8.79 17.57 1.70 46.54 10.29 0.58 0.21
0.07 9D 1.27 13.05 8.67 17.70 1.78 46.28 9.38 0.57 0.22 0.07 Const.
10 10A 0.52 5.55 5.00 20.60 2.03 53.35 10.66 0.71 0.24 0.07 10B
0.53 5.76 5.16 20.63 1.92 52.80 10.90 0.67 0.23 0.06 10C 0.47 5.86
5.20 19.54 1.89 53.34 11.41 0.62 0.26 0.06 10D 0.87 8.59 6.85 19.65
1.98 49.65 10.21 0.69 0.23 0.08 Const. 11 11A 0.21 2.48 2.85 20.80
1.99 57.69 11.53 0.70 0.27 0.11 11B 0.22 2.80 3.01 21.30 1.89 57.28
11.07 0.66 0.27 0.11 11C 0.29 3.22 3.38 21.33 2.09 56.92 10.42 0.71
0.25 0.05 11D 0.28 4.01 4.01 18.79 1.69 56.08 12.73 0.64 0.26 0.09
Const. 12 12A 0.65 6.01 5.43 21.50 2.10 52.70 9.28 0.75 0.24 0.10
12B 0.52 6.58 5.62 18.71 1.78 52.59 11.84 0.66 0.26 0.11 12C 0.78
8.60 6.88 19.01 1.69 50.40 10.45 0.69 0.23 0.08 12D 0.72 8.75 7.07
17.74 1.54 50.57 11.29 0.68 0.22 0.10
TABLE-US-00036 TABLE 29 Ratios of C12:C14 and C14:C16in UTEX1435
transgenic lines expressing CwFatB1 (Const. 1, 3, 5, 6, 7, 8) and
CwFatB2 (Const. 2, 4, 9, 10, 11, 12) along with A. thaliana
transgenic lines expressing CwFatB1 (CwFatB1-Ath) and CwFatB2
(CwFatB2-Ath). Sample ID Average 12:14 ratio Average 14:16 ratio
CwFatB1-Ath 0.291 1.070 Const. 1 0.155 0.172 Const. 3 0.233 0.489
Const. 5 0.250 0.250 Const. 6 0.174 0.397 Const. 7 0.185 0.345
Const. 8 0.190 0.254 CwFatB2-Ath 1.072 0.845 Const. 2 1.396 0.332
Const. 4 1.365 0.512 Const. 9 1.419 0.414 Const. 10 1.152 0.277
Const. 11 0.938 0.163 Const. 12 1.191 0.328
Example 5: Identification of Endogenous Nitrogen-Dependent
Prototheca Promoters
[0475] A. Identification and Characterization of Endogenous
Nitrogen-Dependent Promoters.
[0476] A cDNA library was generated from Prototheca moriformis
(UTEX 1435) using standard techniques. The Prototheca moriformis
cells were grown for 48 hours under nitrogen replete conditions.
Then a 5% innoculum (v/v) was then transferred to low nitrogen and
the cells were harvested every 24 hours for seven days. After about
24 hours in culture, the nitrogen supply in the media was
completely depleted. The collected samples were immediately frozen
using dry ice and isopropanol. Total RNA was subsequently isolated
from the frozen cell pellet samples and a portion from each sample
was held in reserve for RT-PCR studies. The rest of the total RNA
harvested from the samples was subjected to polyA selection.
Equimolar amounts of polyA selected RNA from each condition was
then pooled and used to generate a cDNA library in vector pcDNA 3.0
(Invitrogen). Roughly 1200 clones were randomly picked from the
resulting pooled cDNA library and subjected to sequencing on both
strands. Approximately 68 different cDNAs were selected from among
these 1200 sequences and used to design cDNA-specific primers for
use in real-time RT-PCR studies.
[0477] RNA isolated from the cell pellet samples that were held in
reserve was used as substrate in the real time RT-PCR studies using
the cDNA-specific primer sets generated above. This reserved RNA
was converted into cDNA and used as substrate for RT-PCR for each
of the 68 gene specific primer sets. Threshold cycle or C.sub.T
numbers were used to indicate relative transcript abundance for
each of the 68 cDNAs within each RNA sample collected throughout
the time course. cDNAs showing significant increase (greater than
three fold) between nitrogen replete and nitrogen-depleted
conditions were flagged as potential genes whose expression was
up-regulated by nitrogen depletion. As discussed in the
specification, nitrogen depletion/limitation is a known inducer of
lipogenesis in oleaginous microorganisms.
[0478] In order to identify putative promoters/5'UTR sequences from
the cDNAs whose expression was upregulated during nitrogen
depletion/limitation, total DNA was isolated from Prototheca
moriformis (UTEX 1435) grown under nitrogen replete conditions and
were then subjected to sequencing using 454 sequencing technology
(Roche). cDNAs flagged as being up-regulated by the RT-PCR results
above were compared using BLAST against assembled contigs arising
from the 454 genomic sequencing reads. The 5' ends of cDNAs were
mapped to specific contigs, and where possible, greater than 500 bp
of 5' flanking DNA was used to putatively identify promoters/UTRs.
The presence of promoters/5'UTR were subsequently confirmed and
cloned using PCR amplification of genomic DNA. Individual cDNA 5'
ends were used to design 3' primers and 5' end of the 454 contig
assemblies were used to design 5' gene-specific primers.
[0479] As a first screen, one of the putative promoter, the
5'UTR/promoter isolated from Aat2 (Ammonium transporter, SEQ ID NO:
63), was cloned into the Cinnamomum camphora C14 thioesterase
construct with the Chlorella protothecoides stearoyl ACP desaturase
transit peptide, replacing the C. sorokinana glutamate
dehydrogenase promoter. This construct is listed as SEQ ID NO: 81.
To test the putative promoter, the thioesterase construct is
transformed into Prototheca moriformis cells to confirm actual
promoter activity by screening for an increase in C14/C12 fatty
acids under low/no nitrogen conditions, using the methods described
above. Similar testing of the putative nitrogen-regulated promoters
isolated from the cDNA/genomic screen can be done using the same
methods.
[0480] Other putative nitrogen-regulated promoters/5'UTRs that were
isolated from the cDNA/genomic screen were:
TABLE-US-00037 Promoter/5'UTR SEQ ID NO. Fold increased FatB/A
promoter/5'UTR SEQ ID NO: 55 n/a NRAMP metal transporter
promoter/5'UTR SEQ ID NO: 56 9.65 Flap Flagellar-associated protein
promoter/5'UTR SEQ ID NO: 57 4.92 SulfRed Sulfite reductase
promoter/5'UTR SEQ ID NO: 58 10.91 SugT Sugar transporter
promoter/5'UTR SEQ ID NO: 59 17.35 Amt03-Ammonium transporter 03
promoter/5'UTR SEQ ID NO: 60 10.1 Amt02-Ammonium transporter 02
promoter/5'UTR SEQ ID NO: 61 10.76 Aat01-Amino acid transporter 01
promoter/5'UTR SEQ ID NO: 62 6.21 Aat02-Amino acid transporter 02
promoter/5'UTR SEQ ID NO: 63 6.5 Aat03-Amino acid transporter 03
promoter/5'UTR SEQ ID NO: 64 7.87 Aat04-Amino acid transporter 04
promoter/5'UTR SEQ ID NO: 65 10.95 Aat05-Amino acid transporter 05
promoter/5'UTR SEQ ID NO: 66 6.71
[0481] Fold increase refers to the fold increase in cDNA abundance
after 24 hours of culture in low nitrogen medium.
[0482] To gain further insight into potential regulation of these
putative promoter/5'UTRs, eight of the sequences were selected for
further testing: (1) FatB/A; (2) SulfRed Sulfite reductase; (3)
SugT Sugar transporter; (4) Amt02-Ammonium transporter 02; (5)
Aat01-Amino acid transporter 01; (6) Aat03-Amino acid transporter
03; (7) Aat04-Amino acid transporter 04; and (8) Aat05-Amino acid
transporter 05. Higher resolution transcriptome analysis utilizing
Illumina sequencing reads were carried out on RNA isolated from
Prototheca moriformis cells various time points: T0 (seed); 20
hours; 32 hours; 48 hours; 62 hours; and 114 hours post inoculation
from seed. The medium at T0 (seed) was nitrogen replete, while at
the time points 20 hours and longer, the medium contained little to
no nitrogen. Assembled transcript contigs generated from RNA
isolated from each of the time points were then blasted
independently with each of the eight previously identified
transcripts. The results are summarized in Table 30 below.
TABLE-US-00038 TABLE 30 Transcriptome expression profiles for eight
putative promoters/5'UTRs. cDNA TS T20 T32 T48 T62 T114 aa trans_01
absolute 98 96 321 745 927 1300 relative 1 0.98 3.28 7.61 9.47
13.28 aa trans_03 absolute 7 21 51 137 102 109 relative 1 2.95 7.2
19.42 14.47 15.45 aa trans_04 absolute 1 6 25 90 131 160 relative 1
5.16 21.29 74.97 109.35 133.31 aa trans_05 absolute 109 88 123 210
214 273 relative 1 0.81 1.13 1.93 1.97 2.51 ammon trans_02 absolute
683 173 402 991 1413 1397 relative 1 0.25 0.59 1.45 2.07 2.04
fatA/B-1_cDNA absolute 13 36 654 617 544 749 relative 1 2.8 51.57
48.65 42.9 59.1 sug trans_01 absolute 25 25 106 261 266 251
relative 1 1 4.22 10.4 10.63 10 sulfite reductase_01 absolute 634
238 138 145 163 155 relative 1 0.38 0.22 0.22 0.26 0.24
[0483] From the above-summarized results, several of the
transcripts show increased accumulation over time, although
interestingly, the sulfite reductase mRNA shows a distinct decrease
in mRNA accumulation over time.
[0484] These eight putative promoter/5'UTR regions were cloned
upstream of the C. camphora thioesterase coding region with its
native transit peptide taken out and substituted with the transit
peptide from Chlorella protothecoides (UTEX 250) stearoyl ACP
desaturase. Each putative promoter/5'UTR region construct was
introduced into Prototheca moriformis UTEX 1435 via homologous
recombination using DNA from the 6S genomic sequence. Also
contained within the construct is a suc2 sucrose invertase gene
from S. cerevisiae for selection of positive clones on sucrose
containing media/plates. The cDNA sequence for the relevant
portions of the construct for Aat01 is listed in the Sequence
Listing as SEQ ID NO: 67. For the other constructs, the same
backbone was use, the only variable was the putative promoter/5'UTR
sequence. An additional control transgenic strain was generated in
which the C. reinhardtii beta tubulin promoter was used to drive
expression of the C. camphora thioesterase gene. This promoter have
shown to drive constitutive expression of the gene of interest, and
thus provides a useful control against which to measure expression
of the same thioesterase message when driven by the various
putative N-regulated promoters/5'UTRs tested.
[0485] Once the transgenic clones were generated, three separate
experiments were carried out. The first two experiments assess the
potential nitrogen regulatability of all eight putative promoters
by measuring steady state thioesterase mRNA levels via RT-PCR,
fatty acid profiles and ammonia levels in the culture supernatants.
Clones were initially grown at 28.degree. C. with agitation (200
rpm) in nitrogen rich seed medium (1 g/L ammonium nitrate-15 mM
nitrogen as ammonia, 4 g/L yeast extract) for 24 to 48 hours, at
which point 20 OD units (A.sub.750) were used to inoculate 50 ml of
low nitrogen media (0.2 g/L ammonium sulfate-3 mM nitrogen as
ammonia, 0.2 g/L yeast extract). Cells were sampled every 24 hours
for 6 days and a sample was also collected right before switching
to low nitrogen conditions. A portion of the cells from each sample
was then used for total RNA extraction using Trizol reagent
(according to manufacturer's suggested methods). Ammonia assays
revealed that ammonia levels in the supernatants fell below the
limits of detection (.about.100 .mu.M) after 24 hours in low
nitrogen medium.
[0486] For real-time RT-PCR, all RNA levels were normalized to
levels of an internal control RNA expressed in Prototheca
moriformis (UTEX 1435) for each time point. The internal control
RNA, termed cd189, is a product of the ARG9 gene which encodes
N-acetyl ornithine aminotransferase. Primers sets used for
real-time RT-PCR in these experiments were:
TABLE-US-00039 Gene specific to Primer sequence 5'-3' SEQ ID NO: C.
camphora TACCCCGCCTGGGGCGACAC SEQ ID TE forward NO: 68 C. camphora
CTTGCTCAGGCGGCGGGTGC SEQ ID TE reverse NO: 69 cd189 forward
CCGGATCTCGGCCAGGGCTA SEQ ID NO: 70 cd189 reverse
TCGATGTCGTGCACCGTCGC SEQ ID NO: 71
[0487] Lipid profiles from each of the transformants from each time
point were also generated and compared to the RT-PCR results. Based
on the ammonia levels, RT-PCR results and changes in C12-C14 fatty
acid levels, it was concluded that the Amino acid transporter 01
(Aat-01), Amino acid transporter 04 (Aat-04), and Ammonium
transporter 02 (Amt-02) sequences do contain a functional
nitrogen-regulatable promoter/5'UTR.
[0488] From the RT-PCR results, Aat-01 demonstrated the ability to
drive steady state C. camphora thioesterase mRNA levels up to four
times higher than control (C. reinhardtii beta tubulin promoter).
The mRNA levels also correlated with nitrogen limitation and a
marked increase in C12-C14 fatty acid levels. These results
demonstrate that the 5'UTR associated with the Aat-01 promoter is
likely more efficient at driving protein synthesis under lipid
biosynthesis than the control C. reinhardtii promoter. Like the
Aat-01 promoter, the Aat-04 promoter was able to drive mRNA
accumulation up to five times higher than that of the C.
reinhardtii control promoter. However, the Aat-04 promoter
construct only produced a modest ability to impact C12-C14 fatty
acid levels. These data demonstrate that the Aat-04 promoter is
clearly regulatable by nitrogen depletion, but the UTR associated
with the promoter likely functions poorly as a translational
enhancer. Finally, the Amt-02 promoter was similar to the Aat-01
promoter, in that it was able to drive mRNA accumulation up to
three times higher than that of the control promoter. The mRNA
levels also correlated with nitrogen limitation and a marked
increase in C12-C14 fatty acid levels. Taken together, all three of
these promoters were demonstrated to be nitrogen-regulated.
[0489] B. Further Characterization of the Ammonium Transporter 3
(Amt03) Promoter and Expression of Various Thioesterases.
[0490] As described above, partial cDNAs termed ammonium
transporter 02 and 03 (amt02 and amt03) were identified. Along with
these two partial cDNAs, a third partial cDNA termed ammonium
transporter 01 (amt01) was also identified. Alignment of the
partial cDNA and the putative translated amino acid sequences were
compared. Results show amt01 to be more distantly related of the
three sequences, while amt02 and amt03 differ by only a single
amino acid.
[0491] Promoters/5'UTRs were generated initially in silico by
blasting the partial cDNA sequences against Roche 454 genomic DNA
assemblies and Illumina transcriptome assemblies as described
above. Transcript contigs showing identity to the cDNA encoding
amt01, amt02, and amt03 were identified, however, the transcript
contigs could not differentiate between the three mRNAs as the
contigs contained sequences shared by all three. Roche 454 genomic
DNA assemblies gave hits to amt02 and amt03 cDNA sequences and
contained N-terminal protein sequences. PCR was carried out to
clone the 5' flanking regions. The PCR primers used to validate the
clone amt02 and amt03 promoter/UTR were:
TABLE-US-00040 Amt03 forward: (SEQ ID NO: 85)
5'-GGAGGAATTCGGCCGACAGGACGCGCGTCA-3' Amt03 reverse: (SEQ ID NO: 86)
5'-GGAGACTAGTGGCTGCGACCGGCCTGTG-3' Amt02 forward: (SEQ ID NO: 87)
5'-GGAGGAATTCTCACCAGCGGACAAAGCACCG-3' Amt02 reverse: (SEQ ID NO:
88) 5'-GGAGACTAGTGGCTGCGACCGGCCTCTGG-3'
In both cases, the 5' and 3' primers contained useful restriction
sites for the anticipated cloning into expression vectors to
validate the functionality of these promoter/5'UTR regions.
[0492] Pair wise alignments between the DNAs cloned through this
combined in silico and PCR-based method and the original cDNA
encoding amt02 (SEQ ID NO: 61) and amt03 (SEQ ID NO: 60) were
performed. Results of these alignments showed significant
differences between the original cDNAs and the cloned genomic
sequences, indicating that ammonium transporters likely represent a
diverse gene family. Additionally, the promoter/5'UTR clone based
on the combined method for amt03 was different than the original
amt03 sequence, whereas the amt02 sequences were identical. Further
experiments to characterize the amt03 promoter/UTR sequence (SEQ ID
NO: 89) was carried out and described below.
[0493] The above identified amt03 promoter/UTR sequence (SEQ ID NO:
89) was tested by cloning this putative promoter/UTR sequence to
drive the expression of four different thioesterases. The
expression cassette contained upstream and downstream homologous
recombination sequences to the 6S locus of the genome (SEQ ID NOs:
82 and 84, respectively). The cassette also contains a S.
cerevisiae SUC2 sucrose invertase cDNA to enable the selection for
positive clones on sucrose containing medium. The sucrose invertase
expression was driven by the C. reinhardtii beta tubulin promoter
and also contained a C. vulgaris nitrate reductase 3'UTR. The amt03
promoter/UTR sequence was then cloned downstream of the sucrose
invertase cassette followed by in-frame thioesterase cDNA sequence
from one of four thioesterase genes: (1) C14 thioesterase from C.
camphora; (2) C12 thioesterase from U. californica; (3) C10-C16
thioesterase from U. americana; or (4) C10 thioesterase from C.
hookeriana and also contained a C. vulgaris nitrate reductase
3'UTR. The C14 C. camphora thioesterase, C12 U. californica
thioesterase, and the C10-C16 U. americana all contained the
transit peptide from a Chlorella protothecoides stearoyl ACP
desaturase. The C10 C. hookeriana thioesterase contained the
transit peptide from a Prototheca moriformis delta 12 fatty acid
desaturase (FAD). In all cases, the sequences were codon optimized
for expression in Prototheca moriformis. The sequences to the
foregoing thioesterase constructs are described in the Sequence
Listing:
amt03 promoter/UTR::C. camphora thioesterase construct SEQ ID NO:
90 C. camphora thioesterase construct SEQ ID NO: 91 U. californica
thioesterase construct SEQ ID NO: 92 U. americana thioesterase
construct SEQ ID NO: 93 C. hookeriana thioesterase construct SEQ ID
NO: 94
[0494] Transgenic lines were generated via biolistic transformation
methods as described above in Example 2 into wild type Prototheca
moriformis cells and selection was carried out on sucrose
containing plates/medium. Positive lines were then screened for the
degree to which their fatty acid profiles were altered. Four lines,
one resulting from the transformation with each of the four
above-described constructs, were then subjected to additional
analysis. Line 76 expressed the C. camphora C14 thioesterase, line
37 expressed the U. californica C12 thioesterase, line 60 expressed
the U. americana C10-C16 thioesterase, and line 56 expressed the C.
hookeriana C10 thioesterase. Each line was grown for 48 hours in
medium containing sucrose as the sole carbon source and samples of
cells were removed at 14, 24, 36 and 48 hours (seed culture) for
determination of fatty acid profile via direct transesterification
to fatty acid methyl esters and subsequent analysis by GC-FID
(described above) and for isolation of total RNA. At the end of 48
hours, these cells were used to inoculate cultures with no or low
levels of nitrogen (containing sucrose as the sole carbon source)
maintained at either pH 5.0 (citrate buffered, 0.05M final
concentration) or pH 7.0 (HEPES buffered, 0.1M final
concentration). Culture samples were removed at 12, 24, 72 and 108
hours (lipid production) for fatty acid profiling and isolation of
total RNA. Ammonia assays of these cultures revealed that ammonia
levels fell below the limits of detection (ca. 100 .mu.M) after 24
hours in low nitrogen medium.
[0495] Real-time RT-PCR assays on the mRNA levels of the
thioesterases were performed on total RNA from each of the time
points collected above and all mRNA levels were normalized to the
levels of an internal control RNA (cd189). Primer sets used in
real-time PCR are shown in Table 31 below:
TABLE-US-00041 TABLE 31 Primer sets for real-time PCR. Gene
specific to Primer sequence 5'-3' SEQ ID NO: C. camphora TE forward
TACCCCGCCTGGGGCGACAC SEQ ID NO: 68 C. camphora TE reverse
CTTGCTCAGGCGGCGGGTGC SEQ ID NO: 69 U. californica TE forward
CTGGGCGACGGCTTCGGCAC SEQ ID NO: 95 U. californica TE reverse
AAGTCGCGGCGCATGCCGTT SEQ ID NO: 96 U. americana TE forward
CCCAGCTGCTCACCTGCACC SEQ ID NO: 97 U. americana TE reverse
CACCCAAGGCCAACGGCAGCGCCGTG SEQ ID NO: 98 C. hookeriana TE forward
TACCCCGCCTGGGGCGACAC SEQ ID NO: 99 C. hookeriana TE reverse
AGCTTGGACAGGCGGCGGGT SEQ ID NO: 100 cd189 reverse
TCGATGTCGTGCACCGTCGC SEQ ID NO: 71 cd189 forward
CCGGATCTCGGCCAGGGCTA SEQ ID NO: 70
[0496] The results from the fatty acid profiles at each of the time
points in the seed culture phase showed very little impact from the
thioesterases. With the commencement of the lipid production phase,
the fatty acid profiles were significantly impacted, with the
increases that are far more dramatic for the cultures maintained at
pH 7.0 as compared to the cultures at pH 5.0. While the magnitude
of the difference between pH 7.0 and 5.0 target fatty acid
accumulation varied with each thioesterase tested, the overall
effect was the same: that the cells grown at pH 5.0 showed
significantly lower levels of the target fatty acids accumulated,
but more than compared to control wild type cells.
[0497] Analysis of the RNA isolated from these same samples
correlated very will with the fatty acid profile data, in that
there was a clear impact of culture pH on the steady state mRNA
levels for each of the thioesterases. Taking the fatty acid
accumulation data and the mRNA data together, the pH regulation of
thioesterase gene expression driven by the amt03 promoter/UTR was
clearly mediated either at the level of transcription, mRNA
stability or both. Additionally, it was observed that the steady
state levels of U. californica mRNA were four logs lower as
compared to the steady state levels of C. hookeriana mRNA. This
observation is consistent with the hypothesis that the individual
mRNA sequences may play a role in controlling expression. These
data imply that ammonium uptake in Prototheca moriformis by the
amt03 family of transporters is coupled directly to pH.
[0498] Additional fatty acid profile analysis was performed on
twelve lines generated from the transformation of Prototheca
moriformis cells with the construct amt03 promoter/UTR driving the
expression of the U. americana C10-C16 thioesterase. Line 60,
described above, was a part of the following analysis. Table 32
below shows the lipid profiles of three of the twelve lines that
were analyzed along with the wild type control.
TABLE-US-00042 TABLE 32 Fatty acid profiles of transformants
containing the U. americana TE driven by the amt03 promoter/UTR.
Total Area % C8:0 C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 C18:2
Saturates wild type 0.00 0.01 0.04 1.27 27.20 3.85 58.70 7.18 32.36
Line 40 2.38 20.61 3.41 28.41 29.92 1.91 8.57 3.74 86.64 Line 44
1.50 20.16 4.44 31.88 26.66 1.88 6.95 5.42 86.50 Line 60 0.98 14.56
3.15 27.49 31.76 2.14 12.23 6.36 80.06
[0499] As shown in the table above, the levels of total saturates
was increased dramatically over that of wild type with over 2.6
fold in the case of line 40 compared to wildtype (total saturates
from the twelve lines analyzed ranged from about 63% to over 86%).
Additionally, the U. americana thioesterase, when expressed at
these levels, dramatically reduces the level of unsaturates,
especially C18:1 and C18:2 (see lines 40 and 44), where in line 44,
C18:1 levels are reduced by over 8 fold compared to the wild type.
Also, the U. americana thioesterase (driven by the amt03 promoter)
greatly increases the levels of mid-chain fatty acids. Line 44
shows C10:0-C14:0 levels at greater than 56%, approximately 42 fold
higher than the levels seen in the wildtype strain and C8:0-C14:0
levels at greater than 57%. Additional strains transformed with a
construct of the Amt03 promoter driving the expression of the U.
americana thioesterase had representative lipid profile of: 0.23%
C8:0; 9.64% C10:0; 2.62% C12:0; 31.52% C14:0; 37.63% C16:0; 5.34%
C18:0; 7.05% C18:1; and 5.03% C18:2, with a total saturates
percentage at 86.98%.
[0500] Additional lipid profiles generated from the transformation
of Prototheca moriformis cells with the construct amt03
promoter/UTR (SEQ ID NO: 89) driving the expression of the C.
hookeriana C10 thioesterase (SEQ ID NO: 94). Positive clones
expressing this construct were selected and grown at pH 7.0
conditions. Representative lipid profile from a positive clone was:
9.87% C8:0; 23.97% C10:0; 0.46% C12:0; 1.24% C14:0; 10.24% C16:0;
2.45% C18:0; 42.81% C18:1; and 7.32% C18:2. This clone had a C8-C10
percentage of 33.84
[0501] Taken together, the data suggest that the amt03
promoter/UTR, and other promoters like it, can be used as a tightly
regulated promoter, which may be particularly useful for expressing
a potentially toxic compound and strict enforcement of gene
expression is required. The ability of Prototheca moriformis to
grow under a wide range (at least pH 5.0 to 7.0) of pH regimes
makes this organism particularly useful in combination with
regulatory elements such as the amt03 promoter/UTR. Additionally,
the lipid profile data above demonstrates the impressive ability of
the amt03 promoter/UTR to drive gene expression.
Example 6: Altering the Levels of Saturated Fatty Acids in the
Microalgae Prototheca moriformis
[0502] A. Decreasing Stearoyl ACP Desaturase and Delta 12 Fatty
Acid Desaturase Expression by Gene Knock-Out Approach
[0503] As part of a genomics screen using a bioinformatics based
approach based on cDNAs, Illumia transcriptome and Roche 454
sequencing of genomic DNA from Prototheca moriformis (UTEX 1435),
two specific groups of genes involved in fatty acid desaturation
were identified: stearoyl ACP desaturases (SAD) and delta 12 fatty
acid desaturases (A12 FAD). Stearoyl ACP desaturase enzymes are
part of the lipid synthesis pathway and they function to introduce
double bonds into the fatty acyl chains, for example, the synthesis
of C18:1 fatty acids from C18:0 fatty acids. Delta 12 fatty acid
desaturases are also part of the lipid synthesis pathway and they
function to introduce double bonds into already unsaturated fatty
acids, for example, the synthesis of C18:2 fatty acids from C18:1
fatty acids. Southern blot analysis using probes based on the two
classes of fatty acid desaturase genes identified during the
bioinformatics efforts indicated that each class of desaturase
genes was likely comprised of multiple family members. Additionally
the genes encoding stearoyl ACP desaturases fell into two distinct
families. Based on these results, three gene disruption constructs
were designed to potentially disrupt multiple gene family members
by targeting more highly conserved coding regions within each
family of desaturase enzymes.
[0504] Three homologous recombination targeting constructs were
designed using: (1) highly conserved portions of the coding
sequence of delta 12 fatty acid desaturase (d12FAD) family members
and (2) two constructs targeting each of the two distinct families
of SAD, each with conserved regions of the coding sequences from
each family. This strategy would embed a selectable marker gene
(the suc2 sucrose invertase cassette from S. cerevisiae conferring
the ability to hydrolyze sucrose) into these highly conserved
coding regions (targeting multiple family members) rather than a
classic gene replacement strategy where the homologous
recombination would target flanking regions of the targeted
gene.
[0505] All constructs were introduced into the cells by biolistic
transformation using the methods described above and constructs
were linearized before being shot into the cells. Transformants
were selected on sucrose containing plates/media and changes in
lipid profile were assayed using the above-described method.
Relevant sequences from each of the three targeting constructs are
listed below.
TABLE-US-00043 Description SEQ ID NO: 5' sequence from coding
region of d12FAD from SEQ ID NO: 72 targeting construct 3' sequence
from coding region of d12FAD from SEQ ID NO: 73 targeting construct
d12FAD targeting construct cDNA sequence SEQ ID NO: 74 5' sequence
from coding region of SAD2A SEQ ID NO: 75 3' sequence from coding
region of SAD2A SEQ ID NO: 76 SAD2A targeting construct cDNA
sequence SEQ ID NO: 77 5' sequence from coding region os SAD2B SEQ
ID NO: 78 3' sequence from coding region of SAD2B SEQ ID NO: 79
SAD2B targeting construct cDNA sequence SEQ ID NO: 80
[0506] Representative positive clones from transformations with
each of the constructs were picked and the lipid profiles for these
clones were determined (expressed in Area %) and summarized in
Table 33 below.
TABLE-US-00044 TABLE 33 Lipid profiles for desaturase knockouts.
Fatty Acid d12FAD KO SAD2A KO SAD2B KO wt UTEX 1435 C8:0 0 0 0 0
C10:0 0.01 0.01 0.01 0.01 C12:0 0.03 0.03 0.03 0.03 C14:0 1.08
0.985 0.795 1.46 C16:0 24.42 25.335 23.66 29.87 C18:0 6.85 12.89
19.555 3.345 C18:1 58.35 47.865 43.115 54.09 C18:2 7.33 10.27 9.83
9.1 C18:3 alpha 0.83 0.86 1 0.89 C20:0 0.48 0.86 1.175 0.325
[0507] Each of the construct had a measurable impact on the desired
class of fatty acid and in all three cases C18:0 levels increased
markedly, particularly with the two SAD knockouts. Further
comparison of multiple clones from the SAD knockouts indicated that
the SAD2B knockout lines had significantly greater reductions in
C18:1 fatty acids than the C18:1 fatty acid levels observed with
the SAD2A knockout lines.
[0508] Additional .DELTA.12 fatty acid desaturase (FAD) knockouts
were generated in a Prototheca moriformis background using the
methods described above. In order to identify potential homologous
of .DELTA.12FADs, the following primers were used in order to
amplify a genomic region encoding a putative FAD:
TABLE-US-00045 Primer 1 SEQ ID NO: 101 5'-TCACTTCATGCCGGCGGTCC-3'
Primer 2 SEQ ID NO: 102 5'-GCGCTCCTGCTTGGCTCGAA-3'
The sequences resulting from the genomic amplification of
Prototheca moriformis genomic DNA using the above primers were
highly similar, but indicated that multiple genes or alleles of
.DELTA.12FADs exist in Prototheca.
[0509] Based on this result, two gene disruption constructs were
designed that sought to inactivate one or more .DELTA.12FAD genes.
The strategy would to embed a sucrose invertase (suc2 from S.
cerevisiae) cassette, thus conferring the ability to hydrolyze
sucrose as a selectable marker, into highly conserved coding
regions rather than use a classic gene replacement strategy. The
first construct, termed pSZ1124, contained 5' and 3' genomic
targeting sequences flanking a C. reinhardtii .beta.-tubulin
promoter driving the expression of the S. cerevisiae suc2 gene and
a Chlorella vulgaris nitrate reductase 3'UTR (S. cerevisiae suc2
cassette). The second construct, termed pSZ1125, contained 5' and
3' genomic targeting sequences flanking a C. reinhardtii
.beta.-tubulin promoter driving the expression of the S. cerevisiae
suc2 gene and a Chlorella vulgaris nitrate reductase 3'UTR. The
relevant sequences of the constructs are listed in the Sequence
Listing:
pSZ1124 (FAD2B) 5' genomic targeting sequence SEQ ID NO: 103
pSZ1124 (FAD2B) 3' genomic targeting sequence SEQ ID NO: 104 S.
cerevisiae suc2 cassette SEQ ID NO: 105 pSZ1125 (FAD2C) 5' genomic
targeting sequence SEQ ID NO: 106 pSZ1125 (FAD2C) 3' genomic
targeting sequence SEQ ID NO: 107
[0510] pSZ1124 and pSZ1125 were each introduced into a Prototheca
moriformis background and positive clones were selected based on
the ability to hydrolyze sucrose. Table 34 summarizes the lipid
profiles (in Area %, generated using methods described above)
obtained in two transgenic lines in which pSZ1124 and pSZ1125
targeting vectors were utilized.
TABLE-US-00046 TABLE 34 Lipid profiles of .DELTA.12 FAD knockouts
C10:0 C12:0 C14:0 C16:0 C16:1 C18:0 C18:1 C18:2 C18:3.alpha. parent
0.01 0.03 1.15 26.13 1.32 4.39 57.20 8.13 0.61 FAD2B 0.02 0.03 0.80
12.84 1.92 0.86 74.74 7.08 0.33 FAD2C 0.02 0.04 1.42 25.85 1.65
2.44 66.11 1.39 0.22
[0511] The transgenic containing the FAD2B (pSZ1124) construct gave
a very interesting and unexpected result in lipid profile, in that
the C18:2 levels, which would be expected to decrease, only
decreased by about one area %. However, the C18:1 fatty acid levels
increased significantly, almost exclusively at the expense of the
C16:0 levels, which decreased significantly. The transgenic
containing the FAD2C (pSZ1125) construct also gave a change in
lipid profile: the levels of C18:2 are reduced significantly along
with a corresponding increase in C18:1 levels.
Beef Tallow Mimetic
[0512] One positive clone generated from the above SAD2B knockout
experiment as described above was selected to be used as the
background for the further introduction of a C14-preferring fatty
acyl-ACP thioesterase gene. The construct introducing the C.
camphora C14-preferring thioesterase contained targeting sequence
to the 6S genomic region (allowing for targeted integration of the
transforming DNA via homologous recombination) and the expression
construct contained the C. reinhardtii .beta.-tubulin promoter
driving the expression of the neoR gene with the Chlorella vulgaris
nitrate reductase 3'UTR, followed by a second C. reinhardtii
.beta.-tubulin promoter driving the expression of a codon-optimized
C. camphora thioesterase with a Chlorella protothecoides stearoyl
ACP desaturase transit peptide with a second Chlorella vulgaris
nitrate reductase 3'UTR. The 5' 6S genomic donor sequence is listed
in SEQ ID NO: 82; the 3' 6S genomic donor sequence is listed in SEQ
ID NO: 84; and the relevant expression construct for the C.
camphora thioesterase is listed in SEQ ID NO: 83.
[0513] Transformation was carried out using biolistic methods as
described above and the cells were allowed to recover for 24 hours
on plates containing 2% sucrose. After this time, the cells were
re-suspended and re-plated on plates containing 2% sucrose and 50
.mu.g/ml G418 for selection. Nine clones out of the positive clones
generated were selected for lipid production and lipid profile. The
nine transgenic clones (with the SAD2B KO and expressing C.
camphora C14-preferring thioesterase) were cultured as described
above and analyzed for lipid profile. The results are summarized
below in Table 35. The lipid profile for tallow is also included in
Table 35 below (National Research Council 1976: Fat Content and
Composition of Animal Product).
TABLE-US-00047 TABLE 35 Lipid profile of thioesterase transformed
clones. C10:0 C12:0 C14:0 C16:0 C16:1 C18:0 C18:1 C18:2 C18:3 C20
SAD2BKO 0.01 0.33 6.13 24.24 0.19 11.08 42.03 13.45 0.98 0.73 C.
camphora TE clone 1 SAD2BKO 0.01 0.16 3.42 23.80 0.40 9.40 50.62
10.2 0.62 0.70 C. camphora TE clone 2 SAD2BKO 0.01 0.20 4.21 25.69
0.40 7.79 50.51 9.37 0.66 0.63 C. camphora TE clone 3 SAD2BKO 0.01
0.21 4.29 23.57 0.31 9.44 50.07 10.07 0.70 0.70 C. camphora TE
clone 4 SAD2BKO 0.01 0.18 3.87 24.42 0.32 9.24 49.75 10.17 0.71
0.71 C. camphora TE clone 5 SAD2BKO 0.01 0.28 5.34 23.78 0.33 9.12
49.12 10.00 0.68 0.70 C. camphora TE clone 6 SAD2BKO 0.01 0.15 3.09
23.07 0.32 10.08 51.21 10.00 0.66 0.74 C. camphora TE clone 7
SAD2BKO 0.01 0.29 5.33 24.62 0.37 7.02 49.67 10.74 0.69 0.70 C.
camphora TE clone 8 SAD2BKO 0.01 0.12 2.74 25.13 0.30 10.17 50.18
9.42 0.71 0.71 C. camphora TE clone 9 wt UTEX 0.01 0.02 0.96 23.06
0.79 3.14 61.82 9.06 0.46 0.27 1435 SAD2BKO 0.01 0.03 0.80 23.66
0.13 19.56 43.12 9.83 1.00 1.18 Tallow 0.00 0.00 4.00 26.00 3.00
14.00 41.00 3.00 1.00 0.00
[0514] As can be seen in Table 35, the lipid profiles of the
transgenic lines are quite similar to the lipid profile of tallow.
Taken collectively, the data demonstrate the utility of combining
specific transgenic backgrounds, in this case, a SAD2B knockout
with a C14-preferring thioesterase (from C. camphora), to generate
an transgenic algal strain that produce oil similar to the lipid
profile of tallow.
[0515] B. RNAi Approach to Down-Regulation of Delta 12 Desaturase
Gene (FADc) in Prototheca Cells
[0516] Vectors down-regulating FADc (delta 12 desaturase gene) gene
expression by RNAi were introduced into a Prototheca moriformis
UTEX 1435 genetic background. The Saccharomyces cerevisiae suc2
sucrose invertase gene was utilized as a selectable marker,
conferring the ability to grow on sucrose as a sole-carbon source
to positive clones. The first type of constructs utilized a portion
of the first exon of the FADc coding region linked in cis to its
first intron followed by a repeat unit of the first exon in reverse
orientation. This type of constructs theoretically leads to the
formation of a hairpin RNA when expressed as mRNA. Two constructs
of this first type were created, one driven by the Prototheca
moriformis Amt03 promoter (SEQ ID NO: 89), termed pSZ1468, and a
second construct driven by the Chlamydomomas reinhardtii
.beta.-tubulin promoter (SEQ ID NO: 114), termed pSZ 1469. A second
type of constructs utilized the large FADc exon 2 in the antisense
orientation driven by either the Prototheca moriformis Amt03
promoter (SEQ ID NO: 89), termed pSZ1470, or driven by the
Chlamydomomas reinhardtii .beta.-tubulin promoter (SEQ ID NO: 114),
termed pSZ1471. All four constructs had a S. cerevisiae suc2
sucrose invertase cassette (SEQ ID NO: 159) and a 5' (SEQ ID NO:
82) and 3' (SEQ ID NO: 84) homologous recombination targeting
sequences (flanking the construct) to the 6S genomic region for
integration into the nuclear genome. Sequences of the FADc portions
of each RNAi construct along with the relevant portions of each
construct are listed in the Sequence Listing as:
TABLE-US-00048 Description SEQ ID NO: pSZ1468 FADc RNAi hairpin
cassette SEQ ID NO: 163 Relevant portions of the pSZ1468 construct
SEQ ID NO: 164 pSZ1469 FADc RNAi hairpin cassette SEQ ID NO: 165
Relevant portions of the pSZ1469 construct SEQ ID NO: 166 pSZ1470
FADc exon 2 RNAi cassette SEQ ID NO: 167 Relevant portions of the
pSZ1470 construct SEQ ID NO: 168 pSZ1471 FADc exon 2 RNAi cassette
SEQ ID NO: 169 Relevant portions of the pSZ1471 construct SEQ ID
NO: 170
[0517] Each of the four constructs were transformed into a
Prototheca moriformis background and positive clones were screened
using plates with sucrose as the sole carbon source. Positive
clones were picked from each transformation and a subset were
selected to determine the impact of the hairpin and antisense
cassettes contained in pSZ1468, pSZ1469, pSZ1470 and pSZ1471 on
fatty acid profiles. The selected clones from each transformation
were grown under lipid producing conditions and the lipid profiles
were determined using direct transesterification methods as
described above. Representative lipid profiles from each of the
transformations are summarized below in Table 36. Wildtype 1 and 2
cells were untransformed Prototheca moriformis cells that were run
with each of the transformants as a negative control.
TABLE-US-00049 TABLE 36 Lipid profiles of Prototheca moriformis
cells containing RNAi constructs to down-regulate the expression of
delta 12 desaturase gene (FADc). Strain C10:0 C12:0 C14:0 C16:0
C18:0 C18:1 C18:2 wildtype 1 0.01 0.03 1.20 27.08 4.01 57.58 7.81
pSZ1468 0.01 0.04 1.33 25.95 3.68 65.60 1.25 clone A pSZ1468 0.01
0.03 1.18 23.43 2.84 65.32 4.91 clone B pSZ1468 0.01 0.04 1.34
23.18 4.27 63.65 5.17 clone C pSZ1468 0.01 0.03 1.24 23.00 3.85
61.92 7.62 clone D pSZ1470 0.01 0.03 1.23 24.79 4.33 58.43 8.92
clone A pSZ1470 0.01 0.03 1.26 24.91 4.14 57.59 9.64 clone B
pSZ1470 0.01 0.03 1.21 23.35 4.75 58.52 9.70 clone C wildtype 2
0.01 0.03 0.98 24.65 3.68 62.48 6.26 pSZ1469 0.01 0.03 1.05 21.74
2.71 71.33 1.22 clone A pSZ1469 0.01 0.03 1.01 22.60 2.98 70.19
1.27 clone B pSZ1469 0.01 0.03 1.03 19.82 2.38 72.95 1.82 clone C
pSZ1469 0.01 0.03 1.03 20.54 2.66 70.96 2.71 clone D pSZ1471 0.01
0.03 1.03 18.42 2.63 66.94 8.55 clone A pSZ1471 0.01 0.03 0.94
18.61 2.58 67.13 8.66 clone B pSZ1471 0.01 0.03 1.00 18.31 2.46
67.41 8.71 clone C pSZ1471 0.01 0.03 0.93 18.82 2.54 66.84 8.77
clone D
[0518] The above summarized results showed that the hairpin
constructs, pSZ1468 and pSZ1469, showed specific expected
phenotypes, namely a reduction in C18:2 fatty acid levels and an
increase in C18:1 fatty acid levels as compared to wildtype1 and
wildtype 2, respectively. The antisense constructs, pSZ1470 and
pSZ1471 did not result a decrease in C18:2 fatty acid levels, but
instead showed a slight increase when compared to wildtype 1 and
wildtype 2, respectively and a slight decrease in C16:0 fatty acid
levels.
[0519] C. Expression of an Exogenous Stearoyl-ACP Desaturase
[0520] The Olea europaea stearoyl-ACP desaturase (GenBank Accession
No. AAB67840.1) was introduced into a Prototheca moriformis
UTEX1435 genetic background. The expression construct contained a
5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination
targeting sequences (flanking the construct) to the 6S genomic
region for integration into the nuclear genome and a S. cerevisiae
suc2 sucrose invertase coding region under the control of C.
reinhardtii .beta.-tubulin promoter/5'UTR and Chlorella vulgaris
nitrate reductase 3' UTR. This S. cerevisiae suc2 expression
cassette is listed as SEQ ID NO: 159 and served as a selection
marker. The Olea europaea stearoyl-ACP desaturase coding region was
under the control of the Prototheca moriformis Amt03 promoter/5'UTR
(SEQ ID NO: 89) and C. vulgaris nitrate reductase 3'UTR, and the
native transit peptide was replaced with the Chlorella
protothecoides stearoyl-ACP desaturase transit peptide (SEQ ID NO:
49. The codon-optimized cDNA sequences and amino acid sequences
(with the replaced transit peptide) are listed in the Sequence
Listing as SEQ ID NO: 171 and SEQ ID NO: 172, respectively. The
entire O. europaea SAD expression cassette was termed pSZ1377 and
transformed into a Prototheca moriformis genetic background.
Positive clones were screened on plates with sucrose as the sole
carbon source. A subset of the positive clones were selected and
grown under lipid production conditions and lipid profiles were
determined using direct transesterification methods as described
above. The lipid profiles of the selected clones are summarized in
Table 37 below.
TABLE-US-00050 TABLE 37 Lipid profiles of Olea europaea
stearoyl-ACP desaturase transgenic Prototheca moriformis cells.
Strain C14:0 C16:0 C18:0 C18:1 C18:2 wildtype 0.88 22.82 3.78 64.43
6.54 pSZ1377 0.94 18.60 1.50 69.45 7.67 clone A pSZ1377 0.93 18.98
1.35 69.12 7.67 clone B pSZ1377 0.93 19.01 2.31 68.56 7.43 clone
C
[0521] The above summarized results demonstrate that the
introduction of an heterologous desaturase, in this case a
stearoyl-ACP desaturase from Olea europaea, can result in higher
levels of C18:1 fatty acid and a concomitant decrease in C18:0 and
C16:0 fatty acid levels.
Example 7: Engineering Prototheca to Produce Hydroxylated Fatty
Acids
[0522] The Ricinus communis oleate 12-hydroxylase (Rc12hydro)
(GenBank Accession No. AAC49010.1) was introduced into a Prototheca
moriformis UTEX1435 genetic background. The expression construct
contained a 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84) homologous
recombination targeting sequences (flanking the construct) to the
6S genomic region for integration into the nuclear genome and a S.
cerevisiae suc2 sucrose invertase coding region under the control
of C. reinhardtii .beta.-tubulin promoter/5'UTR and Chlorella
vulgaris nitrate reductase 3' UTR. This S. cerevisiae suc2
expression cassette is listed as SEQ ID NO: 159 and served as a
selection marker. The Ricinus communis oleate 12-hydroxylase coding
region was under the control of the Prototheca moriformis Amt03
promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase
3'UTR. The codon-optimized cDNA sequences and amino acid sequences
are listed in the Sequence Listing as SEQ ID NO: 173 and SEQ ID NO:
174, respectively. The entire Rc12hydro expression cassette was
termed pSZ1419 and transformed into a Prototheca moriformis genetic
background. Positive clones were screened on plates with sucrose as
the sole carbon source. A subset of the positive clones were
selected and grown under lipid production conditions and screened
for the product of the R. communis oleate 12-hydroxylase, namely,
ricinoleic acid using a GC/MS method.
[0523] The GC/MS method used to detect any ricinoleic acid produced
in positive Rc12hydro transgenics was as follows. Samples of
positive clones and a wildtype control were dried and then
suspended in 2.2 mL of 4.5 H.sub.2SO.sub.4 in methanol-toluene,
10:1 (v/v). The mixture was then heated at 70-75.degree. C. for 3.5
hours with intermittent sonication and vortexing. After cooling to
room temperature, 2 mL of 6% K.sub.2CO.sub.3 (aq) and 2 mL of
heptane was added, the mixture was then vortexed vigorously and the
separation of layers was hastened by centrifugation at 900 rpm for
2 minutes. The upper layer was removed and concentrated to dryness
with a stream of nitrogen. To the resulting oil was added 500 .mu.L
of dry pyridine and 500 .mu.L of BSTFA/1% TMCS (Thermo Scientific).
The resulting solution was heated at 70-75.degree. C. for 1.5 hours
and then concentrated to dryness with a stream of nitrogen. The
residue was then resuspended in 2 mL of heptane and reconcentrated.
Samples were resuspended in 2 mL of heptane and analyzed by GC/MS
on a Thermo Trace GC Ultra/DSQII system in EI mode using selective
ion monitoring of the base-peak of the TMS either of methyl
ricinoleate (m/z 187). Fatty acid methyl esters were separated on a
Restek Rxi-5Sil MS column (0.25 mm ID, 30 m length, 0.5 .mu.m film
thickness) using helium as the carrier gas at a flow of 1 mL/min.
The initial temperature of the column was held at 130.degree. C.
for 4 minutes, followed by a ramp of 4.degree. C./min to a final
temperature of 240.degree. C. The presence of ricinoleic acid in
samples was confirmed by comparison of retention time and full-scan
mass spectra to an authentic sample of ricinoleic acid treated as
described above. FIG. 2 shows the GC retention time of a
representative positive transgenic clone compared to the ricinoleic
acid standard and a wildtype control. The positive transgenic clone
has a derivable peak at RT:33.22/33.23 which corresponds to a
similar peak in the ricinoleic acid standard, indicating the
presence of derivable ricinoleic acid in both the transgenic clone
and the positive control. This peak was entirely lacking in the
wildtype control sample.
Example 8: Engineering Prototheca with Alternative Selectable
Markers
[0524] A. Expression of a Secretable .alpha.-Galactosidase in
Prototheca moriformis
[0525] Methods and effects of expressing a heterologous sucrose
invertase gene in Prototheca species have been previously described
in PCT Application No. PCT/US2009/66142, hereby incorporated by
reference. The expression of other heterologous polysaccharide
degrading enzymes was examined in this Example. The ability to grow
on melibiose (.alpha.-D-gal-glu) by Prototheca moriformis UTEX 1435
with one of the following exogenous gene encoding a
.alpha.-galactosidase was tested: MEL1 gene from Saccharomyces
carlbergensis (amino acid sequence corresponding to NCBI accession
number P04824), AglC gene from Aspergillus niger (amino acid
sequence corresponding to NCBI accession number Q9UUZ4), and the
.alpha.-galactosidase from the higher plant Cyamopsis tetragobobola
(Guar bean) (amino acid sequence corresponding to NCBI accession
number P14749). The above accession numbers and corresponding amino
acid sequences are hereby incorporated by reference. In all cases,
genes were optimized according to the preferred codon usage in
Prototheca moriformis. The relevant portions of the expression
cassette are listed below along with the Sequence Listing numbers.
All expression cassettes used the 5' and 3' C1p homologous
recombination targeting sequences for stable genomic integration,
the Chlamydomonas reinhardtii TUB2 promoter/5'UTR, and the
Chlorella vulgaris nitrate reductase 3'UTR.
[0526] S. carlbergensis MEL1 amino acid sequence SEQ ID NO: 108
[0527] S. carlbergensis MEL1 amino acid sequence signal peptide SEQ
ID NO: 109
[0528] S. carlbergensis MEL1 transformation cassette SEQ ID NO:
110
[0529] S. carlbergensis MEL1 sequence (codon optimized) SEQ ID NO:
111
[0530] 5' C1p homologous recombination targeting sequence SEQ ID
NO: 112
[0531] 3' C1p homologous recombination targeting sequence SEQ ID
NO: 113
[0532] Chlamydomonas reinhardtii TUB2 promoter/5'UTR SEQ ID NO:
114
[0533] Chlorella vulgaris nitrate reductase 3'UTR SEQ ID NO:
115
[0534] A. niger AlgC amino acid sequence SEQ ID NO: 116
[0535] A. niger AlgC amino acid sequence signal peptide SEQ ID NO:
117
[0536] A. niger AlgC sequence (codon optimized) SEQ ID NO: 118
[0537] A. niger AlgC transformation cassette SEQ ID NO: 119
[0538] C. tetragonobola .alpha.-galactosidase amino acid sequence
SEQ ID NO: 120
[0539] C. tetragonobola .alpha.-galactosidase sequence (codon
optimized) SEQ ID NO: 121
[0540] C. tetragonobola .alpha.-galactosidase transformation
cassette SEQ ID NO: 122
[0541] Prototheca moriformis cells were transformed with each of
the three expression cassettes containing S. carlbergensis MEL1, A.
niger AlgC, or C. tetragonobola .alpha.-galactosidase gene using
the biolistic transformation methods as described in Example 2
above. Positive clones were screened using plates containing 2%
melibiose as the sole carbon source. No colonies appeared on the
plates for the C. tetragonobola expression cassette transformants.
Positive clones were picked from the plates containing the S.
carlbergensis MEL1 transformants and the A. niger AlgC
transformants. Integration of the transforming DNA was confirmed
using PCR with primers targeting a portion of the C. vulgaris 3'UTR
and the 3' C1p homologous recombination targeting sequence.
TABLE-US-00051 5' primer C.vulgaris 3'UTR:downstream C1p sequence
(SEQ ID NO: 123) ACTGCAATGCTGATGCACGGGA 3' primer C.vulgaris
3'UTR:downstream C1p sequence (SEQ ID NO: 124)
TCCAGGTCCTTTTCGCACT
[0542] As a negative control, genomic DNA from untransformed
Prototheca moriformis cells were also amplified with the primer
set. No products were amplified from genomic DNA from the wild type
cells.
[0543] Several positive clones from each of the S. carlbergensis
MEL1 transformants and the A. niger AlgC transformants (as
confirmed by PCR) were tested for their ability to grow on
melibiose as the sole carbon source in liquid media. These selected
clones were grown for 3 days in conditions and base medium
described in Example 1 above with melibiose as the sole carbon
source. All clones containing either .alpha.-galactosidase-encoding
genes grew robustly during this time, while the untransformed wild
type strain and Prototheca moriformis expressing a Saccharomyces
cerevisiae SUC2 sucrose invertase both grew poorly on the melibiose
media. These results suggest that the .alpha.-galactosidase
encoding genes may be used as a selectable marker for
transformation. Also, these data indicate that the native signal
peptides present in the S. carlbergensis MEL1 (SEQ ID NO: 109) or
A. niger AlgC (SEQ ID NO: 117) are useful for targeting proteins to
the periplasm in Prototheca moriformis cells.
[0544] B. THIC Genes Complements Thiamine Auxotrophy in
Prototheca
[0545] Thiamine prototrophy in Prototheca moriformis cells was
examined using expression of exogenous THIC genes. Thiamine
biosynthesis in plants and algae is typically carried out in the
plastid, hence most nuclear encoded proteins involved in its
production will need to be efficiently targeted to the plastid. DNA
sequencing and transcriptome sequencing of Prototheca moriformis
cells revealed that all of the genes encoding the thiamine
biosynthetic enzymes were present in the genome, with the exception
of THIC. To dissect the lesion responsible for thiamine auxotrophy
at the biochemical level, the growth of Prototheca moriformis cells
under five different regimes were examined: (1) in the presence of
2 .mu.M thiamine hydrochloride; (2) without thiamine; (3) without
thiamine, but with 2 .mu.M hydroxyethyl thiazole (THZ); (4) without
thiamine, but with 2 .mu.M
2-methyl-4-amino-5-(aminomethyl)pyrimidine (PYR); and (5) without
thiamine, but with 2 .mu.M THZ and 2 .mu.M PYR. Results from the
growth experiments under these 5 different conditions indicated
that Prototheca moriformis cells are capable of de novo synthesis,
but can only produce thiamine pyrophosphate (TPP) if the PYR
precursor is provided. This result is consistent with the
hypothesis that the thiamine auxotrophy of Prototheca moriformis is
due to the inability to synthesize hydroxymethylpyrimidine
phosphate (HMP-P) from aminoimidazole ribonucleotide, which is the
conversion catalyze by THIC enzyme.
[0546] Prototheca moriformis cells were transformed using the
biolistic transformation methods described above in Example 2,
expressing the Coccomyxa C-169 THIC (amino acid sequence
corresponding to JGI Protein ID 30481, and hereby incorporated by
reference) and a S. cerevisiae SUC2 sucrose invertase as the
selective marker. This expression construct contained the native
transit peptide sequence from Coccomyxa C-169 THIC, upstream and
downstream homologous recombination targeting sequences to the 6S
region of genomic DNA, a C. reinhardtii TUB2 promoter/5'UTR region
(SEQ ID NO: 104), and a Chlorella vulgaris nitrate reductase 3'UTR
(SEQ ID NO: 115). The S. cerevisiae SUC2 expression was also driven
by a C. reinhardtii TUB2 promoter/5'UTR region (SEQ ID NO: 114) and
contained a Chlorella vulgaris nitrate reductase 3'UTR (SEQ ID NO:
115). Genes were optimized according to the preferred codon usage
in Prototheca moriformis. The relevant expression cassette
sequences are listed in the Sequence Listing and detailed
below:
Coccomyxa C-169 THIC amino acid sequence SEQ ID NO: 125 Coccomyxa
C-169 THIC amino acid sequence native transit peptide SEQ ID NO:
126 Coccomyxa C-169 THIC transformation cassette SEQ ID NO: 127
Coccomyxa C-169 THIC sequence (codon optimized) SEQ ID NO: 128 S.
cerevisiae SUC2 sequence (codon optimized) SEQ ID NO: 129 5' 6S
homologous recombination targeting sequence SEQ ID NO: 82 3' 6S
homologous recombination targeting sequence SEQ ID NO: 84 Selection
of positive clones were performed on plates without thiamine and
containing sucrose as the sole carbon source. Positive clones were
confirmed using PCR with a 5' primer that binds within the
Coccomyxa C-169 THIC gene and a 3' primer that anneals downstream
of the transforming DNA in the 6S locus. PCR confirmed positive
clones were also confirmed using Southern blot assays.
[0547] To observe the thiamine auxotrophy of wildtype Prototheca
moriformis cells, it was necessary to first deplete cells of
internal thiamine reserves. To test growth in medium without
thiamine, cells were first grown to stationary phase in medium
containing 2 .mu.M thiamine and then the cells were diluted to an
optical density at 750 nm (OD750) of approximately 0.05 in medium
without thiamine. The diluted cells were then grown once more to
stationary phase in medium without thiamine (about 2-3 days). These
thiamine-depleted cells were used to inoculate cultures for growth
studies in medium without thiamine. Wildtype cells were grown in
medium with glucose as the carbon source (with or without thiamine)
and positive clones with the native transit peptide Coccomyxa C-169
THIC construct were grown in medium with sucrose as the sole carbon
source. Growth was measured by monitoring the absorbance at 750 nm.
Results of the growth experiments showed substantial greater growth
in thiamine-free medium of strains expressing the transgene
compared to wildtype cells in thiamine-free medium. However, the
transformants failed to achieve the growth rate and cell densities
of wildtype cells in thiamine-containing media. There was also a
strong correlation between the amount of growth in the transformant
clones in thiamine-free medium and the copy number of the
integrated Coccomyxa enzyme (i.e., the more copy numbers of the
transgene, the better the growth of the cells in thiamine-free
medium).
[0548] Additional transformants were generated using expression
constructs containing the Coccomyxa THIC, the Arabidopsis thaliana
THIC gene, and the Synechocystis sp. PCC 6803 thiC gene. In the
case of the Coccomyxa and the A. thaliana THIC gene, the native
transit peptide sequence was replaced with the transit peptide
sequence from a Chlorella protothecoides stearoyl-ACP desaturase
(SAD) gene. Synechocystis sp. is a cyanobacterium and the thiC
protein does not contain a native transit peptide sequence. In the
Synechocystis sp thiC construct, the transit peptide sequence from
a Chlorella protothecoides SAD gene was fused to the N-terminus of
the Synechocystis sp. thiC. In all cases, the sequences were codon
optimized for expression in Prototheca moriformis. All three of the
foregoing constructs contained a upstream and downstream homologous
recombination targeting sequence to the 6S region of the genome
(SEQ ID NOs: 82 and 84), a Chlorella protothecoides actin
promoter/5' UTR, and a Chlorella protothecoides EF1A gene 3'UTR.
All three constructs contained a neoR gene driven by the C.
reinhardtii TUB2 promoter/5'UTR (SEQ ID NO: 114) and contained the
C. vulgaris 3'UTR (SEQ ID NO: 115), conferring the selection by
G418. The amino acid sequence of the A. thaliana THIC corresponded
to NCBI accession number NP_180524 and the amino acid sequence of
the Synechocystis sp. thiC corresponded to NCBI accession number
NP_442586, both sequences hereby incorporated by reference. The
relevant expression cassette sequences are listed in the Sequence
Listing and detailed below: [0549] Coccomyxa THIC expression
construct with C. protothecoides transit peptide SEQ ID NO: 130
[0550] Coccomyxa THIC with C. protothecoides transit peptide SEQ ID
NO: 131 [0551] C. protothecoides actin promoter/5' UTR SEQ ID NO:
132 [0552] C. protothecoides EF1A 3'UTR SEQ ID NO: 133 [0553] A.
thaliana THIC expression construct SEQ ID NO: 134 [0554] A.
thaliana THIC with C. protothecoides transit peptide SEQ ID NO: 135
[0555] A. thaliana THIC amino acid sequence with native transit
peptide SEQ ID NO: 136 [0556] Synechocystis sp. thiC expression
construct SEQ ID NO: 137 [0557] Synechocystis sp. thiC with C.
protothecoides transit peptide SEQ ID NO: 138 [0558] Synechocystis
sp. thiC amino acid sequence SEQ ID NO: 139 [0559] neoR gene SEQ ID
NO: 140
[0560] Positive clones were screened on plates containing G418 and
several clones from each transformation were picked for
verification by PCR. Integration of the transforming DNA constructs
containing the Coccomyxa C-169 (with C. protothecoides transit
peptide), A. thaliana and Synechocystis sp. PCC 6803 THIC genes,
respectively into the 6S locus of the genome was confirmed using
PCR analysis with the following primers:
TABLE-US-00052 5' THIC Coccomyxa confirmation primer sequence (SEQ
ID NO: 141) ACGTCGCGACCCATGCTTCC 3' THIC confirmation primer
sequence (SEQ ID NO: 142) GGGTGATCGCCTACAAGA 5' THIC A. thaliana
confirmation primer sequence (SEQ ID NO: 143) GCGTCATCGCCTACAAGA 5'
thiC Synechocystis sp. confirmation primer sequence (SEQ ID NO:
144) CGATGCTGTGCTACGTGA
[0561] Growth experiments on thiamine depleted cells (as described
above) were performed using selected confirmed positive clones from
transformants of each of the different constructs in medium
containing G418. All transformants were able to grow (with varying
degrees of robustness) in thiamine-free medium. Comparison of the
growth of the transformants in thiamine-free medium to wild type
cells on thiamine-containing medium showed the following ranking
with respect to their ability to support growth in thiamine-free
medium: (1) A. thaliana transformants; (2) Coccomyxa C-169 (with C.
protothecoides transit peptide) transformants; and (3)
Synechocystis sp. transformants. These results suggest that while a
single copy of A. thaliana THIC was able to complement thiamine
auxotrophy in Prototheca moriformis cells, multiple copies of
Coccomyxa C-169 (with either the native transit peptide sequence or
a transit peptide sequence from C. protothecoides) and
Synechocystis sp. THIC was required to enable rapid growth in the
absence of thiamine. Given the variability in results of the
different THIC from the different sources, the ability of any
particular THIC gene to fully complement the lesion present in
Prototheca species is not predictable.
[0562] An alignment of the three THIC amino acid sequences was
performed. While there exist significant sequence conservation
between thiC from Synechocystis sp. compared to the THICs from
Coccomyxa and A. thaliana (41% identity at the amino acid level),
the cyanobacterial protein is missing a domain at the N-terminus
that is well-conserved in the algal and plant proteins. Despite the
missing domain (and presumably resulting in structural
differences), the construct expressing the Synechocystis sp. thiC
was able to at least partially restore thiamine prototrophic in
Prototheca moriformis cells.
Example 9: Fuel Production
[0563] A. Extraction of Oil from Microalgae Using an Expeller Press
and a Press Aid
[0564] Microalgal biomass containing 38% oil by DCW was dried using
a drum dryer resulting in resulting moisture content of 5-5.5%. The
biomass was fed into a French L250 press. 30.4 kg (67 lbs.) of
biomass was fed through the press and no oil was recovered. The
same dried microbial biomass combined with varying percentage of
switchgrass as a press aid was fed through the press. The
combination of dried microbial biomass and 20% w/w switchgrass
yielded the best overall percentage oil recovery. The pressed cakes
were then subjected to hexane extraction and the final yield for
the 20% switchgrass condition was 61.6% of the total available oil
(calculated by weight). Biomass with above 50% oil dry cell weight
did not require the use of a pressing aid such as switchgrass in
order to liberate oil. Other methods of extraction of oil from
microalgae using an expeller press are described in PCT Application
No. PCT/US2010/31108 and is hereby incorporated by reference.
[0565] B. Production of Biodiesel from Prototheca Oil
[0566] Degummed oil from Prototheca moriformis UTEX 1435, produced
according to the methods described above, was subjected to
transesterification to produce fatty acid methyl esters. Results
are shown in Table 38 below.
[0567] The lipid profile of the oil was:
C10:0 0.02
C12:0 0.06
C14:0 1.81
C14.1 0.07
C16:0 24.53
C16:1 1.22
C18:0 2.34
C18:1 59.21
C18:2 8.91
C18:3 0.28
C20:0 0.23
C20:1 0.10
C20:1 0.08
C21:0 0.02
C22:0 0.06
C24:0 0.10
TABLE-US-00053 [0568] TABLE 38 Biodiesel profile from Prototheca
moriformis triglyceride oil. Method Test Result Units ASTM Cold
Soak Filterability of Filtration Time 120 sec D6751 A1 Biodiesel
Blend Fuels Volume Filtered 300 ml ASTM D93 Pensky-Martens Closed
Cup Procedure Used A Flash Point Corrected Flash 165.0 .degree. C.
Point ASTM Water and Sediment in Middle Sediment and Water 0.000
Vol % D2709 Distillate Fuels (Centrifuge Method) EN 14538
Determination of Ca and Mg Sum of (Ca and <1 mg/kg Content by
ICP OES Mg) EN 14538 Determination of Ca and Mg Sum of (Na and K)
<1 mg/kg Content by ICP OES ASTM D445 Kinematic/Dynamic
Kinematic Viscosity 4.873 mm.sup.2/s Viscosity @ 104.degree.
F/40.degree. C. ASTM D874 Sulfated Ash from Lubricating Sulfated
Ash <0.005 Wt % Oils and Additives ASTM Determination of Total
Sulfur Sulfur, mg/kg 1.7 mg/kg D5453 in Light Hydrocarbons, Spark
Ignition Engine Fuel, Diesel Engine Fuel, and Engine Oil by
Ultraviolet Fluorescence. ASTM D130 Corrosion - Copper Strip
Biodiesel-Cu 1a Corrosion 50.degree. C. (122.degree. F.)/3 hr ASTM
Cloud Point Cloud Point 6 .degree. C. D2500 ASTM Micro Carbon
Residue Average Micro <0.10 Wt % D4530 Method Carbon Residue
ASTM D664 Acid Number of Petroleum Procedure Used A Products by
Potentiometric Acid Number 0.20 mg Titration KOH/g ASTM
Determination of Free and Free Glycerin <0.005 Wt % D6584 Total
Glycerin in B-100 Total Glycerin 0.123 Wt % Biodiesel Methyl Esters
By Gas Chromatography ASTM Additive Elements in Phosphorus 0.000200
Wt % D4951 Lubricating Oils by ICP-AES ASTM Distillation of
Petroleum IBP 248 .degree. C. D1160 Products at Reduced Pressure
AET @ 5% 336 .degree. C. Recovery AET @ 10% 338 .degree. C.
Recovery AET @ 20% 339 .degree. C. Recovery AET @ 30% 340 .degree.
C. Recovery AET @ 40% 342 .degree. C. Recovery AET @ 50% 344
.degree. C. Recovery AET @ 60% 345 .degree. C. Recovery AET @ 70%
347 .degree. C. Recovery AET @ 80% 349 .degree. C. Recovery AET @
90% 351 .degree. C. Recovery AET @ 95% 353 .degree. C. Recovery FBP
362 .degree. C. % Recovered 98.5 % % Loss 1.5 % % Residue 0.0 %
Cold Trap Volume 0.0 ml IBP 248 .degree. C. EN 14112 Determination
of Oxidation Oxidation Stability >12 hr Stability (Accelerated
Operating Temp 110 .degree. C. Oxidation Test) (usually 110 deg C.)
ASTM Density of Liquids by Digital API Gravity @ 60.degree. F. 29.5
.degree.API D4052 Density Meter ASTM D Determination of Ignition
Derived Cetane >61.0 6890 Delay (ID) and Derived Number (DCN)
Cetane Number (DCN)
[0569] The lipid profile of the biodiesel was highly similar to the
lipid profile of the feedstock oil. Other oils provided by the
methods and compositions of the invention can be subjected to
transesterification to yield biodiesel with lipid profiles
including (a) at least 4% C8-C14; (b) at least 0.3% C8; (c) at
least 2% C10; (d) at least 2% C12; and (3) at least 30% C8-C14.
[0570] The Cold Soak Filterability by the ASTM D6751 A1 method of
the biodiesel produced was 120 seconds for a volume of 300 ml. This
test involves filtration of 300 ml of B100, chilled to 40.degree.
F. for 16 hours, allowed to warm to room temp, and filtered under
vacuum using 0.7 micron glass fiber filter with stainless steel
support. Oils of the invention can be transesterified to generate
biodiesel with a cold soak time of less than 120 seconds, less than
100 seconds, and less than 90 seconds.
[0571] C. Production of Renewable Diesel
[0572] Degummed oil from Prototheca moriformis UTEX 1435, produced
according to the methods described above and having the same lipid
profile as the oil used to make biodiesel in this Example, above,
was subjected to transesterification to produce renewable
diesel.
[0573] The oil was first hydrotreated to remove oxygen and the
glycerol backbone, yielding n-paraffins. The n-parrafins were then
subjected to cracking and isomerization. A chromatogram of the
material is shown in FIG. 1. The material was then subjected to
cold filtration, which removed about 5% of the C18 material.
Following the cold filtration the total volume material was cut to
flash point and evaluated for flash point, ASTM D-86 distillation
distribution, cloud point and viscosity. Flash point was 63.degree.
C.; viscosity was 2.86 cSt (centistokes); cloud point was 4.degree.
C. ASTM D86 distillation values are shown in Table 39:
TABLE-US-00054 TABLE 39 ASTM D86 distillation values. Readings in
.degree. C.: Volume Temperature IBP 173 5 217.4 10 242.1 15 255.8
20 265.6 30 277.3 40 283.5 50 286.6 60 289.4 70 290.9 80 294.3 90
300 95 307.7 FBP 331.5
[0574] The T10-T90 of the material produced was 57.9.degree. C.
Methods of hydrotreating, isomerization, and other covalent
modification of oils disclosed herein, as well as methods of
distillation and fractionation (such as cold filtration) disclosed
herein, can be employed to generate renewable diesel compositions
with other T10-T90 ranges, such as 20, 25, 30, 35, 40, 45, 50, 60
and 65.degree. C. using triglyceride oils produced according to the
methods disclosed herein.
[0575] The T10 of the material produced was 242.1.degree. C.
Methods of hydrotreating, isomerization, and other covalent
modification of oils disclosed herein, as well as methods of
distillation and fractionation (such as cold filtration) disclosed
herein, can be employed to generate renewable diesel compositions
with other T10 values, such as T10 between 180 and 295, between 190
and 270, between 210 and 250, between 225 and 245, and at least
290.
[0576] The T90 of the material produced was 300.degree. C. Methods
of hydrotreating, isomerization, and other covalent modification of
oils disclosed herein, as well as methods of distillation and
fractionation (such as cold filtration) disclosed herein can be
employed to generate renewable diesel compositions with other T90
values, such as T90 between 280 and 380, between 290 and 360,
between 300 and 350, between 310 and 340, and at least 290.
[0577] The FBP of the material produced was 300.degree. C. Methods
of hydrotreating, isomerization, and other covalent modification of
oils disclosed herein, as well as methods of distillation and
fractionation (such as cold filtration) disclosed herein, can be
employed to generate renewable diesel compositions with other FBP
values, such as FBP between 290 and 400, between 300 and 385,
between 310 and 370, between 315 and 360, and at least 300.
[0578] Other oils provided by the methods and compositions of the
invention can be subjected to combinations of hydrotreating,
isomerization, and other covalent modification including oils with
lipid profiles including (a) at least 4% C8-C14; (b) at least 0.3%
C8; (c) at least 2% C10; (d) at least 2% C12; and (3) at least 30%
C8-C14.
[0579] Although this invention has been described in connection
with specific embodiments thereof, it will be understood that it is
capable of further modifications. This application is intended to
cover any variations, uses, or adaptations of the invention
following, in general, the principles of the invention and
including such departures from the present disclosure as come
within known or customary practice within the art to which the
invention pertains and as may be applied to the essential features
hereinbefore set forth.
Example 10: Engineering Microorganisms to Produce C18:2 and C18:3
Glycerolipids
[0580] The synthesis of lipids in algae and plants starts with
conversion of Glucose or other carbon sources into acetyl CoA via
the plastidic pyruvate dehydrogenase complex. Next, Acetyl CoA
carboxylase (ACCase) utilizing bicarbonate as a substrate,
generates the 3-C compound, malonyl CoA. .beta.-ketoacyl-ACP (acyl
carrier protein) synthase III (KAS III) then catalyzes the first
condensation reaction between malonyl CoA and Acetyl CoA to produce
a 4-C compound. Successive 2-C additions through C16:0 are
catalyzed by KAS I. The final 2-C extension to C18:0 is catalyzed
by KAS II. Thioesterases (TEs) terminate elongation off of the
acyl-ACP. The soluble enzyme, Stearoyl ACP desaturase (SAD) has
activity toward C18:0-ACP substrates and forms the double bond at
the A9 position resulting in oleate-ACP. The resulting C18:1 fatty
acid is liberated from the ACP via the action of either an oleate
or broad specificity TE.
[0581] All fatty acids, once liberated from ACP in the plastid are
transported to the ER where lipid (TAG) biosynthesis occurs.
Broadly speaking, there are two routes for lipid biosynthesis in
the ER of higher plants, however the two pathways no doubt share
substrates at some level. The fatty acyl CoA independent pathway
transfers fatty acyl groups between phosphatidyl choline
(P-choline) moieties employing acyllysophosphatidylcholine acyl
transferases that may exhibit very selective substrate
specificites, ultimately transferring them to diacylglycerol (DAG).
The enzyme diacylglycerol acyltransferase (DGAT) carries out the
final transfer of fatty acyl groups from an acyl CoA substrate to
DAG resulting in the final triacyl glycerol. The fatty acyl CoA
dependent pathway, on the other hand, transfers fatty acyl groups
using fatty acyl CoAs as substrates onto glycerol-3-phosphate,
lysophosphatidic acid (LPA) and DAG through the actions of glycerol
phosphate acyltransferase (GPAT), lysophosphatidic acid
acyltransferase (LPAAT) and DGAT, respectively.
[0582] Enzymes useful in engineering microorganisms to synthesize
TAGs comprising C18:2 and C18:3 include .beta.-ketoacyl-ACP
synthase IIs (KAS II), stearoyl ACP desaturases (SADs),
thioesterases, including oleate specific thioesterases, fatty acid
desaturates (FADs), and glycerolipid desaturases, such as .omega.-6
fatty acid desaturases, .omega.-3 fatty acid desaturases, or
.omega.-6-oleate desaturases. These different enzymes can be
overexpressed in microorganisms either singly or in combination to
increase C18:2 or C18:3 fatty acid or TAG production. Increasing
the expression of KAS II enzyme activity pushes carbon accumulation
from palmitate (C16:0) toward stearate (C18:0) and beyond. The
amino acid sequences of several candidate KAS II enzymes are shown
below in Table 40. The KAS II sequences disclosed are from higher
plant species that specifically produce elevated levels of oleic,
linoleic or linolenic fatty acids. A skilled artisan will be able
to identify other genes for KAS II, including without limitation
Jatropha curcas (GenBank Accession No. ABJ90469.2), Glycine max
(GenBank Accession No. AAW88762.1), Elaeis oleifera (GenBank
Accession No. ACQ41833.1), Arabidopsis thaliana (GenBank Accession
No. AAL91174), Vitis vinifera (GenBank Accession No. CBI27767), and
Gossypium hirsutum (GenBank Accession No. ADK23940.1).
TABLE-US-00055 TABLE 40 Exemplary KAS II enzymes. KAS II enzyme SEQ
ID NO Ricinus communis SEQ ID NO: 175 Helianthus annus SEQ ID NO:
176 Brassica napus SEQ ID NO: 177 Glycine max SEQ ID NO: 178 P.
moriformis SEQ ID NO: 179
[0583] Converting increased levels of stearates to oleic acid
(C18:1) for the production of elevated levels of linoleic and
linolenic fatty acids is achieved through microbial overexpression
of one or more lipid pathway enzymes. Two additional enzymatic
activities that have utility in elevating the levels of unsaturates
are the stearoyl ACP desaturases (SAD) and oleate specific
thioesterases. Converting increased levels of stearates (C18:0) to
oleic acid through the action of one or both of these enzymes is
first accomplished for the formation of linoleic and linolenic
fatty acids.
[0584] The amino acid sequences of exemplary SAD enzymes useful for
overexpression for elevating oleic acid levels are referenced in
Table 41. In addition, the endogenous SAD from P. moriformis (SEQ
ID NO:180) is also effective for increasing C18:1 levels. The SAD
sequences disclosed are from higher plant species that specifically
produce elevated levels of oleic, linoleic or linolenic fatty
acids. A skilled artisan will be able to identify other genes for
SADs.
TABLE-US-00056 TABLE 41 Exemplary SAD enzymes. SAD enzyme SEQ ID NO
GenBank ID No. Ricinus communis SEQ ID NO: 196 ACG59946.1
Helianthus annus SEQ ID NO: 197 AAB65145.1 Brassica juncea SEQ ID
NO: 198 AAD40245.1 Glycine max SEQ ID NO: 199 ACJ39209.1 Olea
europaea SEQ ID NO: 200 AAB67840.1 Vernicia fordii SEQ ID NO: 201
ADC32803.1
[0585] SAD enzymes have activity toward C18:0-ACP substrates and
form the carbon-carbon double bond at the A9 position resulting in
oleate-ACP. The resulting C18:1 fatty acid is liberated from the
ACP via the action of either an oleate or broad specificity TE. We
have shown in the examples herein that the over expression of the
Olea europaea stearoyl-ACP desaturase (Accession No: AAB67840.1;
SEQ ID NO: 172) or the Carthamus tinctorius ACP thioesterase
(Accession No: AAA33019.1; SEQ ID NO: 195) results in increased
accumulation of C18:1 fatty acids. The amino acid sequences of
exemplary oleate thioesterases useful for increasing oleic fatty
acids are referenced in Table 42. A skilled artisan will be able to
identify other genes for oleate thioesterases.
TABLE-US-00057 TABLE 42 Exemplary thioesterases for elevated oleic
fatty acid production. Thioesterase Enzyme SEQ ID NO GenBank ID No.
Helianthus annus SEQ ID NO: 202 AAL79361.1 Brassica rapa SEQ ID NO:
203 AAC49002.1 Jatropha curcas SEQ ID NO: 204 ABX82799.3 Zea mays
SEQ ID NO: 205 ACG40089.1 Zea mays SEQ ID NO: 206 ACG42559.1
[0586] Fatty acid desaturates are additional enzymes that have
utility in increasing accumulation of linoleic and linolenic fatty
acids in microbes. In particular, two enzymatic activities, FAD 2
and FAD 3, provide increased accumulation of linoleic and linolenic
fatty acids in microbes. The amino acid sequences of exemplary FAD
2 and FAD 3 enzymes are shown below in Table 43.
TABLE-US-00058 TABLE 43 Exemplary FAD 2 and FAD 3 enzymes. FAD 2
and FAD 3 enzymes SEQ ID NO Linus usitatissimum 12 desaturase SEQ
ID NO: 181 Linus usitatissimum 15 desaturase SEQ ID NO: 182 Linus
usitatissimum 15 desaturase SEQ ID NO: 183 Carthamus tinctorus 12
desaturase SEQ ID NO: 184 Helianthus annus 12 desaturase SEQ ID NO:
185
[0587] In addition to those enzymes listed in Table 43, the amino
acid sequences of exemplary .DELTA.12 FAD enzymes are listed in
Table 44. Other .DELTA.12 FAD enzymes suitable for overexpression
in microorganisms are referenced in Table 45. The amino acid
sequences of exemplary .DELTA.15 FADs and other enzymes useful for
increasing the level of unsaturated fatty acids and TAGs are listed
in Table 46. Additional glycerolipid desaturase enzymes are
provided in Table 47.
TABLE-US-00059 TABLE 44 Exemplary .DELTA.12 FAD enzymes for
increasing linoleic fatty acid production. .DELTA.12 FAD enzyme SEQ
ID NO GenBank ID No. Carthamus tinctorius SEQ ID NO: 207 ADM48790.1
Gossypium hirsutum SEQ ID NO: 208 CAA71199.1 Glycine max SEQ ID NO:
209 BAD89862.1 Zea mays SEQ ID NO: 210 ABF50053.1 Prototheca
moriformis SEQ ID NO: 211 allele 1 Prototheca moriformis SEQ ID NO:
212 allele 2
TABLE-US-00060 TABLE 45 Additional .DELTA.12 FAD enzymes suitable
for overexpression in microorganisms to increase linoleic acid or
linolenic acid. .DELTA.12 FAD enzymes GGenBank Accession No.
Vernonia galamensis AAAF04094.1 Vernonia galamensis AAAF04093.1
Wrightia tinctoria AADK47520.1 Olea europaea AAAW63041.1 Vernicia
fordii AAAN87573 Arabidopsis thaliana AAAA32782.1 Camelina sativa
AADU18247.1 Camelina sativa AADU18248.1 Camelina sativa AADU18249.1
Carthamus tinctorius AADK94440.1 Glycine max BBAD89862.1 Glycine
max DDQ532371.1 Gossypium hirsutum AAAL37484.1 Linum usitatissimum
AACF49507.1 Linum usitatissimum AACF49508.1 Oenothera biennis
AACB47482 Saccharomyces cerevisiae NNP_011460.1 Zea mays
AACG37433.1 Brassica rapa CCAD30827.1
TABLE-US-00061 TABLE 46 Exemplary .DELTA.15 FAD enzymes for
increasing linolenic fatty acid production .DELTA.15 FAD enzyme SEQ
ID NO GenBank ID No. Brassica napa SEQ ID NO: 213 AAA32994.1
Camelina sativa SEQ ID NO: 214 Camelina sativa SEQ ID NO: 215
Glycine max SEQ ID NO: 216 ACF19424.1 Vernicia fordii SEQ ID NO:
217 AAF12821.1 Ricinus communis SEQ ID NO: 218 EEF36775.1 Linum
usitatissimum SEQ ID NO: 219 ADV92272.1 Prototheca moriformis SEQ
ID NO: 220 allele 1 Prototheca moriformis SEQ ID NO: 221 allele
2
TABLE-US-00062 TABLE 47 Glycerolipid desaturases suitable for
overexpression in microorganisms to increase linolenic acid or
increase levels of unsaturated TAGs. Glycerolipid desaturases
GenBank Acession No. Glycine max ACD69577.1 Glycine max cultivar
volania ACS15381.1 Glycine soja P48621.1 Arabidopsis thaliana
NP_180559.1 Linum grandiflorum BAG70949.1 Zea mays BAA22440.1 Olea
europaea ABG88130.2 Jatropha curcas ABX82798.1 Vernicia fordii
CAB45155.1 Vernicia fordii AAD13527.1
[0588] The amino acid sequences disclosed herein are expressed in
microbes utilizing the methods disclosed herein. Coding sequences
can be optimized for expression in the microorganism. For example,
for expression in P. moriformis, preferred codon usage as disclosed
in Table 2 herein are utilized.
Example 11: Engineering Microorganisms for Increased Production of
Linolenic Unsaturated Fatty Acids and Glycerolipids
[0589] As described in Example 10, .DELTA.15 desaturase enzymes
catalyze the formation of a double bond at position 15 of C18:2
(linoleic) fatty acids or fatty acyl molecules, thereby generating
C18:3 (linolenic) fatty acids or fatty acyl molecules. Certain
higher plant species, including Brassica napus (Bn), Camelina
sativa (Cs), and Linum usitatissimum, which produce oils rich in
linolenic unsaturated fatty acids, are sources of genes encoding
.DELTA.15 desaturases that can be expressed in microorganisms to
affect fatty acid profiles. This example describes the use of
polynucleotides that encode .DELTA.15 desaturases enzymes to
engineer microorganisms in which the fatty acid profile of the
transformed microorganism has been enriched in linolenic acid.
[0590] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis UTEX 1435, strain A, was
transformed with individually with each of the plasmid constructs
listed in Table 49 according to the biolistic transformation
methods detailed in Example 2. Each construct contained a 5' (SEQ
ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination
targeting sequences (flanking the construct) to the 6S genomic
region for integration into the nuclear genome and a S. cerevisiae
suc2 sucrose invertase coding region under the control of C.
reinhardtii .beta.-tubulin promoter/5'UTR and Chlorella vulgaris
nitrate reductase 3' UTR. This S. cerevisiae suc2 expression
cassette is listed as SEQ ID NO: 159 and the sucrose invertase gene
served as a selection marker. All protein-coding regions were codon
optimized to reflect the codon bias inherent in Prototheca
moriformis UTEX 1435 nuclear genes, in accordance with Table 2. The
coding regions of desaturase genes from Brassica napus (Bn FAD3,
GenBank Accession No. AAA32994), Camelina sativa FAD-7, and Linum
usitatissimum (Lu FAD3A and Lu FAD3B, GenBank Accession Nos.
ABA02172 and ABA02173) were each under the control of the
Prototheca moriformis Amt03 promoter/5'UTR (SEQ ID NO: 89) and C.
vulgaris nitrate reductase 3'UTR. A FLAG.RTM. epitope sequence was
encoded in the N-terminus cytoplasmic loop of the recombinant
desaturase gene sequences.
TABLE-US-00063 TABLE 49 Plasmid constructs used to transform
Protheca moriformis (UTEX 1435) strain A. Plasmid Construct
Relevant Sequence Elements SEQ ID NO: pSZ2124
6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03: SEQ ID NO: 222
3xFlag-BnFad3:Cvnr::6S pSZ2125
6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03: SEQ ID NO: 223
3xFlag-CsFad7-1:Cvnr::6S pSZ2126
6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03: SEQ ID NO: 224
3xFlag-LuFad3A:Cvnr::6S pSZ2127
6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03: SEQ ID NO: 225
3xFlag-LuFad3B:Cvnr::6S
[0591] Each of the constructs pSZ2124, pSZ2125, pSZ2126, and
pSZ2127 was transformed individually into strain A. Primary
transformants were selected on agar plates containing sucrose as a
sole carbon source. Individual transformants were clonally purified
and grown at pH 7.0 under conditions suitable for lipid production,
similar those disclosed in Example 1. Lipid samples were prepared
from dried biomass from each transformant. 20-40 mg of dried
biomass from each was resuspended in 2 mL of 5% H.sub.2SO.sub.4 in
MeOH, and 200 ul of toluene containing an appropriate amount of a
suitable internal standard (C19:0) was added. The mixture was
sonicated briefly to disperse the biomass, then heated at
70-75.degree. C. for 3.5 hours. 2 mL of heptane was added to
extract the fatty acid methyl esters, followed by addition of 2 mL
of 6% K.sub.2CO.sub.3 (aq) to neutralize the acid. The mixture was
agitated vigorously, and a portion of the upper layer was
transferred to a vial containing Na.sub.2SO.sub.4 (anhydrous) for
gas chromatography analysis using standard FAME GC/FID (fatty acid
methyl ester gas chromatography flame ionization detection)
methods. Fatty acid profiles were analyzed using standard fatty
acid methyl ester gas chromatography flame ionization (FAME GC/FID)
detection methods. The resulting fatty acid profiles (expressed as
Area % of total fatty acids) from a set of representative clones
arising from strain A transformations of pSZ2124, pSZ2125, pSZ2126
and pSZ2127 are shown in Table 50. For comparison, fatty acid
profiles of lipids obtained from untransformed strain A control
cells are additionally presented in Table 50.
TABLE-US-00064 TABLE 50 Unsaturated C18:1, C18:2, and C18:3 fatty
acid profiles of Prototheca moriformis cells engineered to express
exogenous desaturase enzymes of higher plants. % of Total Fatty
Acids Strain Sample C18:1 C18:2 C18:3 strain A 1 55.68 7.99 0.63
untransformed 2 55.31 8.16 0.7 pSZ2124 Transformant 1 60.42 1.62
7.69 Brassica napus Transformant 2 59.7 0.6 8.49 FAD3 Transformant
3 60.56 1.19 8.15 Transformant 4 59.85 0.8 7.9 pSZ2125 Transformant
1 57.11 9.45 1.4 Camelina Transformant 2 57.5 8.56 1.39 sativa FAD7
Transformant 3 56.27 8.78 1.39 Transformant 4 52.57 9.39 1.7
pSZ2126 Transformant 1 58.97 0.84 9.67 Linum Transformant 2 57.93
1.36 11.92 usitatissimum Transformant 3 59.37 0.58 10.33 FAD3A
Transformant 4 59.05 0.49 10.24 pSZ2127 Linum Transformant 1 59.6
1.67 8.67 usitatissimum Transformant 2 59.73 1.02 8.6 FAD3B
Transformant 3 60.04 1.6 8.74 Transformant 4 58.57 0.89 9.05
[0592] The untransformed Prototheca moriformis (UTEX 1435) strain A
strain exhibits a fatty acid profile comprising less than 1% C18:3
fatty acids. In contrast, fatty acid profiles of strain A
expressing higher plant fatty acid desaturase enzymes showed
increased composition of C18:3 fatty acids, ranging from about 2 to
17 fold increase. Engineered strains expressing FAD3A or FAD3B of
Linum usitatissimum or the FAD3 gene product of Brassica napus
showed the greatest degree of C18:3 increase (Table 50). The ratio
of 18:3 to total C18 unsaturates was about 1% in the untransformed
strains and ranged from about 2% to 17% in the transformed strains.
The ratio of 18:2 to total C18:0 was about 12-13% in the
untransformed strains and ranged from about 1% to 15% in the
transformed strains with the lowest levels in the FAD3A
transformant. These data demonstrate the utility and effectiveness
of polynucleotides permitting exogenous expression of .DELTA.15
desaturase fatty acid desaturase enzymes to alter the fatty acid
profile of engineered microorganisms, and in particular in
increasing the concentration of 18:3 fatty acids in microbial
cells.
Example 12: Engineering Microorganisms for Increased Production of
Stearic Acid and Stearate Through a Hairpin RNA Approach
[0593] Stearoyl ACP desaturase (SAD) enzymes are a part of the
lipid synthesis pathway. They function to introduce double bonds
into fatty acyl chains. For example, SAD enzymes catalyze the
synthesis of C18:1 fatty acids from C18:0 fatty acids (stearic
acid). As shown in Example 6, interruption of SAD2 alleles of
Prototheca moriformis through targeted gene disruption resulted in
measurable increases in C18:0 fatty acid levels in the fatty acid
profiles of the engineered microorganism. This example describes
the use of polynucleotides encoding hairpin RNAs that down-regulate
the expression of SAD2 to engineer microorganisms in which the
fatty acid profile of the transformed microorganism has been
enriched in saturated C18:0 fatty acids.
[0594] Four constructs, pSZ2139-pSZ2142, listed in Table 51, were
designed to attenuate expression of the Prototheca moriformis SAD2
gene product. Each construct contained a different nucleic acid
sequence encoding a hairpin RNA targeted against the Prototheca
moriformis SAD2 mRNA transcript, with a stem length ranging in size
from 180 to 240 base pairs, as well as 5' (SEQ ID NO: 82) and 3'
(SEQ ID NO: 84) homologous recombination targeting sequences
(flanking the construct) to the 6S genomic region for integration
into the nuclear genome and a S. cerevisiae suc2 sucrose invertase
coding region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. The polynucleotide sequence
encoding the SAD2 RNA hairpin of each construct was under the
control of the C. reinhardtii .beta.-tubulin promoter/5'UTR and C.
vulgaris nitrate reductase 3'UTR.
TABLE-US-00065 TABLE 51 Plasmid constructs used to transform
Protheca moriformis (UTEX 1435) strain A. Plasmid Construct
Relevant Sequence Elements SEQ ID NO: SZ2139
6S::Cr.beta.tub:ScSuc2:Cvnr:Cr.beta.tub:PmSAD2- SEQ ID NO: hairpin
A hpA:Cvnr::6S 226 SZ2140
6S::Cr.beta.tub:ScSuc2:Cvnr:Cr.beta.tub:PmSAD2- SEQ ID NO: hairpin
B hpB:Cvnr::6S 227 SZ2141
6S::Cr.beta.tub:ScSuc2:Cvnr:Cr.beta.tub:PmSAD2- SEQ ID NO: hairpin
C hpC:Cvnr::6S 228 SZ2142
6S::Cr.beta.tub:ScSuc2:Cvnr:Cr.beta.tub:PmSAD2- SEQ ID NO: hairpin
D hpD:Cvnr::6S 229
[0595] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis UTEX 1435, strain A, was
transformed individually with the plasmid constructs listed in
Table 51 according to biolistic transformation methods detailed in
Example 2. Primary transformants were selected on agar plates
containing sucrose as a sole carbon source, clonally purified, and
grown under standard lipid production conditions. Fatty acid
profiles were determined using direct transesterification methods
as described in Example 11. The resulting fatty acid profiles
(expressed as Area % of total fatty acids) from a set of
representative clones arising from transformations of strain A with
pSZ2139, pSZ2140, pSZ2141, and pSZ2142 are shown in Table 52,
below. For comparison, fatty acid profiles of lipids obtained from
untransformed strain A control cells are additionally presented in
Table 52.
TABLE-US-00066 TABLE 52 C18:0, C18:1, and C18:2 fatty acid profiles
of Prototheca moriformis cells engineered to express hairpin RNA
constructs targeting stearoyl ACP desaturase gene/gene products.
Strain/ % Ratio Plasmid % Total Fatty Acids C18 Sat:C18 Construct
Transformant C18:0 C18:1 C18:2 UnSat strain A Untransformed 2.77
60.74 7.27 4 strain Transformant I 6.39 51.69 9.06 11 A/pSZ2139
Transformant 2 5.49 52.89 9.25 9 hairpin A Transformant 3 3.39
56.12 8.85 5 Transformant 4 3.24 54.55 8.62 5 strain Transformant I
22.14 36.14 8.13 50 A/pSZ2140 Transformant 2 17.19 41.17 8.31 35
hairpin B Transformant 3 9.45 49.81 8.79 16 Transformant 4 5.61
53.8 9.02 9 strain Transformant I 20.7 40.96 6.45 44 A/pSZ2141
Transformant 2 16.33 45.57 7.31 31 hairpin C Transformant 3 13.43
44.79 9.04 25 Transformant 4 12.7 46.25 9.98 23 Transformant 5 8.47
50.65 9.12 14 strain Transformant 1 26.99 30.93 8.31 69 A/pSZ2142
Transformant 2 10.96 47.27 9.9 19 hairpin D Transformant 3 8.64
50.77 11.7 14 Transformant 4 7.67 49.76 9.39 13
[0596] The data presented in Table 52 show a clear impact of the
expression of SAD2 hairpin RNA constructs on the C18:0 and C18:1
fatty acid profile of the host organism. The fatty acid profiles of
strain A transformants comprising SAD2 hairpin RNA constructs
demonstrated an increase in the percentage of saturated C18:0 fatty
acids with a concomitant diminution of unsaturated C18:1 fatty
acids. Fatty acid profiles of the untransformed strain comprise
about 3% C18:0. Fatty acid profiles of the transformed strains
comprise greater than 3% to almost 27% C18:0. The ratio of C18:0 to
total C18 unsaturates was about 4% in the untransformed strains and
ranged from about 5% to 69% in the transformed strains. These data
illustrate the successful expression and use of polynucleotide SAD
RNA hairpin constructs in Prototheca moriformis to alter the
percentage of saturated fatty acids in the engineered host
microbes, and in particular in increasing the concentration of
C18:0 fatty acids and decreasing C18:1 fatty acids in microbial
cells.
Example 13: Altering Fatty Acid Profiles of Microalgae Through
Overexpression of .beta.-Ketoacyl-ACP Synthase II Genes
[0597] .beta.-ketoacyl-ACP synthase II (KASII) catalyzes the
2-carbon extension of C16:0-ACP to C18:0-ACP during fatty acid
biosynthesis. Plasmid constructs were created to assess whether the
fatty acid profile of a host cell can be affected as a result of
expression of a KASII gene. Sources of KASII gene sequences were
selected from Protheca moriformis UTEX 1435 or from higher plants
(Glycine max GenBank Accession No. AAW88763, Helianthus annus
GenBank Accession No. ABI18155, and Ricinus communis GenBank
Accession No. AAA33872).
[0598] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis UTEX 1435, strain A, was
transformed individually with one of the following plasmid
constructs in Table 53 using the methods of Example 2. Each
construct comprised 5' (SEQ ID NO: 82) and 3' (SEQ ID NO: 84)
homologous recombination targeting sequences (flanking the
construct) to the 6S genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
29 and served as a selection marker. For each construct, the KASII
coding region was under the control of the Prototheca moriformis
Amt03 promoter/5'UTR (SEQ ID NO: 37) and C. vulgaris nitrate
reductase 3'UTR. The native transit peptide of each KASII enzyme
was replaced with the Chlorella protothecoides stearoyl-ACP
desaturase transit peptide (SEQ ID NO: 54). All protein coding
regions were codon optimized to reflect the codon bias inherent in
Prototheca moriformis UTEX 1435 nuclear genes in accordance with
Table 2.
TABLE-US-00067 TABLE 53 Plasmid constructs used to transform
Protheca moriformis (UTEX 1435) strain A. Plasmid Source of KASII
Construct enzyme Sequence Elements SEQ ID. NO: SZ1747 Glycine max
(Glm) 6S::.beta.- SEQ ID NO: 230 tub:suc2:nr::Amt03:S106SAD:
GlmKASII:nr::6S SZ1750 Helianthus annuus 6S::.beta.- SEQ ID NO: 231
(Ha) tub:suc2:nr::Amt03:S106SAD: HaKASII:nr::6S SZ1754 Ricinus
communis 6S:.beta.- SEQ ID NO: 232 (Rc) tub:suc2:nr::Amt03:S106SAD:
RcKASII:nr::6S SZ2041 Protheca moriformis 6S::.beta.- SEQ ID NO:
233 (Pm) tub:suc2:nr:Amt03:S106SAD: PmKASII:nr::6S
[0599] Relevant restriction sites in the construct
6S::.beta.-Tub:suc2:nr::Amt03:S106SAD:PmKASII:nr::6S are indicated
in lowercase, bold and underlining and are 5'-3' BspQ 1, Kpn I, Xba
I, Mfe I, BamH I, EcoR I, Spe I, Asc I, Cla I, Sac I, BspQ I,
respectively. BspQI sites delimit the 5' and 3' ends of the
transforming DNA. Bold, lowercase sequences represent genomic DNA
from strain A that permit targeted integration at the 6S locus via
homologous recombination. Proceeding in the 5' to 3' direction, the
C. reinhardtii .beta.-tubulin promoter driving expression of the
yeast sucrose invertase gene (conferring the ability of strain A to
metabolize sucrose) is indicated by boxed text. The initiator ATG
and terminator TGA for invertase are indicated by uppercase, bold
italics while the coding region is indicated in lowercase italics.
The Chlorella vulgaris nitrate reductase 3' UTR is indicated by
lowercase underlined text followed by an endogenous amt03 promoter
of P. moriformis, indicated by boxed italicized text. The Initiator
ATG and terminator TGA codons of the PmKASII are indicated by
uppercase, bold italics, while the remainder of the gene is
indicated by bold italics. The Chlorella protothecoides S106
stearoyl-ACP desaturase transit peptide is located between the
initiator ATG and the Asc I site. The C. vulgaris nitrate reductase
3' UTR is again indicated by lowercase underlined text followed by
the strain A 6S genomic region indicated by bold, lowercase text.
The relevant nucleotide sequence of the construct
6S::.beta.-tub:suc2:nr::Amt03:S106SAD:PmKASII:nr::6S is provided in
the sequence listings as SEQ ID. NO: 234. The codon-optimized
sequence of PmKASII comprising a Chlorella protothecoides S106
stearoyl-ACP desaturase transit peptide is provided the sequence
listings as SEQ ID. NO: 235. SEQ ID NO: 236 provides the protein
translation of SEQ ID NO. 235.
TABLE-US-00068
gctcttcgccgccgccactcctgctcgagcgcgcccgcgcgtgcgccgccagcgccttggccttttcgccgcg-
ctcgtgcgcgtcgctgatgt
ccatcaccaggtccatgaggtctgccttgcgccggctgagccactgcttcgtccgggcggccaagaggagcatg-
agggaggactcctggt
ccagggtcctgacgtggtcgcggctctgggagcgggccagcatcatctggctctgccgcaccgaggccgcctcc-
aactggtcctccagca
gccgcagtcgccgccgaccctggcagaggaagacaggtgaggggggtatgaattgtacagaacaaccacgagcc-
ttgtctaggcagaa
tccctaccagtcatggctttacctggatgacggcctgcgaacagctgtccagcgaccctcgctgccgccgcttc-
tcccgcacgcttctttcca
gcaccgtgatggcgcgagccagcgccgcacgctggcgctgcgcttcgccgatctgaggacagtcggggaactct-
gatcagtctaaacccc
cttgcgcgttagtgttgccatcctttgcagaccggtgagagccgacttgttgtgcgccaccccccacaccacct-
cctcccagaccaattctgt ##STR00030## ##STR00031## ##STR00032##
##STR00033## ##STR00034##
atgacgaacgagacgtccgaccgccccctggtgcacttcacccccaacaagggctggatgaacgaccccaacgg-
cctgtggtacgacgag
aaggacgccaagtggcacctgtacttccagtacaacccgaacgacaccgtctgggggacgcccttgttctgggg-
ccacgccacgtccgacg
acctgaccaactgggaggaccagcccatcgccatcgccccgaagcgcaacgactccggcgccttctccggctcc-
atggtggtggactacaa
caacacctccggcttcttcaacgacaccatcgacccgcgccagcgctgcgtggccatctggacctacaacaccc-
cggagtccgaggagcagt
acatctcctacagcctggacggcggctacaccttcaccgagtaccagaagaaccccgtgctggccgccaactcc-
acccagttccgcgacccg
aaggtcttctggtacgagccctcccagaagtggatcatgaccgcggccaagtcccaggactacaagatcgagat-
ctactcctccgacgacctg
aagtcctggaagctggagtccgcgttcgccaacgagggcttcctcggctaccagtacgagtgccccggcctgat-
cgaggtccccaccgagca
ggaccccagcaagtcctactgggtgatgttcatctccatcaaccccggcgccccggccggcggctccttcaacc-
agtacttcgtcggcagcttc
aacggcacccacttcgaggccttcgacaaccagtcccgcgtggtggacttcggcaaggactactacgccctgca-
gaccttcttcaacaccgac
ccgacctacgggagcgccctgggcatcgcgtgggcctccaactgggagtactccgccttcgtgcccaccaaccc-
ctggcgctcctccatgtcc
ctcgtgcgcaagttctccctcaacaccgagtaccaggccaacccggagacggagctgatcaacctgaaggccga-
gccgatcctgaacatca
gcaacgccggcccctggagccggttcgccaccaacaccacgttgacgaaggccaacagctacaacgtcgacctg-
tccaacagcaccggca
ccctggagttcgagctggtgtacgccgtcaacaccacccagacgatctccaagtccgtgttcgcggacctctcc-
ctctggttcaagggcctgga
ggaccccgaggagtacctccgcatgggcttcgaggtgtccgcgtcctccttcttcctggaccgcgggaacagca-
aggtgaagttcgtgaagga
gaacccctacttcaccaaccgcatgagcgtgaacaaccagcccttcaagagcgagaacgacctgtcctactaca-
aggtgtacggcttgctgg
accagaacatcctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctacttcatgaccaccggg-
aacgccctgggctccgtg ##STR00035##
gtatcgacacactctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatat-
ccctgccgcttttatcaaacagcctc
agtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagctgcttgtgctatttgcgaataccaccccca-
gcatccccttccctcgtttcatatcgctt
gcatcccaaccgcaacttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctc-
gcacagccttggtttgggctccgcc
tgtattctcctggtactgcaacctgtaaaccagcactgcaatgctgatgcacgggaagtagtgggatgggaaca-
caaatggaggatcccgcgtctc
gaacagagcgcgcagaggaacgctgaaggtctcgcctctgtcgcacctcagcgcggcatacaccacaataacca-
cctgacgaatgcgcttggtt
cttcgtccattagcgaagcgtccggttcacacacgtgccacgttggcgaggtggcaggtgacaatgatcggtgg-
agctgatggtcgaaacgttcac ##STR00036## ##STR00037## ##STR00038##
##STR00039## ##STR00040## ##STR00041## ##STR00042## ##STR00043##
##STR00044## ##STR00045## ##STR00046## ##STR00047## ##STR00048##
##STR00049## ##STR00050## ##STR00051## ##STR00052## ##STR00053##
##STR00054## ##STR00055## ##STR00056## ##STR00057## ##STR00058##
##STR00059## ##STR00060## ##STR00061## ##STR00062## ##STR00063##
taaggcagcagcagctcggatagtatcgacacactctggacgctggtcgtgtgatggactgttgccgccacact-
tgctgccttgacctgtgaatatcc
ctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagctgcttg-
tgctatttgcgaataccacccccagcat
ccccttccctcgtttcatatcgcttgcatcccaaccgcaacttatctacgctgtcctgctatccctcagcgctg-
ctcctgctcctgctcactgcccctcgc
acagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaaccagcactgcaatgctgatgca-
cgggaagtagtgggatgggaaca
caaatggaaagcttaattaagagctcttgttttccagaaggagttgctccttgagcctttcattctcagcctcg-
ataacctccaaagccgctcta
attgtggagggggttcgaatttaaaagcttggaatgttggttcgtgcgtctggaacaagcccagacttgttgct-
cactgggaaaaggaccat
cagctccaaaaaacttgccgctcaaaccgcgtacctctgctttcgcgcaatctgccctgttgaaatcgccacca-
cattcatattgtgacgctt
gagcagtctgtaattgcctcagaatgtggaatcatctgccccctgtgcgagcccatgccaggcatgtcgcgggc-
gaggacacccgccactc
gtacagcagaccattatgctacctcacaatagttcataacagtgaccatatttctcgaagctccccaacgagca-
cctccatgctctgagtgg
ccaccccccggccctggtgcttgcggagggcaggtcaaccggcatggggctaccgaaatccccgaccggatccc-
accacccccgcgatg
ggaagaatctctccccgggatgtgggcccaccaccagcacaacctgctggcccaggcgagcgtcaaaccatacc-
acacaaatatccttgg
catcggccctgaattccttctgccgctctgctacccggtgcttctgtccgaagcaggggttgctagggatcgct-
ccgagtccgcaaacccttg tcgcgtggcggggcttgttcgagcttgaagagc
[0600] Upon individual transformation of each plasmid construct
into strain A, positive clones were selected on agar plates
comprising sucrose as the sole carbon source. As in the previous
examples, primary transformants were clonally purified and grown
under standard lipid production conditions at pH 7 and lipid
samples were prepared from dried biomass from each transformant.
Fatty acid profiles were determined using direct
transesterification methods as described in Example 11. The
resulting fatty acid profiles (expressed as Area % of total fatty
acids) from a set of representative clones arising from
transformations of strain A Fatty acid profiles (expressed as Area
%) of several positive transformants as compared to those of
untransformed strain A controls are summarized for each plasmid
construct in Table 54 below.
TABLE-US-00069 TABLE 54 Fatty acid profiles of Prototheca
moriformis cells engineered to overexpress KAS II genes. Plasmid
KASII Construct Source Transformant % C14:0 % C16:0 % C18:0 % C18:1
% C18:2 None no over- 1 1.36 28.69 2.92 56.36 8.16 expression 2
1.35 28.13 3.57 55.63 8.79 3 1.22 25.74 2.82 60.6 7.31 4 1.22 25.74
2.82 60.6 7.31 pSZ1747 Glycine 1 2.23 25.34 2.69 57.35 9.53 max 2
2.18 25.46 2.74 57.35 9.46 3 2.18 25.33 2.89 57.34 9.5 4 2.2 25.69
2.66 57.28 9.43 5 2.17 25.38 3.03 56.99 9.72 pSZ1750 H. annus 1
2.43 26.82 2.72 55.17 9.87 2 2.44 27.14 2.62 54.89 9.81 3 2.61 26.9
2.67 54.43 10.25 4 1.96 30.32 2.87 53.87 8.26 5 2.55 27.64 2.98
53.82 10.07 pSZ1754 Ricinus 1 1.84 24.41 2.89 59.26 9.08 communis 2
1.3 25.04 2.81 58.75 9.65 3 1.27 25.98 2.76 58.33 9.22 4 1.95 25.34
2.77 58.15 9.22 5 1.3 26.53 2.75 57.87 9.09 pSZ2041 P. 1 1.63 11.93
3.62 70.95 9.64 moriformis 2 1.85 11.63 3.34 69.88 10.93 3 1.84
12.01 3.81 69.56 10.45 4 1.63 14.22 3.72 68.86 9.6 5 1.67 15.04
3.05 68.63 9.24
[0601] A clear diminution of C16:0 chain lengths with a concomitant
increase in C18:1 length fatty acids was observed upon
overexpression of the Prototheca moriformis (UTEX 1435) KASII gene
further codon optimized using the codon frequency denoted in Table
2 using pSZ2041. Similar fatty acid profile changes were observed
upon transformation of constructs expressing the Prototheca
moriformis (UTEX 1435) KASII gene driven by a .beta.-tublin
promoter.
[0602] These results show that exogenous overexpression of a codon
optimized Prototheca lipid biosynthesis gene can alter the fatty
acid profile of genetically engineered microalgae. In particular,
overexpression of a KASII gene can increase the percentage of C18
fatty acids from about 68% in the untransformed cells to about
84%.
Example 14: Altering the Levels of Mid-Chain Fatty Acids in
Engineered Prototheca Through Targeted Knockout of a KASI
Allele
[0603] .beta.-ketoacyl-ACP synthase I (KASI) catalyzes 2-carbon
extensions of C4:0, C6:0, C8:0, C10:0, C12:0, and C14:0 fatty
acyl-ACP molecules during fatty acid biosynthesis. In this example,
a knockout plasmid construct, pSZ2014, was created to assess the
impact on the fatty acid profile of a host cell upon targeted
disruption of a KASI genetic locus.
[0604] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis UTEX 1435, strain A, was
transformed the pSZ2014 construct using the biolistic
transformations methods described in Example 2. pSZ2014 comprised
the S. cerevisiae suc2 invertase expression cassette under control
of the C. reinhardtii .beta.-tubulin promoter and Chlorella
vulgaris nitrate reductase 3' UTR, flanked on either side by KASI
gene-specific homology regions to target the construct for
integration into the KASI locus of the Prototheca moriformis
genome. This S. cerevisiae suc2 expression cassette is listed as
SEQ ID NO: 159 and served as a selection marker. Relevant sequences
for the targeting regions to the KASI locus for nuclear genome
integration are shown below and listed in SEQ ID NO: 238 and SEQ ID
NO: 239. Relevant restriction sites in pSZ2014, indicated in
lowercase, bold and underlining, are 5'-3' BspQ 1, Kpn I, AscI, Xho
I, Sac I, BspQ I, respectively are shown in the sequence below.
BspQI sites delimit the 5' and 3' ends of the transforming DNA.
Bold, lowercase sequences represent genomic DNA from strain A that
permit targeted integration at KASI locus via homologous
recombination. Proceeding in the 5' to 3' direction, the C.
reinhardtii b-tubulin promoter driving the expression of the
codon-optimized yeast sucrose invertase gene (conferring the
ability of strain A to metabolize sucrose) is indicated by boxed
text. The initiator ATG codon and terminator TGA codon for suc2
invertase are indicated by uppercase, bold italics while the coding
region is indicated in lowercase italics. The Chlorella vulgaris
nitrate reductase 3' UTR is indicated by lowercase underlined text.
The transforming sequence of pSZ2014 is shown below and listed as
SEQ ID NO: 237.
TABLE-US-00070
gctcttcgctcaccgcgtgaattgctgtcccaaacgtaagcatcatcgtggctcggtcacgcgatcctggatc-
cggggatcctagaccgctggtggagagc
gctgccgtcggattggtggcaagtaagattgcgcaggttggcgaagggagagaccaaaaccggaggctggaagc-
gggcacaacatcgtattattgcgt
atagtagagcagtggcagtcgcatttcgaggtccgcaacggatctcgcaagctcgctacgctcacagtaggaga-
aaggggaccactgcccctgccaga
atggtcgcgaccctctccctcgccggccccgcctgcaacacgcagtgcgtatccggcaagcgggctgtcgcctt-
caaccgcccccatgttggcgtccggg
ctcgatcaggtgcgctgaggggggtttggtgtgcccgcgcctctgggcccgtgtcggccgtgcggacgtggggc-
cctgggcagtggatcagcagggtttg
cgtgcaaatgcctataccggcgattgaatagcgatgaacgggatacggttgcgctcactccatgcccatgcgac-
cccgtttctgtccgccagccgtggtcg ##STR00064## ##STR00065## ##STR00066##
##STR00067##
ctggccggcttcgccgccaagatcagcgcctccatgacgaacgagacgtccgaccgccccctggtgcacttcac-
ccccaacaagggctggatgaacgacccca
acggcctgtggtacgacgagaaggacgccaagtggcacctgtacttccagtacaacccgaacgacaccgtctgg-
gggacgcccttgttctggggccacgccac
gtccgacgacctgaccaactgggaggaccagcccatcgccatcgccccgaagcgcaacgactccggcgccttct-
ccggctccatggtggtggactacaaca
acacctccggcttcttcaacgacaccatcgacccgcgccagcgctgcgtggccatctggacctacaacaccccg-
gagtccgaggagcagtacatctcctaca
gcctggacggcggctacaccttcaccgagtaccagaagaaccccgtgctggccgccaactccacccagttccgc-
gacccgaaggtcttctggtacgagccc
tcccagaagtggatcatgaccgcggccaagtcccaggactacaagatcgagatctactcctccgacgacctgaa-
gtcctggaagctggagtccgcgttcgc
caacgagggcttcctcggctaccagtacgagtgccccggcctgatcgaggtccccaccgagcaggaccccagca-
agtcctactgggtgatgttcatctccat
caaccccggcgccccggccggcggctccttcaaccagtacttcgtcggcagcttcaacggcacccacttcgagg-
ccttcgacaaccagtcccgcgtggtgga
cttcggcaaggactactacgccctgcagaccttcttcaacaccgacccgacctacgggagcgccctgggcatcg-
cgtgggcctccaactgggagtactccgc
cttcgtgcccaccaacccctggcgctcctccatgtccctcgtgcgcaagttctccctcaacaccgagtaccagg-
ccaacccggagacggagctgatcaacctg
aaggccgagccgatcctgaacatcagcaacgccggcccctggagccggttcgccaccaacaccacgttgacgaa-
ggccaacagctacaacgtcgacctg
tccaacagcaccggcaccctggagttcgagctggtgtacgccgtcaacaccacccagacgatctccaagtccgt-
gttcgcggacctctccctctggttcaagg
gcctggaggaccccgaggagtacctccgcatgggcttcgaggtgtccgcgtcctccttcttcctggaccgcggg-
aacagcaaggtgaagttcgtgaaggag
aacccctacttcaccaaccgcatgagcgtgaacaaccagcccttcaagagcgagaacgacctgtcctactacaa-
ggtgtacggcttgctggaccagaacat
cctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctacttcatgaccaccgggaacgccctgg-
gctccgtgaacatgacgacgggggtgg ##STR00068##
atggactgttgccgccacacttgctgccttgacctgtgaatatccctgccgcttttatcaaacagcctcagtgt-
gtttgatcttgtgtgtacgcgcttttgcg
agttgctagctgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcgcttgcatc-
ccaaccgcaacttatctacgctgtcctgc
tatccctcagcgctgctcctgctcctgctcactgcccctcgcacagccttggtttgggctccgcctgtattctc-
ctggtactgcaacctgtaaaccagcactg
caatgctgatgcacgggaagtagtgggatgggaacacaaatggaggatcgtagagctccacctgcatccgcctg-
gcgctcgaggacgccggcgtctcgcccga
cgaggtcaactacgtcaacgcgcacgccacctccaccctggtgggcgacaaggccgaggtgcgcgcggtcaagt-
cggtctttggcgacatgaagggcatcaag
atgaacgccaccaagtccatgatcgggcactgcctgggcgccgccggcggcatggaggccgtcgccacgctcat-
ggccatccgcaccggctgggtgcacccca
ccatcaaccacgacaaccccatcgccgaggtcgacggcctggacgtcgtcgccaacgccaaggcccagcacaaa-
atcaacgtcgccatctccaactccttcgg
cttcggcgggcacaactccgtcgtcgcctttgcgcccttccgcgagtaggcggagcgagcgcgcttggctgagg-
agggaggcggggtgcgagccctttggctg
cgcgcgatactctccccgcacgagcagactccacgcgcctgaatctacttgtcaacgagcaaccgtgtgttttg-
tccgtggccattcttattatttctccgac
tgtggccgtactctgtttggctgtgcaagcaccgaagagc
[0605] Upon transformation of plasmid construct pSZ2014 into strain
A, positive clones were selected on plates with sucrose as the sole
carbon source. Primary transformants were clonally purified and
grown under standard lipid production conditions. Lipid samples
were prepared from dried biomass from each transformant. Fatty acid
profiles were determined using direct transesterification methods
as described in Example 11. Fatty acid profiles (expressed as Area
% of total fatty acid) of several positive transformants, compared
to those of untransformed strain A controls, are summarized for in
Table 55 below.
TABLE-US-00071 TABLE 55 Fatty acid profiles of engineered
Prototheca moriformis cells comprising a selectable marker to
disrupt an endogenous KASI allele. Transformant % C14:0 % C16:0 %
C18:0 % C18:1 % C18:2 strain A untransformed 1.22 25.61 2.82 60.76
7.44 control strain A Transformant 1 1.65 32.55 2.17 53.99 7.43
pSZ2014 Transformant 2 2.25 30.04 2.57 55.86 7.12 Transformant 3
3.51 31.22 1.90 53.85 7.00 Transformant 4 4.09 31.51 2.57 53.14
6.21 Transformant 5 4.68 34.47 1.94 49.75 6.49 Transformant 6 5.68
37.98 1.83 44.76 6.75 Transformant 7 5.82 37.82 1.93 44.84 6.44
[0606] As shown in Table 55 above, targeted interruption of a KASI
allele impacted the fatty acid profiles of transformed
microorganisms. Fatty acid profiles of strain A comprising the
pSZ2014 transformation vector showed increased composition of C14:0
and C16:0 fatty acids with a concomitant decrease in C18:1 fatty
acids. In all transformantis, C18:0 fatty acids were reduced. In
some transformations, interruption of the KASI allele further
resulted in a fatty acid profile comprising decreased percentages
of C18:2 fatty acids relative to the fatty acid profile of the
untransformed strain A organism.
[0607] Thus, we increased the percentage of total C14 fatty acids
by about 35% to 400% and the percentage of C16 fatty acids by about
30 to 50% by disruption of an endogenous KASI.
[0608] These data demonstrate the utility of targeted gene
interruption of an endogenous KASI allele to alter the fatty acid
profile of a host microbe.
Example 15: Combining Genetic Modification Approaches to Alter
Fatty Acid Profiles in Prototheca
[0609] In this example, the combination of genetic modifications to
knockout a KASII allele and concomitantly overexpress an exogenous
thioesterase exhibiting a preference for hydrolysis of mid chain
fatty acids is demonstrated in a microorganism to alter the fatty
acid profile of the host organism.
[0610] A classically mutagenized (for higher oil production) strain
of Prototheca moriformis (UTEX 1435), strain C, was initially
transformed with the plasmid construct pSZ1283 according to
biolistic transformation methods detailed in Example 2. pSZ1283
(SEQ ID NO: 256), previously described in PCT Application Nos.
PCT/US2011/038463 and PCT/US2011/038463, comprises the coding
sequence of the Cuphea wrightii FATB2 (CwTE2) thioesterase, 5' (SEQ
ID NO: 82) and 3' (SEQ ID NO: 84) homologous recombination
targeting sequences (flanking the construct) to the 6S genomic
region for integration into the nuclear genome, and a S. cerevisiae
suc2 sucrose invertase coding region under the control of C.
reinhardtii .beta.-tubulin promoter/5'UTR and Chlorella vulgaris
nitrate reductase 3' UTR. This S. cerevisiae suc2 expression
cassette is listed as SEQ ID NO: 159 and served as a selection
marker. The CwTE2 coding sequence was under the control of the
Prototheca moriformis Amt03 promoter/5'UTR (SEQ ID NO: 89) and C.
vulgaris nitrate reductase 3'UTR (SEQ ID NO: 32). The protein
coding regions of CwTE2 and suc2 were codon optimized to reflect
the codon bias inherent in Prototheca moriformis UTEX 1435 nuclear
genes in accordance with Table 2.
[0611] Upon transformation of pSZ1283 into strain C, positive
clones were selected on agar plates with sucrose as the sole carbon
source. Primary transformants were then clonally purified and a
single transformant, strain B, was selected for further genetic
modification. This genetically engineered strain was transformed
with a plasmid construct, pSZ2110 (SEQ ID NO: 240), to interrupt
the KASII allele 1 locus. pSZ2110, written as
KASII'5::CrbTub:NeoR:nr::KASII-'3, comprised a neomycin resistance
(NeoR) expression cassette, conferring resistance to G418, under
control of the C. reinhardtii .quadrature.-tubulin promoter and
Chlorella vulgaris nitrate reductase 3' UTR, flanked on either side
by KASII gene-specific homology regions to target the construct for
integration into the KASII locus of the Prototheca moriformis
genome. The relevant restriction sites in the pSZ2110 construct
from 5'-3' are BspQ 1, KpnI, XbaI, MfeI, BamHI, EcoRI, SpeI, Xho,
Sac I, and BspQI are indicated in lowercase, bold, and underlined
formats. BspQI sites delimit the 5' and 3' ends of the transforming
DNA. Bold, lowercase sequences at the 5' and 3' ends of the
transforming construct represent genomic DNA from UTEX 1435 that
target integration to the KASII allele 1 locus via homologous
recombination. The C. reinhardtii .quadrature.-tubulin is indicated
by lowercase, boxed text. The initiator ATG and terminator TGA for
NeoR are indicated by uppercase italics, while the coding region is
indicated with lowercase italics.
TABLE-US-00072
gctcttcgctggcctgttgccggacgatccgtgtcgtcgagactgcattttgttttgggtgtggggctggggt-
actggatggcttg
agggcatgactttttctgatggagaagattgcaatgagatcatttgggtcgtctatttgtttgctgtgcaagag-
ggtttactggtat
ctggcaccagcttttggcccgtgcccgtttgatggacgcgtgacaggcaggcgtcctggaaagcacagacaccg-
tacgtacga
ccttgacctcccccccttctccacacggcaggtgcgaggctgcccacggcgtcgaggcgggcggtgcgccgggc-
atggtcccg
catcgcgcgcgcggcggccgcggccgacgcaaaccccgcccgccctgagcgccgcgtggtcatcacgggccagg-
gcgtggt
gaccagcctgggccagacgatcgagcagttttacagcagcctgctggagggcgtgagcggcatctcgcagatac-
agaagttc
gacaccacgggctacacgacgacgatcgcgggcgagatcaagtcgctgcagctggacccgtacgtgcccaagcg-
ctgggcg
aagcgcgtggacgacgtgataaagtacgtctacatcgcgggcaagcaggcgctggagagcgccggcctgccgat-
cgaggcg
gcggggctggcgggcgcggggctggacccggcgctgtgcggcgtgctcatcggcaccgccatggcgggcatgac-
gtctttcg ##STR00069## ##STR00070## ##STR00071## ##STR00072##
aatatcaATGatcgagcaggacggcctccacgccggctcccccgccgcctgggtggagcgcctgttcggctacg-
actgggccc
agcagaccatcggctgctccgacgccgccgtgttccgcctgtccgcccagggccgccccgtgctgttcgtgaag-
accgacctgtc
cggcgccctgaacgagctgcaggacgaggccgcccgcctgtcctggctggccaccaccggcgtgccctgcgccg-
ccgtgctgg
acgtggtgaccgaggccggccgcgactggctgctgctgggcgaggtgcccggccaggacctgctgtcctcccac-
ctggcccccg
ccgagaaggtgtccatcatggccgacgccatgcgccgcctgcacaccctggaccccgccacctgccccttcgac-
caccaggcca
agcaccgcatcgagcgcgcccgcacccgcatggaggccggcctggtggaccaggacgacctggacgaggagcac-
cagggc
ctggcccccgccgagctgttcgcccgcctgaaggcccgcatgcccgacggcgaggacctggtggtgacccacgg-
cgacgcctg
cctgcccaacatcatggtggagaacggccgcttctccggcttcatcgactgcggccgcctgggcgtggccgacc-
gctaccaggac
atcgccctggccacccgcgacatcgccgaggagctgggcggcgagtgggccgaccgcttcctggtgctgtacgg-
catcgccgcc
cccgactcccagcgcatcgccttctaccgcctgctggacgagttcttcTGAcaattggcagcagcagctcggat-
agtatcgacaca
ctctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatatccctgccgctt-
ttatcaaacagcctcagt
gtgtttgatcttgtgtgtacgcgcttttgcgagttgctagctgcttgtgctatttgcgaataccacccccagca-
tccccttccctcgtttcatat
cgcttgcatcccaaccgcaacttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgc-
ccctcgcacagccttgg
tttgggctccgcctgtattctcctggtactgcaacctgtaaaccagcactgcaatgctgatgcacgggaagtag-
tgggatgggaacaca
aatggaggatccactagttctagagcggccgccaccgcggtggagctcggcggcgtgcgcaagatgaacccctt-
ttgcatcccct
tctccatctccaacatgggcggcgcgatgctggcgatggacatcggcttcatgggccccaactactccatctcc-
acggcctgcg
cgacgggcaactactgcatcctgggcgcggcggaccacatccggcgcggcgacgcaaacgtgatgctggccggc-
ggcgcgg
acgcggccatcatcccctcgggcatcggcggcttcatcgcgtgcaaggcgctgagcaagcgcaacgacgagccc-
gagcgcg
cgagccggccctgggacgccgaccgcgacggcttcgtcatgggcgagggcgccggcgtgctggtgctggaggag-
ctggagc
acgccaagcgccgcggcgcgaccattttggctgaattagttggcggcgcggccacctcggacgcgcaccacatg-
accgagcc
cgacccgcagggccgcggcgtgcgcctctgcctcgagcgcgcgctcgagcgcgcgcgcctcgcgcccgagcgcg-
tcggctac
gtcaacgcgcacggcaccagcacgcccgcgggcgacgtggccgagtaccgcgccatccgcgccgtcatcccgca-
ggactca
ctacgcatcaactccacaaagtccatgatcgggcacctgctcggcggcgccggcgcggtcgaggccgtggccgc-
catccagg
ccctgcgcaccggctggctccaccccaacttgaacctcgagaaccccgcgcctggcgtcgaccccgtcgtgctc-
gtgggctctt cc
[0612] Upon transformation of strain B with pSZ2110, positive
clones were selected on selective agar plates containing G418.
Primary transformants were then clonally purified and grown on
sucrose as a carbon source under standard lipid production
conditions at both pH 5.0 and at pH 7.0. Lipid samples were
prepared from dried biomass from each transformant as described in
Example 11. Fatty acid profiles (expressed as Area % of total fatty
acids) of 5 positive transformants (T1-T5), profiles of strain B
grown on sucrose as a sole carbon source (U1), and profiles of
untransformed UTEX 1435 (U1) grown on glucose as a sole carbon
source, are presented in Table 56 below.
TABLE-US-00073 TABLE 56 Fatty acid profiles of Prototheca
moriformis (UTEX 1435) multiply engineered to ablate an endogenous
KASII gene product and to express a Cuphea wrightii thioesterase.
Strain UTEX strain Fatty 1435 B strain B pSZ2011 acid pH U1 U1 T1
T2 T3 T4 T5 % C10:0 pH 5.0 0.01 * 0.02 0.03 0.03 0.03 0.07 pH 7.0
0.01 5.35 4.94 4.79 4.70 4.10 4.12 % C12:0 pH 5.0 0.04 * 0.09 0.39
0.41 0.41 0.86 pH 7.0 0.04 27.06 25.31 25.03 25.02 23.54 23.47 %
C14:0 pH 5.0 1.30 * 0.92 1.13 1.14 1.15 1.50 pH 7.0 1.56 15.20
14.49 14.22 14.50 15.84 15.85 % C16:0 pH 5.0 25.89 * 36.07 35.05
35.35 35.23 35.05 pH 7.0 29.80 13.89 14.96 14.88 15.11 22.62 22.94
% C18:0 pH 5.0 2.84 * 1.76 1.79 1.84 1.82 1.80 pH 7.0 3.00 1.44
1.57 1.71 1.49 1.37 1.33 % C18:1 pH 5.0 60.34 * 49.82 50.21 49.97
50.01 49.13 pH 7.0 54.96 28.57 29.84 30.45 30.27 24.18 23.96 %
C18:2 pH 5.0 7.40 * 8.39 8.59 8.47 8.52 8.75 pH 7.0 8.15 6.85 7.19
7.16 7.15 6.51 6.65 * Not tested
[0613] As shown in Table 56, the impact of expression of CwTE2 in
Prototheca moriformis (UTEX 1435) strain B is a marked change in
the fatty acid profiles of the transformed microorganisms. Fatty
acid profiles of strain B strains expressing CwTE2 and cultured at
pH 7.0, to promote expression of CwTE2 from the Amt03 promoter,
showed increased composition of C10:0, C12:0, and C14:0 fatty acids
with a concomitant decrease in the composition of C16:0 and C18:1
fatty acids relative to the fatty acid profile of untransformed
UTEX 1435. Subsequent modification of strain B to interrupt a KASII
allele, encoding an enzyme that catalyzes the 2-carbon extension of
C16:0 to C18:0 fatty acids, resulted in an increase in C16:0 fatty
acids with a concomitant decrease in C18:1 fatty acids present in
the lipid profile of the newly engineered strain when grown at pH
5.0. Propagation of transformants at pH 5.0 illustrates the impact
of the KASII allele knockout apart from the thioesterase
contribution to the altered fatty acid profiles, as the pH of this
culture medium is not optimal for activity of the Amt03 promoter.
Upon lipid production at pH 7.0, thereby expressing CwTE2, pSZ2011
transformants exhibited a fatty acid profile increased in
composition of C10:0, C12:0, and C14:0 fatty acids with a
concomitant decrease in the composition of C16:0 and C18:1 fatty
acids relative to the profile of the UTEX 1435 strain. Some pSZ2011
transformants when cultured at pH 7.0 exhibited a fatty acid
profile enriched in C16:0 fatty acids with still a further decrease
in the composition of C18:1 fatty acids relative to the fatty acid
profile of their parent strain strain B cultured at pH 7.0.
[0614] These data demonstrate the utility of multiple genetic
modifications to impact the fatty acid profile of a host organism.
Further, this example illustrates the use of recombinant
polynucleotides to target gene interruption of an endogenous KASII
allele to alter the fatty acid profile of a host microbe.
Example 16: Combining Genetic Modification Approaches to Alter the
Palmitic Acid Composition of Prototheca
[0615] In this example, the combination of genetic modifications to
knockout a KASII allele and concomitantly overexpress an exogenous
thioesterase exhibiting preferential specificity for hydrolysis of
C14 and C16 fatty acids is demonstrated in a microorganism to alter
the fatty acid profile of the host organism.
[0616] A classically mutagenized (for higher oil production) strain
of Prototheca moriformis (UTEX 1435), strain A, was transformed
with the plasmid construct pSZ2004 according to the biolistic
transformation methods detailed in Example 2. pSZ2004, written as
KASII_5'_btub-SUC2-nr_2X_Amt03-Ch16TE2-nr_KASII_3', comprised the
coding sequence of the Cuphea hookeriana fatty acyl-ACP
thioesterase (Ch16TE2, GenBank #Q39513), 5' and 3' homologous
recombination targeting sequences (flanking the construct) for
targeted integration at the KASII locus of the nuclear genome, and
a S. cerevisiae suc2 sucrose invertase coding region under the
control of C. reinhardtii .beta.-tubulin promoter/5'UTR and
Chlorella vulgaris nitrate reductase 3' UTR. Ch16TE2 is a
thioesterase that show preferential specificity for C14 and C16
fatty acids. This S. cerevisiae suc2 expression cassette is listed
as SEQ ID NO: 159 and served as a selection marker. The Ch16TE
coding sequence was under the control of the Prototheca moriformis
Amt03 promoter/5'UTR (SEQ ID NO: 89) repeated in tandem, and C.
vulgaris nitrate reductase 3'UTR. The protein coding regions of
Ch16TE and suc2 were codon optimized to reflect the codon bias
inherent in Prototheca moriformis UTEX 1435 nuclear genes in
accordance with Table 2. pSZ2004 is presented in the sequence
listing as SEQ ID NO: 249.
[0617] Upon transformation with pSZ2004, primary transformants were
selected on plates containing sucrose as a sole carbon source.
Individual transformants were clonally purified and grown under
standard lipid production conditions at pH 7.0, similar to the
conditions as disclosed in Example 1. Fatty acid profiles were
analyzed using standard fatty acid methyl ester gas chromatography
flame ionization (FAME GC/FID) detection methods as described in
Example 11. The resulting fatty acid profile (expressed as Area %
of total fatty acid) from a representative clone arising from the
transformations of the transformation vector pSZ2004 is shown in
Table 57. The fatty acid profile of lipids obtained from the
untransformed strain grown under lipid production conditions
comprising glucose as a sole carbon source are additionally
presented in Table 57.
TABLE-US-00074 TABLE 57 Fatty acid profiles of Prototheca
moriformis (UTEX 1435) multiply engineered to ablate an endogenous
KASII gene product and to express a Cuphea hookeriana thioesterase.
Fatty Acid UTEX 1435 pSZ2004 % C10:0 0.01 0.00 % C12:0 0.04 0.09 %
C14:0 1.27 6.42 % C16:0 27.20 69.97 % C18:0 3.85 1.84 % C18:1 58.70
13.69 % C18:2 7.18 7.15
[0618] As shown in Table 57 above, targeted interruption of a KASII
allele with an expression cassette for expression of a selectable
marker and a C14/C16 preferring thioesterase impacted the fatty
acid profile of transformed microorganism. The fatty acid profile
of the strain comprising the pSZ2004 transformation vector showed
increased composition of C14:0 and C16:0 fatty acids with a
concomitant decrease in C18:0 and C18:1 fatty acids. The
untransformed Prototheca moriformis (UTEX 1435) strain exhibited a
fatty acid profile comprising about 27% C16 fatty acids and about
58% C18:1 fatty acids. In contrast, fatty acid profiles of the
strain disrupted at the KASII locus by a cassette enabling
expression of a Cuphea hookeriana fatty acyl-ACP thioesterase and a
selectable marker comprised about 70% C16 fatty acids and about 14%
fatty acids. The level of C16:0 was increased by over 2.5 fold.
These data show that the genetic modifications of exogenous gene
overexpression and endogenous gene ablation can be combined to
alter fatty acid profiles in host organisms.
[0619] For comparison, fatty acid profiles of a strain disrupted at
the KASII locus, by a cassette enabling expression of a sucrose
invertase gene provided a strain with about 35% C16 fatty acids and
about 50% C18:1 fatty acids.
[0620] These data demonstrate the utility and effectiveness of
polynucleotides permitting exogenous expression of a thioesterase
enzyme to alter the fatty acid profile of engineered
microorganisms, in particular in increasing the concentration of
C14 and C16 fatty acids and concomitantly, through targeted
disruption of a KASII allele with said polynucleotides, effecting
the decrease of C18:0 and C18:1 fatty acids in microbial cells.
Example 17: Engineering Microorganisms to Produce Linoleic
Unsaturated Fatty Acids and Glycerolipids
[0621] Certain .DELTA.12 fatty acid desaturase enzymes can catalyze
the formation of a double bond in C18:1 fatty acids or fatty acyl
molecules, thereby generating C18:2 (linoleic) fatty acids or fatty
acyl molecules. Certain plant species, including Gossypium
hirsutum, Carthamus ticntorius, Glycine max, Helianthus annus, and
Zea mays, which produce oils rich in linoleic unsaturated fatty
acids, are sources of genes encoding .DELTA.12 desaturases that can
be expressed in microorganisms to affect fatty acid profiles. This
example describes the use of polynucleotides that encode .DELTA.12
desaturases enzymes to engineer microorganisms in which the fatty
acid profile of the transformed microorganism has been enriched in
linoleic acid.
[0622] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis UTEX 1435, strain A, was
transformed with one of the following plasmid constructs listed in
Table 58 according to biolistic transformation methods detailed in
Example 2. Each construct contained 5' (SEQ ID NO: 82) and 3' (SEQ
ID NO: 84) homologous recombination targeting sequences (flanking
the construct) to the 6S genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. All protein coding regions
were codon optimized to reflect the codon bias inherent in
Prototheca moriformis UTEX 1435, in accordance with Table 2. The
coding regions of desaturase genes from Gossypium hirsutum (Gh,
GenBank Accession No. CAA71199), Carthamus ticntorius (Ct GenBank
Accession No. ADM48789), Glycine max (Gm, GenBank Accession No.
BAD89862), Helianthus annus (Ha, GenBank Accession No. AAL68983),
and Zea mays (Zm, GenBank Accession No. ABF50053) were each under
the control of the Prototheca moriformis Amt03 promoter/5'UTR (SEQ
ID NO: 89) and C. vulgaris nitrate reductase 3'UTR.
TABLE-US-00075 TABLE 58 Plasmid constructs used to transform
Protheca moriformis (UTEX 1435) strain A. Plasmid Construct
Relevant Sequence Elements SEQ ID NO: pSZ2150
6S::Cr.beta.tub:ScSuc2:Cvnr:PmAmt03:CtFad2-2:Cvnr::6S SEQ ID NO:
241 pSZ2151 6S::Cr.beta.tub:ScSuc2:Cvnr:PmAmt03:GlmFad2-2:Cvnr::6S
SEQ ID NO: 242 pSZ2152
6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03:HaFad2:Cvnr::6S SEQ ID NO: 243
pSZ2153 6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03:ZmFad2:Cvnr::6S SEQ ID
NO: 244 pSZ2172
6S::Cr.beta.tub:ScSuc2:Cvnr::PmAmt03:GhFad2:Cvnr::6S SEQ ID NO:
245
[0623] Each of the constructs listed in Table 58 was transformed
individually into strain A. Primary transformants were selected on
plates containing sucrose as a sole carbon source. Individual
transformants were clonally purified and grown under standard lipid
production conditions at pH 7.0, similar to the conditions as
disclosed in Example 1. Fatty acid profiles were analyzed using
standard fatty acid methyl ester gas chromatography flame
ionization (FAME GC/FID) detection methods described in Example 11.
The resulting fatty acid profiles from a set of representative
clones arising from the corresponding strain A transformations of
Table 58 are shown in Table 59. For comparison, fatty acid profiles
of lipids obtained from untransformed strain A control cells are
additionally presented in Table 59.
TABLE-US-00076 TABLE 59 C18:1, C18:2, and C18:3 fatty acid profiles
of Prototheca moriformis cells engineered to express exogenous FAD
desaturase enzymes. Total C18 % C18 unsaturates (% polyunsatu- % of
Total Fatty Acids of Total Fatty rates/total C18 Strain Sample
C18:1 C18:2 C18:3 Acids) unsaturates strain A Unstransformed 55.37
8.18 0.7 64.25 13.82 strain A Transformant 1 58.29 11.96 0.75 71
17.90 pSZ2150 Ct Transformant 2 59.00 10.29 0.84 70.13 15.87 FAD2-2
Transformant 3 52.41 10.36 1.16 63.93 18.02 Transformant 4 56.77
10.17 0.8 67.74 16.19 Transformant 5 57.19 10.15 0.79 68.13 16.06
strain A Transformant 1 58.09 10.32 0.86 69.27 16.14 pSZ2151 Glm
Transformant 2 59.6 11.87 0.86 72.33 17.60 FAD2-2 Transformant 3
58.93 11.54 0.83 71.3 17.35 Transformant 4 58.4 12.29 0.9 71.59
18.42 Transformant 5 58.27 10.8 0.83 69.9 16.64 Transformant 6
58.85 10.48 0.82 70.15 16.11 strain A Transformant 1 59.30 10.02
0.82 70.14 15.45 pSZ2152 Ha Transformant 2 58.45 9.87 0.81 69.13
15.45 FAD2 Transformant 3 59.38 9.89 0.79 70.06 15.24 Transformant
4 59.54 9.79 0.81 70.14 15.11 Transformant 5 59.07 9.92 0.82 69.81
15.38 Transformant 6 59.57 10.02 0.55 70.14 15.07 strain A
Transformant 1 64.30 11.18 0.89 76.37 15.80 pSZ2153 Zm Transformant
2 58.54 10.49 0.88 69.91 16.26 FAD2 Transformant 3 58.80 9.95 0.81
69.56 15.47 Transformant 4 56.18 10.81 1.16 68.15 17.56
Transformant 5 58.82 10.02 0.83 69.67 15.57 Transformant 6 58.72
10.06 0.86 69.64 15.68 strain A Transformant 1 55.71 10.85 0.84
67.4 17.34 pSZ2172 Transformant 2 56.12 10.29 0.75 67.16 16.44
Gh-FLAG-FAD2 Transformant 3 54.14 12 0.96 67.1 19.31 Transformant 4
55.72 11.68 0.75 68.15 18.24
[0624] The untransformed Prototheca moriformis (UTEX 1435) strain
exhibits a fatty acid profile comprising less than 8.5% C18:2 fatty
acids. As shown in Table 59. the lipid profiles of strain A strains
expressing higher plant fatty acid desaturase enzymes showed
increased C18:2 fatty acids. Total C18 unsaturated fatty acids
increased from about 64% to about 67-72%. Similarly, the ratio of
total C18 polyunsaturated fatty acids (C18:2 and C18:3) to total
combined C18 unsaturated fatty acids (C18:1, C18:2 and C18:3)
increased from less than 14% to over 19%. These data demonstrate
the utility and effectiveness of polynucleotides permitting
exogenous expression of .DELTA.12 desaturase fatty acid desaturase
enzymes to alter the fatty acid profile of engineered
microorganisms.
Example 18: Altering the Levels of Fatty Acids of Engineered
Microbes Through Multiple Allelic Disruption of a Fatty Acid
Desaturase
[0625] This example describes the use of a transformation vector to
disrupt the FADc loci of Prototheca moriformis with a
transformation cassette comprising a selectable marker and sequence
encoding an exogenous SAD enzyme to engineer microorganisms in
which the fatty acid profile of the transformed microorganism has
been altered.
[0626] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis (UTEX 1435), strain C, was
transformed with the transformation construct pSZ1499 (SEQ ID NO:
246) according to biolistic transformation methods detailed in
Example 2. pSZ1499 comprised nucleotide sequence of the Olea
europaea stearoyl-ACP desaturase gene, codon-optimized for
expression in Protheca moriformis UTEX 1435. The pSZ1499 expression
construct contained 5' (SEQ ID NO: 247) and 3' (SEQ ID NO: 248)
homologous recombination targeting sequences (flanking the
construct) to the FADc genomic region for integration into the
nuclear genome and a S. cerevisiae suc2 sucrose invertase coding
region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. The Olea europaea
stearoyl-ACP desaturase coding region was under the control of the
Prototheca moriformis Amt03 promoter/5'UTR (SEQ ID NO: 89) and C.
vulgaris nitrate reductase 3'UTR, and the native transit peptide
was replaced with the Chlorella protothecoides stearoyl-ACP
desaturase transit peptide (SEQ ID NO: 49). The entire O. europaea
SAD expression cassette was termed pSZ1499 and can be written as
FADc5'_btub-Suc2-nr_amt03-S106SAD-OeSAD-nr-FADc3'.
[0627] Primary transformants were selected on plates containing
sucrose as a sole carbon source. Individual transformants were
clonally purified and grown under standard lipid production
conditions at pH 7.0, similar to the conditions as disclosed in
Example 1. Fatty acid profiles were analyzed using standard fatty
acid methyl ester gas chromatography flame ionization (FAME GC/FID)
detection methods as described in Example 11. The resulting fatty
acid profiles from a set of representative clones arising from the
transformations of the transformation vector are shown in Table 60.
Fatty acid profiles of lipids obtained from the untransformed
strain C strain grown under lipid production conditions comprising
glucose as a sole carbon source (pH 5.0) are additionally presented
in Table 60.
TABLE-US-00077 TABLE 60 Fatty acid profiles of Prototheca
moriformis (UTEX 1435) multiply engineered to knockout endogenous
FADc alleles and to express an O. europaea stearoyl-ACP desaturase.
% Strain Transformant % C16:0 % C18:0 % C18:1 C18:2 strain C
untransformed 28.50 3.72 57.70 7.04 strain C untransformed 28.57
3.69 57.61 7.07 strain C Transformant 1 20.37 1.13 74.38 0.01
pSZ1499 Transformant 2 19.98 1.16 74.60 0.00 Transformant 3 20.10
1.16 74.70 0.00 Transformant 4 21.13 1.21 73.86 0.00 Transformant 5
19.95 1.11 74.58 0.00 Transformant 6 20.20 1.14 74.61 0.00
Transformant 7 20.72 1.15 74.15 0.00 Transformant 8 20.06 1.11
74.44 0.00 Transformant 9 19.86 1.18 74.88 0.00
[0628] As shown in Table 60, transformation of strain C with
pSZ1499 impacts the fatty acid profiles of the transformed
microbes. The untransformed Prototheca moriformis (UTEX 1435)
strain C strain exhibits a fatty acid profile comprising less than
60% C18:1 fatty acids and greater than 7% C18:2 fatty acids. In
contrast, strain C strains transformed with pSZ1499 exhibited fatty
acid profiles with an increased composition of C18:1 fatty acids
and a concomitant decrease in C18:0 and C18:2 fatty acids. C18:2
fatty acids were undetected in the fatty acid profiles of strain C
transformed with pSZ1499. The absence of detectable C18:2 fatty
acids in pSZ1499 transformants indicated that the transformation
with pSZ1499, bearing homologous recombination targeting sequences
for integration into multiple FADc genomic loci, had abolished FAD
activity.
[0629] Southern blot analysis was conducted to verify that multiple
FADc alleles were interrupted by the pSZ1499 transformation vector.
Genomic DNA was extracted from strain C and pSZ1499 transformants
using standard molecular biology methods. DNA from each sample was
run on 0.8% agarose gels after digestion with the restriction
enzyme PstI. DNA from this gel was transferred onto a Nylon+
membrane (Amersham), which was then hybridized with a P32-labeled
polynucleotide probe corresponding to FADc 3' region. FIG. 3 shows
maps of the pSZ1499 transformation cassette, the two sequenced FADc
alleles of Prototheca moriformis (UTEX 1435), and the predicted
sizes of the alleles disrupted by the pSZ1499 transformation
vector. FADc allele 1 comprises a PstI restriction site, whereas
FADc allele 2 does not. Integration of the SAD cassette would
introduce a PstI restriction site into the disrupted FADc allele,
resulting in a .about.6 kb fragment resolved on the Southern,
regardless of which allele was disrupted. FIG. 4 shows the results
of Southern blot analysis. A hybridization band at .about.6 kb is
detected in both transformants. No smaller hybridization bands,
that would be indicative of uninterrupted alleles, were detected.
These results indicate that both FADc alleles were disrupted by
pSZ1499.
[0630] The ablation of both alleles of the FADc fatty acid
desaturase with a SAD expression cassette results in fatty acid
profiles comprising about 74% C18:1. Collectively, these data
demonstrate the utility and effectiveness of polynucleotides
permitting knockout of FAD alleles and concomitant exogenous
expression of stearoyl-ACP desaturase enzymes to alter the fatty
acid profile of engineered microorganisms.
Example 19: Characteristics of Processed Oil Produced from
Engineered Microorganisms
[0631] Methods and effects of transforming Prototheca moriformis
(UTEX 1435) with transformation vector pSZ1500 (SEQ ID NO: 250)
have been previously described in PCT Application Nos.
PCT/US2011/038463 and PCT/US2011/038463.
[0632] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis (UTEX 1435), strain C, was
transformed with the transformation construct pSZ1500 according to
biolistic transformation methods detailed in Example 2. Primary
transformants were selected on agar plates containing sucrose as a
sole carbon source, clonally purified, and a single engineered
line, strain D was selected for analysis. Strain D was grown as
described herein. Hexane extraction of the oil from the generated
biomass was then performed using standard methods, and the
resulting triglyceride oil was determined to be free of residual
hexane. Other methods of extraction of oil from microalgae using an
expeller press are described in PCT Application No.
PCT/US2010/31108 and are hereby incorporated by reference.
[0633] Oil extracted from biomass of strain D was then refined,
bleached, and deodorized using well known vegetable oil processing
methods. These procedures generated an oil sample, RBD469, which
was subjected to a number of analytical testing protocols according
to methods defined through the American Oil Chemists' Society, the
American Society for Testing and Materials, and the International
Organization for Standardization. The results of these analyses are
summarized below in Table 60.
TABLE-US-00078 TABLE 60 Analytical results for oil sample RBD469.
Method Number Test Description Results Units AOCS Ca 3a-46
Insoluble impurities <0.01 % AOCS Ca 5a-40 Free Fatty Acids
(Oleic) 0.02 % AOCS Ca 5a-40 Acid Value 0.04 mg KOH/g AOCS CA 9f-57
Neutral oil 98.9 % D97 Cloud Point -15 deg C. D97 Pour Point -18
deg C. Karl Fischer Moisture 0.01 % AOCS Cc 13d-55 Chlorophyll
<0.01 ppm (modified) Iodine Value 78.3 g I.sub.2/100 g AOCS Cd
8b-90 Peroxide Value 0.31 meq/kg ISO 6885 p-Anisidine Value 0.65
AOCS Cc 18-80 Dropping Melting point 6.2 deg C. (Mettler) AOCS Cd
11d-96 Tricylglicerides 98.6 % AOCS Cd 11d-96 Monoglyceride
<0.01 % AOCS Cd 11d-96 Diglicerides 0.68 % AOCS Cd 20-91 Total
Polar Compounds 2.62 % IUPAC, 2.507 and Oxidized & Polymerized
17.62 % 2.508 Tricylglicerides AOCS Cc 9b-55 Flash Point 244 deg C.
AOCS Cc 9a-48 Smoke Point 232 deg C. AOCS Cd 12b-92 Oxidataive
Stability Index 31.6 hours Rancimat (110.degree. C.) AOCS Ca 6a-40
Unsaponified Matter 2.28 %
[0634] The same lot of Prototheca moriformis strain D RBD469 oil
was analyzed for trace element content, solid fat content, and
Lovibond color according to AOCS methods. Results of these analyses
are presented below in Table 61, Table 62, and Table 63.
TABLE-US-00079 TABLE 61 ICP Elemental Analysis of RBD469 oil.
Method Number Test Description Results in ppm AOCS Ca 20-99 and
Phosphorus 1.09 AOCS Ca 17-01 Calcium 0.1 (modified) Magnesium 0.04
Iron <0.02 Sulfur 28.8 Copper <0.05 Potassium <0.50 Sodium
<0.50 Silicon 0.51 Boron 0.06 Aluminum <0.20 Lead <0.20
Lithium <0.02 Nickel <0.20 Vanadium <0.05 Zinc <0.02
Arsenic <0.20 Mercury <0.20 Cadmium <0.03 Chromium
<0.02 Manganese <0.05 Silver <0.05 Titanium <0.05
Selenium <0.50 UOP779 Chloride organic <1 UOP779 Chloride
inorganic 7.24 AOCS Ba 4e-93 Nitrogen 6.7
TABLE-US-00080 TABLE 62 Solid Fat Content of RBD469 Oil Method
Number Solid Fat Content Result AOCS Cd 12b-93 Solid Fat Content
10.degree. C. 0.13% AOCS Cd 12b-93 Solid Fat Content 15.degree. C.
0.13% AOCS Cd 12b-93 Solid Fat Content 20.degree. C. 0.28% AOCS Cd
12b-93 Solid Fat Content 25.degree. C. 0.14% AOCS Cd 12b-93 Solid
Fat Content 30.degree. C. 0.08% AOCS Cd 12b-93 Solid Fat Content
35.degree. C. 0.25%
TABLE-US-00081 TABLE 63 Lovibond Color of RBD469 Oil Method Number
Color Result Unit AOCS Cc 13j-97 red 2 unit AOCS Cc 13j-97 yellow
27 unit
[0635] RBD469 oil was subjected to transesterification to produce
fatty acid methyl esters (FAMEs). The resulting fatty acid methyl
ester profile of RBD469 is shown in Table 64:
TABLE-US-00082 TABLE 64 Fatty acid methyl ester Profile of RBD469
Oil Fatty Acid Area % C10 0.01 C12:0 0.04 C14:0 0.64 C15:0 0.08
C16:0 8.17 C16:1 iso 0.39 C16:1 0.77 C17:0 0.08 C18:0 1.93 C18:1
85.88 C18:1 0.05 C18:2 0.05 C20:0 0.3 C20:1 0.06 C20:1 0.44 C22:0
0.11 C23:0 0.03 C24:0 0.1 Total FAMEs Identified 99.13
Example 20: Engineered Microalgae with Altered Fatty Acid
Profiles
[0636] As described above, integration of heterologous genes to
knockout or knockdown specific endogenous lipid pathway enzymes in
Prototheca species can alter the fatty acid profiles of the
engineered microbe. In this example, plasmid constructs were
created to assess whether the lipid profile of a host cell can be
affected as a result of a knockout or knockdown of an endogenous
fatty acyl-ACP thioesterase gene, FATA1.
[0637] A. Altering Lipid Profiles by Knockout of an Endogenous
Prototheca moriformis Thioesterase Gene
[0638] A classically mutagenized (for higher oil production)
derivative of Protheca moriformis UTEX 1435, strain A, was
transformed with one of the following plasmid constructs in Table
65 using the methods of Example 2. Each construct contained a
region for integration into the nuclear genome to interrupt the
endogenous FATA1 gene and a S. cerevisiae suc2 sucrose invertase
coding region under the control of C. reinhardtii .beta.-tubulin
promoter/5'UTR and Chlorella vulgaris nitrate reductase 3' UTR.
This S. cerevisiae suc2 expression cassette is listed as SEQ ID NO:
159 and served as a selection marker. All protein coding regions
were codon optimized to reflect the codon bias inherent in
Prototheca moriformis UTEX 1435 nuclear genes in accordance with
Table 2. Relevant sequences for the targeting regions for the FATA1
gene used for nuclear genome integration are shown below.
TABLE-US-00083 Description SEQ ID NO: 5' sequence for integration
into FATA1 locus SEQ ID NO: 251 3' sequence for integration into
FATA1 locus SEQ ID NO: 252
TABLE-US-00084 TABLE 65 Plasmid constructs used to transform
Protheca moriformis (UTEX 1435) strain A. Plasmid Construct
Sequence Elements 1 FATA1-CrbTub_yInv_nr-FATA1 2
FATA1-CrbTub_yInv_nr::amt03_CwTE2_nr-FATA1
[0639] Relevant restriction sites in the construct
FATA1-CrbTub_yInv_nr-FATA1 (SEQ ID NO: 253) are indicated in
lowercase, bold and underlining and are 5'-3' BspQ 1, Kpn I, Asc I,
Mfe I, Sac I, BspQ I, respectively. BspQI sites delimit the 5' and
3' ends of the transforming DNA. Bold, lowercase sequences
represent genomic DNA from strain A that permit targeted
integration at FATA1 locus via homologous recombination. Proceeding
in the 5' to 3' direction, the C. reinhardtii .beta.-tubulin
promoter driving the expression of the yeast sucrose invertase gene
(conferring the ability of strain A to metabolize sucrose) is
indicated by boxed text. The initiator ATG and terminator TGA for
invertase are indicated by uppercase, bold italics while the coding
region is indicated in lowercase italics. The Chlorella vulgaris
nitrate reductase 3' UTR is indicated by lowercase underlined text
followed by the strain A FATA1 genomic region indicated by bold,
lowercase text:
TABLE-US-00085
gctcttcggagtcactgtgccactgagttcgactggtagctgaatggagtcgctgctccactaaacgaattgt-
cagcaccgcca
gccggccgaggacccgagtcatagcgagggtagtagcgcgccatggcaccgaccagcctgcttgccagtactgg-
cgtctcttc
cgcttctctgtggtcctctgcgcgctccagcgcgtgcgcttttccggtggatcatgcggtccgtggcgcaccgc-
agcggccgctg
cccatgcagcgccgctgcttccgaacagtggcggtcagggccgcacccgcggtagccgtccgtccggaacccgc-
ccaagagt
tttgggagcagcttgagccctgcaagatggcggaggacaagcgcatcttcctggaggagcaccggtgcgtggag-
gtccgggg
ctgaccggccgtcgcattcaacgtaatcaatcgcatgatgatcagaggacacgaagtcttggtggcggtggcca-
gaaacact
gtccattgcaagggcatagggatgcgttccttcacctctcatttctcatttctgaatccctccctgctcactct-
ttctcctcctccttc ##STR00073## ##STR00074## ##STR00075## ##STR00076##
ctgctgcaggccttcctgttcctgctggccggcttcgccgccaagatcagcgcctccatgacgaacgagacgtc-
cgaccgccccct
ggtgcacttcacccccaacaagggctggatgaacgaccccaacggcctgtggtacgacgagaaggacgccaagt-
ggcacctgt
acttccagtacaacccgaacgacaccgtctgggggacgcccttgttctggggccacgccacgtccgacgacctg-
accaactggg
aggaccagcccatcgccatcgccccgaagcgcaacgactccggcgccttctccggctccatggtggtggactac-
aacaacacct
ccggcttcttcaacgacaccatcgacccgcgccagcgctgcgtggccatctggacctacaacaccccggagtcc-
gaggagcagt
acatctcctacagcctggacggcggctacaccttcaccgagtaccagaagaaccccgtgctggccgccaactcc-
acccagttcc
gcgacccgaaggtcttctggtacgagccctcccagaagtggatcatgaccgcggccaagtcccaggactacaag-
atcgagatct
actcctccgacgacctgaagtcctggaagctggagtccgcgttcgccaacgagggcttcctcggctaccagtac-
gagtgccccgg
cctgatcgaggtccccaccgagcaggaccccagcaagtcctactgggtgatgttcatctccatcaaccccggcg-
ccccggccgg
cggctccttcaaccagtacttcgtcggcagcttcaacggcacccacttcgaggccttcgacaaccagtcccgcg-
tggtggacttcg
gcaaggactactacgccctgcagaccttcttcaacaccgacccgacctacgggagcgccctgggcatcgcgtgg-
gcctccaact
gggagtactccgccttcgtgcccaccaacccctggcgctcctccatgtccctcgtgcgcaagttctccctcaac-
accgagtaccag
gccaacccggagacggagctgatcaacctgaaggccgagccgatcctgaacatcagcaacgccggcccctggag-
ccggttcg
ccaccaacaccacgttgacgaaggccaacagctacaacgtcgacctgtccaacagcaccggcaccctggagttc-
gagctggtg
tacgccgtcaacaccacccagacgatctccaagtccgtgttcgcggacctctccctctggttcaagggcctgga-
ggaccccgagg
agtacctccgcatgggcttcgaggtgtccgcgtcctccttcttcctggaccgcgggaacagcaaggtgaagttc-
gtgaaggagaa
cccctacttcaccaaccgcatgagcgtgaacaaccagcccttcaagagcgagaacgacctgtcctactacaagg-
tgtacggcttg
ctggaccagaacatcctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctacttcatgaccac-
cgggaacgcc ##STR00077##
ggcagcagcagctcggatagtatcgacacactctggacgctggtcgtgtgatggactgttgccgccacacttgc-
tgccttgacctgtga
atatccctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagc-
tgcttgtgctatttgcgaata
ccacccccagcatccccttccctcgtttcatatcgcttgcatcccaaccgcaacttatctacgctgtcctgcta-
tccctcagcgctgctcct
gctcctgctcactgcccctcgcacagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaa-
ccagcactgcaatgctg
atgcacgggaagtagtgggatgggaacacaaatggaggatcgtagagctcactagtatcgatttcgaagacagg-
gtggttggctgg
atggggaaacgctggtcgcgggattcgatcctgctgcttatatcctccctggaagcacacccacgactctgaag-
aagaaaacg
tgcacacacacaacccaaccggccgaatatttgcttccttatcccgggtccaagagagactgcgatgcccccct-
caatcagcat
cctcctccctgccgcttcaatcttccctgcttgcctgcgcccgcggtgcgccgtctgcccgcccagtcagtcac-
tcctgcacaggc
cccttgtgcgcagtgctcctgtaccctttaccgctccttccattctgcgaggccccctattgaatgtattcgtt-
gcctgtgtggcca
agcgggctgctgggcgcgccgccgtcgggcagtgctcggcgactttggcggaagccgattgttcttctgtaagc-
cacgcgcttg
ctgctttgggaagagaagggggggggtactgaatggatgaggaggagaaggaggggtattggtattatctgagt-
tgggtgaa gagc
[0640] To introduce the Cuphea wrightii ACP-thioesterase 2 (CwTE2)
gene (Accession No: U56104) into at the FATA1 locus of strain A, a
construct was generated to express the protein coding region of the
CwTE2 gene under the control of the Prototheca moriformis Amt03
promoter/5'UTR (SEQ ID NO: 89) and C. vulgaris nitrate reductase
3'UTR. The construct that has been expressed in strain A can be
written as FATA1-CrbTub_yInv_nr::amt03_CwTE2_nr-FATA1 (SEQ ID NO:
254).
[0641] Relevant restriction sites in the construct
FATA1-CrbTub_yInv_nr::amt03_CwTE2_nr-FATA1 are indicated in
lowercase, bold and underlining and are 5'-3' BspQ 1, Kpn I, Asc I,
Mfe I, BamH I, EcoR I, Spe I, Asc I, Pac I, Sac I, BspQ I,
respectively. BspQI sites delimit the 5' and 3' ends of the
transforming DNA. Bold, lowercase sequences represent genomic DNA
from strain A that permit targeted integration at FATA1 locus via
homologous recombination. Proceeding in the 5' to 3' direction, the
C. reinhardtii .beta.-tubulin promoter driving the expression of
the yeast sucrose invertase gene (conferring the ability of strain
A to metabolize sucrose) is indicated by boxed text. The initiator
ATG and terminator TGA for invertase are indicated by uppercase,
bold italics while the coding region is indicated in lowercase
italics. The Chlorella vulgaris nitrate reductase 3' UTR is
indicated by lowercase underlined text followed by an endogenous
Amt03 promoter of Prototheca moriformis, indicated by boxed italics
text. The Initiator ATG and terminator TGA codons of the C.
wrightii ACP-thioesterase are indicated by uppercase, bold italics,
while the remainder of the ACP-thioesterase coding region is
indicated by bold italics. The C. vulgaris nitrate reductase 3' UTR
is again indicated by lowercase underlined text followed by the
strain A FATA1 genomic region indicated by bold, lowercase
text:
TABLE-US-00086
gctcttcggagtcactgtgccactgagttcgactggtagctgaatggagtcgctgctccactaaacgaattgt-
cagcaccgcca
gccggccgaggacccgagtcatagcgagggtagtagcgcgccatggcaccgaccagcctgcttgccagtactgg-
cgtctcttc
cgcttctctgtggtcctctgcgcgctccagcgcgtgcgcttttccggtggatcatgcggtccgtggcgcaccgc-
agcggccgctg
cccatgcagcgccgctgcttccgaacagtggcggtcagggccgcacccgcggtagccgtccgtccggaacccgc-
ccaagagt
tttgggagcagcttgagccctgcaagatggcggaggacaagcgcatcttcctggaggagcaccggtgcgtggag-
gtccgggg
ctgaccggccgtcgcattcaacgtaatcaatcgcatgatgatcagaggacacgaagtcttggtggcggtggcca-
gaaacact
gtccattgcaagggcatagggatgcgttccttcacctctcatttctcatttctgaatccctccctgctcactct-
ttctcctcctccttc ##STR00078## ##STR00079## ##STR00080## ##STR00081##
ctgctgcaggccttcctgttcctgctggccggcttcgccgccaagatcagcgcctccatgacgaacgagacgtc-
cgaccgccccct
ggtgcacttcacccccaacaagggctggatgaacgaccccaacggcctgtggtacgacgagaaggacgccaagt-
ggcacctgt
acttccagtacaacccgaacgacaccgtctgggggacgcccttgttctggggccacgccacgtccgacgacctg-
accaactggg
aggaccagcccatcgccatcgccccgaagcgcaacgactccggcgccttctccggctccatggtggtggactac-
aacaacacct
ccggcttcttcaacgacaccatcgacccgcgccagcgctgcgtggccatctggacctacaacaccccggagtcc-
gaggagcagt
acatctcctacagcctggacggcggctacaccttcaccgagtaccagaagaaccccgtgctggccgccaactcc-
acccagttcc
gcgacccgaaggtcttctggtacgagccctcccagaagtggatcatgaccgcggccaagtcccaggactacaag-
atcgagatct
actcctccgacgacctgaagtcctggaagctggagtccgcgttcgccaacgagggcttcctcggctaccagtac-
gagtgccccgg
cctgatcgaggtccccaccgagcaggaccccagcaagtcctactgggtgatgttcatctccatcaaccccggcg-
ccccggccgg
cggctccttcaaccagtacttcgtcggcagcttcaacggcacccacttcgaggccttcgacaaccagtcccgcg-
tggtggacttcg
gcaaggactactacgccctgcagaccttcttcaacaccgacccgacctacgggagcgccctgggcatcgcgtgg-
gcctccaact
gggagtactccgccttcgtgcccaccaacccctggcgctcctccatgtccctcgtgcgcaagttctccctcaac-
accgagtaccag
gccaacccggagacggagctgatcaacctgaaggccgagccgatcctgaacatcagcaacgccggcccctggag-
ccggttcg
ccaccaacaccacgttgacgaaggccaacagctacaacgtcgacctgtccaacagcaccggcaccctggagttc-
gagctggtg
tacgccgtcaacaccacccagacgatctccaagtccgtgttcgcggacctctccctctggttcaagggcctgga-
ggaccccgagg
agtacctccgcatgggcttcgaggtgtccgcgtcctccttcttcctggaccgcgggaacagcaaggtgaagttc-
gtgaaggagaa
cccctacttcaccaaccgcatgagcgtgaacaaccagcccttcaagagcgagaacgacctgtcctactacaagg-
tgtacggcttg
ctggaccagaacatcctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctacttcatgaccac-
cgggaacgcc ##STR00082##
ggcagcagcagctcggatagtatcgacacactctggacgctggtcgtgtgatggactgttgccgccacacttgc-
tgccttgacctgtga
atatccctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagc-
tgcttgtgctatttgcgaata
ccacccccagcatccccttccctcgtttcatatcgcttgcatcccaaccgcaacttatctacgctgtcctgcta-
tccctcagcgctgctcct
gctcctgctcactgcccctcgcacagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaa-
ccagcactgcaatgctg
atgcacgggaagtagtgggatgggaacacaaatggaggatcccgcgtctcgaacagagcgcgcagaggaacgct-
gaagggtctcg
cctctgtcgcacctcagcgcggcatacaccacaataaccacctgacgaatgcgcttggttcttcgtccattagc-
gaagcgtccggttca
cacacgtgccacgttggcgaggtggcaggtgacaatgatcggtggagctgatggtcgaaacgttcacagcctag-
ggatatcgaattc ##STR00083## ##STR00084## ##STR00085## ##STR00086##
##STR00087## ##STR00088## ##STR00089## ##STR00090## ##STR00091##
##STR00092## ##STR00093## ##STR00094## ##STR00095## ##STR00096##
##STR00097## ##STR00098## ##STR00099## ##STR00100## ##STR00101##
##STR00102## ##STR00103## ##STR00104## ##STR00105## ##STR00106##
##STR00107## ##STR00108## ##STR00109## ##STR00110##
cgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatatccctgccgcttttatcaa-
acagcctcagtgtgtttg
atcttgtgtgtacgcgcttttgcgagttgctagctgcttgtgctatttgcgaataccacccccagcatcccctt-
ccctcgtttcatatcgcttg
catcccaaccgcaacttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctcg-
cacagccttggtttggg
ctccgcctgtattctcctggtactgcaacctgtaaaccagcactgcaatgctgatgcacgggaagtagtgggat-
gggaacacaaatgg
aaagcttgagctcttgttttccagaaggagttgctccttgagcctttcattctcagcctcgataacctccaaag-
ccgctctaattgtggagg
gggttcgaagacagggtggttggctggatggggaaacgctggtcgcgggattcgatcctgctgcttatatcctc-
cctggaagca
cacccacgactctgaagaagaaaacgtgcacacacacaacccaaccggccgaatatttgcttccttatcccggg-
tccaagag
agactgcgatgcccccctcaatcagcatcctcctccctgccgcttcaatcttccctgcttgcctgcgcccgcgg-
tgcgccgtctgc
ccgcccagtcagtcactcctgcacaggccccttgtgcgcagtgctcctgtaccctttaccgctccttccattct-
gcgaggccccct
attgaatgtattcgttgcctgtgtggccaagcgggctgctgggcgcgccgccgtcgggcagtgctcggcgactt-
tggcggaagc
cgattgttcttctgtaagccacgcgcttgctgattgggaagagaagggggggggtactgaatggatgaggagga-
gaaggag gggtattggtattatctgagttgggtgaagagc
[0642] Upon individual transformation of plasmid construct 1 or 2
into strain A, positive clones were selected on agar plates
comprising sucrose as the sole carbon source. As in the previous
examples, primary transformants were clonally purified and grown
under standard lipid production conditions at pH 7 and lipid
samples were prepared from dried biomass from each transformant.
Fatty acid profiles were determined using direct
transesterification methods as described in Example 11. The
resulting fatty acid profiles (expressed as Area % of total fatty
acids) from a set of representative clones arising from
transformations with construct 1 as compared to those of
untransformed strain A controls are presented in Table 66. The
resulting fatty acid profiles (expressed as Area % of total fatty
acids) from a set of representative clones arising from
transformations with construct 2 as compared to those of
untransformed strain A controls are presented in Table 67.
TABLE-US-00087 TABLE 66 Fatty acid profiles of Prototheca
moriformis cells comprising a selectable marker to disrupt an
endogenous FATA1 allele. % Transformation % C14:0 % C16:0 % C18:0 %
C18:1 C18:2 Wildtype 1.23 25.68 2.83 60.54 7.52 Transformant 1 0.86
16.95 1.75 68.44 9.78 Transformant 2 0.85 17.33 1.71 68.57 9.31
Transformant 3 0.82 17.40 1.78 68.55 9.22 Transformant 4 0.84 17.43
1.78 68.25 9.53 Transformant 5 0.75 17.64 2.02 69.02 8.61
[0643] Results presented in Table 66 show that ablation of the
host's endogenous FATA1 allele alters the fatty acid profile of the
engineered microalgae. The impact of targeting a selectable marker
to the endogenous FATA1 allele on the fatty acid profile of the
transformed microbe is a clear diminution of C16:0 fatty acids with
concomitant increase in C18:1 fatty acids.
TABLE-US-00088 TABLE 67 Fatty acid profiles of Prototheca
moriformis cells containing a selectable marker and an exogenous
thioesterase to disrupt an endogenous FATA1 allele. Carbon % % % %
% % % Transformant source C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 C18:2
strain A Wildtype Glucose 0.01 0.04 1.38 28.83 3.00 56.05 8.21
Wildtype Glucose 0.01 0.04 1.50 29.38 3.00 55.29 8.23 Wildtype
Glucose/Fruc- 0.01 0.05 1.48 28.58 3.20 57.14 7.27 tose Wildtype
Glucose/Fruc- 0.01 0.04 1.54 29.05 3.23 56.47 7.32 tose >2 1
Glucose/Fruc- 4.29 19.98 9.17 20.68 3.47 34.38 6.37 copies tose 2
Glucose/Fruc- 3.11 16.17 9.91 15.97 1.57 45.72 5.81 tose 3 Sucrose
4.84 24.22 11.56 19.48 2.67 29.56 6.02 4 Sucrose 3.24 16.67 10.39
16.34 1.43 44.41 6.00 1-2 1 Glucose/Fruc- 0.18 1.64 1.85 14.43 2.12
70.30 7.63 copies tose 2 Glucose/Fruc- 0.18 1.56 1.74 13.56 2.25
71.04 7.72 tose 3 Sucrose 0.19 1.69 1.89 13.79 3.15 69.97 7.68 4
Sucrose 0.15 1.26 1.49 13.44 2.73 71.46 7.77
[0644] Concordant with targeting a selectable marker alone to the
host's FATA1 allele, integration of a selectable marker concomitant
with an exogenous thioesterase results in an alteration of the
fatty acid profile of the engineered microalgae. As shown in Table
67 above, targeting an exogenous thioesterase gene to interrupt the
FATA1 allele results in a clear diminution of C16:0 fatty acid
production. The expression of the CwTE2 thioesterase at the FATA1
locus also impacts mid chain fatty acids and C18:1 fatty acid
production to an extent that is dependent upon the level of
exogenous thioesterase activity present in the transformants
analyzed. There is good concordance between copy number of the
amplified transgene at the target integration site and thioesterase
levels as revealed either by impacts on fatty acid profiles or
recombinant protein accumulation as assessed by Western
blotting.
[0645] Transgenic lines in which the CwTE2 gene has undergone
amplification show a marked increase in C10:0-C14:0 fatty acids and
a concurrent decrease in C18:1 fatty acids. In contrast, those
transformants in which CwTE2 has undergone little or no
amplification are consistent with lower expression of the exogenous
thioesterase, resulting in a slight increase in mid chain fatty
acids and a far greater impact on the increase of C18:1 fatty
acids.
[0646] Collectively, these data show that targeted disruption of
the host's endogenous FATA1 allele alters the lipid profile of the
engineered microalgae. These data demonstrate the utility and
effectiveness of polynucleotides permitting targeted disruption of
a FATA allele to alter the fatty acid profile of engineered
microbial cells, in particular in decreasing the concentration of
C16 fatty acids and increasing the concentration of C18:1 fatty
acids. These data additionally demonstrate the utility and
effectiveness of polynucleotides permitting targeted disruption of
a FATA allele while concomitantly expressing an exogenous
thioesterase to alter the fatty acid profile of engineered
microbial cells, in particular in decreasing the concentration of
C16 fatty acids.
[0647] B. Altering Lipid Profiles by Knockdown of an Endogenous
Prototheca Moriformis Thioesterase Gene
[0648] A construct to down-regulate the Prototheca moriformis FATA1
gene expression by RNAi was introduced into a Prototheca moriformis
UTEX 1435 strain A genetic background. The Saccharomyces cerevisiae
suc2 sucrose invertase gene was utilized as a selectable marker,
conferring the ability to grow on sucrose as a sole-carbon source.
The construct utilized the first exon of the FatA1 coding region,
followed by the endogenous intron, and a repeat unit of the first
exon in the reverse orientation. 5' and 3' homologous recombination
targeting sequences (flanking the construct) to the 6S genomic
region, listed as SEQ ID NO: 82 and 84 respectively, were included
for integration of the hairpin construct into the nuclear genome.
This construct is designated
6S::.beta.-Tub:suc2:nr::.beta.-tub:hairpinFatA:nr::6S.
[0649] Relevant restriction sites in
6S::.beta.-Tub:suc2:nr::.beta.-tub:hairpin FatA:nr::6S are
indicated in lowercase, bold and underlining and are 5'-3' BspQ 1,
Kpn I, Mfe I, BamH I, EcoR I, Spe I, Xho I, Sac I, BspQ I,
respectively. BspQI sites delimit the 5' and 3' ends of the
transforming DNA. Bold, lowercase sequences represent genomic DNA
from strain A that permit targeted integration at 6s locus via
homologous recombination. Proceeding in the 5' to 3' direction, the
C. reinhardtii .beta.-tubulin promoter driving the expression of
the yeast sucrose invertase gene (conferring the ability of strain
A to metabolize sucrose) is indicated by boxed text. The initiator
ATG and terminator TGA for invertase are indicated by uppercase,
bold italics while the coding region is indicated in lowercase
italics. The Chlorella vulgaris nitrate reductase 3' UTR is
indicated by lowercase underlined text followed by the second C.
reinhardtii .beta.-tubulin promoter driving the expression of the
Hairpin FatA1, indicated by boxed italics text. The Initiator ATG
codon of the FatA1 is indicated by uppercase, bold italics, while
the remainder of the first exon of FatA1 coding region is indicated
by uppercase. The intron of the FatA gene is indicated as
underlined uppercase, and a linker region shown in underlined
uppercase, bold italics was created at the FatA1 intron/reversed
first exon junction to aid in RNA splicing in these vectors. The
inverted first exon of FatA1 is indicated by uppercase. The C.
vulgaris nitrate reductase 3' UTR is again indicated by lowercase
underlined text followed by the strain A 6S genomic region
indicated by bold, lowercase text. The sequence of the FATA
portions of this RNAi construct is listed as SEQ ID NO: 255.
TABLE-US-00089
gctcttcgccgccgccactcctgctcgagcgcgcccgcgcgtgcgccgccagcgccttggccttttcgccgcg-
ctcgtgcgcgtc
gctgatgtccatcaccaggtccatgaggtctgccttgcgccggctgagccactgcttcgtccgggcggccaaga-
ggagcatga
gggaggactcctggtccagggtcctgacgtggtcgcggctctgggagcgggccagcatcatctggctctgccgc-
accgaggc
cgcctccaactggtcctccagcagccgcagtcgccgccgaccctggcagaggaagacaggtgaggggggtatga-
attgtaca
gaacaaccacgagccttgtctaggcagaatccctaccagtcatggctttacctggatgacggcctgcgaacagc-
tgtccagcg
accctcgctgccgccgcttctcccgcacgcttctttccagcaccgtgatggcgcgagccagcgccgcacgctgg-
cgctgcgctt
cgccgatctgaggacagtcggggaactctgatcagtctaaacccccttgcgcgttagtgttgccatcctttgca-
gaccggtgag
agccgacttgttgtgcgccaccccccacaccacctcctcccagaccaattctgtcacctttttggcgaaggcat-
cggcctcggcc ##STR00111## ##STR00112## ##STR00113## ##STR00114##
##STR00115##
cgcctccatgacgaacgagacgtccgaccgccccctggtgcacttcacccccaacaagggctggatgaacgacc-
ccaacggcc
tgtggtacgacgagaaggacgccaagtggcacctgtacttccagtacaacccgaacgacaccgtctgggggacg-
cccttgttctg
gggccacgccacgtccgacgacctgaccaactgggaggaccagcccatcgccatcgccccgaagcgcaacgact-
ccggcgc
cttctccggctccatggtggtggactacaacaacacctccggcttcttcaacgacaccatcgacccgcgccagc-
gctgcgtggcca
tctggacctacaacaccccggagtccgaggagcagtacatctcctacagcctggacggcggctacaccttcacc-
gagtaccaga
agaaccccgtgctggccgccaactccacccagttccgcgacccgaaggtcttctggtacgagccctcccagaag-
tggatcatgac
cgcggccaagtcccaggactacaagatcgagatctactcctccgacgacctgaagtcctggaagctggagtccg-
cgttcgccaa
cgagggcttcctcggctaccagtacgagtgccccggcctgatcgaggtccccaccgagcaggaccccagcaagt-
cctactgggt
gatgttcatctccatcaaccccggcgccccggccggcggctccttcaaccagtacttcgtcggcagcttcaacg-
gcacccacttcg
aggccttcgacaaccagtcccgcgtggtggacttcggcaaggactactacgccctgcagaccttcttcaacacc-
gacccgaccta
cgggagcgccctgggcatcgcgtgggcctccaactgggagtactccgccttcgtgcccaccaacccctggcgct-
cctccatgtccc
tcgtgcgcaagttctccctcaacaccgagtaccaggccaacccggagacggagctgatcaacctgaaggccgag-
ccgatcctg
aacatcagcaacgccggcccctggagccggttcgccaccaacaccacgttgacgaaggccaacagctacaacgt-
cgacctgtc
caacagcaccggcaccctggagttcgagctggtgtacgccgtcaacaccacccagacgatctccaagtccgtgt-
tcgcggacctc
tccctctggttcaagggcctggaggaccccgaggagtacctccgcatgggcttcgaggtgtccgcgtcctcctt-
cttcctggaccgc
gggaacagcaaggtgaagttcgtgaaggagaacccctacttcaccaaccgcatgagcgtgaacaaccagccctt-
caagagcg
agaacgacctgtcctactacaaggtgtacggcttgctggaccagaacatcctggagctgtacttcaacgacggc-
gacgtcgtgtcc
accaacacctacttcatgaccaccgggaacgccctgggctccgtgaacatgacgacgggggtggacaacctgtt-
ctacatcgac ##STR00116##
ggactgttgccgccacacttgctgccttgacctgtgaatatccctgccgcttttatcaaacagcctcagtgtgt-
ttgatcttgtgtgtacgcg
cttttgcgagttgctagctgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcg-
cttgcatcccaaccgcaac
ttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctcgcacagccttggtttg-
ggctccgcctgtattctcc
tggtactgcaacctgtaaaccagcactgcaatgctgatgcacgggaagtagtgggatgggaacacaaatggagg-
atcccgcgtctcg
aacagagcgcgcagaggaacgctgaaggtctcgcctctgtcgcacctcagcgcggcatacaccacaataaccac-
ctgacgaatgcg
cttggttcttcgtccattagcgaagcgtccggttcacacacgtgccacgttggcgaggtggcaggtgacaatga-
tcggtggagctgatg ##STR00117## ##STR00118## ##STR00119## ##STR00120##
##STR00121##
GTGGTCCTCTGCGCGCTCCAGCGCGTGCGCTTTTCCGGTGGATCATGCGGTCCGT
GGCGCACCGCAGCGGCCGCTGCCCATGCAGCGCCGCTGCTTCCGAACAGTGGCG
GTCAGGGCCGCACCCGCGGTAGCCGTCCGTCCGGAACCCGCCCAAGAGTTTTGG
GAGCAGCTTGAGCCCTGCAAGATGGCGGAGGACAAGCGCATCTTCCTGGAGGAG
CACCGGTGCGTGGAGGTCCGGGGCTGACCGGCCGTCGCATTCAACGTAATCAAT
CGCATGATGATCAGAGGACACGAAGTCTTGGTGGCGGTGGCCAGAAACACTGTC
CATTGCAAGGGCATAGGGATGCGTTCCTTCACCTCTCATTTCTCATTTCTGAATCC
##STR00122## ##STR00123##
CTCAAGCTGCTCCCAAAACTCTTGGGCGGGTTCCGGACGGACGGCTACCGCGGGT
GCGGCCCTGACCGCCACTGTTCGGAAGCAGCGGCGCTGCATGGGCAGCGGCCGC
TGCGGTGCGCCACGGACCGCATGATCCACCGGAAAAGCGCACGCGCTGGAGCGC
GCAGAGGACCACAGAGAAGCGGAAGAGACGCCAGTACTGGCAAGCAGGCTGGT
CGGTGCCATatcgatagatctcttaaggcagcagcagctcggatagtatcgacacactctggacgctggtcgtg-
tgatggact
gttgccgccacacttgctgccttgacctgtgaatatccctgccgcttttatcaaacagcctcagtgtgtttgat-
cttgtgtgtacgcgctttg
cgagttgctagctgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcgcttgca-
tcccaaccgcaacttatct
acgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctcgcacagccttggtttgggctcc-
gcctgtattctcctggta
ctgcaacctgtaaaccagcactgcaatgctgatgcacgggaagtagtgggatgggaacacaaatggaaagctta-
attaagagctctt
gttttccagaaggagttgctccttgagcctttcattctcagcctcgataacctccaaagccgctctaattgtgg-
agggggttcgaa
tttaaaagcttggaatgttggttcgtgcgtctggaacaagcccagacttgttgctcactgggaaaaggaccatc-
agctccaaaa
aacttgccgctcaaaccgcgtacctctgctttcgcgcaatctgccctgttgaaatcgccaccacattcatattg-
tgacgcttgagc
agtctgtaattgcctcagaatgtggaatcatctgccccctgtgcgagcccatgccaggcatgtcgcgggcgagg-
acacccgcc
actcgtacagcagaccattatgctacctcacaatagttcataacagtgaccatatttctcgaagctccccaacg-
agcacctccat
gctctgagtggccaccccccggccctggtgcttgcggagggcaggtcaaccggcatggggctaccgaaatcccc-
gaccggat
cccaccacccccgcgatgggaagaatctctccccgggatgtgggcccaccaccagcacaacctgctggcccagg-
cgagcgtc
aaaccataccacacaaatatccttggcatcggccctgaattccttctgccgctctgctacccggtgcttctgtc-
cgaagcagggg
ttgctagggatcgctccgagtccgcaaacccttgtcgcgtggcggggcttgttcgagcttgaagagc
Expression of 6S::.beta.-Tub:suc2:nr::.beta.-tub:hairpin
FatA:nr::6S leads to the formation of a hairpin RNA to silence the
target FatA gene product. Upon transformation of the construct
6S::.beta.-Tub:suc2:nr::.beta.-tub:hairpin FatA:nr::6S into strain
A, positive clones were selected on agar plates comprising sucrose
as the sole carbon source. Primary transformants were clonally
purified and grown under standard lipid production conditions at pH
5.0 and lipid samples were prepared from dried biomass from each
transformant. Fatty acid profiles were determined using direct
transesterification methods as described in Example 11. The
resulting fatty acid profiles (expressed as Area % of total fatty
acids) from a set of representative clones arising from
transformations as compared to those of an untransformed strain A
control are presented in Table 68.
TABLE-US-00090 TABLE 68 Fatty acid profiles of Prototheca
moriformis cells containing an RNA hairpin construct to
down-regulate the expression of FATA. % % % % % % % % Transformant
C10:0 C12:0 C14:0 C16:0 C16:1 C18:0 C18:1 C18:2 Untransformed 0.01
0.03 1.23 25.68 0.96 2.83 60.54 7.52 Transformant 0.01 0.03 0.71
15.10 1.05 1.67 72.08 8.27 1 Transformant 0.01 0.03 0.81 15.66 1.16
1.56 70.03 9.61 2 Transformant 0.01 0.03 1.09 22.67 1.05 2.12 63.18
8.66 3 Transformant 0.01 0.04 1.14 23.31 1.01 2.23 62.83 8.26 4
[0650] The data presented in Table 68 show a clear impact of the
expression of a FATA hairpin RNA construct on the C16 and C18:1
fatty acid profile of the host organism. The fatty acid profiles of
strain A transformants comprising the FATA hairpin RNA construct
demonstrated an increase in the percentage of C18:1 fatty acids
with a concomitant diminution of C16 fatty acids. These data
illustrate the successful expression and use of a polynucleotide
FATA RNA hairpin construct in Prototheca moriformis to alter the
fatty acid profile of engineered host microbes, and in particular
in increasing the concentration of C18:1 fatty acids and decreasing
C16 fatty acids in microbial cells.
Example 21: Engineering Chlorella sorokinian
[0651] Expression of recombinant genes in accordance with the
present invention in Chlorella sorokinian can be accomplished by
modifying the methods and vectors taught by Dawson et al. as
discussed herein. Briefly, Dawson et al., Current Microbiology Vol.
35 (1997) pp. 356-362, reported the stable nuclear transformation
of Chlorella sorokiniana with plasmid DNA. Using the transformation
method of microprojectile bombardment, Dawson introduced the
plasmid pSV72-NRg, encoding the full Chlorella vulgaris nitrate
reductase gene (NR, GenBank Accession No. U39931), into mutant
Chlorella sorokiniana (NR-mutants). The NR-mutants are incapable of
growth without the use of nitrate as a source of nitrogen. Nitrate
reductase catalyzes the conversion of nitrate to nitrite. Prior to
transformation, Chlorella sorokiniana NR-mutants were unable to
grow beyond the microcolony stage on culture medium comprising
nitrate (NO.sub.3.sup.-) as the sole nitrogen source. The
expression of the Chlorella vulgaris NR gene product in NR-mutant
Chlorella sorokiniana was used as a selectable marker to rescue the
nitrate metabolism deficiency. Upon transformation with the
pSV72-NRg plasmid, NR-mutant Chlorella sorokiniana stably
expressing the Chlorella vulgaris NR gene product were obtained
that were able to grow beyond the microcolony stage on agar plates
comprising nitrate as the sole carbon source. Evaluation of the DNA
of the stable transformants was performed by Southern analysis and
evaluation of the RNA of the stable transformants was performed by
RNase protection. Selection and maintenance of the transformed
Chlorella sorokiniana (NR mutant) was performed on agar plates (pH
7.4) comprising 0.2 g/L MgSO.sub.4, 0.67 g/L KH.sub.2PO.sub.4, 3.5
g/L K.sub.2HPO.sub.4, 1.0 g/L
Na.sub.3C.sub.6H.sub.5O.sub.7.H.sub.2O and 16.0 g/L agar, an
appropriate nitrogen source (e.g., NO.sub.3.sup.-), micronutrients,
and a carbon source. Dawson also reported the propagation of
Chlorella sorokiniana and Chlorella sorokiniana NR mutants in
liquid culture medium. Dawson reported that the plasmid pSV72-NRg
and the promoter and 3' UTR/terminator of the Chlorella vulgaris
nitrate reductase gene were suitable to enable heterologous gene
expression in Chlorella sorokiniana NR-mutants. Dawson also
reported that expression of the Chlorella vulgaris nitrate
reductase gene product was suitable for use as a selectable marker
in Chlorella sorokiniana NR-mutants.
[0652] In an embodiment of the present invention, vector pSV72-NRg,
comprising nucleotide sequence encoding the Chlorella vulgaris
nitrate reductase (CvNR) gene product for use as a selectable
marker, is constructed and modified to further comprise a lipid
biosynthesis pathway expression cassette sequence, thereby creating
a transformation vector. The lipid biosynthesis pathway expression
cassette encodes one or more lipid biosynthesis pathway proteins
selected from Table 70, each protein-coding sequence
codon-optimized for expression in Chlorella sorokiniana to reflect
the codon bias inherent in nuclear genes of Chlorella sorokiniana
in accordance with Tables 69A-D. For each lipid biosynthesis
pathway protein of Table 70, the codon-optimized gene sequence can
individually be operably linked to the CvNR promoter upstream of
the protein-coding sequence and operably linked to the CvNR
3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Chlorella sorokiniana
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes.
Stable transformation of Chlorella sorokiniana with the
transformation vector is achieved through well-known transformation
techniques including microprojectile bombardment or other known
methods. Activity of the CvNR gene product can be used as a
selectable marker to rescue the nitrogen assimilation deficiency of
Chlorella sorokiniana NR mutant strains and to select for Chlorella
sorokiniana NR-mutants stably expressing the transformation vector.
Growth media suitable for Chlorella sorokiniana lipid production
include, but are not limited to 0.5 g/L KH.sub.2PO.sub.4, 0.5 g/L
K.sub.2HPO.sub.4, 0.25 g/L MgSO.sub.4-7H.sub.2O, with supplemental
micronutrients and the appropriate nitrogen and carbon sources
(Patterson, Lipids Vol. 5:7 (1970), pp. 597-600). Evaluation of
fatty acid profiles of Chlorella sorokiniana lipids can be assessed
through standard lipid extraction and analytical methods described
herein.
Examples 22-44: Introduction and Tables
[0653] Examples 22-44 below describe the engineering of various
microorganisms in accordance with the present invention. To alter
the fatty acid profile of a microorganism, microorganisms can be
genetically modified wherein endogenous or exogenous lipid
biosynthesis pathway enzymes are expressed, overexpressed, or
attenuated. Steps to genetically engineer a microbe to alter its
fatty acid profile as to the degree of fatty acid unsaturation and
to decrease or increase fatty acid chain length comprise the design
and construction of a transformation vector (e.g., a plasmid),
transformation of the microbe with one or more vectors, selection
of transformed microbes (transformants), growth of the transformed
microbe, and analysis of the fatty acid profile of the lipids
produced by the engineered microbe.
[0654] Transgenes that alter the fatty acid profiles of host
organisms can be expressed in numerous eukaryotic microbes.
Examples of expression of transgenes in eukaryotic microbes
including Chlamydomonas reinhardtii, Chlorella ellipsoidea,
Chlorella saccarophila, Chlorella vulgaris, Chlorella kessleri,
Chlorella sorokiniana, Haematococcus pluvialis, Gonium pectorale,
Volvox carteri, Dunaliella tertiolecta, Dunaliella viridis,
Dunaliella salina, Closterium peracerosum-strigosum-littorale
complex, Nannochloropsis sp., Thalassiosira pseudonana,
Phaeodactylum tricornutum, Navicula saprophila, Cylindrotheca
fusiformis, Cyclotella cryptica, Symbiodinium microadriacticum,
Amphidinium sp., Chaetoceros sp., Mortierella alpina, and Yarrowia
lipolytica can be found in the scientific literature. These
expression techniques can be combined with the teachings of the
present invention to produce engineered microorganisms with altered
fatty acid profiles.
[0655] Transgenes that alter the fatty acid profiles of host
organisms can also be expressed in numerous prokaryotic microbes.
Examples of expression of transgenes in oleaginous microbes
including Rhodococcus opacus can be found in the literature. These
expression techniques can be combined with the teachings of the
present invention to produce engineered microorganisms with altered
fatty acid profiles.
TABLE-US-00091 TABLEs 69A-D Codon preference listing. Amino
Chlorella Chlorella Chlorella Chlorella Dunaliella Volvox
Haematococcus Acid Codon sorokiniana vulgaris ellipsoidea kessleri
tertiolecta carteri pluvialis Ala GCG 0.20 0.25 0.15 0.14 0.09 0.25
0.21 Ala GCA 0.05 0.24 0.32 0.10 0.17 0.13 0.27 Ala GCT 0.12 0.16
0.26 0.18 0.31 0.26 0.17 Ala GCC 0.63 0.35 0.27 0.58 0.43 0.36 0.35
Arg AGG 0.03 0.09 0.10 0.09 0.26 0.08 0.14 Arg AGA 0.04 0.05 0.14
0.01 0.09 0.03 0.05 Arg CGG 0.06 0.19 0.09 0.06 0.06 0.17 0.15 Arg
CGA 0.00 0.10 0.08 0.00 0.08 0.08 0.10 Arg CGT 0.06 0.09 0.37 0.14
0.12 0.22 0.13 Arg CGC 0.81 0.48 0.22 0.71 0.40 0.43 0.42 Asn AAT
0.04 0.16 0.43 0.06 0.27 0.23 0.21 Asn AAC 0.96 0.84 0.57 0.94 0.73
0.77 0.79 Asp GAT 0.13 0.25 0.47 0.12 0.40 0.35 0.27 Asp GAC 0.87
0.75 0.53 0.88 0.60 0.65 0.73 Cys TGT 0.06 0.13 0.43 0.09 0.20 0.17
0.27 Cys TGC 0.94 0.87 0.57 0.91 0.80 0.83 0.64 End TGA 0.00 0.72
0.14 0.14 0.36 0.24 0.70 End TAG 0.33 0.11 0.29 0.00 0.00 0.18 0.22
End TAA 0.67 0.17 4.00 0.86 0.64 0.59 0.09 Gln CAG 0.42 0.40 0.15
0.40 0.27 0.29 0.33 Gln CAA 0.04 0.04 0.21 0.40 0.27 0.07 0.10 Glu
GAG 0.53 0.50 0.33 0.40 0.27 0.53 0.49 Glu GAA 0.02 0.06 0.31 0.40
0.27 0.11 0.07 Gly GGG 0.04 0.16 0.19 0.08 0.10 0.12 0.22 Gly GGA
0.02 0.11 0.13 0.07 0.13 0.12 0.11 Gly GGT 0.03 0.12 0.39 0.24 0.25
0.23 0.15 Gly GGC 0.91 0.61 0.29 0.96 0.51 0.53 0.52 His CAT 0.14
0.16 0.30 0.08 0.25 0.35 0.27 His CAC 0.86 0.84 0.70 0.93 0.75 0.65
0.73 Ile ATA 0.00 0.04 0.07 0.01 0.04 0.08 0.09 Ile ATT 0.15 0.30
0.63 0.29 0.31 0.35 0.29 Ile ATC 0.85 0.66 0.65 0.69 0.65 0.57 0.62
Leu TTG 0.03 0.07 0.03 0.05 0.14 0.14 0.16 Leu TTA 0.00 0.01 0.32
0.00 0.02 0.03 0.02 Leu CTG 0.72 0.61 0.34 0.61 0.60 0.45 0.53 Leu
CTA 0.01 0.03 0.03 0.04 0.04 0.07 0.07 Leu CTT 0.04 0.08 0.16 0.06
0.06 0.14 0.09 Leu CTC 0.20 0.20 0.12 0.24 0.14 0.17 0.13 Lys AAG
0.98 0.94 0.54 0.98 0.90 0.90 0.84 Lys AAA 0.02 0.06 0.46 0.02 0.10
0.10 0.16 Met ATG 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Phe TTT 0.28
0.32 0.42 0.31 0.24 0.27 0.35 Phe TTC 0.72 0.68 0.58 0.69 0.76 0.73
0.65 Pro CCG 0.18 0.31 0.09 0.07 0.04 0.34 0.15 Pro CCA 0.06 0.17
0.36 0.07 0.04 0.20 0.24 Pro CCT 0.10 0.14 0.25 0.17 0.04 0.19 0.29
Pro CCC 0.66 0.38 0.29 0.69 0.04 0.27 0.32 Ser AGT 0.03 0.04 0.14
0.02 0.08 0.08 0.07 Ser AGC 0.27 0.38 0.18 0.18 0.31 0.27 0.31 Ser
TCG 0.12 0.14 0.08 0.10 0.02 0.19 0.10 Ser TCA 0.03 0.08 0.14 0.08
0.09 0.09 0.14 Ser TCT 0.09 0.11 0.26 0.18 0.19 0.14 0.13 Ser TCC
0.47 0.24 0.20 0.44 0.30 0.24 0.24 Thr ACG 0.11 0.20 0.13 0.05 0.12
0.27 0.19 Thr ACA 0.01 0.20 0.32 0.07 0.20 0.12 0.23 Thr ACT 0.12
0.13 0.29 0.12 0.24 0.20 0.18 Thr ACC 0.76 0.47 0.26 0.76 0.44 0.41
0.40 Trp TGG 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Tyr TAT 0.07 0.15
0.43 0.27 0.28 0.24 0.19 Tyr TAC 0.93 0.85 0.57 0.73 0.72 0.76 0.81
Val GTG 0.71 0.54 0.37 0.60 0.54 0.46 0.62 Val GTA 0.00 0.05 0.25
0.03 0.09 0.07 0.09 Val GTT 0.11 0.14 0.24 0.09 0.14 0.17 0.09 Val
GTC 0.18 0.27 0.14 0.28 0.23 0.30 0.21 Closterium peracerosum-
strigosum- Dunaliella Dunaliella Gonium Phaeodactylum Chaetoceros
Amino Acid Codon littorale complex viridis salina pectorale
tricornutum compressum Ala GCG 0.48 0.13 0.15 0.43 0.15 0.08 Ala
GCA 0.10 0.27 0.20 0.09 0.10 0.37 Ala GCT 0.15 0.25 0.27 0.08 0.23
0.36 Ala GCC 0.26 0.35 0.39 0.41 0.52 0.18 Arg AGG 0.04 0.25 0.22
0.13 0.02 0.14 Arg AGA 0.00 0.06 0.05 0.00 0.04 0.29 Arg CGG 0.18
0.08 0.12 0.40 0.10 0.00 Arg CGA 0.00 0.06 0.06 0.05 0.12 0.19 Arg
CGT 0.13 0.15 0.13 0.08 0.41 0.38 Arg CGC 0.64 0.39 0.43 0.35 0.31
0.00 Asn AAT 0.04 0.17 0.23 0.07 0.30 0.58 Asn AAC 0.96 0.83 0.77
0.93 0.65 0.42 Asp GAT 0.30 0.38 0.40 0.11 0.41 0.53 Asp GAC 0.70
0.62 0.60 0.89 0.59 0.47 Cys TGT 0.06 0.24 0.17 0.20 0.39 0.44 Cys
TGC 0.94 0.76 0.83 0.90 0.61 0.56 End TGA 0.75 0.31 0.37 0.50 0.06
0.50 End TAG 0.00 0.15 0.14 0.00 0.13 0.00 End TAA 0.25 0.54 0.49
0.50 0.81 0.50 Gln CAG 0.53 0.36 0.32 0.31 0.23 0.16 Gln CAA 0.09
0.12 0.08 0.07 0.14 0.19 Glu GAG 0.31 0.44 0.51 0.56 0.21 0.28 Glu
GAA 0.06 0.09 0.09 0.07 0.42 0.37 Gly GGG 0.31 0.14 0.10 0.18 0.08
0.12 Gly GGA 0.06 0.11 0.12 0.09 0.34 0.33 Gly GGT 0.09 0.22 0.22
0.07 0.30 0.39 Gly GGC 0.53 0.54 0.56 0.65 0.28 0.16 His CAT 0.33
0.25 0.25 0.43 0.28 0.84 His CAC 0.67 0.75 0.75 0.57 0.72 0.16 Ile
ATA 0.03 0.03 0.03 0.07 0.03 0.12 Ile ATT 0.23 0.25 0.31 0.33 0.51
0.65 Ile ATC 0.74 0.72 0.66 0.59 0.46 0.23 Leu TTG 0.04 0.11 0.12
0.04 0.26 0.11 Leu TTA 0.00 0.01 0.01 0.00 0.02 0.14 Leu CTG 0.31
0.60 0.61 0.64 0.15 0.05 Leu CTA 0.01 0.05 0.04 0.01 0.05 0.08 Leu
CTT 0.04 0.07 0.08 0.05 0.18 0.51 Leu CTC 0.60 0.16 0.14 0.26 0.34
0.11 Lys AAG 0.86 0.87 0.89 0.93 0.75 0.52 Lys AAA 0.14 0.13 0.11
0.07 0.25 0.48 Met ATG 1.00 1.00 1.00 1.00 1.00 1.00 Phe TTT 0.09
0.25 0.29 0.10 0.44 0.65 Phe TTC 0.91 0.75 0.71 0.90 0.56 0.35 Pro
CCG 0.28 0.10 0.08 0.53 0.29 0.05 Pro CCA 0.15 0.10 0.17 0.09 0.12
0.45 Pro CCT 0.12 0.10 0.30 0.04 0.20 0.33 Pro CCC 0.44 0.10 0.45
0.34 0.40 0.17 Ser AGT 0.04 0.09 0.06 0.02 0.12 0.14 Ser AGC 0.05
0.31 0.32 0.20 0.12 0.07 Ser TCG 0.22 0.04 0.06 0.42 0.19 0.08 Ser
TCA 0.16 0.08 0.10 0.09 0.06 0.31 Ser TCT 0.05 0.17 0.15 0.07 0.15
0.23 Ser TCC 0.47 0.31 0.30 0.20 0.35 0.18 Thr ACG 0.30 0.16 0.13
0.42 0.23 0.10 Thr ACA 0.06 0.21 0.18 0.03 0.13 0.38 Thr ACT 0.22
0.18 0.23 0.08 0.19 0.27 Thr ACC 0.42 0.46 0.46 0.47 0.45 0.25 Trp
TGG 1.00 1.00 1.00 1.00 1.00 1.00 Tyr TAT 0.07 0.16 0.21 0.12 0.18
0.67 Tyr TAC 0.93 0.84 0.79 0.88 0.82 0.33 Val GTG 0.50 0.64 0.62
0.57 0.22 0.30 Val GTA 0.02 0.03 0.05 0.04 0.09 0.27 Val GTT 0.06
0.11 0.11 0.04 0.22 0.10 Val GTC 0.42 0.22 0.23 0.35 0.47 0.33
Amino Cylindrotheca Amphidinium Symbiodinium Nannochloropsis
Cyclotella Navicula Thalassiosira C. Acid Codon fusiformis carterae
microadriacticum sp cryptica pelliculosa pseudonana reinhardtii Ala
GCG 0.07 0.17 0.22 0.24 0.11 0.00 0.11 0.35 Ala GCA 0.14 0.33 0.26
0.10 0.16 0.13 0.25 0.08 Ala GCT 0.35 0.29 0.20 0.17 0.45 0.44 0.33
0.13 Ala GCC 0.43 0.20 0.32 0.48 0.27 0.44 0.30 0.43 Arg AGG 0.09
0.15 0.27 0.00 0.09 0.05 0.18 0.05 Arg AGA 0.14 0.03 0.27 0.00 0.05
0.10 0.17 0.01 Arg CGG 0.06 0.08 0.09 0.00 0.04 0.05 0.06 0.20 Arg
CGA 0.16 0.18 0.09 0.29 0.08 0.35 0.11 0.04 Arg CGT 0.34 0.18 0.09
0.14 0.47 0.20 0.34 0.09 Arg CGC 0.22 0.40 0.18 0.57 0.28 0.25 0.15
0.62 Asn AAT 0.42 0.37 0.21 0.00 0.25 0.47 0.43 0.09 Asn AAC 0.58
0.63 0.79 1.00 0.75 0.53 0.57 0.91 Asp GAT 0.54 0.54 0.50 0.20 0.52
0.20 0.56 0.14 Asp GAC 0.46 0.46 0.50 0.80 0.48 0.80 0.44 0.86 Cys
TGT 0.44 0.75 0.50 0.00 0.29 0.10 0.54 0.10 Cys TGC 0.56 0.25 0.50
1.00 0.71 0.90 0.46 0.90 End TGA 0.13 0.50 1.00 0.00 0.10 0.00 0.31
0.27 End TAG 0.10 0.00 0.00 0.00 0.00 0.00 0.38 0.22 End TAA 0.77
0.50 0.00 1.00 0.90 1.00 0.31 0.52 Gln CAG 0.12 0.33 0.28 0.41 0.19
0.21 0.16 0.38 Gln CAA 0.25 0.15 0.17 0.00 0.17 0.28 0.19 0.04 Glu
GAG 0.23 0.41 0.50 0.59 0.38 0.17 0.40 0.55 Glu GAA 0.39 0.10 0.06
0.00 0.26 0.34 0.26 0.03 Gly GGG 0.06 0.19 0.32 0.10 0.10 0.03 0.12
0.11 Gly GGA 0.47 0.10 0.12 0.05 0.45 0.28 0.51 0.06 Gly GGT 0.35
0.34 0.16 0.25 0.22 0.13 0.23 0.11 Gly GGC 0.12 0.37 0.40 0.60 0.24
0.56 0.14 0.72 His CAT 0.39 0.12 0.40 0.00 0.42 1.00 0.50 0.11 His
CAC 0.61 0.88 0.60 1.00 0.58 0.00 0.50 0.89 Ile ATA 0.06 0.05 0.00
0.00 0.04 0.00 0.08 0.03 Ile ATT 0.42 0.53 0.38 0.14 0.53 0.73 0.38
0.22 Ile ATC 0.52 0.42 0.63 0.86 0.42 0.27 0.54 0.75 Leu TTG 0.26
0.35 0.39 0.22 0.20 0.16 0.29 0.04 Leu TTA 0.09 0.01 0.00 0.00 0.03
0.00 0.05 0.01 Leu CTG 0.09 0.22 0.39 0.09 0.06 0.12 0.08 0.73 Leu
CTA 0.05 0.00 0.04 0.00 0.03 0.04 0.06 0.03 Leu CTT 0.37 0.31 0.13
0.04 0.39 0.36 0.20 0.05 Leu CTC 0.13 0.12 0.04 0.65 0.29 0.32 0.32
0.15 Lys AAG 0.60 0.93 0.85 1.00 0.70 0.83 0.76 0.95 Lys AAA 0.40
0.07 0.15 0.00 0.30 0.17 0.24 0.05 Met ATG 1.00 1.00 1.00 1.00 1.00
1.00 1.00 1.00 Phe TTT 0.37 0.21 0.25 0.20 0.31 0.78 0.38 0.16 Phe
TTC 0.63 0.79 0.75 0.80 0.69 0.22 0.62 0.84 Pro CCG 0.11 0.14 0.18
0.08 0.10 0.21 0.16 0.33 Pro CCA 0.33 0.42 0.09 0.08 0.16 0.29 0.31
0.08 Pro CCT 0.32 0.22 0.41 0.25 0.35 0.21 0.31 0.13 Pro CCC 0.24
0.22 0.32 0.58 0.39 0.29 0.23 0.47 Ser AGT 0.12 0.13 0.09 0.00 0.09
0.13 0.18 0.04 Ser AGC 0.09 0.24 0.14 0.13 0.08 0.28 0.11 0.35 Ser
TCG 0.13 0.03 0.05 0.00 0.15 0.25 0.17 0.25 Ser TCA 0.12 0.25 0.05
0.00 0.12 0.08 0.12 0.05 Ser TCT 0.30 0.16 0.23 0.13 0.39 0.25 0.23
0.07 Ser TCC 0.24 0.19 0.45 0.75 0.18 0.03 0.19 0.25 Thr ACG 0.09
0.14 0.10 0.28 0.10 0.18 0.21 0.30 Thr ACA 0.15 0.28 0.10 0.00 0.15
0.09 0.19 0.08 Thr ACT 0.39 0.12 0.10 0.17 0.33 0.41 0.28 0.10 Thr
ACC 0.37 0.47 0.70 0.56 0.43 0.32 0.32 0.52 Trp TGG 1.00 1.00 1.00
1.00 1.00 1.00 1.00 1.00 Tyr TAT 0.38 0.32 0.20 0.00 0.38 0.20 0.39
0.10 Tyr TAC 0.62 0.68 0.80 1.00 0.62 0.80 0.61 0.90 Val GTG 0.11
0.65 0.67 0.31 0.16 0.18 0.29 0.67 Val GTA 0.06 0.05 0.00 0.00 0.09
0.09 0.16 0.03 Val GTT 0.38 0.08 0.11 0.15 0.42 0.09 0.28 0.07 Val
GTC 0.46 0.21 0.22 0.54 0.33 0.64 0.27 0.22 Yarrowia Mortierella
Rhodococcus Amino Acid Codon lipolytica alpina opacus Ala GCG 0.08
0.14 0.35 Ala GCA 0.11 0.12 0.14 Ala GCT 0.35 0.29 0.09 Ala GCC
0.46 0.45 0.43 Arg AGG 0.05 0.05 0.05 Arg AGA 0.13 0.06 0.02 Arg
CGG 0.12 0.06 0.26 Arg CGA 0.52 0.09 0.12 Arg CGT 0.11 0.32 0.11
Arg CGC 0.07 0.42 0.44 Asn AAT 0.17 0.15 0.21 Asn AAC 0.83 0.85
0.79 Asp GAT 0.35 0.42 0.24 Asp GAC 0.65 0.58 0.76 Cys TGT 0.46
0.13 0.26 Cys TGC 0.54 0.87 0.74 End TGA 0.16 0.05 0.72 End TAG
0.38 0.25 0.17 End TAA 0.46 0.70 0.11 Gln CAG 0.33 0.36 0.28 Gln
CAA 0.08 0.06 0.06 Glu GAG 0.44 0.49 0.45 Glu GAA 0.14 0.09 0.22
Gly GGG 0.05 0.03 0.18 Gly GGA 0.28 0.29 0.15 Gly GGT 0.32 0.32
0.20 Gly GGC 0.34 0.36 0.48 His CAT 0.34 0.27 0.20 His CAC 0.66
0.73 0.80 Ile ATA 0.03 0.01 0.05 Ile ATT 0.44 0.33 0.14
Ile ATC 0.53 0.66 0.81 Leu TTG 0.09 0.27 0.09 Leu TTA 0.02 0.00
0.01 Leu CTG 0.37 0.26 0.41 Leu CTA 0.05 0.02 0.03 Leu CTT 0.18
0.12 0.06 Leu CTC 0.29 0.32 0.40 Lys AAG 0.84 0.91 0.80 Lys AAA
0.16 0.09 0.20 Met ATG 1.00 1.00 1.00 Phe TTT 0.38 0.39 0.09 Phe
TTC 0.62 0.61 0.91 Pro CCG 0.10 0.07 0.52 Pro CCA 0.10 0.08 0.09
Pro CCT 0.32 0.36 0.07 Pro CCC 0.47 0.49 0.32 Ser AGT 0.07 0.05
0.08 Ser AGC 0.11 0.14 0.23 Ser TCG 0.16 0.32 0.33 Ser TCA 0.08
0.08 0.07 Ser TCT 0.28 0.12 0.05 Ser TCC 0.30 0.29 0.24 Thr ACG
0.11 0.17 0.28 Thr ACA 0.14 0.10 0.11 Thr ACT 0.26 0.23 0.07 Thr
ACC 0.49 0.49 0.53 Trp TGG 1.00 1.00 1.00 Tyr TAT 0.18 0.20 0.18
Tyr TAC 0.82 0.80 0.82 Val GTG 0.33 0.22 0.37 Val GTA 0.05 0.02
0.05 Val GTT 0.26 0.27 0.10 Val GTC 0.36 0.49 0.49
TABLE-US-00092 TABLE 70 Lipid biosynthesis pathway proteins.
3-Ketoacyl ACP synthase Cuphea hookeriana 3-ketoacyl-ACP synthase
(GenBank Acc. No. AAC68861.1), Cuphea wrightii beta-ketoacyl-ACP
synthase II (GenBank Acc. No. AAB37271.1), Cuphea lanceolata
beta-ketoacyl-ACP synthase IV (GenBank Acc. No. CAC59946.1), Cuphea
wrightii beta-ketoacyl-ACP synthase II (GenBank Acc. No.
AAB37270.1), Ricinus communis ketoacyl-ACP synthase (GenBank Acc.
No. XP_002516228), Gossypium hirsutum ketoacyl- ACP synthase
(GenBank Acc. No. ADK23940.1), Glycine max plastid 3-keto-acyl-ACP
synthase II-A (GenBank Acc No. AAW88763.1), Elaeis guineensis
beta-ketoacyl-ACP synthase II (GenBank Acc. No. AAF26738.2),
Helianthus annuus plastid 3-keto-acyl-ACP synthase I (GenkBank Acc.
No. ABM53471.1), Glycine max3-keto-acyl-ACP synthase I (GenkBank
Acc. No. NP_001238610.1), Helianthus annuus plastid 3-keto-acyl-ACP
synthase II (GenBank Acc ABI18155.1), Brassica napus
beta-ketoacyl-ACP synthetase 2 (GenBank Acc. No. AAF61739.1),
Perilla frutescens beta-ketoacyl-ACP synthase II (GenBank Acc. No.
AAC04692.1), Helianthus annus beta-ketoacyl-ACP synthase II
(GenBank Accession No. ABI18155), Ricinus communis
beta-ketoacyl-ACP synthase II (GenBank Accession No. AAA33872),
Haematococcus pluvialis beta-ketoacyl acyl carrier protein synthase
(GenBank Accession No. HM560033.1), Jatropha curcasbeta
ketoacyl-ACP synthase I (GenBank Accession No. ABJ90468.1), Populus
trichocarpa beta-ketoacyl-ACP synthase I (GenBank Accession No.
XP_002303661.1), Coriandrum sativum beta-ketoacyl- ACP synthetase I
(GenBank Accession No. AAK58535.1), Arabidopsis thaliana 3-oxoacyl-
[acyl-carrier-protein] synthase I (GenBank Accession No.
NP_001190479.1), Vitis vinifera 3- oxoacyl-[acyl-carrier-protein]
synthase I (GenBank Accession No. XP_002272874.2) Fatty acyl-ACP
Thioesterases Umbellularia californica fatty acyl-ACP thioesterase
(GenBank Acc. No. AAC49001), Cinnamomum camphora fatty acyl-ACP
thioesterase (GenBank Acc. No. Q39473), Umbellularia californica
fatty acyl-ACP thioesterase (GenBank Acc. No. Q41635), Myristica
fragrans fatty acyl-ACP thioesterase (GenBank Acc. No. AAB71729),
Myristica fragrans fatty acyl-ACP thioesterase (GenBank Acc. No.
AAB71730), Elaeis guineensis fatty acyl- ACP thioesterase (GenBank
Acc. No. ABD83939), Elaeis guineensis fatty acyl-ACP thioesterase
(GenBank Acc. No. AAD42220), Populus tomentosa fatty acyl-ACP
thioesterase (GenBank Acc. No. ABC47311), Arabidopsis thaliana
fatty acyl-ACP thioesterase (GenBank Acc. No. NP_172327),
Arabidopsis thaliana fatty acyl-ACP thioesterase (GenBank Acc. No.
CAA85387), Arabidopsis thaliana fatty acyl-ACP thioesterase
(GenBank Acc. No. CAA85388), Gossypium hirsutum fatty acyl-ACP
thioesterase (GenBank Acc. No. Q9SQI3), Cuphea lanceolata fatty
acyl-ACP thioesterase (GenBank Acc. No. CAA54060), Cuphea
hookeriana fatty acyl-ACP thioesterase (GenBank Acc. No. AAC72882),
Cuphea calophylla subsp. mesostemon fatty acyl-ACP thioesterase
(GenBank Acc. No. ABB71581), Cuphea lanceolata fatty acyl-ACP
thioesterase (GenBank Acc. No. CAC19933), Elaeis guineensis fatty
acyl-ACP thioesterase (GenBank Acc. No. AAL15645), Cuphea
hookeriana fatty acyl- ACP thioesterase (GenBank Acc. No. Q39513),
Gossypium hirsutum fatty acyl-ACP thioesterase (GenBank Acc. No.
AAD01982), Vitis vinifera fatty acyl-ACP thioesterase (GenBank Acc.
No. CAN81819), Garcinia mangostana fatty acyl-ACP thioesterase
(GenBank Acc. No. AAB51525), Brassica juncea fatty acyl-ACP
thioesterase (GenBank Acc. No. ABI18986), Madhuca longifolia fatty
acyl-ACP thioesterase (GenBank Acc. No. AAX51637), Brassica napus
fatty acyl-ACP thioesterase (GenBank Acc. No. ABH11710), Brassica
napus fatty acyl-ACP thioesterase (GenBank Acc. No. CAA52070.1),
Oryza sativa (indica cultivar-group) fatty acyl-ACP thioesterase
(GenBank Acc. No. EAY86877), Oryza sativa (japonica cultivar-group)
fatty acyl-ACP thioesterase (GenBank Acc. No. NP_001068400), Oryza
sativa (indica cultivar-group) fatty acyl-ACP thioesterase (GenBank
Acc. No. EAY99617), Cuphea hookeriana fatty acyl-ACP thioesterase
(GenBank Acc. No. AAC49269), Ulmus Americana fatty acyl-ACP
thioesterase (GenBank Acc. No. AAB71731), Cuphea lanceolata fatty
acyl-ACP thioesterase (GenBank Acc. No. CAB60830), Cuphea palustris
fatty acyl-ACP thioesterase (GenBank Acc. No. AAC49180), Iris
germanica fatty acyl-ACP thioesterase (GenBank Acc. No. AAG43858,
Iris germanica fatty acyl-ACP thioesterase (GenBank Acc. No.
AAG43858.1), Cuphea palustris fatty acyl-ACP thioesterase (GenBank
Acc. No. AAC49179), Myristica fragrans fatty acyl-ACP thioesterase
(GenBank Acc. No. AAB71729), Myristica fragrans fatty acyl-ACP
thioesterase (GenBank Acc. No. AAB717291.1), Cuphea hookeriana
fatty acyl-ACP thioesterase GenBank Acc. No. U39834), Umbelluaria
californica fatty acyl-ACP thioesterase (GenBank Acc. No. M94159),
Cinnamomum camphora fatty acyl-ACP thioesterase (GenBank Acc. No.
U31813), Ricinus communis fatty acyl-ACP thioesterase (GenBank Acc.
No. ABS30422.1), Helianthus annuus acyl-ACP thioesterase (GenBank
Accession No. AAL79361.1), Jatropha curcas acyl-ACP thioesterase
(GenBank Accession No. ABX82799.3), Zea mays oleoyl-acyl carrier
protein thioesterase, (GenBank Accession No. ACG40089.1),
Haematococcus pluvialis fatty acyl- ACP thioesterase (GenBank
Accession No. HM560034.1) Desaturase Enzymes Linum usitatissimum
fatty acid desaturase 3C, (GenBank Acc. No. ADV92272.1), Ricinus
communis omega-3 fatty acid desaturase, endoplasmic reticulum,
putative, (GenBank Acc. No. EEF36775.1), Vernicia fordii omega-3
fatty acid desaturase, (GenBank Acc. No. AAF12821), Glycine max
chloroplast omega 3 fatty acid desaturase isoform 2, (GenBank Acc.
No. ACF19424.1), Prototheca moriformis FAD-D omega 3 desaturase
(SEQ ID NO: 221), Prototheca moriformis linoleate desaturase (SEQ
ID NO: 220), Carthamus tinctorius delta 12 desaturase, (GenBank
Accession No. ADM48790.1), Gossypium hirsutum omega-6 desaturase,
(GenBank Accession No. CAA71199.1), Glycine max microsomal
desaturase (GenBank Accession No. BAD89862.1), Zea mays fatty acid
desaturase (GenBank Accession No. ABF50053.1), Brassica napa
linoleic acid desaturase (GenBank Accession No. AAA32994.1),
Camelina sativa omega-3 desaturase (SEQ ID NO: 214), Prototheca
moriformis delta 12 desaturase allele 2 (SEQ ID NO: 212), Camelina
sativa omega-3 FAD7- 1 (SEQ ID NO: 215), Helianthus annuus
stearoyl-ACP desaturase, (GenBank Accession No. AAB65145.1),
Ricinus communis stearoyl-ACP desaturase, (GenBank Accession No.
AACG59946.1), Brassica juncea plastidic delta-9-stearoyl-ACP
desaturase (GenBank Accession No. AAD40245.1), Glycine max
stearoyl-ACP desaturase (GenBank Accession No. ACJ39209.1), Olea
europaea stearoyl-ACP desaturase (GenBank Accession No.
AAB67840.1), Vernicia fordii stearoyl-acyl-carrier protein
desaturase, (GenBank Accession No. ADC32803.1), Descurainia sophia
delta-12 fatty acid desaturase (GenBank Accession No. ABS86964.2),
Euphorbia lagascae delta12-oleic acid desaturase (GenBank Acc. No.
AAS57577.1), Chlorella vulgaris delta 12 fatty acid desaturease
(GenBank Accession No. ACF98528), Chlorella vulgaris omega-3 fatty
acid desaturease (GenBank Accession No. BAB78717), Haematococcus
pluvialis omega-3 fatty acid desaturase (GenBank Accession No.
HM560035.1), Haematococcus pluvialis stearoyl-ACP-desaturase
GenBank Accession No. EF586860.1, Haematococcus pluvialis
stearoyl-ACP-desaturase GenBank Accession No. EF523479.1 Oleate
12-hydroxylase Enzymes Ricinus communis oleate 12-hydroxylase
(GenBank Acc. No. AAC49010.1), Physaria lindheimeri oleate
12-hydroxylase (GenBank Acc. No. ABQ01458.1), Physaria lindheimeri
mutant bifunctional oleate 12-hydroxylase:desaturase (GenBank Acc.
No. ACF17571.1), Physaria lindheimeri bifunctional oleate
12-hydroxylase:desaturase (GenBank Accession No. ACQ42234.1),
Physaria lindheimeri bifunctional oleate 12- hydroxylase:desaturase
(GenBank Acc. No. AAC32755.1), Arabidopsis lyrata subsp. Lyrata
(GenBank Acc. No. XP_002884883.1)
Example 22: Engineering Chlorella vulgaris
[0656] Expression of recombinant genes in accordance with the
present invention in Chlorella vulgaris can be accomplished by
modifying the methods and vectors taught by Chow and Tung et al. as
discussed herein. Briefly, Chow and Tung et al., Plant Cell
Reports, Volume 18 (1999), pp. 778-780, reported the stable nuclear
transformation of Chlorella vulgaris with plasmid DNA. Using the
transformation method of electroporation, Chow and Tung introduced
the plasmid pIG121-Hm (GenBank Accession No. AB489142) into
Chlorella vulgaris. The nucleotide sequence of pIG121-Hm comprised
sequence encoding a beta-glucuronidase (GUS) reporter gene product
operably-linked to a CaMV 35S promoter upstream of the GUS
protein-coding sequence and further operably linked to the 3'
UTR/terminator of the nopaline synthase (nos) gene downstream of
the GUS protein-coding sequence. The sequence of plasmid pIG121-Hm
further comprised a hygromycin B antibiotic resistance cassette.
This hygromycin B antibiotic resistance cassette comprised a CaMV
35S promoter operably linked to sequence encoding the hygromycin
phosphotransferase (hpt, GenBank Accession No. BAH24259) gene
product. Prior to transformation, Chlorella vulgaris was unable to
be propagated in culture medium comprising 50 ug/ml hygromycin B.
Upon transformation with the pIG121-Hm plasmid, transformants of
Chlorella vulgaris were obtained that were propagated in culture
medium comprising 50 ug/ml hyrgromycin B. The expression of the hpt
gene product in Chlorella vulgaris enabled propagation of
transformed Chlorella vulgaris in the presence of 50 ug/mL
hyrgromycin B, thereby establishing the utility of the a hygromycin
B resistance cassette as a selectable marker for use in Chlorella
vulgaris. Detectable activity of the GUS reporter gene indicated
that CaMV 35S promoter and nos 3'UTR are suitable for enabling
heterologous gene expression in Chlorella vulgaris. Evaluation of
the genomic DNA of the stable transformants was performed by
Southern analysis. Selection and maintenance of transformed
Chlorella vulgaris was performed on agar plates comprising YA
medium (agar and 4 g/L yeast extract). The propagation of Chlorella
vulgaris in liquid culture medium was conducted as discussed by
Chow and Tung. Propagation of Chlorella vulgaris in media other
than YA medium has been described (for examples, see Chader et al.,
Revue des Energies Renouvelabes, Volume 14 (2011), pp. 21-26 and
Illman et al., Enzyme and Microbial Technology, Vol. 27 (2000), pp.
631-635). Chow and Tung reported that the plasmid pIG121-Hm, the
CaMV 35S promoter, and the Agrobacterium tumefaciens nopaline
synthase gene 3'UTR/terminator are suitable to enable heterologous
gene expression in Chlorella vulgaris. In addition, Chow and Tung
reported the hyromycin B resistance cassette was suitable for use
as a selectable marker in Chlorella vulgaris. Additional plasmids,
promoters, 3'UTR/terminators, and selectable markers suitable for
enabling heterologous gene expression in Chlorella vulgaris have
been discussed in Chader et al., Revue des Energies Renouvelabes,
Volume 14 (2011), pp. 21-26.
[0657] In an embodiment of the present invention, pIG121-Hm,
comprising the nucleotide sequence encoding the hygromycin B gene
product for use as a selectable marker, is constructed and modified
to further comprise a lipid biosynthesis pathway expression
cassette sequence, thereby creating a transformation vector. The
lipid biosynthesis pathway expression cassette encodes one or more
lipid biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in Chlorella
vulgaris to reflect the codon bias inherent in nuclear genes of
Chlorella vulgaris in accordance with Tables 69A-D. For each lipid
biosynthesis pathway protein of Table 70, the codon-optimized gene
sequence can individually be operably linked to the CaMV 35S
promoter upstream of the protein-coding sequence and operably
linked to the Agrobacterium tumefaciens nopaline synthase gene
3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Chlorella vulgaris
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes.
Stable transformation of Chlorella vulgaris with the transformation
vector is achieved through well-known transformation techniques
including electroporation or other known methods. Activity of the
hygromycin B resistance gene product can be used as a marker to
select for Chlorella vulgaris transformed with the transformation
vector on, but not limited to, agar medium comprising hygromycin.
Growth media suitable for Chlorella vulgaris lipid production
include, but are not limited to BG11 medium (0.04 g/L
KH.sub.2PO.sub.4, 0.075 g/L CaCl.sub.2, 0.036 g/L citric acid,
0.006 g/L Ammonium Ferric Citrate, 1 mg/L EDTA, and 0.02 g/L
Na.sub.2CO.sub.3) supplemented with trace metals, and optionally
1.5 g/L NaNO3. Additional media suitable for culturing Chlorella
vulgaris for lipid production include, for example, Watanabe medium
(comprising 1.5 g/L KNO.sub.3, 1.25 g/L KH.sub.2PO.sub.4, 1.25 g
1.sup.-1 MgSO.sub.4-7H.sub.2O, 20 mg 1.sup.-1 FeSO.sub.4-7H.sub.2O
with micronutrients and low-nitrogen medium (comprising 203 mg/l
(NH.sub.4).sub.2HPO.sub.4, 2.236 g/l KCl, 2.465 g/l MgSO.sub.4,
1.361 g/l KH.sub.2PO.sub.4 and 10 mg/l FeSO.sub.4) as reported by
Illman et al., Enzyme and Microbial Technology, Vol. 27 (2000), pp.
631-635. Evaluation of fatty acid profiles of Chlorella vulgaris
lipids can be assessed through standard lipid extraction and
analytical methods described herein.
Example 23: Engineering Chlorella ellipsoidea
[0658] Expression of recombinant genes in accordance with the
present invention in Chlorella ellipsoidea can be accomplished by
modifying the methods and vectors taught by Chen et al. as
discussed herein. Briefly, Chen et al., Current Genetics, Vol. 39:5
(2001), pp. 365-370, reported the stable transformation of
Chlorella ellipsoidea with plasmid DNA. Using the transformation
method of electroporation, Chen introduced the plasmid
pBinU.OMEGA.NP-1 into Chlorella ellipsoidea. The nucleotide
sequence of pBinU.OMEGA.NP-1 comprised sequence encoding the
neutrophil peptide-1 (NP-1) rabbit gene product operably linked to
a Zea mays Ubiquitin (ubi1) gene promoter upstream of the NP-1
protein-coding region and operably linked to the 3' UTR/terminator
of the nopaline synthase (nos) gene downstream of the NP-1
protein-coding region. The sequence of plasmid pBinU.OMEGA.NP-1
further comprised a G418 antibiotic resistance cassette. This G418
antibiotic resistance cassette comprised sequence encoding the
aminoglycoside 3'-phosphotransferase (aph 3') gene product. The aph
3' gene product confers resistance to the antibiotic G418. Prior to
transformation, Chlorella ellipsoidea was unable to be propagated
in culture medium comprising 30 ug/mL G418. Upon transformation
with the pBinU.OMEGA.NP-1 plasmid, transformants of Chlorella
ellipsoidea were obtained that were propagated in selective culture
medium comprising 30 ug/mL G418. The expression of the aph 3' gene
product in Chlorella ellipsoidea enabled propagation of transformed
Chlorella ellipsoidea in the presence of 30 ug/mL G418, thereby
establishing the utility of the G418 antibiotic resistance cassette
as selectable marker for use in Chlorella ellipsoidea. Detectable
activity of the NP-1 gene product indicated that the ubi1 promoter
and nos 3' UTR are suitable for enabling heterologous gene
expression in Chlorella ellipsoidea. Evaluation of the genomic DNA
of the stable transformants was performed by Southern analysis.
Selection and maintenance of the transformed Chlorella ellipsoidea
was performed on Knop medium (comprising 0.2 g/L K.sub.2HPO.sub.4,
0.2 g/L MgSO.sub.4.7H.sub.2O, 0.12 g/L KCl, and 10 mg/L FeCl3, pH
6.0-8.0 supplemented with 0.1% yeast extract and 0.2% glucose) with
15 ug/mL G418 (for liquid cultures) or with 30 ug/mL G418 (for
solid cultures comprising 1.8% agar). Propagation of Chlorella
ellipsoidea in media other than Knop medium has been reported (see
Cho et al., Fisheries Science, Vol. 73:5 (2007), pp. 1050-1056,
Jarvis and Brown, Current Genetics, Vol. 19 (1991), pp. 317-321 and
Kim et al., Marine Biotechnology, Vol. 4 (2002), pp. 63-73).
Additional plasmids, promoters, 3'UTR/terminators, and selectable
markers suitable for enabling heterologous gene expression in
Chlorella ellipsoidea have been reported (see Jarvis and Brown and
Kim et al., Marine Biotechnology, Vol. 4 (2002), pp. 63-73). Chen
reported that the plasmid pBinU.OMEGA.NP-1, the ubi1 promoter, and
the Agrobacterium tumefaciens nopaline synthase gene
3'UTR/terminator are suitable to enable exogenous gene expression
in Chlorella ellipsoidea. In addition, Chen reported that the G418
resistance cassette encoded on pBinU.OMEGA.NP-1 was suitable for
use as a selectable marker in Chlorella ellipsoidea.
[0659] In an embodiment of the present invention, vector
pBinU.OMEGA.NP-1, comprising the nucleotide sequence encoding the
aph 3' gene product, conferring resistance to G418, for use as a
selectable marker, is constructed and modified to further comprise
a lipid biosynthesis pathway expression cassette sequence, thereby
creating a transformation vector. The lipid biosynthesis pathway
expression cassette encodes one or more lipid biosynthesis pathway
proteins selected from Table 70, each protein-coding sequence
codon-optimized for expression in Chlorella ellipsoidea to reflect
the codon bias inherent in nuclear genes of Chlorella ellipsoidea
in accordance with Tables 69A-D. For each lipid biosynthesis
pathway protein of Table 70, the codon-optimized gene sequence can
individually be operably linked to the Zea mays ubi1 promoter
upstream of the protein-coding sequence and operably linked to the
Agrobacterium tumefaciens nopaline synthase gene 3'UTR/terminator
at the 3' region, or downstream, of the protein-coding sequence.
The transformation construct may additionally comprise homology
regions to the Chlorella ellipsoidea genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. Stable transformation of Chlorella
ellipsoidea with the transformation vector is achieved through
well-known transformation techniques including electroporation or
other known methods. Activity of the aph 3' gene product can be
used as a marker to select for Chlorella ellipsoidea transformed
with the transformation vector on, but not limited to, Knop agar
medium comprising G418. Growth media suitable for Chlorella
ellipsoidea lipid production include, but are not limited to, Knop
medium and those culture medium reported by Jarvis and Brown and
Kim et al. Evaluation of fatty acid profiles of Chlorella
ellipsoidea lipids can be assessed through standard lipid
extraction and analytical methods described herein.
Example 24: Engineering Chlorella kessleri
[0660] Expression of recombinant genes in accordance with the
present invention in Chlorella kessleri can be accomplished by
modifying the methods and vectors taught by El-Sheekh et al. as
discussed herein. Briefly, El-Sheekh et al., Biologia Plantarium,
Vol. 42:2 (1999), pp. 209-216, reported the stable transformation
of Chlorella kessleri with plasmid DNA. Using the transformation
method of microprojectile bombardment, El-Sheekh introduced the
plasmid pBI121 (GenBank Accession No. AF485783) into Chlorella
kessleri. Plasmid pBI121 comprised a kanamycin/neomycin antibiotic
resistance cassette. This kanamycin/neomycin antibiotic resistance
cassette comprised the Agrobacterium tumefaciens nopaline synthase
(nos) gene promoter, sequence encoding the neomycin
phosphotransferase II (nptII) gene product (GenBank Accession No.
AAL92039) for resistance to kanamycin and G418, and the 3'
UTR/terminator of the Agrobacterium tumefaciens nopaline synthase
(nos) gene. pBI121 further comprised sequence encoding a
beta-glucuronidase (GUS) reporter gene product operably linked to a
CaMV 35S promoter and operably linked to a 3' UTR/terminator of the
nos gene. Prior to transformation, Chlorella kessleri was unable to
be propagated in culture medium comprising 15 ug/L kanamycin. Upon
transformation with the pBI121 plasmid, transformants of Chlorella
kessleri were obtained that were propagated in selective culture
medium comprising 15 mg/L kanamycin. The express ion of the nptII
gene product in Chlorella kessleri enabled propagation in the
presence of 15 mg/L kanamycin, thereby establishing the utility of
the kanamycin/neomycin antibiotic resistance cassette as selectable
marker for use in Chlorella kessleri. Detectable activity of the
GUS gene product indicated that the CaMV 35S promoter and nos 3'
UTR are suitable for enabling heterologous gene expression in
Chlorella kessleri. Evaluation of the genomic DNA of the stable
transformants was performed by Southern analysis. As reported by
El-Sheekh, selection and maintenance of transformed Chlorella
kessleri was conducted on semisolid agar plates comprising YEG
medium (1% yeast extract, 1% glucose) and 15 mg/L kanamycin.
El-Sheekh also reported the propagation of Chlorella kessleri in
YEG liquid culture media. Additional media suitable for culturing
Chlorella kessleri for lipid production are disclosed in Sato et
al., BBA Molecular and Cell Biology of Lipids, Vol. 1633 (2003),
pp. 27-34). El-Sheekh reported that the plasmid pBI121, the CaMV
promoter, and the nopaline synthase gene 3'UTR/terminator are
suitable to enable heterologous gene expression in Chlorella
kessleri. In addition, El-Sheekh reported that the
kanamycin/neomycin resistance cassette encoded on pBI121 was
suitable for use as a selectable marker in Chlorella kessleri.
[0661] In an embodiment of the present invention, vector pBI121,
comprising the nucleotide sequence encoding the kanamycin/neomycin
resistance gene product for use as a selectable marker, is
constructed and modified to further comprise a lipid biosynthesis
pathway expression cassette sequence, thereby creating a
transformation vector. The lipid biosynthesis pathway expression
cassette encodes one or more lipid biosynthesis pathway proteins
selected from Table 70, each protein-coding sequence
codon-optimized for expression in Chlorella kessleri to reflect the
codon bias inherent in nuclear genes of Chlorella kessleri in
accordance with Tables 69A-D. For each lipid biosynthesis pathway
protein of Table 70, the codon-optimized gene sequence can
individually be operably linked to the CaMV 35S promoter upstream
of the protein-coding sequence and operably linked to the
Agrobacterium tumefaciens nopaline synthase gene 3'UTR/terminator
at the 3' region, or downstream, of the protein-coding sequence.
The transformation construct may additionally comprise homology
regions to the Chlorella kessleri genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. Stable transformation of Chlorella
kessleri with the transformation vector is achieved through
well-known transformation techniques including microprojectile
bombardment or other known methods. Activity of the nptII gene
product can be used as a marker to select for Chlorella kessleri
transformed with the transformation vector on, but not limited to,
YEG agar medium comprising kanamycin or neomycin. Growth media
suitable for Chlorella kessleri lipid production include, but are
not limited to, YEG medium, and those culture media reported by
Sato et al. Evaluation of fatty acid profiles of Chlorella kessleri
lipids can be assessed through standard lipid extraction and
analytical methods described herein.
Example 25: Engineering Dunaliella tertiolecta
[0662] Expression of recombinant genes in accordance with the
present invention in Dunaliella tertiolecta can be accomplished by
modifying the methods and vectors taught by Walker et al. as
discussed herein. Briefly, Walker et al., Journal of Applied
Phycology, Vol. 17 (2005), pp. 363-368, reported stable nuclear
transformation of Dunaliella tertiolecta with plasmid DNA. Using
the transformation method of electroporation, Walker introduced the
plasmid pDbleFLAG1.2 into Dunaliella tertiolecta. pDbleFLAG1.2
comprised sequence encoding a bleomycin antibiotic resistance
cassette, comprising sequence encoding the Streptoalloteichus
hindustanus Bleomycin binding protein (ble), for resistance to the
antibiotic phleomycin, operably linked to the promoter and 3' UTR
of the Dunaliella tertiolecta ribulose-1,5-bisphosphate
carboxylase/oxygenase small subunit gene (rbcS1, GenBank Accession
No. AY530155). Prior to transformation, Dunaliella tertiolecta was
unable to be propagated in culture medium comprising 1 mg/L
phleomycin. Upon transformation with the pDbleFLAG1.2 plasmid,
transformants of Dunaliella tertiolecta were obtained that were
propagated in selective culture medium comprising 1 mg/L
phleomycin. The expression of the ble gene product in Dunaliella
tertiolecta enabled propagation in the presence of 1 mg/L
phleomycin, thereby establishing the utility of the bleomycin
antibiotic resistance cassette as selectable marker for use in
Dunaliella tertiolecta. Evaluation of the genomic DNA of the stable
transformants was performed by Southern analysis. As reported by
Walker, selection and maintenance of transformed Dunaliella
tertiolecta was conducted in Dunaliella medium (DM, as described by
Provasoli et al., Archiv fur Mikrobiologie, Vol. 25 (1957), pp.
392-428) further comprising 4.5 g/L NaCl and 1 mg/L pheomycin.
Additional media suitable for culturing Dunaliella tertiolecta for
lipid production are discussed in Takagi et al., Journal of
Bioscience and Bioengineering, Vol. 101:3 (2006), pp. 223-226 and
in Massart and Hanston, Proceedings Venice 2010, Third
International Symposium on Energy from Biomass and Waste. Walker
reported that the plasmid pDbleFLAG1.2 and the promoter and 3' UTR
of the Dunaliella tertiolecta ribulose-1,5-bisphosphate
carboxylase/oxygenase small subunit gene are suitable to enable
heterologous expression in Dunaliella tertiolecta. In addition,
Walker reported that the bleomycin resistance cassette encoded on
pDbleFLAG1.2 was suitable for use as a selectable marker in
Dunaliella tertiolecta.
[0663] In an embodiment of the present invention, vector
pDbleFLAG1.2, comprising the nucleotide sequence encoding the ble
gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
Dunaliella tertiolecta to reflect the codon bias inherent in
nuclear genes of Dunaliella tertiolecta in accordance with Tables
69A-D. For each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the rbcS1 promoter upstream of the protein-coding sequence and
operably linked to the rbcS1 3'UTR/terminator at the 3' region, or
downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Dunaliella tertiolecta genome for targeted genomic integration of
the transformation vector. Homology regions may be selected to
disrupt one or more genomic sites of endogenous lipid biosynthesis
pathway genes. Stable transformation of Dunaliella tertiolecta with
the transformation vector is achieved through well-known
transformation techniques including electroporation or other known
methods. Activity of the ble gene product can be used as a marker
to select for Dunaliella tertiolecta transformed with the
transformation vector on, but not limited to, DM medium comprising
pheomycin. Growth medium suitable for Dunaliella tertiolecta lipid
production include, but are not limited to DM medium and those
culture media described by Takagi et al. and Massart and Hanston.
Evaluation of fatty acid profiles of Dunaliella tertiolecta lipids
can be assessed through standard lipid extraction and analytical
methods described herein.
Example 26: Engineering Volvox carteri
[0664] Expression of recombinant genes in accordance with the
present invention in Volvox carteri can be accomplished by
modifying the methods and vectors taught by Hallman and Rappel et
al. as discussed herein. Briefly, Hallman and Rappel et al., The
Plant Journal, Volume 17 (1999), pp. 99-109, reported the stable
nuclear transformation of Volvox carteri with plasmid DNA. Using
the transformation method of microprojectile bombardment, Hallman
and Rappel introduced the pzeoE plasmid into Volvox carteri. The
pzeoE plasmid comprised sequence encoding a bleomycin antibiotic
resistance cassette, comprising sequence encoding the
Streptoalloteichus hindustanus Bleomycin binding protein (ble), for
resistance to the antibiotic zeocin, operably linked to and the
promoter and 3' UTR of the Volvox carteri beta-tubulin gene
(GenBank Accession No. L24547). Prior to transformation, Volvox
carteri was unable to be propagated in culture medium comprising
1.5 ug/ml zeocin. Upon transformation with the pzeoE plasmid,
transformants of Volvox carteri were obtained that were propagated
in selective culture medium comprising greater than 20 ug/ml
zeocin. The expression of the ble gene product in Volvox carteri
enabled propagation in the presence of 20 ug/ml zeocin, thereby
establishing the utility of the bleomycin antibiotic resistance
cassette as selectable marker for use in Volvox carteri. Evaluation
of the genomic DNA of the stable transformants was performed by
Southern analysis. As reported by Hallman and Rappel, selection and
maintenance of transformed Volvox carteri was conducted in Volvox
medium (VM, as described by Provasoli and Pintner, The Ecology of
Algae, Special Publication No. 2 (1959), Tyron, C. A. and Hartman,
R. T., eds., Pittsburgh: University of Pittsburgh, pp. 88-96) with
1 mg/L pheomycin. Media suitable for culturing Volvox carteri for
lipid production are also discussed by Starr in Starr R, C., Dev
Biol Suppl., Vol. 4 (1970), pp. 59-100). Hallman and Rappel
reported that the plasmid pzeoE and the promoter and 3' UTR of the
Volvox carteri beta-tubulin gene are suitable to enable
heterologous expression in Volvox carteri. In addition, Hallman and
Rappel reported that the bleomycin resistance cassette encoded on
pzeoE was suitable for use as a selectable marker in Volvox
carteri. Additional plasmids, promoters, 3'UTR/terminators, and
selectable markers suitable for enabling heterologous gene
expression in Volvox carteri and suitable for use as selective
markers Volvox carteri in have been reported (for instance see
Hallamann and Sumper, Proceedings of the National Academy of
Sciences, Vol. 91 (1994), pp 11562-11566 and Hallman and Wodniok,
Plant Cell Reports, Volume 25 (2006), pp. 582-581).
[0665] In an embodiment of the present invention, vector pzeoE,
comprising the nucleotide sequence encoding the ble gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in Volvox
carteri to reflect the codon bias inherent in nuclear genes of
Volvox carteri in accordance with Tables 69A-D. For each lipid
biosynthesis pathway protein of Table 70, the codon-optimized gene
sequence can individually be operably linked to the Volvox carteri
beta-tubulin promoter upstream of the protein-coding sequence and
operably linked to the Volvox carteri beta-tubulin 3'UTR/terminator
at the 3' region, or downstream, of the protein-coding sequence.
The transformation construct may additionally comprise homology
regions to the Volvox carteri genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. One skilled in the art can identify
such homology regions within the sequence of the Volvox carteri
genome (referenced in the publication by Prochnik et al., Science,
Vol. 329:5988 (2010), pp 223-226). Stable transformation of Volvox
carteri with the transformation vector is achieved through
well-known transformation techniques including microprojectile
bombardment or other known methods. Activity of the ble gene
product can be used as a marker to select for Volvox carteri
transformed with the transformation vector on, but not limited to,
VM medium comprising zeocin. Growth medium suitable for Volvox
carteri lipid production include, but are not limited to VM medium
and those culture media discussed by Starr. Evaluation of fatty
acid profiles of Volvox carteri lipids can be assessed through
standard lipid extraction and analytical methods described
herein.
Example 27: Engineering Haematococcus pluvialis
[0666] Expression of recombinant genes in accordance with the
present invention in Haematococcus pluvialis can be accomplished by
modifying the methods and vectors taught by Steinbrenner and
Sandmann et al. as discussed herein. Briefly, Steinbrenner and
Sandmann et al., Applied and Environmental Microbiology, Vol. 72:12
(2006), pp. 7477-7484, reported the stable nuclear transformation
of Haematococcus pluvialis with plasmid DNA. Using the
transformation method of microprojectile bombardment, Steinbrenner
introduced the plasmid pPlat-pds-L504R into Haematococcus
pluvialis. The plasmid pPlat-pds-L504R comprised a norflurazon
resistance cassette, which comprised the promoter, protein-coding
sequence, and 3'UTR of the Haematococcus pluvialis phytoene
desaturase gene (Pds, GenBank Accession No. AY781170), wherein the
protein-coding sequence of Pds was modified at position 504
(thereby changing a leucine to an arginine) to encode a gene
product (Pds-L504R) that confers resistance to the herbicide
norflurazon. Prior to transformation with pPlat-pds-L504R,
Haematococcus pluvialis was unable to propagate on medium
comprising 5 uM norflurazon. Upon transformation with the
pPlat-pds-L504R plasmid, transformants of Haematococcus pluvialis
were obtained that were propagated in selective culture medium
comprising 5 uM norflurazon. The expression of the Pds-L504R gene
product in Haematococcus pluvialis enabled propagation in the
presence of 5 uM norflurazon, thereby establishing the utility of
the norflurazon herbicide resistance cassette as selectable marker
for use in Haematococcus pluvialis. Evaluation of the genomic DNA
of the stable transformants was performed by Southern analysis. As
reported by Steinbrenner, selection and maintenance of transformed
Haematococcus pluvialis was conducted on agar plates comprising OHA
medium (OHM (0.41 g/L KNO.sub.3, 0.03 g/L Na.sub.2HPO.sub.4, 0.246
g/L MgSO.sub.4-7H.sub.2O, 0.11 g/L CaCl.sub.2.2H.sub.2O, 2.62 mg/L
Fe.sub.(III)citrate.times.H.sub.2O, 0.011 mg/L
CoCl.sub.2.6H.sub.2O, 0.012 mg/L CuSO.sub.4.5H.sub.2O, 0.075 mg/L
Cr.sub.2O.sub.3, 0.98 mg/L MnCl.sub.2.4H.sub.2O, 0.12 mg/L
Na.sub.2MoO.sub.4.times.2H.sub.2O, 0.005 mg/L SeO.sub.2 and 25 mg/L
biotin, 17.5 mg/L thiamine, and 15 mg/L vitamin B12), supplemented
with 2.42 g/L Tris-acetate, and 5 mM norflurazon. Propagation of
Haematococcus pluvialis in liquid culture was performed by
Steinbrenner and Sandmann using basal medium (basal medium as
described by Kobayashi et al., Applied and Environmental
Microbiology, Vol. 59 (1993), pp. 867-873). Steinbrenner and
Sandmann reported that the pPlat-pds-L504R plasmid and promoter and
3' UTR of the Haematococcus pluvialis phytoene desaturase gene are
suitable to enable heterologous expression in Haematococcus
pluvialis. In addition, Steinbrenner and Sandmann reported that the
norflurazon resistance cassette encoded on pPlat-pds-L504R was
suitable for use as a selectable marker in Haematococcus pluvialis.
Additional plasmids, promoters, 3'UTR/terminators, and selectable
markers suitable for enabling heterologous gene expression in
Haematococcus pluvialis have been reported (see Kathiresan et al.,
Journal of Phycology, Vol. 45 (2009), pp 642-649).
[0667] In an embodiment of the present invention, vector
pPlat-pds-L504R, comprising the nucleotide sequence encoding the
Pds-L504R gene product for use as a selectable marker, is
constructed and modified to further comprise a lipid biosynthesis
pathway expression cassette sequence, thereby creating a
transformation vector. The lipid biosynthesis pathway expression
cassette encodes one or more lipid biosynthesis pathway proteins
selected from Table 70, each protein-coding sequence
codon-optimized for expression in Haematococcus pluvialis to
reflect the codon bias inherent in nuclear genes of Haematococcus
pluvialis in accordance with Tables 69A-D. For each lipid
biosynthesis pathway protein of Table 70, the codon-optimized gene
sequence can individually be operably linked to the Haematococcus
pluvialis pds gene promoter upstream of the protein-coding sequence
and operably linked to the Haematococcus pluvialis pds gene
3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Haematococcus
pluvialis genome for targeted genomic integration of the
transformation vector. Homology regions may be selected to disrupt
one or more genomic sites of endogenous lipid biosynthesis pathway
genes. Stable transformation of Haematococcus pluvialis with the
transformation vector is achieved through well-known transformation
techniques including microprojectile bombardment or other known
methods. Activity of the Pds-L504R gene product can be used as a
marker to select for Haematococcus pluvialis transformed with the
transformation vector on, but not limited to, OHA medium comprising
norflurazon. Growth media suitable for Haematococcus pluvialis
lipid production include, but are not limited to basal medium and
those culture media described by Kobayashi et al., Kathiresan et
al, and Gong and Chen, Journal of Applied Phycology, Vol. 9:5
(1997), pp. 437-444). Evaluation of fatty acid profiles of
Haematococcus pluvialis lipids can be assessed through standard
lipid extraction and analytical methods described herein.
Example 28: Engineering Closterium peracerosum-strigosum-littorale
complex
[0668] Expression of recombinant genes in accordance with the
present invention in Closterium peracerosum-strigosum-littorale
complex can be accomplished by modifying the methods and vectors
taught by Abe et al. as discussed herein. Briefly, Abe et al.,
Plant Cell Physiology, Vol. 52:9 (2011), pp. 1676-1685, reported
the stable nuclear transformation of Closterium
peracerosum-strigosum-littorale complex with plasmid DNA. Using the
transformation methods of microprojectile bombardment, Abe
introduced the plasmid pSA106 into Closterium
peracerosum-strigosum-littorale complex. Plasmid pSA106 comprised a
bleomycin resistance cassette, comprising sequence encoding the
Streptoalloteichus hindustanus Bleomycin binding protein gene (ble,
GenBank Accession No. CAA37050) operably linked to the promoter and
3' UTR of the Closterium peracerosum-strigosum-littorale complex
Chlorophyll a/b-binding protein gene (CAB, GenBank Accession No.
AB363403). Prior to transformation with pSA106, Closterium
peracerosum-strigosum-littorale complex was unable to propagate on
medium comprising 3 ug/ml phleomycin. Upon transformation with
pSA106, transformants of Closterium peracerosum-strigosum-littorale
complex were obtained that were propagated in selective culture
medium comprising 3 ug/ml phleomycin. The expression of the ble
gene product in Closterium peracerosum-strigosum-littorale complex
enabled propagation in the presence of 3 ug/ml phleomycin, thereby
establishing the utility of the bleomycin antibiotic resistance
cassette as selectable marker for use in Closterium
peracerosum-strigosum-littorale complex. Evaluation of the genomic
DNA of the stable transformants was performed by Southern analysis.
As reported by Abe, selection and maintenance of transformed
Closterium peracerosum-strigosum-littorale complex was conducted
first in top agar with C medium (0.1 g/L KNO.sub.3, 0.015 g/L
Ca(NO.sub.3).sub.2.4H2O, 0.05 g/L glycerophosphate-Na2, 0.04 g/L
MgSO.sub.4.7H.sub.2O, 0.5 g/L Tris (hydroxylmethyl) aminomethane,
trace minerals, biotin, vitamins B.sub.1 and B.sub.12) and then
subsequently isolated to agar plates comprising C medium
supplemented with phleomycin. As reported by Abe, propagation of
Closterium peracerosum-strigosum-littorale complex in liquid
culture was performed in C medium. Additional liquid culture medium
suitable for propagation of Closterium
peracerosum-strigosum-littorale complex are discussed by Sekimoto
et al., DNA Research, 10:4 (2003), pp. 147-153. Abe reported that
the pSA106 plasmid and promoter and 3' UTR of the Closterium
peracerosum-strigosum-littorale complex CAB gene are suitable to
enable heterologous gene expression in Closterium
peracerosum-strigosum-littorale complex. In addition, Abe reported
that the bleomycin resistance cassette encoded on pSA106 was
suitable for use as a selectable marker in Closterium
peracerosum-strigosum-littorale complex. Additional plasmids,
promoters, 3'UTR/terminators, and selectable markers suitable for
enabling heterologous gene expression in Closterium
peracerosum-strigosum-littorale complex have been reported (see Abe
et al., Plant Cell Physiology, Vol. 49 (2008), pp. 625-632).
[0669] In an embodiment of the present invention, vector pSA106,
comprising the nucleotide sequence encoding the ble gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Closterium peracerosum-strigosum-littorale complex to reflect the
codon bias inherent in nuclear genes of Closterium
peracerosum-strigosum-littorale complex in accordance with Tables
69A-D. For each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the Closterium peracerosum-strigosum-littorale complex CAB gene
promoter upstream of the protein-coding sequence and operably
linked to the Closterium peracerosum-strigosum-littorale complex
CAB gene 3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Closterium
peracerosum-strigosum-littorale complex genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. Stable transformation of Closterium
peracerosum-strigosum-littorale complex with the transformation
vector is achieved through well-known transformation techniques
including microprojectile bombardment or other known methods.
Activity of the ble gene product can be used as a marker to select
for Closterium peracerosum-strigosum-littorale complex transformed
with the transformation vector on, but not limited to, C medium
comprising phleomycin. Growth media suitable for Closterium
peracerosum-strigosum-littorale complex lipid production include,
but are not limited to C medium and those culture media reported by
Abe et al. and Sekimoto et al. Evaluation of fatty acid profiles of
Closterium peracerosum-strigosum-littorale complex lipids can be
assessed through standard lipid extraction and analytical methods
described herein.
Example 29: Engineering Dunaliella viridis
[0670] Expression of recombinant genes in accordance with the
present invention in Dunaliella viridis can be accomplished by
modifying the methods and vectors taught by Sun et al. as discussed
herein. Briefly, Sun et al., Gene, Vol. 377 (2006), pp. 140-149,
reported the stable transformation of Dunaliella viridis with
plasmid DNA. Using the transformation method of electoporation, Sun
introduced the plasmid pDVNR, encoding the full Dunaliella viridis
nitrate reductase gene into mutant Dunaliella viridis (Dunaliella
viridis NR-mutants.) The NR-mutants are incapable of growth without
the use of nitrate as a source of nitrogen. Nitrate reductase
catalyzes the conversion of nitrate to nitrite. Prior to
transformation, Dunaliella viridis NR-mutants were unable to
propagate in culture medium comprising nitrate (NO.sub.3.sup.-) as
the sole nitrogen source. The expression of the Dunaliella viridis
NR gene product in NR-mutant Dunaliella viridis was used as a
selectable marker to rescue the nitrate metabolism deficiency. Upon
transformation with the pDVNR plasmid, NR-mutant Dunaliella viridis
stably expressing the Dunaliella viridis NR gene product were
obtained that were able to grow on agar plates comprising nitrate
as the sole carbon source. Evaluation of the DNA of the stable
transformants was performed by Southern analysis. Selection and
maintenance of the transformed Dunaliella viridis (NR mutant) was
performed on agar plates comprising 5 mM KNO.sub.3. Sun also
reported the propagation of Dunaliella viridis and Dunaliella
viridis NR mutants in liquid culture medium. Additional media
suitable for propagation of Dunaliella viridis are reported by
Gordillo et al., Journal of Applied Phycology, Vol. 10:2 (1998),
pp. 135-144 and by Moulton and Burford, Hydrobiologia, Vols.
204-205:1 (1990), pp. 401-408. Sun reported that the plasmid pDVNR
and the promoter and 3' UTR/terminator of the Dunaliella viridis
nitrate reductase gene were suitable to enable heterologous
expression in Dunaliella viridis NR-mutants. Sun also reported that
expression of the Dunaliella viridis nitrate reductase gene product
was suitable for use as a selectable marker in Dunaliella viridis
NR-mutants.
[0671] In an embodiment of the present invention, vector pDVNR,
comprising the nucleotide sequence encoding the Dunaliella viridis
nitrate reductase (DvNR) gene product for use as a selectable
marker, is constructed and modified to further comprise a lipid
biosynthesis pathway expression cassette sequence, thereby creating
a transformation vector. The lipid biosynthesis pathway expression
cassette encodes one or more lipid biosynthesis pathway proteins
selected from Table 70, each protein-coding sequence
codon-optimized for expression in Dunaliella viridis to reflect the
codon bias inherent in nuclear genes of Dunaliella viridis in
accordance with Tables 69A-D. For each lipid biosynthesis pathway
protein of Table 70, the codon-optimized gene sequence can
individually be operably linked to the DvNR promoter upstream of
the protein-coding sequence and operably linked to the DvNR
3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Dunaliella viridis
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes.
Stable transformation of Dunaliella viridis NR mutants with the
transformation vector is achieved through well-known transformation
techniques including electorporation or other known methods.
Activity of the DvNR gene product can be used as a selectable
marker to rescue the nitrogen assimilation deficiency of Dunaliella
viridis NR mutant strains and to select for Dunaliella viridis
NR-mutants stably expressing the transformation vector. Growth
media suitable for Dunaliella viridis lipid production include, but
are not limited to those discussed by Sun et al., Moulton and
Burford, and Gordillo et al. Evaluation of fatty acid profiles of
Dunaliella viridis lipids can be assessed through standard lipid
extraction and analytical methods described herein.
Example 30: Engineering Dunaliella salina
[0672] Expression of recombinant genes in accordance with the
present invention in Dunaliella salina can be accomplished by
modifying the methods and vectors taught by Geng et al. as
discussed herein. Briefly, Geng et al., Journal of Applied
Phycology, Vol. 15 (2003), pp. 451-456, reported the stable
transformation of Dunaliella salina with plasmid DNA. Using the
transformation method of electroporation, Geng introduced the
pU.OMEGA.HBsAg-CAT plasmid into Dunaliella salina.
pU.OMEGA.HBsAg-CAT comprises a hepatitis B surface antigen (HBsAG)
expression cassette comprising sequence encoding the hepatitis B
surface antigen operably linked to a Zea mays ubi1 promoter
upstream of the HBsAG protein-coding region and operably linked to
the 3'UTR terminator of the Agrobacterium tumefaciens nopaline
synthase gene (nos) downstream of the HBsAG protein-coding region.
pU.OMEGA.HBsAg-CAT further comprised a chloramphenicol resistance
cassette, comprising sequence encoding the chloramphenicol
acetyltransferase (CAT) gene product, conferring resistance to the
antibiotic chloramphenicol, operably linked to the simian virus 40
promoter and enhancer. Prior to transformation with
pU.OMEGA.HBsAg-CAT, Dunaliella salina was unable to propagate on
medium comprising 60 mg/L chloramphenicol. Upon transformation with
the pU.OMEGA.HBsAg-CAT plasmid, transformants of Dunaliella salina
were obtained that were propagated in selective culture medium
comprising 60 mg/L chloramphenicol. The expression of the CAT gene
product in Dunaliella salina enabled propagation in the presence of
60 mg/L chloramphenicol, thereby establishing the utility of the
chloramphenicol resistance cassette as selectable marker for use in
Dunaliella salina. Detectable activity of the HBsAg gene product
indicated that ubi1 promoter and nos 3'UTR/terminator are suitable
for enabling gene expression in Dunaliella salina. Evaluation of
the genomic DNA of the stable transformants was performed by
Southern analysis. Geng reported that selection and maintenance of
the transformed Dunaliella salina was performed on agar plates
comprising Johnson's medium (J1, described by Borowitzka and
Borowitzka (eds), Micro-algal Biotechnology. Cambridge University
Press, Cambridge, pp. 460-461) with 60 mg/L chloramphenicol. Liquid
propagation of Dunaliella salina was performed by Geng in J1 medium
with 60 mg/L chloramphenicol. Propagation of Dunaliella salina in
media other than J1 medium has been discussed (see Feng et al.,
Mol. Bio. Reports, Vol. 36 (2009), pp. 1433-1439 and Borowitzka et
al., Hydrobiologia, Vols. 116-117:1 (1984), pp. 115-121).
Additional plasmids, promoters, 3'UTR/terminators, and selectable
markers suitable for enabling heterologous gene expression in
Dunaliella salina have been reported by Feng et al. Geng reported
that the plasmid pU.OMEGA.HBsAg-CAT, the ubi1 promoter, and the
Agrobacterium tumefaciens nopaline synthase gene 3'UTR/terminator
are suitable to enable exogenous gene expression in Dunaliella
salina. In addition, Geng reported that the CAT resistance cassette
encoded on pU.OMEGA.HBsAg-CAT was suitable for use as a selectable
marker in Dunaliella salina.
[0673] In an embodiment of the present invention, vector
pU.OMEGA.HBsAg-CAT, comprising the nucleotide sequence encoding the
CAT gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
Dunaliella salina to reflect the codon bias inherent in nuclear
genes of Dunaliella salina in accordance with Tables 69A-D. For
each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the ubi1 promoter upstream of the protein-coding sequence and
operably linked to the Agrobacterium tumefaciens nopaline synthase
gene 3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Dunaliella salina
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes.
Stable transformation of Dunaliella salina with the transformation
vector is achieved through well-known transformation techniques
including electroporation or other known methods. Activity of the
CAT gene product can be used as a selectable marker to select for
Dunaliella salina transformed with the transformation vector in,
but not limited to, J1 medium comprising chrloramphenicol. Growth
medium suitable for Dunaliella salina lipid production include, but
are not limited to J1 medium and those culture media described by
Feng et al. and Borowitzka et al. Evaluation of fatty acid profiles
of Dunaliella salina lipids can be assessed through standard lipid
extraction and analytical methods described herein.
Example 31: Engineering Gonium pectoral
[0674] Expression of recombinant genes in accordance with the
present invention in Gonium pectoral can be accomplished by
modifying the methods and vectors taught by Lerche and Hallman et
al. as discussed herein. Briefly, Lerche and Hallman et al., BMC
Biotechnology, Volume 9:64, 2009, reported the stable nuclear
transformation of Gonium pectorale with plasmid DNA. Using the
transformation method of microprojectile bombardment, Lerche
introduced the plasmid pPmr3 into Gonium pectorale. Plasmid pPmr3
comprised a paromomycin resistance cassette, comprising a sequence
encoding the aminoglycoside 3'-phosphotransferase (aphVIII) gene
product (GenBank Accession No. AAB03856) of Streptomyces rimosus
for resistance to the antibiotic paromomycin, operably linked to
the Volvox carteri hsp70A-rbcS3 hybrid promoter upstream of the
aphVIII protein-coding region and operably linked to the 3'
UTR/terminator of the Volvox carteri rbcS3 gene downstream of the
aphVIII protein-coding region. Prior to transformation with pPmr3,
Gonium pectorale was unable to propagate on medium comprising 0.06
ug/ml paromomycin. Upon transformation with pPmr3, transformants of
Gonium pectorale were obtained that were propagated in selective
culture medium comprising 0.75 and greater ug/ml paromomycin. The
expression of the aphVIII gene product in Gonium pectorale enabled
propagation in the presence of 0.75 and greater ug/ml paromomycin,
thereby establishing the utility of the paromomycin antibiotic
resistance cassette as selectable marker for use in Gonium
pectorale. Evaluation of the genomic DNA of the stable
transformants was performed by Southern analysis. Lerche and
Hallman reported that selection and maintenance of the transformed
Gonium pectorale was performed in liquid Jaworski's medium (20 mg/L
Ca(NO.sub.3).sub.2.4H.sub.2O, 12.4 mg/L KH.sub.2PO.sub.4, 50 mg/L
MgSO.sub.4.7H.sub.2O, 15.9 mg/L NaHCO.sub.3, 2.25 mg/L EDTA-FeNa,
2.25 mg/L EDTA Na.sub.2, 2.48 g/L H.sub.3BO.sub.3, 1.39 g/L
MnCl.sub.2.4H.sub.2O, 1 mg/L
(NH.sub.4).sub.6MO.sub.7O.sub.24.4H.sub.2O, 0.04 mg/L vitamin B12,
0.04 mg/L Thiamine-HCl, 0.04 mg/L biotin, 80 mg/L NaNO.sub.3, 36
mg/L Na.sub.4HPO.sub.4.12H.sub.2O) with 1.0 ug/ml paromomycin.
Additional plasmids, promoters, 3'UTR/terminators, and selectable
markers suitable for enabling heterologous gene expression in
Gonium pectorale are further discussed by Lerche and Hallman.
Lerche and Hallman reported that the plasmid pPmr3, Volvox carteri
hsp70A-rbcS3 hybrid promoter, and the 3' UTR/terminator of the
Volvox carteri rbcS3 gene are suitable to enable exogenous gene
expression in Gonium pectorale. In addition, Lerche and Hallman
reported that the paromomycin resistance cassette encoded pPmr3 was
suitable for use as a selectable marker in Gonium pectorale.
[0675] In an embodiment of the present invention, vector pPmr3,
comprising the nucleotide sequence encoding the aphVIII gene
product for use as a selectable marker, is constructed and modified
to further comprise a lipid biosynthesis pathway expression
cassette sequence, thereby creating a transformation vector. The
lipid biosynthesis pathway expression cassette encodes one or more
lipid biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in Gonium
pectorale to reflect the codon bias inherent in nuclear genes of
Gonium pectorale in accordance with Tables 69A-D. For each lipid
biosynthesis pathway protein of Table 70, the codon-optimized gene
sequence can individually be operably linked to the Volvox carteri
hsp70A-rbcS3 hybrid promoter upstream of the protein-coding
sequence and operably linked to the Volvox carteri rbcS3 gene
3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Gonium pectorale
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes.
Stable transformation of Gonium pectorale with the transformation
vector can be achieved through well-known transformation techniques
including microprojectile bombardment or other known methods.
Activity of the aphVIII gene product can be used as a selectable
marker to select for Gonium pectorale transformed with the
transformation vector in, but not limited to, Jaworski's medium
comprising paromomycin. Growth media suitable for Gonium pectorale
lipid production include Jawaorski's medium and media reported by
Stein, American Journal of Botany, Vol. 45:9 (1958), pp. 664-672.
Evaluation of fatty acid profiles of Gonium pectorale lipids can be
assessed through standard lipid extraction and analytical methods
described herein.
Example 32: Engineering Phaeodactylum tricornutum
[0676] Expression of recombinant genes in accordance with the
present invention in Phaeodactylum tricornutum can be accomplished
by modifying the methods and vectors taught by Apt et al. as
discussed herein. Briefly, Apt et al., Molecular and General
Genetics, Vol. 252 (1996), pp. 572-579, reported the stable nuclear
transformation of Phaeodactylum tricornutum with vector DNA. Using
the transformation technique of microprojectile bombardment, Apt
introduced the plasmid pfcpA into Phaeodactylum tricornutum.
Plasmid pfcpA comprised a bleomycin resistance cassette, comprising
sequence encoding the Streptoalloteichus hindustanus Bleomycin
binding protein (ble), for resistance to the antibiotics phleomycin
and zeocin, operably linked to the promoter of the Phaeodactylum
tricornutum fucoxanthin chlorophyll a binding protein gene (fcpA)
upstream of the ble protein-coding region and operably linked to
the 3' UTR/terminator of the Phaeodactylum tricornutum fcpA gene at
the 3' region, or downstream of the ble protein-coding region.
Prior to transformation with pfcpA, Phaeodactylum tricornutum was
unable to propagate on medium comprising 50 ug/ml zeocin. Upon
transformation with pfcpA, transformants of Phaeodactylum
tricornutum were obtained that were propagated in selective culture
medium comprising 50 ug/ml zeocin. The expression of the ble gene
product in Phaeodactylum tricornutum enabled propagation in the
presence of 50 ug/ml zeocin, thereby establishing the utility of
the bleomycin antibiotic resistance cassette as selectable marker
for use in Phaeodactylum tricornutum. Evaluation of the genomic DNA
of the stable transformants was performed by Southern analysis. Apt
reported that selection and maintenance of the transformed
Phaeodactylum tricornutum was performed on agar plates comprising
LDM medium (as reported by Starr and Zeikus, Journal of Phycology,
Vol. 29, Supplement, (1993)) with 50 mg/L zeocin. Apt reported
liquid propagation of Phaeodactylum tricornutum transformants in
LDM medium with 50 mg/L zeocin. Propagation of Phaeodactylum
tricornutum in medium other than LDM medium has been discussed (by
Zaslavskaia et al., Science, Vol. 292 (2001), pp. 2073-2075, and by
Radokovits et al., Metabolic Engineering, Vol. 13 (2011), pp.
89-95). Additional plasmids, promoters, 3'UTR/terminators, and
selectable markers suitable for enabling heterologous gene
expression in Phaeodactylum tricornutum have been reported in the
same report by Apt et al., by Zaslavskaia et al., and by Radokovits
et al.). Apt reported that the plasmid pfcpA, and the Phaeodactylum
tricornutum fcpA promoter and 3' UTR/terminator are suitable to
enable exogenous gene expression in Phaeodactylum tricornutum. In
addition, Apt reported that the bleomycin resistance cassette
encoded on pfcpA was suitable for use as a selectable marker in
Phaeodactylum tricornutum.
[0677] In an embodiment of the present invention, vector pfcpA,
comprising the nucleotide sequence encoding the ble gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Phaeodactylum tricornutum to reflect the codon bias inherent in
nuclear genes of Phaeodactylum tricornutum in accordance with
Tables 69A-D. For each lipid biosynthesis pathway protein of Table
70, the codon-optimized gene sequence can individually be operably
linked to the Phaeodactylum tricornutum fcpA gene promoter upstream
of the protein-coding sequence and operably linked to the
Phaeodactylum tricornutum fcpA gene 3'UTR/terminator at the 3'
region, or downstream, of the protein-coding sequence. The
transformation construct may additionally comprise homology regions
to the Phaeodactylum tricornutum genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. One skilled in the art can identify
such homology regions within the sequence of the Phaeodactylum
tricornutum genome (referenced in the publication by Bowler et al.,
Nature, Vol. 456 (2008), pp. 239-244). Stable transformation of
Phaeodactylum tricornutum with the transformation vector is
achieved through well-known transformation techniques including
microprojectile bombardment or other known methods. Activity of the
ble gene product can be used as a marker to select for
Phaeodactylum tricornutum transformed with the transformation
vector in, but not limited to, LDM medium comprising paromomycin.
Growth medium suitable for Phaeodactylum tricornutum lipid
production include, but are not limited to f/2 medium as reported
by Radokovits et al. Evaluation of fatty acid profiles of
Phaeodactylum tricornutum lipids can be assessed through standard
lipid extraction and analytical methods described herein.
Example 33: Engineering Chaetoceros sp.
[0678] Expression of recombinant genes in accordance with the
present invention in Chaetoceros sp. can be accomplished by
modifying the methods and vectors taught by Yamaguchi et al. as
discussed herein. Briefly, Yamaguchi et al., Phycological Research,
Vol. 59:2 (2011), pp. 113-119, reported the stable nuclear
transformation of Chaetoceros sp. with plasmid DNA. Using the
transformation method of microprojectile bombardment, Yamaguchi
introduced the plasmid pTpfcp/nat into Chaetoceros sp. pTpfcp/nat
comprised a nourseothricin resistance cassette, comprising sequence
encoding the nourseothricin acetyltransferase (nat) gene product
(GenBank Accession No. AAC60439) operably linked to the
Thalassiosira pseudonana fucoxanthin chlorophyll a/c binding
protein gene (fcp) promoter upstream of the nat protein-coding
region and operably linked to the Thalassiosira pseudonana fcp gene
3' UTR/terminator at the 3' region (downstream of the nat protein
coding-sequence). The nat gene product confers resistance to the
antibiotic nourseothricin. Prior to transformation with pTpfcp/nat,
Chaetoceros sp. was unable to propagate on medium comprising 500
ug/ml nourseothricin. Upon transformation with pTpfcp/nat,
transformants of Chaetoceros sp. were obtained that were propagated
in selective culture medium comprising 500 ug/ml nourseothricin.
The expression of the nat gene product in Chaetoceros sp. enabled
propagation in the presence of 500 ug/ml nourseothricin, thereby
establishing the utility of the nourseothricin antibiotic
resistance cassette as selectable marker for use in Chaetoceros sp.
Evaluation of the genomic DNA of the stable transformants was
performed by Southern analysis. Yamaguchi reported that selection
and maintenance of the transformed Chaetoceros sp. was performed on
agar plates comprising f/2 medium (as reported by Guilard, R. R.,
Culture of Phytoplankton for feeding marine invertebrates, In
Culture of Marine Invertebrate Animals, Smith and Chanley (eds)
1975, Plenum Press, New York, pp. 26-60) with 500 ug/ml
nourseothricin. Liquid propagation of Chaetoceros sp.
transformants, as performed by Yamaguchi, was carried out in f/2
medium with 500 mg/L nourseothricin. Propagation of Chaetoceros sp.
in additional culture medium has been reported (for example in
Napolitano et al., Journal of the World Aquaculture Society, Vol.
21:2 (1990), pp. 122-130, and by Volkman et al., Journal of
Experimental Marine Biology and Ecology, Vol. 128:3 (1989), pp.
219-240). Additional plasmids, promoters, 3'UTR/terminators, and
selectable markers suitable for enabling heterologous gene
expression in Chaetoceros sp. have been reported in the same report
by Yamaguchi et al. Yamaguchi reported that the plasmid pTpfcp/nat,
and the Thalassiosira pseudonana fcp promoter and 3' UTR/terminator
are suitable to enable exogenous gene expression in Chaetoceros sp.
In addition, Yamaguchi reported that the nourseothricin resistance
cassette encoded on pTpfcp/nat was suitable for use as a selectable
marker in Chaetoceros sp.
[0679] In an embodiment of the present invention, vector
pTpfcp/nat, comprising the nucleotide sequence encoding the nat
gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
the closely-related Chaetoceros compressum to reflect the codon
bias inherent in nuclear genes of Chaetoceros compressum in
accordance with Tables 69A-D. For each lipid biosynthesis pathway
protein of Table 70, the codon-optimized gene sequence can
individually be operably linked to the Thalassiosira pseudonana fcp
gene promoter upstream of the protein-coding sequence and operably
linked to the Thalassiosira pseudonana fcp gene 3'UTR/terminator at
the 3' region, or downstream, of the protein-coding sequence. The
transformation construct may additionally comprise homology regions
to the Chaetoceros sp. genome for targeted genomic integration of
the transformation vector. Homology regions may be selected to
disrupt one or more genomic sites of endogenous lipid biosynthesis
pathway genes. Stable transformation of Chaetoceros sp. with the
transformation vector is achieved through well-known transformation
including microprojectile bombardment or other known methods.
Activity of the nat gene product can be used as a selectable marker
to select for Chaetoceros sp. transformed with the transformation
vector in, but not limited to, f/2 agar medium comprising
nourseothricin. Growth medium suitable for Chaetoceros sp. lipid
production include, but are not limited to, f/2 medium, and those
culture media discussed by Napolitano et al. and Volkman et al.
Evaluation of fatty acid profiles of Chaetoceros sp lipids can be
assessed through standard lipid extraction and analytical methods
described herein.
Example 34: Engineering Cylindrotheca fusiformis
[0680] Expression of recombinant genes in accordance with the
present invention in Cylindrotheca fusiformis can be accomplished
by modifying the methods and vectors taught by Poulsen and Kroger
et al. as discussed herein. Briefly, Poulsen and Kroger et al.,
FEBS Journal, Vol. 272 (2005), pp. 3413-3423, reported the
transformation of Cylindrotheca fusiformis with plasmid DNA. Using
the transformation method of microprojectile bombardment, Poulsen
and Kroger introduced the pCF-ble plasmid into Cylindrotheca
fusiformis. Plasmid pCF-ble comprised a bleomycin resistance
cassette, comprising sequence encoding the Streptoalloteichus
hindustanus Bleomycin binding protein (ble), for resistance to the
antibiotics zeocin and phleomycin, operably linked to the
Cylindrotheca fusiformis fucozanthin chlorophyll a/c binding
protein gene (fcpA, GenBank Accession No. AY125580) promoter
upstream of the ble protein-coding region and operably linked to
the Cylindrotheca fusiformis fcpA gene 3'UTR/terminator at the 3'
region (down-stream of the ble protein-coding region). Prior to
transformation with pCF-ble, Cylindrotheca fusiformis was unable to
propagate on medium comprising 1 mg/ml zeocin. Upon transformation
with pCF-ble, transformants of Cylindrotheca fusiformis were
obtained that were propagated in selective culture medium
comprising 1 mg/ml zeocin. The expression of the ble gene product
in Cylindrotheca fusiformis enabled propagation in the presence of
1 mg/ml zeocin, thereby establishing the utility of the bleomycin
antibiotic resistance cassette as selectable marker for use in
Cylindrotheca fusiformis. Poulsen and Kroger reported that
selection and maintenance of the transformed Cylindrotheca
fusiformis was performed on agar plates comprising artificial
seawater medium with 1 mg/ml zeocin. Poulsen and Kroger reported
liquid propagation of Cylindrotheca fusiformis transformants in
artificial seawater medium with 1 mg/ml zeocin. Propagation of
Cylindrotheca fusiformis in additional culture medium has been
discussed (for example in Liang et al., Journal of Applied
Phycology, Vol. 17:1 (2005), pp. 61-65, and by Orcutt and
Patterson, Lipids, Vol. 9:12 (1974), pp. 1000-1003). Additional
plasmids, promoters, and 3'UTR/terminators for enabling
heterologous gene expression in Chaetoceros sp. have been reported
in the same report by Poulsen and Kroger. Poulsen and Kroger
reported that the plasmid pCF-ble and the Cylindrotheca fusiformis
fcp promoter and 3' UTR/terminator are suitable to enable exogenous
gene expression in Cylindrotheca fusiformis. In addition, Poulsen
and Kroger reported that the bleomycin resistance cassette encoded
on pCF-ble was suitable for use as a selectable marker in
Cylindrotheca fusiformis.
[0681] In an embodiment of the present invention, vector pCF-ble,
comprising the nucleotide sequence encoding the ble gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Cylindrotheca fusiformis to reflect the codon bias inherent in
nuclear genes of Cylindrotheca fusiformis in accordance with Tables
69A-D. For each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the Cylindrotheca fusiformis fcp gene promoter upstream of the
protein-coding sequence and operably linked to the Cylindrotheca
fusiformis fcp gene 3'UTR/terminator at the 3' region, or
downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Cylindrotheca fusiformis genome for targeted genomic integration of
the transformation vector. Homology regions may be selected to
disrupt one or more genomic sites of endogenous lipid biosynthesis
pathway genes. Stable transformation of Cylindrotheca fusiformis
with the transformation vector is achieved through well-known
transformation techniques including microprojectile bombardment or
other known methods. Activity of the ble gene product can be used
as a selectable marker to select for Cylindrotheca fusiformis
transformed with the transformation vector in, but not limited to,
artificial seawater agar medium comprising zeocin. Growth media
suitable for Cylindrotheca fusiformis lipid production include, but
are not limited to, artificial seawater and those media reported by
Liang et al. and Orcutt and Patterson. Evaluation of fatty acid
profiles of Cylindrotheca fusiformis lipids can be assessed through
standard lipid extraction and analytical methods described
herein.
Example 35: Engineering Amphidinium sp.
[0682] Expression of recombinant genes in accordance with the
present invention in Amphidinium sp. can be accomplished by
modifying the methods and vectors taught by ten Lohuis and Miller
et al. as discussed herein. Briefly, ten Lohuis and Miller et al.,
The Plant Journal, Vol. 13:3 (1998), pp. 427-435, reported the
stable transformation of Amphidinium sp. with plasmid DNA. Using
the transformation technique of agitation in the presence of
silicon carbide whiskers, ten Lohuis introduced the plasmid pMT
NPT/GUS into Amphidinium sp. pMT NPT/GUS comprised a neomycin
resistance cassette, comprising sequence encoding the neomycin
phosphotransferase II (nptII) gene product (GenBank Accession No.
AAL92039) operably linked to the Agrobacterium tumefaciens nopaline
synthase (nos) gene promoter upstream, or 5' of the nptII
protein-coding region and operably linked to the 3' UTR/terminator
of the nos gene at the 3' region (down-stream of the nptII
protein-coding region). The nptII gene product confers resistance
to the antibiotic G418. The pMT NPT/GUS plasmid further comprised
sequence encoding a beta-glucuronidase (GUS) reporter gene product
operably-linked to a CaMV 35S promoter and further operably linked
to the CaMV 35S 3' UTR/terminator. Prior to transformation with pMT
NPT/GUS, Amphidinium sp. was unable to be propagated on medium
comprising 3 mg/ml G418. Upon transformation with pMT NPT/GUS,
transformants of Amphidinium sp. were obtained that were propagated
in selective culture medium comprising 3 mg/ml G418. The expression
of the nptII gene product in Amphidinium sp. enabled propagation in
the presence of 3 mg/ml G418, thereby establishing the utility of
the neomycin antibiotic resistance cassette as selectable marker
for use in Amphidinium sp. Detectable activity of the GUS reporter
gene indicated that CaMV 35S promoter and 3'UTR are suitable for
enabling gene expression in Amphidinium sp. Evaluation of the
genomic DNA of the stable transformants was performed by Southern
analysis. ten Lohuis and Miller reported liquid propagation of
Amphidinium sp transformants in medium comprising seawater
supplemented with F/2 enrichment solution (provided by the supplier
Sigma) and 3 mg/ml G418 as well as selection and maintenance of
Amphidinium sp. transformants on agar medium comprising seawater
supplemented with F/2 enrichment solution and 3 mg/ml G418.
Propagation of Amphidinium sp. in additional culture medium has
been reported (for example in Mansour et al., Journal of Applied
Phycology, Vol. 17:4 (2005) pp. 287-v300). An additional plasmid,
comprising additional promoters, 3'UTR/terminators, and a
selectable marker for enabling heterologous gene expression in
Amphidinium sp. have been reported in the same report by ten Lohuis
and Miller. ten Lohuis and Miller reported that the plasmid pMT
NPT/GUS and the promoter and 3' UTR/terminator of the nos and CaMV
35S genes are suitable to enable exogenous gene expression in
Amphidinium sp. In addition, ten Lohuis and Miller reported that
the neomycin resistance cassette encoded on pMT NPT/GUS was
suitable for use as a selectable marker in Amphidinium sp.
[0683] In an embodiment of the present invention, vector pMT
NPT/GUS, comprising the nucleotide sequence encoding the nptII gene
product for use as a selectable marker, is constructed and modified
to further comprise a lipid biosynthesis pathway expression
cassette sequence, thereby creating a transformation vector. The
lipid biosynthesis pathway expression cassette encodes one or more
lipid biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Amphidinium sp. to reflect the codon bias inherent in nuclear genes
of the closely-related species, Amphidinium carterae in accordance
with Tables 69A-D. For each lipid biosynthesis pathway protein of
Table 70, the codon-optimized gene sequence can individually be
operably linked to the Agrobacterium tumefaciens nopaline synthase
(nos) gene promoter upstream of the protein-coding sequence and
operably linked to the nos 3'UTR/terminator at the 3' region, or
downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Amphidinium sp. genome for targeted genomic integration of the
transformation vector. Homology regions may be selected to disrupt
one or more genomic sites of endogenous lipid biosynthesis pathway
genes. Stable transformation of Amphidinium sp. with the
transformation vector is achieved through well-known transformation
techniques including silicon fibre-mediated microinjection or other
known methods. Activity of the nptII gene product can be used as a
selectable marker to select for Amphidinium sp. transformed with
the transformation vector in, but not limited to, seawater agar
medium comprising G418. Growth media suitable for Amphidinium sp.
lipid production include, but are not limited to, artificial
seawater and those media reported by Mansour et al. and ten Lohuis
and Miller. Evaluation of fatty acid profiles of Amphidinium sp.
lipids can be assessed through standard lipid extraction and
analytical methods described herein.
Example 36: Engineering Symbiodinium microadriacticum
[0684] Expression of recombinant genes in accordance with the
present invention in Symbiodinium microadriacticum can be
accomplished by modifying the methods and vectors taught by ten
Lohuis and Miller et al. as discussed herein. Briefly, ten Lohuis
and Miller et al., The Plant Journal, Vol. 13:3 (1998), pp.
427-435, reported the stable transformation of Symbiodinium
microadriacticum with plasmid DNA. Using the transformation
technique of silicon fibre-mediated microinjection, ten Lohuis
introduced the plasmid pMT NPT/GUS into Symbiodinium
microadriacticum. pMT NPT/GUS comprised a neomycin resistance
cassette, comprising sequence encoding the neomycin
phosphotransferase II (nptII) gene product (GenBank Accession No.
AAL92039) operably linked to the Agrobacterium tumefaciens nopaline
synthase (nos) gene promoter upstream, or 5' of the nptII
protein-coding region and operably linked to the 3' UTR/terminator
of the nos gene at the 3' region (down-stream of the nptII
protein-coding region). The nptII gene product confers resistance
to the antibiotic G418. The pMT NPT/GUS plasmid further comprised
sequence encoding a beta-glucuronidase (GUS) reporter gene product
operably-linked to a CaMV 35S promoter and further operably linked
to the CaMV 35S 3' UTR/terminator. Prior to transformation with pMT
NPT/GUS, Symbiodinium microadriacticum was unable to be propagated
on medium comprising 3 mg/ml G418. Upon transformation with pMT
NPT/GUS, transformants of Symbiodinium microadriacticum were
obtained that were propagated in selective culture medium
comprising 3 mg/ml G418. The expression of the nptII gene product
in Symbiodinium microadriacticum enabled propagation in the
presence of 3 mg/ml G418, thereby establishing the utility of the
neomycin antibiotic resistance cassette as selectable marker for
use in Symbiodinium microadriacticum. Detectable activity of the
GUS reporter gene indicated that CaMV 35S promoter and 3'UTR are
suitable for enabling gene expression in Symbiodinium
microadriacticum. Evaluation of the genomic DNA of the stable
transformants was performed by Southern analysis. ten Lohuis and
Miller reported liquid propagation of Symbiodinium microadriacticum
transformants in medium comprising seawater supplemented with F/2
enrichment solution (provided by the supplier Sigma) and 3 mg/ml
G418 as well as selection and maintenance of Symbiodinium
microadriacticum transformants on agar medium comprising seawater
supplemented with F/2 enrichment solution and 3 mg/ml G418.
Propagation of Symbiodinium microadriacticum in additional culture
medium has been discussed (for example in Iglesias-Prieto et al.,
Proceedings of the National Academy of Sciences, Vol. 89:21 (1992)
pp. 10302-10305). An additional plasmid, comprising additional
promoters, 3'UTR/terminators, and a selectable marker for enabling
heterologous gene expression in Symbiodinium microadriacticum have
been discussed in the same report by ten Lohuis and Miller. ten
Lohuis and Miller reported that the plasmid pMT NPT/GUS and the
promoter and 3' UTR/terminator of the nos and CaMV 35S genes are
suitable to enable exogenous gene expression in Symbiodinium
microadriacticum. In addition, ten Lohuis and Miller reported that
the neomycin resistance cassette encoded on pMT NPT/GUS was
suitable for use as a selectable marker in Symbiodinium
microadriacticum.
[0685] In an embodiment of the present invention, vector pMT
NPT/GUS, comprising the nucleotide sequence encoding the nptII gene
product for use as a selectable marker, is constructed and modified
to further comprise a lipid biosynthesis pathway expression
cassette sequence, thereby creating a transformation vector. The
lipid biosynthesis pathway expression cassette encodes one or more
lipid biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Symbiodinium microadriacticum. to reflect the codon bias inherent
in nuclear genes of Symbiodinium microadriacticum in accordance
with Tables 69A-D. For each lipid biosynthesis pathway protein of
Table 70, the codon-optimized gene sequence can individually be
operably linked to the Agrobacterium tumefaciens nopaline synthase
(nos) gene promoter upstream of the protein-coding sequence and
operably linked to the nos 3'UTR/terminator at the 3' region, or
downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Symbiodinium microadriacticum genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. Stable transformation of Symbiodinium
microadriacticum with the transformation vector is achieved through
well-known transformation techniques including silicon
fibre-mediated microinjection or other known methods. Activity of
the nptII gene product can be used as a selectable marker to select
for Symbiodinium microadriacticum transformed with the
transformation vector in, but not limited to, seawater agar medium
comprising G418. Growth media suitable for Symbiodinium
microadriacticum lipid production include, but are not limited to,
artificial seawater and those media reported by Iglesias-Prieto et
al. and ten Lohuis and Miller. Evaluation of fatty acid profiles of
Symbiodinium microadriacticum lipids can be assessed through
standard lipid extraction and analytical methods described
herein.
Example 37: Engineering Nannochloropsis sp.
[0686] Expression of recombinant genes in accordance with the
present invention in Nannochloropsis sp. W2J3B can be accomplished
by modifying the methods and vectors taught by Kilian et al. as
discussed herein. Briefly, Kilian et al., Proceedings of the
National Academy of Sciences, Vol. 108:52 (2011) pp. 21265-21269,
reported the stable nuclear transformation of Nannochloropsis with
a transformation construct. Using the transformation method of
electroporation, Kilian introduced the transformation construct C2
into Nannochloropsis sp. W2J3B. The C2 transformation construct
comprised a bleomycin resistance cassette, comprising the coding
sequence for the Streptoalloteichus hindustanus Bleomycin binding
protein (ble), for resistance to the antibiotics phleomycin and
zeocin, operably linked to and the promoter of the Nannochloropsis
sp. W2J3B violaxanthin/chlorophyll a-binding protein gene VCP2
upstream of the ble protein-coding region and operably linked to
the 3'UTR/terminator of the Nannochloropsis sp. W2J3B
violaxanthin/chlorophyll a-binding gene VCP1 downstream of the ble
protein-coding region. Prior to transformation with C2,
Nannochloropsis sp. W2J3B was unable to propagate on medium
comprising 2 ug/ml zeocin. Upon transformation with C2,
transformants of Nannochloropsis sp. W2J3B were obtained that were
propagated in selective culture medium comprising 2 ug/ml zeocin.
The expression of the ble gene product in Nannochloropsis sp. W2J3B
enabled propagation in the presence of 2 ug/ml zeocin, thereby
establishing the utility of the bleomycin antibiotic resistance
cassette as selectable marker for use in Nannochloropsis.
Evaluation of the genomic DNA of the stable transformants was
performed by PCR. Kilian reported liquid propagation of
Nannochloropsis sp. W2J3B transformants in F/2 medium (reported by
Guilard and Ryther, Canadian Journal of Microbiology, Vol. 8
(1962), pp. 229-239) comprising fivefold levels of trace metals,
vitamins, and phosphate solution, and further comprising 2 ug/ml
zeocin. Kilian also reported selection and maintenance of
Nannochloropsis sp. W2J3B transformants on agar F/2 medium
comprising artificial seawater 2 mg/ml zeocin. Propagation of
Nannochloropsis in additional culture medium has been discussed
(for example in Chiu et al., Bioresour Technol., Vol. 100:2 (2009),
pp. 833-838 and Pal et al., Applied Microbiology and Biotechnology,
Vol. 90:4 (2011), pp. 1429-1441.). Additional transformation
constructs, comprising additional promoters and 3'UTR/terminators
for enabling heterologous gene expression in Nannochloropsis sp.
W2J3B and selectable markers for selection of transformants have
been described in the same report by Kilian. Kilian reported that
the transformation construct C2 and the promoter of the
Nannochloropsis sp. W2J3B violaxanthin/chlorophyll a-binding
protein gene VCP2 and 3' UTR/terminator of the Nannochloropsis sp.
W2J3B violaxanthin/chlorophyll a-binding protein gene VCP1 are
suitable to enable exogenous gene expression in Nannochloropsis sp.
W2J3B. In addition, Kilian reported that the bleomycin resistance
cassette encoded on C2 was suitable for use as a selectable marker
in Nannochloropsis sp. W2J3B.
[0687] In an embodiment of the present invention, transformation
construct C2, comprising the nucleotide sequence encoding the ble
gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
Nannochloropsis sp. W2J3B to reflect the codon bias inherent in
nuclear genes of Nannochloropsis sp. in accordance with Tables
69A-D. For each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the Nannochloropsis sp. W2J3B VCP2 gene promoter upstream of the
protein-coding sequence and operably linked to the Nannochloropsis
sp. W2J3B VCP1 gene 3'UTR/terminator at the 3' region, or
downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Nannochloropsis sp. W2J3B genome for targeted genomic integration
of the transformation vector. Homology regions may be selected to
disrupt one or more genomic sites of endogenous lipid biosynthesis
pathway genes. Stable transformation of Nannochloropsis sp. W2J3B
with the transformation vector is achieved through well-known
transformation techniques including electroporation or other known
methods. Activity of the ble gene product can be used as a
selectable marker to select for Nannochloropsis sp. W2J3B
transformed with the transformation vector in, but not limited to,
F/2 medium comprising zeocin. Growth media suitable for
Nannochloropsis sp. W2J3B lipid production include, but are not
limited to, F/2 medium and those media reported by Chiu et al. and
Pal et al. Evaluation of fatty acid profiles of Nannochloropsis sp.
W2J3B lipids can be assessed through standard lipid extraction and
analytical methods described herein.
Example 38: Engineering Cyclotella cryptica
[0688] Expression of recombinant genes in accordance with the
present invention in Cyclotella cryptica can be accomplished by
modifying the methods and vectors taught by Dunahay et al. as
discussed herein. Briefly, Dunahay et al., Journal of Phycology,
Vol. 31 (1995), pp. 1004-1012, reported the stable transformation
of Cyclotella cryptica with plasmid DNA. Using the transformation
method of microprojectile bombardment, Dunahay introduced the
plasmid pACCNPT5.1 into Cyclotella cryptica. Plasmid pACCNPT5.1
comprised a neomycin resistance cassette, comprising the coding
sequence of the neomycin phosphotransferase II (nptII) gene product
operably linked to the promoter of the Cyclotella cryptica
acetyl-CoA carboxylase (ACCase) gene (GenBank Accession No. L20784)
upstream of the nptII coding-region and operably linked to the
3'UTR/terminator of the Cyclotella cryptica ACCase gene at the 3'
region (downstream of the nptII coding-region). The nptII gene
product confers resistance to the antibiotic G418. Prior to
transformation with pACCNPT5.1, Cyclotella cryptica was unable to
propagate on 50% artificial seawater medium comprising 100 ug/ml
G418. Upon transformation with pACCNPT5.1, transformants of
Cyclotella cryptica were obtained that were propagated in selective
50% artificial seawater medium comprising 100 ug/ml G418. The
expression of the nptII gene product in Cyclotella cryptica enabled
propagation in the presence of 100 ug/ml G418, thereby establishing
the utility of the neomycin antibiotic resistance cassette as
selectable marker for use in Cyclotella cryptica. Evaluation of the
genomic DNA of the stable transformants was performed by Southern
analysis. Dunahay reported liquid propagation of Cyclotella
cryptica in artificial seawater medium (ASW, as discussed by Brown,
L., Phycologia, Vol. 21 (1982), pp. 408-410) supplemented with 1.07
mM sodium silicate and with 100 ug/ml G418. Dunahay also reported
selection and maintenance of Cyclotella cryptica transformants on
agar plates comprising ASW medium with 100 ug/ml G418. Propagation
of Cyclotella cryptica in additional culture medium has been
discussed (for example in Sriharan et al., Applied Biochemistry and
Biotechnology, Vol. 28-29:1 (1991), pp. 317-326 and Pahl et al.,
Journal of Bioscience and Bioengineering, Vol. 109:3 (2010), pp.
235-239). Dunahay reported that the plasmid pACCNPT5.1 and the
promoter of the Cyclotella cryptica acetyl-CoA carboxylase (ACCase)
gene are suitable to enable exogenous gene expression in Cyclotella
cryptica. In addition, Dunahay reported that the neomycin
resistance cassette encoded on pACCNPT5.1 was suitable for use as a
selectable marker in Cyclotella cryptica.
[0689] In an embodiment of the present invention, vector
pACCNPT5.1, comprising the nucleotide sequence encoding the nptII
gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
Cyclotella cryptica to reflect the codon bias inherent in nuclear
genes of Cyclotella cryptica in accordance with Tables 69A-D. For
each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the Cyclotella cryptica ACCase promoter upstream of the
protein-coding sequence and operably linked to the Cyclotella
cryptica ACCase 3'UTR/terminator at the 3' region, or downstream,
of the protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Cyclotella cryptica
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes.
Stable transformation of Cyclotella cryptica with the
transformation vector is achieved through well-known transformation
techniques including microprojectile bombardment or other known
methods. Activity of the nptII gene product can be used as a marker
to select for Cyclotella cryptica transformed with the
transformation vector in, but not limited to, agar ASW medium
comprising G418. Growth media suitable for Cyclotella cryptica
lipid production include, but are not limited to, ASW medium and
those media reported by Sriharan et al., 1991 and Pahl et al.
Evaluation of fatty acid profiles of Cyclotella cryptica lipids can
be assessed through standard lipid extraction and analytical
methods described herein.
Example 39: Engineering Navicula saprophila
[0690] Expression of recombinant genes in accordance with the
present invention in Navicula saprophila can be accomplished by
modifying the methods and vectors taught by Dunahay et al. as
discussed herein. Briefly, Dunahay et al., Journal of Phycology,
Vol. 31 (1995), pp. 1004-1012, reported the stable transformation
of Navicula saprophila with plasmid DNA. Using the transformation
method of microprojectile bombardment, Dunahay introduced the
plasmid pACCNPT5.1 into Navicula saprophila. Plasmid pACCNPT5.1
comprised a neomycin resistance cassette, comprising the coding
sequence of the neomycin phosphotransferase II (nptII) gene product
operably linked to the promoter of the Cyclotella cryptica
acetyl-CoA carboxylase (ACCase) gene (GenBank Accession No. L20784)
upstream of the nptII coding-region and operably linked to the
3'UTR/terminator of the Cyclotella cryptica ACCase gene at the 3'
region (downstream of the nptII coding-region). The nptII gene
product confers resistance to the antibiotic G418. Prior to
transformation with pACCNPT5.1, Navicula saprophila was unable to
propagate on artificial seawater medium comprising 100 ug/ml G418.
Upon transformation with pACCNPT5.1, transformants of Navicula
saprophila were obtained that were propagated in selective
artificial seawater medium comprising 100 ug/ml G418. The
expression of the nptII gene product in Navicula saprophila enabled
propagation in the presence of G418, thereby establishing the
utility of the neomycin antibiotic resistance cassette as
selectable marker for use in Navicula saprophila. Evaluation of the
genomic DNA of the stable transformants was performed by Southern
analysis. Dunahay reported liquid propagation of Navicula
saprophila in artificial seawater medium (ASW, as discussed by
Brown, L., Phycologia, Vol. 21 (1982), pp. 408-410) supplemented
with 1.07 mM sodium silicate and with 100 ug/ml G418. Dunahay also
reported selection and maintenance of Navicula saprophila
transformants on agar plates comprising ASW medium with 100 ug/ml
G418. Propagation of Navicula saprophila in additional culture
medium has been discussed (for example in Tadros and Johansen,
Journal of Phycology, Vol. 24:4 (1988), pp. 445-452 and Sriharan et
al., Applied Biochemistry and Biotechnology, Vol. 20-21:1 (1989),
pp. 281-291). Dunahay reported that the plasmid pACCNPT5.1 and the
promoter of the Cyclotella cryptica acetyl-CoA carboxylase (ACCase)
gene are suitable to enable exogenous gene expression in Navicula
saprophila. In addition, Dunahay reported that the neomycin
resistance cassette encoded on pACCNPT5.1 was suitable for use as a
selectable marker in Navicula saprophila.
[0691] In an embodiment of the present invention, vector
pACCNPT5.1, comprising the nucleotide sequence encoding the nptII
gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
Navicula saprophila to reflect the codon bias inherent in nuclear
genes of the closely-related Navicula pelliculosa in accordance
with Tables 69A-D. For each lipid biosynthesis pathway protein of
Table 70, the codon-optimized gene sequence can individually be
operably linked to the Cyclotella cryptica ACCase gene promoter
upstream of the protein-coding sequence and operably linked to the
Cyclotella cryptica ACCase gene 3'UTR/terminator at the 3' region,
or downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Navicula saprophila genome for targeted genomic integration of the
transformation vector. Homology regions may be selected to disrupt
one or more genomic sites of endogenous lipid biosynthesis pathway
genes. Stable transformation of Navicula saprophila with the
transformation vector is achieved through well-known transformation
techniques including microprojectile bombardment or other known
methods. Activity of the nptII gene product can be used as a
selectable marker to select for Navicula saprophila transformed
with the transformation vector in, but not limited to, agar ASW
medium comprising G418. Growth media suitable for Navicula
saprophila lipid production include, but are not limited to, ASW
medium and those media reported by Sriharan et al. 1989 and Tadros
and Johansen. Evaluation of fatty acid profiles of Navicula
saprophila lipids can be assessed through standard lipid extraction
and analytical methods described herein.
Example 40: Engineering Thalassiosira pseudonana
[0692] Expression of recombinant genes in accordance with the
present invention in Thalassiosira pseudonana can be accomplished
by modifying the methods and vectors taught by Poulsen et al. as
discussed herein. Briefly, Poulsen et al., Journal of Phycology,
Vol. 42 (2006), pp. 1059-1065, reported the stable transformation
of Thalassiosira pseudonana with plasmid DNA. Using the
transformation method of microprojectile bombardment, Poulsen
introduced the plasmid pTpfcp/nat in to Thalassiosira pseudonana.
pTpfcp/nat comprised a nourseothricin resistance cassette,
comprising sequence encoding the nourseothricin acetyltransferase
(nat) gene product (GenBank Accession No. AAC60439) operably linked
to the Thalassiosira pseudonana fucoxanthin chlorophyll a/c binding
protein gene (fcp) promoter upstream of the nat protein-coding
region and operably linked to the Thalassiosira pseudonana fcp gene
3' UTR/terminator at the 3' region (downstream of the nat protein
coding-sequence). The nat gene product confers resistance to the
antibiotic nourseothricin. Prior to transformation with pTpfcp/nat,
Thalassiosira pseudonana was unable to propagate on medium
comprising 10 ug/ml nourseothricin. Upon transformation with
pTpfcp/nat, transformants of Thalassiosira pseudonana were obtained
that were propagated in selective culture medium comprising 100
ug/ml nourseothricin. The expression of the nat gene product in
Thalassiosira pseudonana enabled propagation in the presence of 100
ug/ml nourseothricin, thereby establishing the utility of the
nourseothricin antibiotic resistance cassette as selectable marker
for use in Thalassiosira pseudonana. Evaluation of the genomic DNA
of the stable transformants was performed by Southern analysis.
Poulsen reported that selection and maintenance of the transformed
Thalassiosira pseudonana was performed in liquid culture comprising
modified ESAW medium (as discussed by Harrison et al., Journal of
Phycology, Vol. 16 (1980), pp. 28-35) with 100 ug/ml
nourseothricin. Propagation of Thalassiosira pseudonana in
additional culture medium has been discussed (for example in
Volkman et al., Journal of Experimental Marine Biology and Ecology,
Vol. 128:3 (1989), pp. 219-240). An additional plasmid, comprising
additional selectable markers suitable for use in Thalassiosira
pseudonana has been discussed in the same report by Poulsen.
Poulsen reported that the plasmid pTpfcp/nat, and the Thalassiosira
pseudonana fcp promoter and 3' UTR/terminator are suitable to
enable exogenous gene expression in Thalassiosira pseudonana. In
addition, Poulsen reported that the nourseothricin resistance
cassette encoded on pTpfcp/nat was suitable for use as a selectable
marker in Thalassiosira pseudonana.
[0693] In an embodiment of the present invention, vector
pTpfcp/nat, comprising the nucleotide sequence encoding the nat
gene product for use as a selectable marker, is constructed and
modified to further comprise a lipid biosynthesis pathway
expression cassette sequence, thereby creating a transformation
vector. The lipid biosynthesis pathway expression cassette encodes
one or more lipid biosynthesis pathway proteins selected from Table
70, each protein-coding sequence codon-optimized for expression in
Thalassiosira pseudonana to reflect the codon bias inherent in
nuclear genes of Thalassiosira pseudonana in accordance with Tables
69A-D. For each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the Thalassiosira pseudonana fcp gene promoter upstream of the
protein-coding sequence and operably linked to the Thalassiosira
pseudonana fcp gene 3'UTR/terminator at the 3' region, or
downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Thalassiosira pseudonana genome for targeted genomic integration of
the transformation vector. Homology regions may be selected to
disrupt one or more genomic sites of endogenous lipid biosynthesis
pathway genes. One skilled in the art can identify such homology
regions within the sequence of the Thalassiosira pseudonana genome
(referenced in the publication by Armbrust et al., Science, Vol.
306: 5693 (2004): pp. 79-86). Stable transformation of
Thalassiosira pseudonana with the transformation vector is achieved
through well-known transformation techniques including
microprojectile bombardment or other known methods. Activity of the
nat gene product can be used as a marker to select for
Thalassiosira pseudonana transformed with the transformation vector
in but not limited to, ESAW agar medium comprising nourseothricin.
Growth media suitable for Thalassiosira pseudonana lipid production
include, but are not limited to, ESAW medium, and those culture
media discussed by Volkman et al. and Harrison et al. Evaluation of
fatty acid profiles of Thalassiosira pseudonana lipids can be
assessed through standard lipid extraction and analytical methods
described herein.
Example 41: Engineering Chlamydomonas reinhardtii
[0694] Expression of recombinant genes in accordance with the
present invention in Chlamydomonas reinhardtii can be accomplished
by modifying the methods and vectors taught by Cerutti et al. as
discussed herein. Briefly, Cerutti et al., Genetics, Vol. 145:1
(1997), pp. 97-110, reported the stable nuclear transformation of
Chlamydomonas reinhardtii with a transformation vector. Using the
transformation method of microprojectile bombardment, Cerutti
introduced transformation construct P[1030] into Chlamydomonas
reinhardtii. Construct P[1030] comprised a spectinomycin resistance
cassette, comprising sequence encoding the aminoglucoside
3''-adenyltransferase (aadA) gene product operably linked to the
Chlamydomonas reinhardtii ribulose-1,5-bisphosphate
carboxylase/oxygenase small subunit gene (RbcS2, GenBank Accession
No. X04472) promoter upstream of the aadA protein-coding region and
operably linked to the Chlamydomonas reinhardtii RbcS2 gene 3'
UTR/terminator at the 3' region (downstream of the aadA protein
coding-sequence). The aadA gene product confers resistance to the
antibiotic spectinomycin. Prior to transformation with P[1030],
Chlamydomonas reinhardtii was unable to propagate on medium
comprising 90 ug/ml spectinomycin. Upon transformation with
P[1030], transformants of Chlamydomonas reinhardtii were obtained
that were propagated in selective culture medium comprising 90
ug/ml spectinomycin, thereby establishing the utility of the
spectinomycin antibiotic resistance cassette as a selectable marker
for use in Chlamydomonas reinhardtii. Evaluation of the genomic DNA
of the stable transformants was performed by Southern analysis.
Cerutti reported that selection and maintenance of the transformed
Chlamydomonas reinhardtii was performed on agar plates comprising
Tris-acetate-phosphate medium (TAP, as described by Harris, The
Chlamydomonas Sourcebook, Academic Press, San Diego, 1989) with 90
ug/ml spectinomycin. Cerutti additionally reported propagation of
Chlamydomonas reinhardtii in TAP liquid culture with 90 ug/ml
spectinomycin. Propagation of Chlamydomonas reinhardtii in
alternative culture medium has been discussed (for example in Dent
et al., African Journal of Microbiology Research, Vol. 5:3 (2011),
pp. 260-270 and Yantao et al., Biotechnology and Bioengineering,
Vol. 107:2 (2010), pp. 258-268). Additional constructs, comprising
additional selectable markers suitable for use in Chlamydomonas
reinhardtii as well as numerous regulatory sequences, including
promoters and 3' UTRs suitable for promoting heterologous gene
expression in Chlamydomonas reinhardtii are known in the art and
have been discussed (for a review, see Radakovits et al.,
Eurkaryotic Cell, Vol. 9:4 (2010), pp. 486-501). Cerutti reported
that the transformation vector P[1030] and the Chlamydomonas
reinhardtii promoter and 3' UTR/terminator are suitable to enable
exogenous gene expression in Chlamydomonas reinhardtii. In
addition, Cerutti reported that the spectinomycin resistance
cassette encoded on P[1030] was suitable for use as a selectable
marker in Chlamydomonas reinhardtii.
[0695] In an embodiment of the present invention, vector P[1030],
comprising the nucleotide sequence encoding the aadA gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Chlamydomonas reinhardtii to reflect the codon bias inherent in
nuclear genes of Chlamydomonas reinhardtii in accordance with
Tables 69A-D. For each lipid biosynthesis pathway protein of Table
70, the codon-optimized gene sequence can individually be operably
linked to the Chlamydomonas reinhardtii RbcS2 promoter upstream of
the protein-coding sequence and operably linked to the
Chlamydomonas reinhardtii RbcS2 3'UTR/terminator at the 3' region,
or downstream, of the protein-coding sequence. The transformation
construct may additionally comprise homology regions to the
Chlamydomonas reinhardtii genome for targeted genomic integration
of the transformation vector. Homology regions may be selected to
disrupt one or more genomic site of an endogenous lipid
biosynthesis pathway gene. One skilled in the art can identify such
homology regions within the sequence of the Chlamydomonas
reinhardtii genome (referenced in the publication by Merchant et
al., Science, Vol. 318:5848 (2007), pp. 245-250). Stable
transformation of Chlamydomonas reinhardtii with the transformation
vector is achieved through well-known transformation techniques
including microprojectile bombardment or other known methods.
Activity of the aadA gene product can be used as a marker to select
for Chlamydomonas reinhardtii transformed with the transformation
vector on, but not limited to, TAP agar medium comprising
spectinomycin. Growth media suitable for Chlamydomonas reinhardtii
lipid production include, but are not limited to, ESAW medium, and
those culture media discussed by Yantao et al. and Dent et al.
Evaluation of fatty acid profiles of Chlamydomonas reinhardtii
lipids can be assessed through standard lipid extraction and
analytical methods described herein.
Example 42: Engineering Yarrowia lipolytica
[0696] Expression of recombinant genes in accordance with the
present invention in Yarrowia lipolytica can be accomplished by
modifying the methods and vectors taught by Fickers et al. as
discussed herein. Briefly, Fickers et al., Journal of
Microbiological Methods, Vol. 55 (2003), pp. 727-737, reported the
stable nuclear transformation of Yarrowia lipolytica with plasmid
DNA. Using a lithium acetate transformation method, Fickers
introduced the plasmid JMP123 into Yarrowia lipolytica. Plasmid
JMP123 comprised a hygromycin B resistance cassette, comprising
sequence encoding the hygromycin B phosphotransferase gene product
(hph), operably-linked to the Yarrowia lipolytica LIP2 gene
promoter (GenBank Accession No. AJ012632) upstream of the hph
protein-coding region and operably linked to the Yarrowia
lipolytica LIP2 gene 3'UTR/terminator downstream of the hph
protein-coding region. Prior to transformation with JMP123,
Yarrowia lipolytica were unable to propagate on medium comprising
100 ug/ml hygromycin. Upon transformation with JMP123, transformed
Yarrowia lipolytica were obtained that were able to propagate on
medium comprising 100 ug/ml hygromycin, thereby establishing the
hygromycin B antibiotic resistance cassette as a selectable marker
for use in Yarrowia lipolytica. The nucleotide sequence provided on
JMP123 of the promoter and 3'UTR/terminator of the Yarrowia
lipolytica LIP2 gene served as donor sequences for homologous
recombination of the hph coding sequence into the LIP2 locus.
Evaluation of the genomic DNA of the stable transformants was
performed by Southern. Fickers reported that selection and
maintenance of the transformed Yarrowia lipolytica was performed on
agar plates comprising standard YPD medium (Yeast Extract Peptone
Dextrose) with 100 ug/ml hygromycin. Liquid culturing of
transformed Yarrowia lipolytica was performed in YPD medium with
hygromycin. Other media and techniques used for culturing Yarrowia
lipolytica have been reported and numerous other plasmids,
promoters, 3' UTRs, and selectable markers for use in Yarrowia
lipolytica have been reported (for example see Pignede et al.,
Applied and Environmental Biology, Vol. 66:8 (2000), pp. 3283-3289,
Chuang et al., New Biotechnology, Vol. 27:4 (2010), pp. 277-282,
and Barth and Gaillardin, (1996), In: K,W. (Ed.), Nonconventional
Yeasts in Biotechnology. Sprinter-Verlag, Berlin-Heidelber, pp.
313-388). Fickers reported that the transformation vector JMP123
and the Yarrowia lipolytica LIP2 gene promoter and 3'
UTR/terminator are suitable to enable heterologous gene expression
in Yarrowia lipolytica. In addition, Fickers reported that the
hygromycin resistance cassette encoded on JMP123 was suitable for
use as a selectable marker in Yarrowia lipolytica.
[0697] In an embodiment of the present invention, vector JMP123,
comprising the nucleotide sequence encoding the hph gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in Yarrowia
lipolytica to reflect the codon bias inherent in nuclear genes of
Yarrowia lipolytica in accordance with Tables 69A-D. For each lipid
biosynthesis pathway protein of Table 70, the codon-optimized gene
sequence can individually be operably linked to the Yarrowia
lipolytica LIP2 gene promoter upstream of the protein-coding
sequence and operably linked to the Yarrowia lipolytica LIP2 gene
3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Yarrowia lipolytica
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes. One
skilled in the art can identify such homology regions within the
sequence of the Yarrowia lipolytica genome (referenced in the
publication by Dujun et al., Nature, Vol. 430 (2004), pp. 35-44).
Stable transformation of Yarrowia lipolytica with the
transformation vector is achieved through well-known transformation
techniques including lithium acetate transformation or other known
methods. Activity of the hph gene product can be used as a marker
to select for Yarrowia lipolytica transformed with the
transformation vector on, but not limited to, YPD medium comprising
hygromycin. Growth media suitable for Yarrowia lipolytica lipid
production include, but are not limited to, YPD medium, and those
culture media described by Chuang et al. Evaluation of fatty acid
profiles of Yarrowia lipolytica lipids can be assessed through
standard lipid extraction and analytical methods described
herein.
Example 43: Engineering Mortierella alpine
[0698] Expression of recombinant genes in accordance with the
present invention in Mortierella alpine can be accomplished by
modifying the methods and vectors taught by Mackenzie et al. as
discussed herein. Briefly, Mackenzie et al., Applied and
Environmental Microbiology, Vol. 66 (2000), pp. 4655-4661, reported
the stable nuclear transformation of Mortierella alpina with
plasmid DNA. Using a protoplast transformation method, MacKenzie
introduced the plasmid pD4 into Mortierella alpina. Plasmid pD4
comprised a hygromycin B resistance cassette, comprising sequence
encoding the hygromycin B phosphotransferase gene product (hpt),
operably-linked to the Mortierella alpina histone H4.1 gene
promoter (GenBank Accession No. AJ249812) upstream of the hpt
protein-coding region and operably linked to the Aspergillus
nidulans N-(5'-phophoribosyl)anthranilate isomerase (trpC) gene
3'UTR/terminator downstream of the hpt protein-coding region. Prior
to transformation with pD4, Mortierella alpina were unable to
propagate on medium comprising 300 ug/ml hygromycin. Upon
transformation with pD4, transformed Mortierella alpina were
obtained that were propagated on medium comprising 300 ug/ml
hygromycin, thereby establishing the hygromycin B antibiotic
resistance cassette as a selectable marker for use in Mortierella
alpina. Evaluation of the genomic DNA of the stable transformants
was performed by Southern. Mackenzie reported that selection and
maintenance of the transformed Mortierella alpina was performed on
PDA (potato dextrose agar) medium comprising hygromycin. Liquid
culturing of transformed Mortierella alpina by Mackenzie was
performed in PDA medium or in S2GYE medium (comprising 5% glucose,
0.5% yeast extract, 0.18% NH.sub.4SO.sub.4, 0.02%
MgSO.sub.4-7H.sub.2O, 0.0001% FeCl.sub.3-6H.sub.2O, 0.1%, trace
elements, 10 mM K.sub.2HPO.sub.4--NaH.sub.2PO.sub.4), with
hygromycin. Other media and techniques used for culturing
Mortierella alpina have been reported and other plasmids,
promoters, 3' UTRs, and selectable markers for use in Mortierella
alpina have been reported (for example see Ando et al., Applied and
Environmental Biology, Vol. 75:17 (2009) pp. 5529-35 and Lu et al.,
Applied Biochemistry and Biotechnology, Vol. 164:7 (2001), pp.
979-90). Mackenzie reported that the transformation vector pD4 and
the Mortierella alpina histone H4.1 promoter and A. nidulans trpC
gene 3' UTR/terminator are suitable to enable heterologous gene
expression in Mortierella alpina. In addition, Mackenzie reported
that the hygromycin resistance cassette encoded on pD4 was suitable
for use as a selectable marker in Mortierella alpina.
[0699] In an embodiment of the present invention, vector pD4,
comprising the nucleotide sequence encoding the hpt gene product
for use as a selectable marker, is constructed and modified to
further comprise a lipid biosynthesis pathway expression cassette
sequence, thereby creating a transformation vector. The lipid
biosynthesis pathway expression cassette encodes one or more lipid
biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Mortierella alpina to reflect the codon bias inherent in nuclear
genes of Mortierella alpina in accordance with Tables 69A-D. For
each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the Mortierella alpina histone H4.1 gene promoter upstream of
the protein-coding sequence and operably linked to the A. nidulans
trpC 3'UTR/terminator at the 3' region, or downstream, of the
protein-coding sequence. The transformation construct may
additionally comprise homology regions to the Mortierella alpina
genome for targeted genomic integration of the transformation
vector. Homology regions may be selected to disrupt one or more
genomic sites of endogenous lipid biosynthesis pathway genes. One
skilled in the art can identify such homology regions within the
sequence of the Mortierella alpina genome (referenced in the
publication by Wang et al., PLOS One, Vol. 6:12 (2011)). Stable
transformation of Mortierella alpina with the transformation vector
is achieved through well-known transformation techniques including
protoplast transformation or other known methods. Activity of the
hpt gene product can be used as a marker to select for Mortierella
alpina transformed with the transformation vector on, but not
limited to, PDA medium comprising hygromycin. Growth media suitable
for Mortierella alpina lipid production include, but are not
limited to, S2GYE medium, and those culture media described by Lu
et al. and Ando et al. Evaluation of fatty acid profiles of
Mortierella alpina lipids can be assessed through standard lipid
extraction and analytical methods described herein.
Example 44: Engineering Rhodococcus opacus PD630
[0700] Expression of recombinant genes in accordance with the
present invention in Rhodococcus opacus PD630 can be accomplished
by modifying the methods and vectors taught by Kalscheuer et al. as
discussed herein. Briefly, Kalscheuer et al., Applied and
Environmental Microbiology, Vol. 52 (1999), pp. 508-515, reported
the stable transformation of Rhodococcus opacus with plasmid DNA.
Using the transformation method of electroporation, Kalscheuer
introduced the plasmid pNC9501 into Rhodococcus opacus PD630.
Plasmid pNC9501 comprised a thiostrepton resistance (thior)
cassette, comprising the full nucleotide sequence of the
Streptomyces azureus 23S rRNA A1067 methyltransferase gene,
including the gene's promoter and 3' terminator sequence. Prior to
transformation with pNC9501, Rhodococcus opacus was unable to
propagate on medium comprising 1 mg/ml thiostrepton. Upon
transformation of Rhodococcus opacus PD630 with pNC9501,
transformants were obtained that propagated on culture medium
comprising 1 mg/ml thiostrepton, thereby establishing the use of
the thiostrepton resistance cassette as a selectable marker in
Rhodococcus opacus PD630. A second plasmid described by Kalscheuer,
pAK68, comprised the resistance thio.sup.r cassette as well as the
gene sequences of the Ralstonia eutropha beta-ketothiolase (phaB),
acetoacetyl-CoA reductase (phaA), and poly3-hydroxyalkanoic acid
synthase (phaC) genes for polyhydroxyalkanoate biosynthesis, driven
by the lacZ promoter. Upon pAK68 transformation of a Rhodococcus
opacus PD630 strain deficient in polyhydroxyalkanoate biosynthesis,
transformed Rhodococcus opacus PD630 were obtained that produced
higher amounts of polyhydroxyalkanoates than the untransformed
strain. Detectable activity of the introduced Ralstonia eutropha
phaB, phaA, and phaC enzymes indicted that the regulatory elements
encoded on the pAK68 plasmid were suitable for heterologous gene
expression in Rhodococcus opacus PD630. Kalscheuer reported that
selection and maintenance of the transformed Rhodococcus opacus
PD630 was performed on standard Luria Broth (LB) medium, nutrient
broth (NB), or mineral salts medium (MSM) comprising thiostrepton.
Other media and techniques used for culturing Rhodococcus opacus
PD630 have been described (for example see Kurosawa et al., Journal
of Biotechnology, Vol. 147:3-4 (2010), pp. 212-218 and Alverez et
al., Applied Microbial and Biotechnology, Vol. 54:2 (2000), pp.
218-223). Kalscheuer reported that the transformation vectors
pNC9501 and pAK68, the promoters of the Streptomyces azureus 23 S
rRNA A1067 methyltransferase gene and lacZ gene are suitable to
enable heterologous gene expression in Rhodococcus opacus PD630. In
addition, Kalscheuer reported that the thio.sup.r cassette encoded
on pNC9501 and pAK68 was suitable for use as a selectable marker in
Rhodococcus opacus PD630.
[0701] In an embodiment of the present invention, vector pNC9501,
comprising the nucleotide sequence encoding the thio.sup.r gene
product for use as a selectable marker, is constructed and modified
to further comprise a lipid biosynthesis pathway expression
cassette sequence, thereby creating a transformation vector. The
lipid biosynthesis pathway expression cassette encodes one or more
lipid biosynthesis pathway proteins selected from Table 70, each
protein-coding sequence codon-optimized for expression in
Rhodococcus opacus PD630 to reflect the codon bias inherent in
nuclear genes of Rhodococcus opacus in accordance with Tables
69A-D. For each lipid biosynthesis pathway protein of Table 70, the
codon-optimized gene sequence can individually be operably linked
to the lacZ gene promoter upstream of the protein-coding sequence.
The transformation construct may additionally comprise homology
regions to the Rhodococcus opacus PD630 genome for targeted genomic
integration of the transformation vector. Homology regions may be
selected to disrupt one or more genomic sites of endogenous lipid
biosynthesis pathway genes. One skilled in the art can identify
such homology regions within the sequence of the Rhodococcus opacus
PD630 genome (referenced in the publication by Holder et al., PLOS
Genetics, Vol. 7:9 (2011). Transformation of Rhodococcus opacus
PD630 with the transformation vector is achieved through well-known
transformation techniques including electoporation or other known
methods. Activity of the Streptomyces azureus 23 S rRNA A1067
methyltransferase gene product can be used as a marker to select
for Rhodococcus opacus PD630 transformed with the transformation
vector on, but not limited to, LB medium comprising thiostrepton.
Growth media suitable Rhodococcus opacus PD630 lipid production
include, but are not limited to those culture media discussed by
Kurosawa et al. and Alvarez et al. Evaluation of fatty acid
profiles of Rhodococcus opacus PD630 lipids can be assessed through
standard lipid extraction and analytical methods described
herein.
[0702] All references cited herein, including patents, patent
applications, and publications, including Genbank Accession
numbers, are hereby incorporated by reference in their entireties,
whether previously specifically incorporated or not. The
publications mentioned herein are cited for the purpose of
describing and disclosing reagents, methodologies and concepts that
may be used in connection with the present invention. Nothing
herein is to be construed as an admission that these references are
prior art in relation to the inventions described herein. In
particular, the following patent applications are hereby
incorporated by reference in their entireties for all purposes: PCT
Application No. PCT/US2008/065563, filed Jun. 2, 2008, entitled
"Production of Oil in Microorganisms", PCT Application No.
PCT/US2010/31108, filed Apr. 14, 2010, entitled "Methods of
Microbial Oil Extraction and Separation", and PCT Application No.
PCT/US2009/066142, filed Nov. 30, 2009, entitled "Production of
Tailored Oils in Heterotrophic Microorganisms".
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20190100780A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20190100780A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References