U.S. patent application number 16/148604 was filed with the patent office on 2019-04-04 for methods and compositions for deuterated biologics.
The applicant listed for this patent is Bristol-Myers Squibb Company. Invention is credited to Harold J. Malone, Paul E. Morin, Michael J. Smith, Haiying Tang.
Application Number | 20190099506 16/148604 |
Document ID | / |
Family ID | 65896009 |
Filed Date | 2019-04-04 |
![](/patent/app/20190099506/US20190099506A1-20190404-C00001.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00002.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00003.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00004.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00005.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00006.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00007.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00008.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00009.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00010.png)
![](/patent/app/20190099506/US20190099506A1-20190404-C00011.png)
View All Diagrams
United States Patent
Application |
20190099506 |
Kind Code |
A1 |
Smith; Michael J. ; et
al. |
April 4, 2019 |
METHODS AND COMPOSITIONS FOR DEUTERATED BIOLOGICS
Abstract
Deuterated polymer-biomolecule conjugates and the synthesis and
use of deuterated polymer-biomolecule conjugates for detecting the
location of specific molecules, e.g., cell surface molecules, in a
subject, and for imaging various processes within the body, for
detecting the location of molecules associated with disease
pathology, and for monitoring disease progression are
disclosed.
Inventors: |
Smith; Michael J.;
(Somerset, NJ) ; Tang; Haiying; (Morganville,
NJ) ; Morin; Paul E.; (Pennington, NJ) ;
Malone; Harold J.; (Spring Lake, NJ) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Bristol-Myers Squibb Company |
Princeton |
NJ |
US |
|
|
Family ID: |
65896009 |
Appl. No.: |
16/148604 |
Filed: |
October 1, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62566924 |
Oct 2, 2017 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 47/6851 20170801;
A61K 49/1857 20130101; A61K 49/126 20130101 |
International
Class: |
A61K 49/18 20060101
A61K049/18; A61K 47/68 20060101 A61K047/68 |
Claims
1. A conjugate comprising a deuterated polymer (D-polymer) and a
biomolecule, wherein the D-polymer can be detected by MRI upon
administration of the conjugate to a subject.
2. The conjugate of claim 1, wherein the average molecular weight
(Mn) of the D-polymer is between 1 kDa and 100 kDa.
3. The conjugate of claim 2, wherein the D-polymer comprises
deuterated polyethylene glycol (D-PEG).
4. The conjugate of claim 3, wherein the D-PEG has the formula
[O(CR.sub.2).sub.2].sub.n, wherein R is deuterium (D) or hydrogen
(H), and n is an integer from 10 to 2500.
5. The conjugate of claim 4, wherein the D-PEG has an OH, SH, or
NH.sub.2 group.
6. The conjugate of claim 5, wherein the D-PEG is selected from the
group consisting of: HO--(CD.sub.2CD.sub.2O).sub.n--H (Mn 2.7);
HO--(CD.sub.2CD.sub.2O).sub.n--H (Mn 3.5);
HO--(CD.sub.2CD.sub.2O).sub.n--H (Mn 4.8);
CD.sub.3CD.sub.2O--(CD.sub.2CD.sub.2O).sub.n--H (Mn 2.7);
CH.sub.3O--(CD.sub.2CD.sub.2O).sub.n--H (Mn 2.2);
CH.sub.3O--(CD.sub.2CD.sub.2O).sub.n--H (Mn 5);
CD.sub.3O--(CD.sub.2CD.sub.2O).sub.nCD.sub.2CD.sub.2NH.sub.2 (Mn
5); CH.sub.3O--(CD.sub.2CD.sub.2O).sub.nCD.sub.2CD.sub.2SH (Mn 2);
and CH.sub.3CH.sub.2O--(CD.sub.2CD.sub.2).sub.n-H.
7. The conjugate of claim 1, wherein between about 50% and 100% of
the hydrogen atoms in the D-polymer are deuterium.
8. The conjugate of claim 1, wherein the biomolecule is or
comprises a targeting moiety TM.
9. The conjugate of claim 8, wherein the TM is a ligand, an
antibody or antibody fragment, or a fibronectin based scaffold
(FBS).
10. The conjugate of claim 9, wherein TM is an antibody or antibody
fragment.
11. The conjugate of claim 8, wherein TM binds to a biological
disease associated with a disease selected from the group
consisting of solid cancers, hematopoietic cancers, hematological
cancers, autoimmune disease, neurodegenerative disease,
cardiovascular disease and pathogenic infections.
12. The conjugate of claim 11, wherein TM binds to a
tumor-associated antigen.
13. The conjugate of claim 12, wherein the tumor associated antigen
is an immune-oncology related biomarker.
14. A method of obtaining an image of a D-polymer-biomolecule
conjugate of according to claim 1 in a subject, the method
comprising, (a) administering the D-polymer-biomolecule conjugate
to the subject; and (b) imaging in vivo the distribution of the
D-polymer-biomolecule conjugate by magnetic resonance imaging
(MRI).
15. A method of diagnosing the presence of a disease in a subject,
the method comprising (a) administering to a subject in need
thereof a D-polymer-biomolecule according to claim 1, which
conjugate binds to a target molecule associated with the presence
of the disease; and (b) obtaining a magnetic resonance image of at
least a portion of the subject to detect the presence or absence of
the D-polymer-biomolecule conjugate; wherein the presence and
location of the D-polymer-biomolecule conjugate above background is
indicative of the presence and location of the disease.
16. The method of claim 15, wherein the disease is selected from
the group consisting of solid cancers, hematopoietic cancers,
hematological cancers, autoimmune disease, neurodegenerative
disease cardiovascular disease, and pathogenic infection.
17. A method of monitoring the progress of a disease in a subject,
the method comprising (a) administering to the subject a
D-polymer-biomolecule conjugate according to claim 1, which
conjugate binds to a target molecule associated with the presence
of the disease at a first time point and obtaining an image of at
least a portion of the subject to determine the amount of the
diseased cells or tissue; and (b) administering to the subject the
D-polymer-biomolecule conjugate at one or more subsequent time
points and obtaining an image of at least a portion of the subject
at each time point, wherein the dimension and location of the
diseased cells or tissue at each time point is indicative of the
progress of the disease.
18. The method of claim 17, wherein the disease is selected from
the group consisting of solid cancers, hematopoietic cancers,
hematological cancers, autoimmune disease, neurodegenerative
disease cardiovascular disease, and pathogenic infection.
19. A method of determining the distribution of a deuterated
molecule in a subject, the method comprising (a) orally
administering the deuterated molecule to the subject and (b)
imaging in vivo the distribution of the deuterated molecule by
magnetic resonance imaging (MRI).
20. A method according to claim 19, wherein the deuterated molecule
is D-PEG.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U.S.C. .sctn.
119(e) of U.S. Provisional Application Ser. No. 62/566,924, filed
Oct. 2, 2017; the disclosure of which is incorporated herein by
reference.
SEQUENCE LISTING
[0002] Incorporated herein by reference in its entirety is a
Sequence Listing named "180816_SEQT_12979USNP_YC.txt" comprising
SEQ ID NO:1 through SEQ ID NO:9, which include nucleic acid and/or
amino acid sequences disclosed herein. The Sequence Listing has
been submitted herewith in ASCII text format via EFS-Web, and thus
constitutes both the paper and computer readable form thereof. The
Sequence Listing was first created using PatentIn 3.5 on Aug. 16,
2018, and is approximately 9 KB in size.
FIELD
[0003] The invention relates to conjugates containing deuterated
polymers and a biomolecule that binds to a target, and the
synthesis and use of deuterated-polymer-biomolecule conjugates for
imaging various processes within the body, for detecting the
location of molecules, e.g., biomarkers, such as those associated
with disease pathology, and for monitoring disease progression.
BACKGROUND
[0004] There is a need for non-invasive, non-toxic and practical in
vivo imaging methodologies to detect molecules, such as molecules
that serve as biomarkers, in a subject. For example, there is a
need for methodologies to provide whole body imaging, e.g., for
detecting the location of PD-L1 positive cells in a subject having
cancer.
SUMMARY OF THE INVENTION
[0005] Provided herein are agents for use in diagnosis and imaging,
e.g., whole body imaging (imaging agents). The agents are molecules
comprising deuterium atoms, which molecules can be detected via
Nuclear Magnetic Resonance (NMR) and Magnetic Resonance Imaging
(MRI).
[0006] In one aspect, provided is a conjugate comprising a
deuterated polymer (D-polymer) linked to a biomolecule
("D-polymer-biomolecule conjugate"). For example, a
D-polymer-biomolecule conjugate may comprise a deuterated
polyethylene glycol moiety (D-PEG), linked to a biomolecule (e.g.,
protein). In certain embodiments, the deuterated
D-polymer-biomolecule conjugate is water soluble. In certain
embodiments, the deuterated D-polymer is water soluble.
[0007] Generally, the molecular weight of the D-polymer is such
that it is sufficient for being detected by MRI when it is
deuterium labeled, and is not significantly toxic when administered
to a subject, e.g., doses are chosen so that the conjugate
comprising the D-polymer does not form levels of vacuoles that are
physiologically unacceptable.
[0008] In some embodiments, the D-polymer in the conjugate
comprises deuterated polyethylene glycol (D-PEG) and/or deuterated
poly(propylene glycol) (D-PPG). In some embodiments, the D-polymer
in the conjugate has an average molecular weight of between about 2
and about 100 kDa, preferably between about 2 and about 50 kDa.
[0009] In some embodiments, the D-polymer in the conjugate is
deuterated polyethylene glycol (D-PEG), or a pharmaceutically
acceptable salt thereof. In some embodiments, the D-PEG comprises
[O(CR.sub.2).sub.2].sub.n, wherein R is deuterium (D) or hydrogen
(H), and n is an integer having a value that provides a molecular
weight of the D-PEG that is sufficient for being detected by MRI
when deuterium labeled, and that is not significantly toxic when
administered to a subject (e.g., it does not form levels of
vacuoles that are physiologically unacceptable). In certain
embodiments, n is an integer from about 10 to about 2500. In some
embodiments, n is an integer from about 20 to about 1000. In some
embodiments, n is an integer from about 30 to about 800. In one
embodiment, n is an integer from about 30 to about 600 or from
about 30 to about 150. In some embodiments, between about 50% and
100% of the R atoms in the D-PEG are deuterium. In some
embodiments, at least about 70% of the R atoms in the D-PEG are
deuterium. In some embodiments, at least about 90% of the R atoms
are deuterium.
[0010] In some embodiments, the biomolecule in the conjugate is a
peptide or protein. In some embodiments, the biomolecule in the
conjugate comprises an antibody or antibody fragment. In some
embodiments, the biomolecule in the conjugate comprises a
fibronectin based scaffold (FBS).
[0011] In related embodiments, the protein portion of the
D-polymer-biomolecule conjugate comprises a ligand which binds to a
biological molecule, e.g., a biological molecule associated with a
disease. In some embodiments, the disease is selected from the
group consisting of solid cancers, hematopoietic cancers,
hematological cancers, autoimmune disease, neurodegenerative
disease, cardiovascular disease and pathogenic infections. In
certain embodiments, the protein portion of the conjugate binds to
a tumor-associated antigen. In certain embodiments, the protein
portion of the conjugate binds to a protein present on a pathogenic
organism, e.g., a virus, bacterium or fungus.
[0012] In some embodiments, the D-polymer-biomolecule conjugate
comprises a D-polymer as described herein directly linked to
biomolecule (e.g., protein). In some embodiments, the
D-polymer-biomolecule conjugate comprises a D-polymer, a linker
moiety, and a protein.
[0013] In certain embodiments, the D-polymer-biomolecule conjugate
provided herein is in the form of a pharmaceutical composition.
[0014] Any known method for linking a polymer to a biomolecule may
be used to link a D-polymer to a biomolecule. In certain aspects,
provided are methods for preparing a deuterated-polymer-biomolecule
conjugate, the method comprising the steps of reacting a D-polymer
comprising a terminal amine with a biomolecule in the presence of
transglutaminase to form an amide bond between an amino group of
the D-polymer and a carboxamide group of a glutamine residue in the
targeting moiety.
[0015] In a related aspect, provided herein is a method of
obtaining an image of a D-polymer-biomolecule conjugate as provided
herein, the method including the steps of (a) administering the
D-polymer-biomolecule conjugate to a subject; and (b) imaging in
vivo the distribution of the D-polymer-biomolecule conjugate by
magnetic resonance imaging. In some embodiments, the imaged
distribution of the D-polymer-biomolecule conjugate is indicative
of the presence or absence of a biomarker or a disease. A biomarker
may be a marker whose presence or absence at specific location(s)
at specific times indicates whether a subject is responding or is
likely to respond to a given therapy, e.g., a cancer therapy. For
example, a biomarker may be PD-L1 or other immune-oncology related
biomarker, such as LAG-3, GITR, Ox-40, and TIGIT.
[0016] In a related aspect, there is provided a method of
determining the distribution of a deuterated molecule in a subject,
the method comprising (a) orally administering the deuterated
molecule to the subject and (b) imaging in vivo the distribution of
the deuterated molecule by magnetic resonance imaging (MRI). In a
preferred embodiment, the deuterated molecule is D-PEG.
[0017] In a related aspect, provided herein is a method of
diagnosing the presence of a disease in a subject, the method
including the steps of (a) administering to a subject in need
thereof a D-polymer-biomolecule conjugate as provided herein which
binds to a target molecule associated with the presence of the
disease; and (b) obtaining an image of at least a portion of the
subject to detect the presence or absence of the
D-polymer-biomolecule conjugate; wherein the presence and location
of the D-polymer-biomolecule conjugate above background is
indicative of the presence and location of the disease.
[0018] In a related aspect, provided herein is a method of
monitoring the progress of a disease in a subject, the method
including the steps of (a) administering to a subject in need
thereof a D-polymer-biomolecule conjugate as provided herein which
binds to a target molecule associated with the presence of the
disease at a first time point and obtaining an image of at least a
portion of the subject to determine the amount of the diseased
cells or tissue; and (b) administering to the subject the
D-polymer-biomolecule conjugate at one or more subsequent time
points and obtaining an image of at least a portion of the subject
at each time point; wherein the dimension and location of the
diseased cells or tissue at each time point is indicative of the
progress of the disease.
[0019] In a related aspect, provided herein is a method of
quantifying diseased cells or tissues or cells or tissues that are
positive for a given marker in a subject, the method including the
steps of (a) administering to a subject, e.g., a subject having
diseased cells or tissues, a D-polymer-biomolecule conjugate as
described herein which binds to a target molecule, e.g., a target
molecule that is located with the diseased cells or tissues; and
(b) detecting the amount of the D-polymer-biomolecule conjugate in
the subject, wherein the level and distribution of the
D-polymer-biomolecule conjugate in the subject or in the diseased
cells or tissues is a quantitative measure of the diseased cells or
tissues or given marker, respectively.
[0020] In a related aspect, provided herein is a method of
screening for an agent for treating a disease including the steps
of (a) contacting a cells expressing a target protein associated
with the disease with a D-polymer-biomolecule conjugate as provided
herein which binds to the target protein in the presence and
absence of a candidate agent; and (b) imaging the cells in the
presence and absence of the candidate agent using magnetic
resonance imaging (MRI), wherein a decrease in the amount of
D-polymer-biomolecule conjugate in the presence of the candidate
agent is indicative of that the agent binds to the target
protein.
[0021] In some embodiments of these methods, the disease is
selected from the group consisting of solid cancers, hematopoietic
cancers, hematological cancers, autoimmune disease,
neurodegenerative disease, cardiovascular disease and pathogenic
infection (e.g., viral, bacterial or fungal infections).
[0022] In some aspects, provided herein is a method of obtaining a
quantitative image of tissues or cells expressing a target protein,
the method including the steps of contacting the cells or tissue
with a D-polymer-biomolecule conjugate as provided herein which
binds to the target protein, and detecting or quantifying the
tissue expressing the target protein using magnetic resonance
imaging (MRI).
[0023] In some embodiments of the methods provided herein, the
biomolecule in the conjugate comprises a protein. In some
embodiments, the biomolecule is a ligand. In some embodiments, the
biomolecule comprises an antibody or antibody fragment. In some
embodiments, the biomolecule comprises a fibronectin based scaffold
(FBS). In some embodiments, the D-polymer-biomolecule conjugate
binds to a tumor-associated antigen or an immune-oncology
associated marker. In still other embodiments, the
D-polymer-biomolecule conjugate binds to a protein present on a
pathogenic organism (e.g., a virus, bacterium or fungus).
[0024] Also provided herein are kits containing the
D-polymer-biomolecule conjugate or reaction precursors for
producing the D-polymer-biomolecule conjugate provided herein and
instructions for using and/or producing the D-polymer-biomolecule
conjugate.
[0025] Other features and advantages of the instant disclosure will
be apparent from the following detailed description and examples,
which should not be construed as limiting.
BRIEF DESCRIPTION OF THE DRAWINGS
[0026] FIG. 1 is a schematic for a D-PEG-labeled protein conjugate
provided herein.
[0027] FIGS. 2A, 2B, and 2C relate to a phantom study for
correlating the sensitivity of an .sup.2H MRI coil for detecting
the .sup.2H signal.
[0028] FIG. 3 is a graph showing the correlation between D-PEG
concentration and signal intensity, from the study of FIGS.
2A-2C.
[0029] FIGS. 4, 5A, 5B, 6A and 6B are deuterium MRI images of the
passage and excretion of D-PEG administered to mice through their
gut.
DETAILED DESCRIPTION
[0030] Described herein are deuterium (D) labeled D-polymer (e.g.,
D-PEG) biomolecular conjugates, and the use of these conjugates as
imaging agents to visualize the location of given molecules in a
subject, such as for use as a prognostic, diagnostic or
predictability biomarker, e.g., to confirm a response to a
treatment or to predict the likelihood of response to a treatment,
or to diagnose, localize, monitor and/or assess diseased cells
and/or tissues, and related biological conditions. The methods may
use deuterium NMR spectroscopy and MRI to detect the
D-polymer-biomolecule conjugates.
Definitions
[0031] In order that the present description may be more readily
understood, certain terms are first defined. Additional definitions
are set forth throughout the detailed description. Unless defined
otherwise, all technical and scientific terms used herein have the
same meaning as commonly understood by one of ordinary skill in the
art, and conventional methods of mass spectroscopy, NMR, MRI, HPLC,
protein chemistry, biochemistry, recombinant DNA techniques and
pharmacology are employed.
[0032] As used herein, the singular forms "a", "an" and "the"
include plural referents unless the context clearly dictates
otherwise. The use of "or" or "and" means "and/or" unless stated
otherwise. Furthermore, use of the term "including" as well as
other forms, such as "include", "includes", and "included", is not
limiting.
[0033] As used herein, "about" means within plus or minus ten
percent of a number. For example, "about 100" would refer to any
number between 90 and 110.
[0034] The term "prosthetic group" refers to an organic molecule
containing a detectable moiety that is capable of being linked to
peptides or proteins.
[0035] As used herein, "target" as a general reference to a
"biological target" refers to anything that can be targeted, e.g.,
a cell, tissue (e.g., cancer or tumor), a pathogenic microorganism
(e.g., bacteria, virus, fungus, plant, prion, protozoa or portion
thereof) or molecule thereon or molecule associated with a
biological pathway, or a biological phenomenon, such as tissue
inflammation, plaque formation, etc.
[0036] The term "targeting ligand", "targeting agent" or "targeting
molecule" are used interchangeably to refer to a molecule, such as
peptide, protein, glycoprotein, etc., that binds to another
molecule. In certain embodiments, a targeting agent is bound to
D-polymer in order to "target" a molecule associated with a
particular cell, tissue, pathogen or biological pathway.
[0037] "Polypeptide" as used herein refers to any sequence of two
or more amino acids, regardless of length, post-translation
modification, or function. "Polypeptide," "peptide," and "protein"
are used interchangeably herein. Polypeptides can include natural
amino acids and non-natural amino acids such as those described in
U.S. Pat. No. 6,559,126, incorporated herein by reference.
Polypeptides can also be modified in any of a variety of standard
chemical ways (e.g., an amino acid can be modified with a
protecting group; the carboxy-terminal amino acid can be made into
a terminal amide group; the amino-terminal residue can be modified
with groups to, e.g., enhance lipophilicity; or the polypeptide can
be chemically glycosylated or otherwise modified to increase
stability or in vivo half-life). Polypeptide modifications can
include the attachment of another structure such as a cyclic
compound or other molecule to the polypeptide and can also include
polypeptides that contain one or more amino acids in an altered
configuration (i.e., R or S; or, L or D).
[0038] An "isolated" polypeptide is one that has been identified
and separated and/or recovered from a component of its natural
environment. Contaminant components of its natural environment are
materials that would interfere with diagnostic or therapeutic uses
for the polypeptide, and may include enzymes, hormones, and other
proteinaceous or nonproteinaceous solutes. In certain embodiments,
polypeptides are purified (1) to greater than 95% by weight of
polypeptide as determined by the Lowry method, or more than 99% by
weight, (2) to a degree sufficient to obtain at least residues of
N-terminal or internal amino acid sequence by use of a spinning cup
sequenator, or (3) to homogeneity by SDS-PAGE under reducing or
non-reducing condition using Coomassie blue or, preferably, silver
stain. Isolated polypeptide includes the polypeptide in situ within
recombinant cells since at least one component of the polypeptide's
natural environment will not be present. Ordinarily, however,
isolated polypeptide will be prepared by at least one purification
step.
[0039] As used herein, a ".sup.10Fn3 domain" or ".sup.10Fn3 moiety"
or ".sup.10Fn3 molecule" refers to wild-type .sup.10Fn3 and
biologically active variants thereof, e.g., biologically active
variants that specifically bind to a target, such as a target
protein. A wild-type human .sup.10Fn3 domain may comprise the amino
acid sequence set forth in SEQ ID NO: 1. Biologically active
variants of a wild-type human .sup.10Fn3 domain include .sup.10Fn3
domains that comprise at least, at most or about 1, 2, 3, 4, 5, 6,
7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
24, 25, 30, 35, 40 or 45 amino acid changes, i.e., substitutions,
additions or deletions, relative to a .sup.10Fn3 domain comprising
SEQ ID NOs: 1.
[0040] An "Adnectin" or "Adx" or "adnectin" or "adx" refers to a
human .sup.10Fn3 molecule that has been modified (relative to the
wild-type sequence) to bind specifically to a target.
[0041] A "region" of a .sup.10Fn3 domain (or moiety or molecule) as
used herein refers to either a loop (AB, BC, CD, DE, EF and FG), a
.beta.-strand (A, B, C, D, E, F and G), the N-terminus
(corresponding to amino acid residues 1-7 of SEQ ID NO: 1), or the
C-terminus (corresponding to amino acid residues 93-94 of SEQ ID
NO: 1).
[0042] A "scaffold region" refers to any non-loop region of a human
.sup.10Fn3 domain. The scaffold region includes the A, B, C, D, E,
F and G .beta.-strands as well as the N-terminal region (amino
acids corresponding to residues 1-7 of SEQ ID NO: 1) and the
C-terminal region (amino acids corresponding to residues 93-94 of
SEQ ID NO: 1).
[0043] The terms "specifically binds," "specific binding,"
"selective binding, and "selectively binds," as used
interchangeably herein refers to an peptide or polypeptide that
exhibits affinity for a biological target, but does not
significantly bind (e.g., less than about 10% binding) to a other
molecules as measured by a technique available in the art such as,
but not limited to, Scatchard analysis and/or competitive binding
assays (e.g., competition ELISA, BIACORE assay).
[0044] The term "preferentially binds" as used herein refers to the
situation in which an peptide or protein binds a selected
biological target at least about 20% greater than it binds a
different biological target as measured by a technique available in
the art such as, but not limited to, Scatchard analysis and/or
competitive binding assays (e.g., competition ELISA, BIACORE
assay).
[0045] The term "K.sub.D," as used herein, is intended to refer to
the dissociation equilibrium constant of an interaction between two
molecules (e.g., D-polymer-biomolecule conjugate and target
molecule) or the affinity of a D-polymer-polymer conjugate for a
target molecule (e.g., a protein), as measured using a surface
plasmon resonance assay or a cell binding assay. A "desired
K.sub.D," as used herein, refers to a K.sub.D of a
D-polymer-biomolecule conjugate that is sufficient for the purposes
contemplated. For example, a desired K.sub.D may refer to the
K.sub.D of a D-polymer-biomolecule conjugate required to elicit a
functional effect in an in vivo imaging assay or in vitro assay,
e.g., NMR or MRI.
[0046] The term "k.sub.ass" or "k.sub.a", as used herein, is
intended to refer to the association rate constant of two
molecules, e.g., a D-polymer-biomolecule conjugate and its
target.
[0047] The term "k.sub.diss" or "k.sub.d" used herein, is intended
to refer to the dissociation rate constant for the dissociation of
two molecules, e.g., a D-polymer-biomolecule conjugate and its
target.
[0048] The term "IC.sub.50", as used herein, refers to the
concentration of a molecule, e.g., a D-polymer-biomolecule
conjugate, that inhibits a response, either in an in vitro or an in
vivo assay, to a level that is 50% of the maximal inhibitory
response, i.e., halfway between the maximal inhibitory response and
the untreated response.
[0049] The term "PK" is an acronym for "pharmacokinetic" and
encompasses properties of a compound including, by way of example,
absorption, distribution, metabolism, and elimination by a subject.
A "PK modulation protein" or "PK moiety" as used herein refers to
any protein, peptide, or moiety that affects the pharmacokinetic
properties of a biologically active molecule when fused to or
administered together with the biologically active molecule.
Examples of a PK modulation protein or PK moiety include PEG, human
serum albumin (HSA) binders (as disclosed in U.S. Publication Nos.
2005/0287153 and 2007/0003549, PCT Publication Nos. WO 2009/083804
and WO 2009/133208), human serum albumin and variants thereof,
transferrin and variants thereof, Fc or Fc fragments and variants
thereof, and sugars (e.g., sialic acid).
[0050] The "serum half-life" of a protein or compound can generally
be defined as the time taken for the serum concentration of the
polypeptide to be reduced by 50%, in vivo, for example due to
degradation of the sequence or compound and/or clearance or
sequestration of the sequence or compound by natural mechanisms.
The half-life can be determined in any manner known per se, such as
by pharmacokinetic analysis. Suitable techniques will be clear to
the person skilled in the art, and may for example generally
involve the steps of suitably administering to a subject a suitable
dose of the amino acid sequence or compound described herein;
collecting blood samples or other samples from the subject at
regular intervals; determining the level or concentration of the
amino acid sequence or compound described herein in said blood
sample; and calculating, from (a plot of) the data thus obtained,
the time until the level or concentration of the amino acid
sequence or compound described herein has been reduced by 50%
compared to the initial level upon dosing. Reference is, for
example, made to the standard handbooks, such as Kenneth, A. et
al., Chemical Stability of Pharmaceuticals: A Handbook for
Pharmacists and in Peters et al., Pharmacokinetic Analysis: A
Practical Approach (1996). Reference is also made to Gibaldi, M. et
al., Pharmacokinetics, 2nd Rev. Edition, Marcel Dekker (1982).
[0051] Half-life can be expressed using parameters such as the
t.sub.1/2-alpha, t.sub.1/2-beta, HL_Lambda_z, and the area under
the curve (AUC). In the present specification, an "increase in
half-life" refers to an increase in any one of these parameters,
any two of these parameters, any three of these parameters or all
four of these parameters. An "increase in half-life" in particular
refers to an increase in the t.sub.1/2-beta, and/or HL Lambda z,
either with or without an increase in the t.sub.1/2-alpha and/or
the AUC or both.
[0052] As used herein, the term "linked" refers to the association
of two or more molecules. The linkage can be covalent or
non-covalent. The linkage also can be genetic (i.e., recombinantly
fused). Such linkages can be achieved using a wide variety of art
recognized techniques, such as chemical conjugation and recombinant
protein production.
[0053] The terms "diagnosis" or "detection" can be used
interchangeably. Whereas diagnosis usually refers to defining a
tissue's specific histological status, detection recognizes and
locates a tissue, lesion or organism containing a particular
detectable target.
[0054] The term "detectable" refers to the ability to detect a
signal over the background signal. The term "detectable signal" as
used herein in the context of imaging agents and diagnostics, is a
signal derived from non-invasive imaging techniques such as, but
not limited to, magnetic resonance imaging (MRI). The detectable
signal is detectable and distinguishable from other background
signals that may be generated from the subject. In other words,
there is a measurable and statistically significant difference
(e.g., a statistically significant difference is enough of a
difference to distinguish among the detectable signal and the
background, such as about 0.1%, 1%, 3%, 5%, 10%, 15%, 20%, 25%,
30%, or 40% or more difference between the detectable signal and
the background) between the detectable signal and the background.
Standards and/or calibration curves can be used to determine the
relative intensity of the detectable signal and/or the
background.
[0055] A "detectably effective amount" of a composition comprising
an imaging agent described herein is defined as an amount
sufficient to yield an acceptable image using equipment that is
available for clinical use. A detectably effective amount of an
imaging agent provided herein may be administered in more than one
injection. The detectably effective amount can vary according to
factors such as the degree of susceptibility of the individual, the
age, sex, and weight of the individual, idiosyncratic responses of
the individual, and the like. Detectably effective amounts of
imaging compositions can also vary according to instrument and
methodologies used. Optimization of such factors is well within the
level of skill in the art. In certain embodiments, a
D-polymer-biomolecule conjugate, e.g., those described herein,
provides a differentiation factor (i.e., specific signal to
background signal) of 2 or more, e.g., 3, 4, 5 or more.
[0056] As used herein, "administering," as used in the context of
imaging agents refers to the physical introduction of a composition
comprising an imaging agent to a subject, using any of the various
methods and delivery systems known to those skilled in the art.
Preferred routes of administration for the imaging agents described
herein include intravenous, intraperitoneal, intramuscular,
subcutaneous, spinal or other parenteral routes of administration,
for example by injection or infusion. The phrase "parenteral
administration" as used herein means modes of administration other
than enteral and topical administration, usually by injection, and
includes, without limitation, intravenous, intraperitoneal,
intramuscular, intraarterial, intrathecal, intralymphatic,
intralesional, intracapsular, intraorbital, intracardiac,
intradermal, transtracheal, subcutaneous, subcuticular,
intraarticular, subcapsular, subarachnoid, intraspinal, epidural
and intrasternal injection and infusion, as well as in vivo
electroporation. Alternatively, an imaging agent described herein
can be administered via a non-parenteral route, such as a topical,
epidermal or mucosal route of administration, for example,
intranasally, orally, vaginally, rectally, sublingually or
topically. Administering can also be performed, for example, once,
a plurality of times, and/or over one or more extended periods.
Preferably, a D-polymer, conjugated or otherwise, is administered
intravenously, subcutaneously, or orally. More preferably, a
conjugated D-polymer is administered intravenously.
[0057] The terms "co-administration" or the like, as used herein,
are meant to encompass administration of the selected
pharmaceutical agents to a single patient, and are intended to
include regimens in which the agents are administered by the same
or different route of administration or at the same or different
time.
[0058] The terms "individual", "patient" and "subject" refer to any
human or non-human animal, e.g., one that receives a composition
comprising an imaging agent described herein.
[0059] As used herein, a labeled molecule is "purified" when the
labeled molecule is partially or wholly separated from unlabeled
molecules, so that the fraction of labeled molecules is enriched
compared to the starting mixture. A "purified" labeled molecule may
comprise a mixture of labeled and unlabeled molecules in almost any
ratio, including but not limited to about 5:95; 10:90; 15:85;
20:80; 25:75; 30:70; 40:60; 50:50; 60:40; 70:30; 75:25; 80:20;
85:15; 90:10; 95:5; 97:3; 98:2; 99:1 or 100:0.
[0060] Throughout the specification, groups and substituents
thereof may be chosen by one skilled in the field to provide stable
moieties and compounds and compounds useful as
pharmaceutically-acceptable compounds and/or intermediate compounds
useful in making pharmaceutically-acceptable compounds.
[0061] Various aspects described herein are described in further
detail in the following subsections.
I. D-Polymer
[0062] In one aspect, provided herein is a D-polymer for use in a
conjugation reaction. The D-polymer is soluble in an 100% aqueous
medium, and there is no need for an organic phase to link the
D-polymer to a peptide or protein molecule. This feature is
particularly advantageous as many biologics (e.g., peptides or
proteins) cannot withstand even small amounts of organic solvents,
which can cause degradation and aggregation issues.
[0063] Provided herein are conjugates comprising a polymer, such as
a water soluble polymer, that is labeled with deuterium (a
"deuterium-polymer" or "D-polymer"). The polymer in a
deuterium-polymer-biomolecule conjugate ("D-polymer-biomolecule
conjugate") may be any polymer that can be labeled with deuterium
and is detectable via MRI or other method for detecting deuterium,
e.g., in a subject. In some embodiments, the deuterium atoms in the
D-polymer are chemically equivalent, to, e.g., enhance sensitivity
of detection.
[0064] The polymer chain may be a natural or synthetic polymer
chain. In some embodiments, the polymer chain has a number average
molecular weight (Mn) ranging up to about 10,000 kg/mol, for
example from about 2-500 kg/mol, or from about 4-200 kg/mol. As
used herein, Mn values may be determined by size exclusion
chromatography coupled with a multi-angle laser light scattering
(MALLS) detector and a refractive index detector to provide
absolute molecular weights and size distributions.
[0065] Generally, the weight of the polymer will be such that it
contains sufficient hydrogen atoms that can be substituted with
deuterium, and is not significantly toxic to the subject to whom it
is administered for imaging (e.g., whole body imaging) purposes.
For example, the size of the polymer should not be such that the
D-polymer-biomolecule conjugate has a half-life that is undesirable
for the purpose (e.g., a half-life that is longer than 10 minutes,
30 minutes, 1 hour or a few hours). Also, preferably, the size or
amount of the D-polymer or conjugate should be such that it does
not creates an undesirable, e.g., toxic, level of vacuoles in the
subject.
[0066] In some embodiments, the D-polymer in the conjugate is
D-PEG. The term "PEG" is used broadly to encompass any polyethylene
glycol molecule, without regard to size or to modification at an
end of the PEG, and can be represented by the formula
X--O(CH.sub.2CH.sub.2O).sub.nH, where n is 10 or more, e.g., 20 to
2500 and X is H or a terminal modification, e.g., a C.sub.1-4
alkyl. PEG can contain further chemical groups which are necessary
for binding reactions, which result from the chemical synthesis of
the molecule; or which act as a spacer for optimal distance of
parts of the molecule. In addition, such a PEG can consist of one
or more PEG side-chains which are linked together. PEGs with more
than one PEG chain are called multiarmed or branched PEGs.
[0067] Exemplary weight-average molecular weights for D-PEG in the
conjugates provided herein include about 1,000 Daltons, about 2,000
Daltons, about 3,000 Daltons, about 4,000 Daltons, about 5,000
Daltons, about 6,000 Daltons, about 7,000 Daltons, about 8,000
Daltons, about 9,000 Daltons and about, 10,000 Daltons. In some
embodiments, the PEG in the conjugate is between about 1
(preferably 2) and about 100 kDa. In some embodiments, the PEG in
the conjugate is between about 2 and about 50 kDa. In some
embodiments, the PEG in the conjugate is about 10, about 20, about
30, about 40, about 50, about 60, about 70, about 80, about 90 or
about 100 kDa.
[0068] The D-PEG can be linear or branched. Branched versions of
D-PEG having a total molecular weight of any of the foregoing can
also be used. In some embodiments, the PEG has two branches. In
other embodiments, the PEG has four branches. In one embodiment,
the PEG is a bis-PEG (NOF Corporation, DE-200MA). In some
embodiments, the PEG in the conjugate is linear.
[0069] In some embodiments, the D-PEG polymer comprises
[O(CH.sub.2).sub.2].sub.n, or a pharmaceutically acceptable salt
thereof, wherein n is an integer from 10 to 2500. In some
embodiments, n is an integer from 20 to 1000. In some embodiments,
n is an integer from 30 to 800. In some embodiments, n is an
integer from 30-600 or from 30 to 150.
[0070] In some embodiments, the structure of the D-PEG is D-PEG-XH,
wherein X is O, S, or NH. In some embodiments, the D-PEG polymer is
a maleimide-terminated D-PEG
##STR00001##
where Y can be --(CH.sub.2).sub.2--, --C.sub.6H.sub.4--, or
--C.sub.6H.sub.10--CH.sub.2--.
[0071] In some embodiments, about 50% to 100% of the hydrogen
molecules in the corresponding un-deuterated PEG molecule are
replaced by deuterium. In some embodiments, at least about 50%, at
least about 60%, at least about 70%, at least about 80%, at least
about 85%, at least about 90%, at least about 95% or at least 98%
of the hydrogens of the corresponding un-deuterated PEG have been
replace by deuterium.
[0072] Suitable D-PEG molecules for use in the conjugates provided
herein are available from Polymer Source Inc., Dorval (Montreal),
Canada, in a variety of molecular weights (Mn) and having different
terminal functional groups (OH, SH, NH.sub.2) that can be used for
conjugation to a targeting moiety, including, but not limited to
HO--(CD.sub.2CD.sub.2O).sub.n--H (Product numbers P4837-dPEO, Mn
2.7; P4836-dPEO, Mn 3.5; and P4927-dPEO, Mn 4.8);
CD.sub.3CD.sub.2O--(CD.sub.2CD.sub.2O).sub.n--H (Product number
P3864A-dPEO, Mn 2.7); CH.sub.3O--(CD.sub.2CD.sub.2O).sub.n--H
(Product numbers P5381-dPEO-OCH.sub.3, Mn 2.2;
P11450-dPEO-OCH.sub.3, Mn 5);
CD.sub.3O--(CD.sub.2CD.sub.2O).sub.nCD.sub.2CD.sub.2NH.sub.2
(Product number P11448dPEG-OCH.sub.3NH.sub.2, Mn 5); and
CH.sub.3O--(CD.sub.2CD.sub.2O).sub.nCD.sub.2CD.sub.2SH (Product
number P5381A-dPEOOCH.sub.3SH, Mn 2) and
CH.sub.3CH.sub.2O(CD.sub.2CD.sub.2).sub.n-H.
[0073] Any method for linking a D-PEG molecule to a biomolecule may
be used, e.g., as described further herein. For example, one or
more D-PEG molecules may be attached at different positions on the
protein, and such attachment may be achieved by reaction with
amines, thiols or other suitable reactive groups. The amine moiety
may be, for example, a primary amine found at the N-terminus of a
polypeptide or an amine group present in an amino acid, such as
lysine or arginine. In some embodiments, the D-PEG moiety is
attached at a position on the polypeptide selected from the group
consisting of: a) the N-terminus; b) between the N-terminus and the
most N-terminal beta strand or beta-like strand; c) a loop
positioned on a face of the polypeptide opposite the target-binding
site; d) between the C-terminus and the most C-terminal beta strand
or beta-like strand; and e) at the C-terminus.
[0074] PEGylation of the biomolecule, e.g., protein, in the
conjugate may be achieved by site-directed PEGylation, wherein a
suitable reactive group is introduced into the protein to create a
site where PEGylation preferentially occurs. In some embodiments,
the protein is modified to introduce a cysteine residue at a
desired position, permitting site-directed PEGylation on the
cysteine. Mutations may be introduced into a protein coding
sequence to generate cysteine residues. This might be achieved, for
example, by mutating one or more amino acid residues to cysteine.
Preferred amino acids for mutating to a cysteine residue include
serine, threonine, alanine and other hydrophilic residues.
Preferably, the residue to be mutated to cysteine is a
surface-exposed residue. Algorithms are well-known in the art for
predicting surface accessibility of residues based on primary
sequence or a protein. Alternatively, surface residues may be
predicted by comparing the amino acid sequences of binding
polypeptides, given that the crystal structure of the framework,
based on which binding polypeptides are designed and evolved, has
been solved (see Himanen et al., Nature 2001; 414:933-8) and thus
the surface-exposed residues identified. PEGylation of cysteine
residues may be carried out using, for example, PEG-maleimide,
PEG-vinylsulfone, PEG-iodoacetamide, or PEG-orthopyridyl
disulfide.
[0075] The D-PEG is typically activated with a suitable activating
group appropriate for coupling to a desired site on the
polypeptide. PEGylation methods are well-known in the art and
further described in Zalipsky, S., et al., "Use of Functionalized
Poly(Ethylene Glycols) for Modification of Polypeptides" in
Polyethylene Glycol Chemistry: Biotechnical and Biomedical
Applications, J. M. Harris, Plenus Press, New York (1992), and in
Zalipsky (1995) Advanced Drug Reviews 16: 157-182.
II. Protein/Peptide Targeting Molecules
[0076] The D-polymer provided herein may be attached to virtually
any targeting molecule (TM), so long as it contains a derivatizable
group that may be modified without affecting the interaction
between the targeting molecule and the in vivo biological target
(e.g., protein, cell or tissue).
[0077] In some embodiments, the targeting molecule is a peptide or
protein, including, but not limited to, antibodies, antibody
fragments, fibronectin based molecules and ligands (e.g., hormones,
growth factors, cytokines, chemokines, interleukins and angiogenic
factors). In some embodiments, the targeting molecule will comprise
one or more binding sites for a target, e.g., a target associated
with a disease or condition, such as a tumor associated or
autoimmune antigen, or immune-oncology related target, or a protein
displayed by a pathogenic organism such as a virus, bacterium,
fungus or protozoan.
[0078] In some embodiments, the D-polymer labeled peptides or
protein may be selected to bind directly to a targeted cell,
tissue, pathogenic organism or other target for imaging and/or
detection. In other embodiments, D-polymer labeled protein or
peptide may be selected to bind directly or indirectly to the in
vivo target molecule. For example, a first protein or peptide may
administered to the subject, followed by a second polymer-labeled
molecule which binds to the first.
Peptides
[0079] Peptides having as few as two amino acid residues,
preferably two to ten residues, may be used and may also be coupled
to other moieties. The targetable construct may also comprise
unnatural amino acids, e.g., D-amino acids, in the backbone
structure to increase the stability of the peptide in vivo. In
alternative embodiments, other backbone structures such as those
constructed from non-natural amino acids or peptoids may be
used.
[0080] In some embodiments, peptides which may be used include
ligands, peptide vaccines, and epitopes. The peptides used as
targetable constructs are conveniently synthesized on an automated
peptide synthesizer using a solid-phase support and standard
techniques of repetitive orthogonal deprotection and coupling.
N-terminal residues may be acetylated to increase serum stability.
Such protecting groups will be known to the skilled artisan. See
Greene and Wuts Protective Groups in Organic Synthesis, 1999 (John
Wiley and Sons, N.Y.).
Antibodies
[0081] In certain embodiments, the targeting molecule used in the
radiotracer composition described herein is an antibody. The term
"antibody" as used to herein may include whole antibodies and any
antigen binding fragments (i.e., "antigen-binding portions") or
single chains thereof. By way of example "antibody" may refer to
both naturally occurring and non-naturally occurring antibodies;
monoclonal and polyclonal antibodies; chimeric and humanized
antibodies; human and nonhuman antibodies; bispecific antibodies;
wholly synthetic antibodies; dAbs and single chain antibodies and
antigen binding fragments thereof.
[0082] The targeting molecules described herein may incorporate any
antibody or fragment known in the art that has binding specificity
for a target antigen associated with a disease state or condition.
Antibodies useful as targeting molecules may be commercially
obtained from a wide variety of sources (e.g., ATTC, Manassas,
Va.), and/or have published variable region sequences which may be
produced according to art recognized recombinant techniques. In
some embodiments, exemplary antibodies for use in the present
methods include an anti-CTLA-4 antibody, an anti-PD-1 antibody, an
anti-PDL-1 antibody, an anti-OX40 (also known as CD134, TNFRSF4,
ACT35 and/or TXGP1L) antibody, or an anti-LAG-3 antibody.
[0083] Antibodies used in the compositions and methods described
herein can be produced using a variety of known techniques.
Immunization protocols and techniques for isolation of immunized
splenocytes are well established in the art. The production of
monoclonal antibodies using the standard somatic cell hybridization
technique described by Kohler and Milstein, Nature 256: 495 (1975),
as well as viral or oncogenic transformation of B lymphocytes,
phage display technique using libraries of human antibody genes are
also routine. In addition, standard methodologies for the
production of chimeric and humanized antibodies are readily
available (see e.g., U.S. Pat. No. 4,816,567 to Cabilly et al.;
U.S. Pat. No. 5,225,539 to Winter, and U.S. Pat. Nos. 5,530,101;
5,585,089; 5,693,762 and 6,180,370 to Queen et al.).
[0084] In certain embodiments, the targeting molecule used in the
conjugate is an antigen binding fragment. As used herein, the term
"antigen-binding portion" of an antibody refers to one or more
fragments of an antibody that retain the ability to specifically
bind to an antigen. Examples of binding fragments encompassed
within the term "antigen-binding portion" of an antibody include
(i) a Fab fragment, a monovalent fragment consisting of the
V.sub.L, V.sub.H, CL and CH1 domains; (ii) a F(ab').sub.2 fragment,
a bivalent fragment comprising two Fab fragments linked by a
disulfide bridge at the hinge region; (iii) a Fd fragment
consisting of the V.sub.H and CH1 domains; (iv) a Fv fragment
consisting of the V.sub.L and V.sub.H domains of a single arm of an
antibody, (v) a dAb fragment (Ward et al., (1989) Nature
341:544-546), which consists of a V.sub.H domain; and (vi) an
isolated complementarity determining region (CDR) or (vii) a
combination of two or more isolated CDRs which may optionally be
joined by a synthetic linker. Furthermore, although the two domains
of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate
genes, they can be joined, using recombinant methods, by a
synthetic linker that enables them to be made as a single protein
chain in which the V.sub.L and V.sub.H regions pair to form
monovalent molecules known as single chain Fv (scFv); see e.g.,
Bird et al. (1988) Science 242:423-426; and Huston et al. (1988)
Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain
antibodies are also intended to be encompassed within the term
"antigen-binding portion" of an antibody. These and other potential
constructs are described at Chan & Carter (2010) Nat. Rev.
Immunol. 10:301. These antibody fragments are obtained using
conventional techniques known to those with skill in the art, and
the fragments are screened for utility in the same manner as are
intact antibodies. Antigen-binding portions can be produced by
recombinant DNA techniques, or by enzymatic or chemical cleavage of
intact immunoglobulins.
[0085] In certain embodiments, the antibody used is modified to
modulate, e.g., decrease the half-life of the antibody or rapid
clearance for use in the medical imaging methods described herein.
Modifications such as I253A (Hornick et al. (2000) J. Nucl. Med.
41:355) and H435A/R I253A or H310A (Kim et al. (2000) Eur. J.
Immunol. 29:2819) in Fc of human IgG1 can decrease FcRn binding.
See also Kenanova et al. (2005) Cancer Res. 65:622. Other means to
enhance clearance include formatting the antigen binding domains of
the present invention as antibody fragments lacking the ability to
bind FcRn, such as Fab fragments. Such modification can reduce the
circulating half-life of an antibody from a couple of weeks to a
matter of hours. Selective PEGylation of antibody fragments can
then be used to fine-tune (increase in increments) the half-life of
the antibody fragments if necessary. Chapman et al. (1999) Nat.
Biotechnol. 17:780.
[0086] D-polymer-biomolecule conjugate compositions containing an
antibody or antigen binding fragment thereof can be assayed for
retention of binding specificity in vitro and/or in vivo. Methods
for analyzing binding affinity, cross-reactivity, and binding
kinetics of various antibody compositions include standard assays
known in the art, for example, ELISA, Western Blotting, flow
cytometry, and BIACORE.RTM. surface plasmon resonance (SPR)
analysis using a BIACORE.RTM. 2000 SPR instrument (Biacore AB,
Uppsala, Sweden).
[0087] Exemplary proteins for use in the D-polymer conjugates
described herein include any known antibody or alternative scaffold
protein, such as Adnectins, that specifically binds to a target,
and does significantly cross-react with unrelated targets.
Fibronectin Based Protein (FBS)
[0088] In some embodiments, the targeting molecule used in the
imaging compositions described herein is a FBS protein. Generally,
FBS protein molecules have inherently rapid blood clearance rates,
which can be advantageous for use with deuterium imaging
technologies by minimizing the amount of time needed for background
probe signals from non-relevant tissue. Rapid clearing probes allow
high contrast images to be collected the same day the probe is
injected, and very importantly, can also serve to reduce overall
radiation exposure to the subject.
[0089] As used herein, a "fibronectin based scaffold" or "FBS"
protein or moiety refers to proteins or moieties that are based on
a fibronectin type III ("Fn3") repeat. Fn3 is a small (about 10
kDa) domain that has the structure of an immunoglobulin (Ig) fold
(i.e., an Ig-like .beta.-sandwich structure, consisting of seven
.beta.-strands and six loops). Fibronectin has 18 Fn3 repeats, and
while the sequence homology between the repeats is low, they all
share a high similarity in tertiary structure. Fn3 domains are also
present in many proteins other than fibronectin, such as adhesion
molecules, cell surface molecules, e.g., cytokine receptors, and
carbohydrate binding domains. For reviews see Bork et al., Proc.
Natl. Acad. Sci. USA, 89(19):8990-8994 (1992); Bork et al., J. Mol.
Biol., 242(4):309-320 (1994); Campbell et al., Structure,
2(5):333-337 (1994); Harpez et al., J. Mol. Biol., 238(4):528-539
(1994)). The term "FBS" protein or moiety is intended to include
scaffolds based on Fn3 domains from these other proteins (i.e., non
fibronectin molecules).
[0090] An Fn3 domain is small, monomeric, soluble, and stable. It
lacks disulfide bonds and, therefore, is stable under reducing
conditions. Fn3 domains comprise, in order from N-terminus to
C-terminus, a beta or beta-like strand, A; a loop, AB; a beta or
beta-like strand, B; a loop, BC; a beta or beta-like strand, C; a
loop, CD; a beta or beta-like strand, D; a loop, DE; a beta or
beta-like strand, E; a loop, EF; a beta or beta-like strand, F; a
loop, FG; and a beta or beta-like strand, G. The seven antiparallel
.beta.-strands are arranged as two beta sheets that form a stable
core, while creating two "faces" composed of the loops that connect
the beta or beta-like strands. Loops AB, CD, and EF are located at
one face ("the south pole") and loops BC, DE, and FG are located on
the opposing face ("the north pole"). There are at least 15
different Fn3 modules in human Fibronectin, and while the sequence
homology between the modules is low, they all share a high
similarity in tertiary structure.
[0091] The loops in Fn3 molecules are structurally similar to
complementary determining regions (CDRs) of antibodies, and when
altered, may be involved in binding of the Fn3 molecule to a
target, e.g., a target protein. Other regions of Fn3 molecules,
such as the beta or beta-like strands and N-terminal or C-terminal
regions, when altered, may also be involved in binding to a target.
Any or all of loops AB, BC, CD, DE, EF and FG may participate in
binding to a target. Any of the beta or beta-like strands may be
involved in binding to a target. Fn3 domains may also bind to a
target through one or more loops and one or more beta or beta-like
strands. Binding may also require the N-terminal or C-terminal
regions. An FBS domain for use in a protein may comprise all loops,
all beta or beta-like strands, or only a portion of them, wherein
certain loops and/or beta or beta-like strands and/or N- or
C-terminal regions are modified (or altered), provided that the FBS
domain preferably binds specifically to a target. For example, an
FBS domain may comprise 1, 2, 3, 4, 5 or 6 loops, 1, 2, 3, 4, 5, 6,
7, or 8 beta strands, and optionally an N-terminal and/or
C-terminal region, wherein one or more loops, one or more beta
strands, the N-terminal region and/or the C-terminal regions are
modified relative to the wild-type FBS domain.
[0092] An example of FBS proteins that are based on human
.sup.10Fn3 domains are adnectins (Adnexus, a wholly owned
subsidiary of Bristol-Myers Squibb). Adnectins are .sup.10Fn3
molecules in which CDR-like loop regions, .beta.-strands,
N-terminal and/or C-terminal regions of a .sup.10Fn3 domain has
been modified to evolve a protein capable of binding to a compound
of interest. For example, U.S. Pat. No. 7,115,396 describes
.sup.10Fn3 domain proteins wherein alterations to the BC, DE, and
FG loops result in high affinity TNF.alpha. binders. U.S. Pat. No.
7,858,739 describes Fn3 domain proteins wherein alterations to the
BC, DE, and FG loops result in high affinity VEGFR2 binders.
[0093] In certain embodiments, an FBS moiety is based on an Fn3
repeat other than the 10.sup.th repeat of the type III domain of
fibronectin, e.g., human fibronectin. For example, an FBS moiety
may be similar to any of the other fibronectin type III repeats,
e.g., the 1.sup.st, 2.sup.nd, 3.sup.rd, 4.sup.th, 5.sup.th,
6.sup.th, 7.sup.th, 8.sup.th, 9.sup.th, 11.sup.th, 12.sup.th,
13.sup.th, 14.sup.th, 15.sup.th, 16.sup.th, 17.sup.th, and
18.sup.th Fn3 repeats. In yet other embodiments, an FBS moiety may
be from a molecule other than fibronectin. Exemplary FBS moieties
may be derived from tenascin, a protein that is composed of 15 Fn3
domains with similar sequence similarities to one another as found
in fibronectin. These repeats are described, e.g., in Jacobs et
al., Protein Engineering, Design & Selection, 25:107 (2012).
Based on the homology of the repeats in the fibronectin molecule
and those in the tenascin molecule, artificial molecules based on
these homologies have been created. Proteins comprising a consensus
amino acid sequence based on the homology of the domains in the
fibronectin molecule are referred to as Fibcon and FibconB (WO
2010/093627 and Jacobs et al. (2012) supra.) and those based on the
homology of the domains in the tenascin molecule are referred to as
Tencon (WO 2010/051274, WO 2010/051310 and WO 2011/137319, which
are specifically incorporated by reference herein). A Fibcon,
FibconB or Tencon moiety, or target binding variants thereof,
whether by itself or linked to a heterologous moiety may be fused
as described herein. Fn3 domains from other proteins, e.g., cell
surface hormone and cytokine receptors, chaperonins, and
carbohydrate-binding domains, may be conjugated as described
herein.
[0094] FBS proteins specific for any desired target molecule can be
generated and tested using art recognized methods. Methods for
testing the binding properties of FBS proteins are also well-known.
For example, one way to rapidly make and test Fn3 domains with
specific binding properties is the nucleic acid-protein fusion
technology of Adnexus, a Bristol-Myers Squibb R&D Company. This
disclosure utilizes the in vitro expression and tagging technology,
termed `PROfusion` which exploits nucleic acid-protein fusions
(RNA- and DNA-protein fusions) to identify novel polypeptides and
amino acid motifs that are important for binding to proteins.
Nucleic acid-protein fusion technology is a technology that
covalently couples a protein to its encoding genetic information.
For a detailed description of the RNA-protein fusion technology and
fibronectin-based scaffold protein library screening methods see
Szostak et al., U.S. Pat. Nos. 6,258,558, 6,261,804, 6,214,553,
6,281,344, 6,207,446, 6,518,018 and 6,818,418; Roberts et al.,
Proc. Natl. Acad. Sci., 1997; 94:12297-12302; and Kurz et al.,
Molecules, 2000; 5:1259-64, all of which are herein incorporated by
reference.
[0095] Exemplary FBS proteins or moieties included, but are not
limited to those which bind to mesothelian, glypican, TL1A, CD8,
myostatin, LPA1 receptors, TNF-alpha, VEGFR2, PCSK9, IL-23, EGFR or
IGF1R and those which are described, e.g., in WO 2010/093627, WO
2011/130324, WO 2009/083804, WO 2009/133208, WO 02/04523, WO
2012/016245, WO 2009/023184, WO 2010/051310, WO 2011/020033, WO
2011/051333, WO 2011/051466, WO 2011/092233, WO 2011/100700, WO
2011/130324, WO 2011/130328, WO 2011/137319, WO 2010/051274, WO
2009/086116, WO 09/058379, WO2013/067029, WO2012/016245 and WO
2017/053619 (all of which are specifically incorporated by
reference herein): any of the FBS proteins or moieties described in
these publications may be used as described herein.
[0096] In some embodiments, the FBS protein binds to PDL-1. In some
embodiments, the FBS protein comprises the amino acid sequence of
any of SEQ ID NOs: 2-8 or a sequence set forth in WO2016086021. In
certain embodiments, an imaging agent, e.g., comprising an FBS
protein, is linked to a moiety that modulates, e.g., increases, its
blood PK by small increments to enhance the imaging contrast or
increase avidity of the D-polymer-biomolecule conjugate. In some
embodiments, the clearance rate of the polypeptide in a mammal
(e.g., mouse, rat, or human) is, or is increased by, greater than
two-fold, greater than three-fold, greater than four-fold or
greater than five-fold relative to the unmodified FBS protein.
Moieties that slow clearance of a protein from the blood, herein
referred to as "PK moieties", include polyoxyalkylene moieties
(e.g., polyethylene glycol), sugars (e.g., sialic acid), and
well-tolerated protein moieties (e.g., Fc and fragments and
variants thereof, transferrin, or serum albumin). The FBS protein
may also be fused to albumin or a fragment (portion) or variant of
albumin as described in U.S. Publication No. 2007/0048282, or may
be fused to one or more serum albumin binding FBS proteins, as
described herein.
[0097] Other PK moieties that can be used in the invention include
those described in Kontermann et al., (Current Opinion in
Biotechnology 2011; 22:868-76), herein incorporated by reference.
Such PK moieties include, but are not limited to, human serum
albumin fusions, human serum albumin conjugates, human serum
albumin binders (e.g., Adnectin PKE, AlbudAb, ABD), XTEN fusions,
PAS fusions (i.e., recombinant PEG mimetics based on the three
amino acids proline, alanine, and serine), carbohydrate conjugates
(e.g., hydroxyethyl starch (HES)), glycosylation, polysialic acid
conjugates, and fatty acid conjugates.
Protein Production
[0098] Proteins for use in the conjugates disclosed herein can also
be produced using cell expression systems using host cells
transformed with nucleic acids encoding the protein cultured in
conventional nutrient media modified as appropriate for inducing
promoters, selecting transformants, or amplifying the genes
encoding the desired sequences. The host cells used to produce the
proteins may be cultured in a variety of media. Commercially
available media such as Ham's F10 (Sigma), Minimal Essential Medium
((MEM), (Sigma)), RPMI-1640 (Sigma), and Dulbecco's Modified
Eagle's Medium ((DMEM), (Sigma)) are suitable for culturing the
host cells. In addition, any of the media described in Ham et al.,
Meth. Enzymol., 58:44 (1979), Barnes et al., Anal. Biochem.,
102:255 (1980), U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762;
4,560,655; or 5,122,469; PCT Publication Nos. WO 90/03430; WO
87/00195; or U.S. Pat. No. RE30,985 may be used as culture media
for the host cells. Any of these media may be supplemented as
necessary with hormones and/or other growth factors (such as
insulin, transferrin, or epidermal growth factor), salts (such as
sodium chloride, calcium, magnesium, and phosphate), buffers (such
as HEPES), nucleotides (such as adenosine and thymidine),
antibiotics (such as Gentamycin drug), trace elements (defined as
inorganic compounds usually present at final concentrations in the
micromolar range), and glucose or an equivalent energy source. Any
other necessary supplements may also be included at appropriate
concentrations that would be known to those skilled in the art. The
culture conditions, such as temperature, pH, and the like, are
those previously used with the host cell selected for expression,
and will be apparent to the ordinarily skilled artisan.
[0099] Proteins can also be produced using cell-free translation
systems. For such purposes, the nucleic acids encoding the protein
must be modified to allow in vitro transcription to produce mRNA
and to allow cell-free translation of the mRNA in the particular
cell-free system being utilized (eukaryotic such as a mammalian or
yeast cell-free translation system or prokaryotic such as a
bacterial cell-free translation system).
[0100] Proteins can also be produced by chemical synthesis (e.g.,
by the methods described in Solid Phase Peptide Synthesis, Second
Edition, The Pierce Chemical Co., Rockford, Ill. (1984)).
Modifications to the protein can also be produced by chemical
synthesis.
[0101] The proteins disclosed herein can be purified by
isolation/purification methods for proteins generally known in the
field of protein chemistry. Non-limiting examples include
extraction, recrystallization, salting out (e.g., with ammonium
sulfate or sodium sulfate), centrifugation, dialysis,
ultrafiltration, adsorption chromatography, ion exchange
chromatography, hydrophobic chromatography, normal phase
chromatography, reversed-phase chromatography, gel filtration, gel
permeation chromatography, affinity chromatography,
electrophoresis, countercurrent distribution or any combinations of
these. After purification, proteins may be exchanged into different
buffers and/or concentrated by any of a variety of methods known to
the art, including, but not limited to, filtration and
dialysis.
[0102] The purified protein is preferably at least 85% pure, more
preferably at least 95% pure, and most preferably at least 98% or
99% pure. Regardless of the exact numerical value of the purity,
the protein is sufficiently pure for use as a pharmaceutical
product.
III. Conjugation of D-Polymers to-Biomolecules
[0103] D-polymers can be linked directly to a targeting moiety
(TM), e.g., a protein or via a cross linking moiety. As used herein
a linker is a molecule or group of atoms positioned between two
moieties. Typically, linkers are bifunctional, i.e., the linker
includes a functional group at each end, wherein the functional
groups are used to couple the linker to the two moieties (e.g.,
D-PEG and targeting moiety). The two functional groups may be the
same, i.e., a homobifunctional linker, or different, i.e., a
heterobifunctional linker. In some embodiments the linker contains
a maleimide group or derivative thereof. In some embodiments, the
linker is a maleimide heterobifunctional reagent. In some
embodiments, the linker is N-(p-Maleimideophenyl)isocyanate.
[0104] In some embodiments, the D-polymer-biomolecule conjugates
have the following structure:
##STR00002##
wherein the conjugate may comprise a D-polymer that is D-PEG or a
D-polymer other than D-PEG.
[0105] In some embodiments, the D-polymer-biomolecule conjugates
have the following structure:
##STR00003##
wherein TM is a targeting moiety, e.g., a protein.
[0106] In some embodiments, the D-polymer-biomolecule conjugates
have the following structure:
##STR00004##
wherein X is O or NH.
[0107] In some embodiments, the D-polymer-biomolecule conjugates
have the following structure:
##STR00005##
[0108] In some embodiments, the D-Polymer-biomolecule conjugates
have the following structure:
##STR00006##
wherein X is NH or O, and wherein the D-PEG can also be a D-Polymer
other than PEG.
[0109] In some embodiments, the D-Polymer-biomolecule conjugates
have the following structure:
##STR00007##
wherein the D-PEG can also be a D-Polymer other than PEG.
[0110] In some embodiments, the TM is a protein which is first
modified to incorporate a cysteine for attaching the D-polymer. In
some embodiments, P.sub.mX.sub.n linked to the C-terminus of the
protein contains a cysteine. For example, the first amino acid
after the proline may be a cysteine, and the cysteine may be the
last amino acid in the molecule or the cysteine may be followed by
one or more amino acids. The presence of a cysteine permits the
conjugation of heterologous moieties such as the D-polymer to the
protein. Exemplary P.sub.mX.sub.n moieties comprising a cysteine
include: P.sub.mCX.sub.n, wherein C is a cysteine, each X is
independently any amino acid, m is an integer that is at least 1
and n is 0 or an integer that is at least 1. In some embodiments, m
may be 1, 2, 3 or more. For example, m may be 1-3 or m may be 1-2.
"n" may be 0, 1, 2, 3 or more, e.g., n may be 1-3 or 1-2. Other
exemplary PmXn moieties include two cysteines, for example,
PmCXn.sub.1CXn.sub.2, wherein each X is independently any amino
acid, n1 and n.sub.2 are independently 0 or an integer that is at
least 1. For example, n.sub.1 may be 1, 2, 3, 4 or 5 and n2 may be
1, 2, 3, 4 or 5. Exemplary PmXn moieties are disclosed in WO
2017/053619 (incorporated herein by reference).
[0111] In certain embodiments, the PmXn moiety is selected from the
group consisting of PC, PPC and PCC. In another embodiment, the
PmXn moiety is PmCXn.sub.1CXn.sub.2. In certain embodiments,
PmCXn.sub.1CXn.sub.2 is selected from the group consisting of
PCPPPC and PCPPPPPC.
[0112] In certain embodiments, the D-PEG polymer polymer can be
bound, e.g., covalently linked, e.g., using maleimide chemistry, to
a cysteine of a PmXn moiety on the protein moiety, wherein at least
one X is a cysteine. Ligation to a cysteine can be performed as
known in the art using maleimide chemistry (e.g., Imperiali, B. et
al., Protein Engineering: Nucleic Acids and Molecular Biology, Vol.
22, pp. 65-96, Gross, H. J., ed. (2009)). For attaching a linker to
a cysteine on a protein, the linker may, e.g., comprise a
maleinimido moiety, which moiety then reacts with the cysteine to
form a covalent bond. In certain embodiments, the amino acids
surrounding the cysteine are optimized to facilitate the chemical
reaction. For example, a cysteine may be surrounded by negatively
charged amino acid for a faster reaction relative to a cysteine
that is surrounded by a stretch of positively charged amino acids
(EP 1074563). Linkage of a drug moiety to a cysteine on a protein
moiety is a site specific linkage. Conventional separation and
purification techniques known in the art can be used to purify
D-polymer-biomolecule conjugates, such as size exclusion (e.g., gel
filtration) and ion exchange chromatography. Products may also be
separated using SDS-PAGE. Products that may be separated include
mono-, di-, tri-, poly- and un-conjugated biomolecules, as well as
free D-polymer. The percentage of mono-D-polymer-biomolecule
conjugates can be controlled by pooling broader fractions around
the elution peak to increase the percentage of
mono-D-polymer-biomolecule conjugates in the composition. About 90%
mono-D-polymer-biomolecule conjugates represent a good balance of
yield and activity.
IV. Targets
[0113] Exemplary in vivo target molecules which bind the
D-polymer-biomolecule conjugates described herein are those
associated with various diseases or conditions, such as a malignant
disease, a cardiovascular disease, an infectious disease, an
inflammatory disease, an autoimmune disease, or a neurological
disease.
[0114] Provided herein are D-polymer-biomolecule conjugates (e.g.,
D-polymer labeled imaging agents) wherein the biomolecule binds
specifically to a target, such as a protein on the surface of human
cells. In certain embodiments, the biomolecule is a peptide; an
antibody, or antigen binding portion thereof or a variant of an
antibody; an alternative scaffold, such as an Fn3 (e.g., a human
Fn3) domain, such as an FBS, e.g., a human .sup.10Fn3 domain. In
certain embodiments, the biomolecule binds to a cell surface
molecule, e.g., a cell surface molecule on a tumor cell or a cell
in the tumor, e.g., a tumor infiltrating lymphocyte that is located
in the tumor. In certain embodiments, the moiety binds to a cell
surface molecule on an immune cell, e.g., a T cell (e.g., a Treg
cell), a Teff cell, a B cell, a macrophage, a dendritic cell, an NK
cell or a Langerhans cell.
[0115] In certain embodiments, a D-polymer-biomolecule conjugate
comprises a moiety that binds specifically to an immuno-oncology
target (receptor or ligand), such as a co-stimulatory receptor on
an immune cell (e.g., T cell or NK cell) or an inhibitor on an
immune cell (e.g., a T cell or NK cell), which targets modulate
immune responses. In one embodiment, the moiety binds to one of the
following targets or ligand or receptor thereof: an immunoglobulin
super family (IgSF) member; a member of the B7 family, which
includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L),
B7-H3, B7-H4, B7-H5 (VISTA), and B7-H6; a member of the TNF
receptor superfamily or its ligand, e.g., CD40, CD40L, OX-40,
OX-40L, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137, GITR,
TRAIL/Apo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG,
RANK, RANKL, TWEAKR/Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL,
BCMA, LT.beta.R, LIGHT, DcR3, HVEM, VEGI/TL1A, TRAMP/DR3, EDAR,
EDA1, XEDAR, EDA2, TNFR1, Lymphotoxin .alpha./TNF.beta., TNFR2,
TNF.alpha., LT.beta.R, Lymphotoxin .alpha. 1.beta.2, FAS, FASL,
RELT, DR6, TROY, NGFR (see, e.g., Tansey (2009) Drug Discovery
Today 00:1); a protein that inhibits an immune cell (e.g., immune
checkpoint inhibitors), such as CTLA-4, PD-1, PD-L1, PD-L2, and
LAG-3, TIM-3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT,
CD113, GPR56, VISTA, 2B4, CD48, GARP, CD73, PD1H, LAIR1, TIM-1,
TIM-4, CD39; a protein that stimulates an immune response, such as
B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, GITR, GITRL, ICOS, ICOS-L,
OX40, OX40L, CD70, CD27, CD40, DR3 and CD28H; any of the following
cell surface molecules: KIR, cytokine or interleukin receptors,
IL-6, IL-10, TGF- , VEGF, CSF-1R, CD25 and IDO.
[0116] In some embodiments, the D-polymer-biomolecule conjugate
binds to an antigen or receptor of a pathogen, including but not
limited to fungi, viruses, parasites and bacteria. Examples of
pathogenic viruses detectable by methods described herein include
HIV, hepatitis (A, B, or C), herpes virus (e.g., VZV, HSV-1, HAV-6,
HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus,
flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus,
respiratory syncytial virus, mumps virus, rotavirus, measles virus,
rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue
virus, papillomavirus, molluscum virus, poliovirus, rabies virus,
JC virus and arboviral encephalitis virus, human immunodeficiency
virus (HIV), herpes virus, cytomegalovirus, rabies virus, influenza
virus, hepatitis B virus, Sendai virus, feline leukemia virus, Reo
virus, polio virus, human serum parvo-like virus, simian virus 40,
respiratory syncytial virus, mouse mammary tumor virus,
Varicella-Zoster virus, Dengue virus, rubella virus, measles virus,
adenovirus, human T-cell leukemia viruses, Epstein-Barr virus,
murine leukemia virus, mumps virus, vesicular stomatitis virus,
Sindbis virus, lymphocytic choriomeningitis virus, wart virus, blue
tongue virus. Examples of bacteria and fungi include, Streptococcus
agalactiae, Legionella pneumophilia, Streptococcus pyogenes,
Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitidis,
Pneumococcus, Hemophilis influenzae B, Treponema pallidum, Lyme
disease spirochetes, Pseudomonas aeruginosa, Mycobacterium leprae,
Brucella abortus, Mycobacterium tuberculosis and Chlostridium
tetani.
[0117] Some examples of pathogenic bacteria causing infections
detectable by methods described herein include chlamydia,
rickettsial bacteria, mycobacteria, staphylococci, streptococci,
pneumonococci, meningococci and gonococci, klebsiella, proteus,
serratia, pseudomonas, legionella, diphtheria, salmonella, bacilli,
cholera, tetanus, botulism, anthrax, plague, leptospirosis, and
Lyme disease bacteria.
[0118] Some examples of pathogenic fungi causing infections
detectable by methods described herein include Candida (albicans,
krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans,
Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor,
absidia, rhizopus), Sporothrix schenkii, Blastomyces dermatitidis,
Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma
capsulatum.
[0119] Some examples of pathogenic parasites causing infections
detectable by methods described herein include Entamoeba
histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba sp.,
Giardia lambia, Cryptosporidium sp., Pneumocystis carinii,
Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma
cruzi, Leishmania donovani, Toxoplasma gondii, and Nippostrongylus
brasiliensis.
V. Biophysical and Biochemical Characterization
[0120] Binding of the D-polymer-biomolecule conjugates described
herein to a molecule may be assessed in terms of equilibrium
constants (e.g., dissociation, K.sub.D) and in terms of kinetic
constants (e.g., on-rate constant, k.sub.on and off-rate constant,
k.sub.off). A D-polymer-biomolecule conjugate will generally bind
to a target with a K.sub.D of less than 500 nM, 100 nM, 10 nM, 1
nM, 500 pM, 200 pM, or 100 pM, although higher K.sub.D values may
be tolerated where the k.sub.off is sufficiently low or the
k.sub.on, is sufficiently high.
[0121] Exemplary assays for determining the binding affinity of a
D-polymer-biomolecule conjugate include, but are not limited to,
solution phase methods such as the kinetic exclusion assay (KinExA)
(Blake et al., JBC 1996; 271:27677-85; Drake et al., Anal Biochem
2004; 328:35-43), surface plasmon resonance (SPR) with the Biacore
system (Uppsala, Sweden) (Welford et al., Opt. Quant. Elect 1991;
23:1; Morton and Myszka, Methods in Enzymology 1998; 295:268) and
homogeneous time resolved fluorescence (HTRF) assays (Newton et
al., J Biomol Screen 2008; 13:674-82; Patel et al., Assay Drug Dev
Technol 2008; 6:55-68).
[0122] In certain embodiments, biomolecular interactions can be
monitored in real time with the Biacore system, which uses SPR to
detect changes in the resonance angle of light at the surface of a
thin gold film on a glass support due to changes in the refractive
index of the surface up to 300 nm away. Biacore analysis generates
association rate constants, dissociation rate constants,
equilibrium dissociation constants, and affinity constants. Binding
affinity is obtained by assessing the association and dissociation
rate constants using a Biacore surface plasmon resonance system
(Biacore, Inc.). A biosensor chip is activated for covalent
coupling of the target. The target is then diluted and injected
over the chip to obtain a signal in response units of immobilized
material. Since the signal in resonance units (RU) is proportional
to the mass of immobilized material, this represents a range of
immobilized target densities on the matrix. Association and
dissociation data are fit simultaneously in a global analysis to
solve the net rate expression for a 1:1 bimolecular interaction,
yielding best fit values for k.sub.in, k.sub.off and R.sub.max
(maximal response at saturation). Equilibrium dissociation
constants for binding, K.sub.D'S are calculated from SPR
measurements as k.sub.off/k.sub.on.
[0123] In some embodiments, the D-polymer-biomolecule conjugates
described herein exhibit a Ku in the SPR affinity assay of 500 nM
or less, 400 nM or less, 300 nM or less, 200 nM or less, 150 nM or
less, 100 nM or less, 90 nM or less, 80 nM or less, 70 nM or less,
60 nM or less, 50 nM or less, 40 nM or less, 30 nM or less, 20 nM
or less, 15 nM or less, 10 nM or less, 5 nM or less, or 1 nM or
less.
[0124] It should be understood that the assays described herein
above are exemplary, and that any method known in the art for
determining the binding affinity between a D-polymer-biomolecule
conjugate and a target (e.g., fluorescence based-transfer (FRET),
enzyme-linked immunosorbent assay, and competitive binding assays
(e.g., radioimmunoassays)) can be used to assess the binding
affinities of the D-polymer-biomolecule conjugate described
herein.
VI. Pharmaceutical Compositions
[0125] Further provided are compositions, e.g., a pharmaceutical
compositions, containing one or a combination of D-polymer
biomolecule conjugates (e.g., D-PEG-FBS conjugates), described
herein, formulated together with a pharmaceutically acceptable
carrier. Such compositions may include one or a combination of
(e.g., two or more different) agents described herein. For example,
a pharmaceutical composition described herein can comprise a
combination D-polymer biomolecule conjugates. Methods well known in
the art for making formulations are found, for example, in
"Remington: The Science and Practice of Pharmacy" (20th ed., ed. A.
R. Gennaro A R., 2000, Lippincott Williams & Wilkins,
Philadelphia, Pa.).
[0126] As used herein, "pharmaceutically acceptable carrier"
includes any and all solvents, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents, and the like that are physiologically compatible.
Preferably, the carrier is suitable for intravenous, intramuscular,
subcutaneous, parenteral, spinal or epidermal administration (e.g.,
by injection or infusion). Depending on the route of
administration, a D-polymer-biomolecule conjugate may be coated in
a material to protect the compound from the action of acids and
other natural conditions that may inactivate the compound.
[0127] The pharmaceutical compounds described herein may include
one or more pharmaceutically acceptable salts. A "pharmaceutically
acceptable salt" refers to a salt that retains the desired
biological activity of the parent compound and does not impart any
undesired toxicological effects (see e.g., Berge, S. M., et al.
(1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid
addition salts and base addition salts. Acid addition salts include
those derived from nontoxic inorganic acids, such as hydrochloric,
nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous
and the like, as well as from nontoxic organic acids such as
aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic
acids, hydroxy alkanoic acids, aromatic acids, aliphatic and
aromatic sulfonic acids and the like. Base addition salts include
those derived from alkaline earth metals, such as sodium,
potassium, magnesium, calcium and the like, as well as from
nontoxic organic amines, such as N,N'-dibenzyl ethylenediamine,
N-methylglucamine, chloroprocaine, choline, diethanolamine,
ethylenediamine, procaine and the like.
[0128] A pharmaceutical composition described herein also may
include a pharmaceutically acceptable anti-oxidant. Examples of
pharmaceutically acceptable antioxidants include: (1) water soluble
antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium
bisulfate, sodium metabisulfite, sodium sulfite and the like; (2)
oil-soluble antioxidants, such as ascorbyl palmitate, butylated
hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin,
propyl gallate, alpha-tocopherol, and the like; and (3) metal
chelating agents, such as citric acid, ethylenediamine tetraacetic
acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the
like.
[0129] Examples of suitable aqueous and nonaqueous carriers that
may be employed in the pharmaceutical compositions described herein
include water, ethanol, polyols (such as glycerol, propylene
glycol, polyethylene glycol, and the like), and suitable mixtures
thereof, vegetable oils, such as olive oil, and injectable organic
esters, such as ethyl oleate. Proper fluidity can be maintained,
for example, by the use of coating materials, such as lecithin, by
the maintenance of the required particle size in the case of
dispersions, and by the use of surfactants.
[0130] These compositions may also contain adjuvants such as
preservatives, wetting agents, emulsifying agents and dispersing
agents. Prevention of presence of microorganisms may be ensured
both by sterilization procedures, supra, and by the inclusion of
various antibacterial and antifungal agents, for example, paraben,
chlorobutanol, phenol sorbic acid, and the like. It may also be
desirable to include isotonic agents, such as sugars, sodium
chloride, and the like into the compositions. In addition,
prolonged absorption of the injectable pharmaceutical form may be
brought about by the inclusion of agents which delay absorption
such as aluminum monostearate and gelatin.
[0131] Pharmaceutically acceptable carriers include sterile aqueous
solutions or dispersions and sterile powders for the extemporaneous
preparation of sterile injectable solutions or dispersion. The use
of such media and agents for pharmaceutically active substances is
known in the art. Except insofar as any conventional media or agent
is incompatible with the active compound, use thereof in the
pharmaceutical compositions described herein is contemplated.
Supplementary active compounds can also be incorporated into the
compositions.
[0132] Pharmaceutical compositions typically must be sterile and
stable under the conditions of manufacture and storage. The
composition can be formulated as a solution, microemulsion,
liposome, or other ordered structure suitable to high drug
concentration. The carrier can be a solvent or dispersion medium
containing, for example, water, ethanol, polyol (for example,
glycerol, propylene glycol, and liquid polyethylene glycol, and the
like), and suitable mixtures thereof. The proper fluidity can be
maintained, for example, by the use of a coating such as lecithin,
by the maintenance of the required particle size in the case of
dispersion and by the use of surfactants. In many cases, it will be
preferable to include isotonic agents, for example, sugars,
polyalcohols such as mannitol, sorbitol, or sodium chloride in the
composition. Prolonged absorption of the injectable compositions
can be brought about by including in the composition an agent that
delays absorption, for example, monostearate salts and gelatin.
[0133] Sterile injectable solutions can be prepared by
incorporating the D-polymer-biomolecule conjugate in the required
amount in an appropriate solvent with one or a combination of
ingredients enumerated above, as required, followed by
sterilization microfiltration. Generally, dispersions are prepared
by incorporating the active compound into a sterile vehicle that
contains a basic dispersion medium and the required other
ingredients from those enumerated above. In the case of sterile
powders for the preparation of sterile injectable solutions, the
preferred methods of preparation are vacuum drying and
freeze-drying (lyophilization) that yield a powder of the active
ingredient plus any additional desired ingredient from a previously
sterile-filtered solution thereof.
[0134] The amount of D-polymer-biomolecule conjugate which can be
combined with a carrier material to produce a single dosage form
will vary depending upon the subject being treated, and the
particular mode of administration. The amount of
D-polymer-biomolecule conjugate which can be combined with a
carrier material to produce a single dosage form will generally be
that amount of the composition which produces a detectable effect.
Generally, out of one hundred percent, this amount will range from
about 0.01 percent to about ninety-nine percent of active
ingredient, preferably from about 0.1 percent to about 70 percent,
most preferably from about 1 percent to about 30 percent of active
ingredient in combination with a pharmaceutically acceptable
carrier.
VII. Administration
[0135] The D-polymer-biomolecule conjugates described herein are
useful in a variety of in vivo imaging applications (e.g., for
tissue or whole body imaging). In certain embodiments, the
D-polymer-biomolecule conjugate can be used to image
target-positive cells or tissues, e.g., target expressing tumors.
For example, the D-polymer-biomolecule conjugate is administered to
a subject in an amount sufficient to uptake the
D-polymer-biomolecule conjugate into the tissue of interest. The
subject is then imaged using an imaging system such as MRI for an
amount of time appropriate for the deuterium content of the agent
to be detectable. The D-polymer-biomolecule conjugate bound to
cells or tissues expressing the targeting agent is then detected by
the imaging system.
[0136] In certain embodiments, administration occurs in an amount
of a D-polymer-biomolecule conjugate of between about 0.005
.mu.g/kg of body weight to about 50 .mu.g/kg of body weight per
day, usually between 0.02 pg/kg of body weight to about 3 .mu.g/kg
of body weight. A particular analytical dosage for the instant
composition includes from about 0.5 .mu.g to about 100 .mu.g of a
D-polymer-biomolecule conjugate. The dosage will usually be from
about 1 .mu.g to about 50 .mu.g of a D-polymer-biomolecule
conjugate.
[0137] Dosage regimens are adjusted to provide the optimum
detectable amount for obtaining a clear image of the tissue or
cells which uptake the D-polymer-biomolecule conjugate. It is
especially advantageous to formulate parenteral compositions in
dosage unit form for ease of administration and uniformity of
dosage. Dosage unit form as used herein refers to physically
discrete units suited as unitary dosages for the subjects to which
the D-polymer-biomolecule conjugate is to be administered. The
specification for the dosage unit forms described herein are
dictated by and directly dependent on (a) the unique
characteristics of the targeting portion of the
D-polymer-biomolecule conjugate; (b) the tissue or cells to be
targeted; (c) the limitations inherent in the imaging technology
used.
[0138] For administration of the a D-polymer-biomolecule conjugate,
the dosage used will depend upon the disease type, targeting
compound used, the age, physical condition, and gender of the
subject, the degree of the disease, the site to be examined, and
others. In particular, sufficient care has to be taken about
exposure doses to a subject. in some embodiments, a saturating dose
of a D-polymer-biomolecule conjugate is administered to the
patient.
[0139] In other embodiments, an effective amount of
D-polymer-biomolecule conjugate will be the amount of compound
sufficient to be visible by MRI or other deuterium detecting method
in the subject.
[0140] Actual dosage levels of the active ingredients in the
pharmaceutical compositions described herein may be varied so as to
obtain an amount of the active ingredient which is effective to
achieve the desired uptake of the D-biomolecule conjugate in the
cells or tissues of a particular patient, composition, and mode of
administration, without being toxic to the patient. It will be
understood, however, that the total daily usage of the
D-polymer-biomolecule conjugate of the present disclosure will be
decided by the attending physician or other attending professional
within the scope of sound medical judgment. The specific effective
dose level for any particular subject will depend upon a variety of
factors, including for example, the activity of the specific
composition employed; the specific composition employed; the age,
body weight, general health, sex, and diet of the host; the time of
administration; the route of administration; the rate of excretion
of the specific compound employed; the duration of the treatment;
other drugs, compounds and/or materials used in combination with
the particular compositions employed, the age, sex, weight,
condition, general health and prior medical history of the patient
being treated, and like factors well known in the medical arts. In
certain embodiments, the amount of D-polymer-biomolecule conjugate
administered into a human subject required for imaging will be
determined by the prescribing physician.
[0141] A composition described herein can be administered via one
or more routes of administration using one or more of a variety of
methods known in the art. As will be appreciated by the skilled
artisan, the route and/or mode of administration will vary
depending upon the desired results. Preferred routes of
administration for D-polymer-biomolecule conjugates described
herein include intravenous, intramuscular, intradermal,
intraperitoneal, subcutaneous, spinal or other parenteral routes of
administration, for example by injection or infusion. The phrase
"parenteral administration" as used herein means modes of
administration other than enteral and topical administration,
usually by injection, and includes, without limitation,
intravenous, intramuscular, intraarterial, intrathecal,
intracapsular, intraorbital, intracardiac, intradermal,
intraperitoneal, transtracheal, subcutaneous, subcuticular,
intraarticular, subcapsular, subarachnoid, intraspinal, epidural
and intrasternal injection and infusion. In certain embodiments,
the D-polymer-biomolecule conjugate is administered
intravenously.
[0142] Alternatively, a D-polymer-biomolecule conjugate described
herein can be administered via a non-parenteral route, such as a
topical, epidermal or mucosal route of administration, for example,
intranasally, orally, vaginally, rectally, sublingually or
topically.
[0143] In certain embodiments, the D-polymer-biomolecule conjugate
described herein can be formulated to ensure proper distribution in
vivo. For example, the blood-brain barrier (BBB) excludes many
highly hydrophilic compounds. Agents may cross the BBB by
formulating them, for example, in liposomes. For methods of
manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811;
5,374,548; and 5,399,331. The liposomes may comprise one or more
moieties which are selectively transported into specific cells or
organs, thus enhance targeted drug delivery (see, e.g., V. V.
Ranade (1989) J. Clin. Pharmacol. 29:685). Exemplary targeting
moieties include folate or biotin (see, e.g., U.S. Pat. No.
5,416,016 to Low et al.); mannosides (Umezawa et al., (1988)
Biochem. Biophys. Res. Commun. 153:1038); antibodies (P. G. Bloeman
et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995)
Antimicrob. Agents Chemother. 39:180); surfactant protein A
receptor (Briscoe et al. (1995) Am. J. Physiol. 1233:134); p 120
(Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K.
Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion;
I. J. Fidler (1994).
VIII. Imaging Methods
[0144] Methods of imaging using D-polymer-biomolecule conjugate as
targeting agents are provided herein. The D-polymer-biomolecule
conjugate can be used with currently available MRI technology for
use in exploratory and diagnostic imaging applications in vitro and
in vivo. Imaging techniques and equipment for deuterium imaging by
MRI scanning are well known in the art (see, e.g., Laracombe et
al., Cancer Res. 50:363-369, 1990; Eskey et al., Cancer Res.
52:6010-6019, 1992; Obata et al., MRM 38:569-572, 1995; Furruya et
al., Ann. Nucl. Med. 11:281-284, 1997) and any such known MRI
imaging technique or apparatus may be utilized.
[0145] For example, after administration, the conjugates
selectively accumulate to the region of interest in the subject
(e.g., a region for which imaging is desired), and the resulting
NMR signals emitted from the region of interest are detected.
Imaging of the region of interest can be performed using any MRI
methods for acquisition of one or more images at particular time
intervals after introducing the imaging agent to the subject and/or
using any MRI scanning equipment. Modeling of the time dependence
and its relationship to the obtained NMR signal may be employed for
monitoring and quantitative evaluation of the spatial distribution
of cells and tissues which bind the protein in the
D-polymer-biomolecule conjugate (e.g., tumors), and are useful the
detection of molecule of interest. The methods also provide a means
for objectively mapping the total volume and distribution of the
D-polymer-biomolecule conjugate, including areas of high and low
capacity. Such mapping is particularly useful for detecting changes
over time, for example, to monitor disease progression and/or
response to drug therapy, radiation or chemotherapy.
IX. Uses
[0146] In vivo applications of the imaging methods provided herein
include disease diagnosis, monitoring of disease progression,
prognosis, determining likelihood of a subject to respond to a
treatment, determining eligibility to a treatment, monitoring of
clinical response to therapy, clinical evaluation and dose
selection of therapeutic compounds, preclinical studies of
potential drug candidates in animal models, and the study of
regional distribution and concentration of target molecules in
tissues and organs. In vitro applications include screening of drug
candidates in cell assays (e.g., competition assays, affinity
assays, etc.)
[0147] In some embodiments, the D-polymer-biomolecule conjugate can
be used to determine the relationship between level of tissue
occupancy by candidate therapeutic compounds and clinical efficacy
in patients; to determine dose selection for clinical trials of
drug candidates prior to initiation of long term clinical studies;
and to compare potencies of different drug candidates.
[0148] In some embodiments, the D-polymer-biomolecule conjugate is
used in a method for in in vivo imaging normal or diseased tissues
and/or organs (e.g., lungs, heart, kidneys, liver, and skin). For
example, the D-polymer-biomolecule conjugate is administered to a
subject in an amount effective to result in uptake of the
D-polymer-biomolecule conjugate into the cells or tissue of
interest. The subject is then introduced to an appropriate imaging
system (e.g., MRI system) for a sufficient amount of time to allow
detection of the D-polymer-biomolecule conjugate. The location of
the detected signal from the D-polymer-biomolecule conjugate can be
correlated with the location of the cells or tissue of interest. In
some embodiments, the dimensions of the location can be determined
as well. In vivo imaging is described herein.
[0149] Accordingly, in certain aspects, provided is a method of
obtaining an image of an D-polymer-biomolecule conjugate, the
method comprising administering the D-polymer-biomolecule conjugate
to a subject, and imaging in vivo the distribution of the
D-polymer-biomolecule conjugate by MRI. The imaged distribution may
be indicative of he location of the biomolecule and/or the target
molecules to which the biomolecule binds.
[0150] In certain embodiments, a method is provided for determining
the presence and/or quantity of a biomarker, e.g., a prognostic or
predictive biomarker, in a subject, and based on the results, a
subject is treated or not or has its treatment stopped or
amended.
[0151] In certain aspects, provided is a method of diagnosing the
presence of a disease in a subject, the method comprising
administering to a subject in need thereof a D-polymer-biomolecule
conjugate which binds to a target molecule associated with the
presence of the disease, and obtaining a radio-image of at least a
portion of the subject to detect the presence or absence of the
D-polymer-biomolecule conjugate.
[0152] In some embodiments, the disease is a solid cancer,
hematopoietic cancer, hematological cancer, autoimmune disease,
neurodegenerative disease, cardiovascular disease or pathogenic
infection.
[0153] MRI imaging with a D-polymer-biomolecule conjugate may be
used to qualitatively or quantitatively detect the targeting
compound. A D-polymer-biomolecule conjugate imaging agent may be
used as a biomarker, and the presence or absence of a positive
signal in a subject may be indicative that, e.g., the subject would
be responsive to a given therapy, e.g., a cancer therapy, or that
the subject is responding or not to a therapy.
[0154] In some embodiments, the steps of this method can be
repeated at determined intervals so that the location and/or size
of the disease can be monitored as a function of time and/or
treatment. In certain embodiments, the D-polymer-biomolecule
conjugate can be used in a subject undergoing treatment (e.g.,
chemotherapy, etc.), to aid in visualizing response to the
treatment. For example, the D-polymer-biomolecule conjugate is
typically visualized and sized prior to treatment, and periodically
(e.g., daily, weekly, monthly, intervals in between these, and the
like) during treatment to monitor the progression or regression of
the disease in the patient.
[0155] Accordingly, in certain aspects, provided is a method of
monitoring the progress of a disease in a subject in need thereof,
the method comprising administering to the subject a
D-polymer-biomolecule conjugate which binds to a target molecule
associated with the presence of the disease at a first time point
and obtaining an image of at least a portion of the subject to
determine the amount of diseased cells or tissue, and administering
to the subject the D-polymer-biomolecule conjugate at one or more
subsequent time points and obtaining an image of at least a portion
of the subject at each subsequent time point (e.g., same portion as
the first time point).
[0156] In certain embodiments, the size of a tumor can be monitored
in a subject undergoing cancer therapy (e.g., chemotherapy,
radiotherapy) and the extent of regression of the tumor can be
monitored in real-time based on detection of D-polymer-biomolecule
conjugate tumor targeting.
[0157] In some embodiments, the methods herein are used to evaluate
the patient's response to therapy. In some embodiments, the methods
are used to select or modify the dosage of therapeutic compounds.
In some embodiments, the methods are used to monitor the uptake of
the D-polymer-biomolecule conjugate in normal tissues to analyze
toxicity or patient to patient variation. In some embodiments, the
methods are used to monitor drug efficacy or to detect drug
resistance.
[0158] In some embodiments, the radiolabeled compounds are
administered to mammals, preferably humans, in a pharmaceutical
composition, either alone or in combination with pharmaceutically
acceptable carriers or diluents according to standard
pharmaceutical practice. Such compositions can be administered
orally or parenterally, including the intravenous, intramuscular,
intraperitoneal, subcutaneous, rectal and topical routes of
administration. In certain embodiments, administration is
intravenous. In certain embodiments the radiolabeled compound is
administered via intravenous injection within less than one hour of
synthesis.
[0159] In some embodiments, the D-polymer-biomolecule conjugate
provided herein is used in vitro as a screening tool to select
compounds for use in treating tissues or cells. For example, in
some embodiments, diseased cells are incubated with the
D-polymer-biomolecule conjugate during or after exposure to one or
more candidate drugs. The ability of the drug candidate to affect
the disease can be imaged over time using the D-polymer-biomolecule
conjugate.
[0160] For example, the integrity of biological activity of the
D-polymer-biomolecule conjugate in vitro in terms of specific
binding to the selected target molecule and uptake of the
radiolabeled composition is assessed in a cell line expressing the
target molecule. For binding and cell association assays, cells may
be incubated at 4.degree. C. or 37.degree. C. for an appropriate
time with the D-polymer-biomolecule conjugate. Nonspecific binding
is determined by the addition of an excess of unlabeled targeting
agent. The extent of specific binding is calculated by subtracting
the nonspecific binding from the total binding. Uptake is expressed
as a percentage of the total added dose of targeting agent to the
cells per microgram of protein (% ID/.mu.g cell protein).
[0161] In a related aspect, the present invention provides a
diagnostic composition for in vivo or in vitro, which includes a
D-polymer-biomolecule, and a pharmaceutically acceptable
carrier.
X. Kits and Articles of Manufacture
[0162] Also provided are kits comprising a
D-polymer-biomolecule-conjugate composition described herein, or
precursor molecules for producing a D-polymer-biomolecule-conjugate
and instructions for use. Kits typically include a packaged
combination of reagents in predetermined amounts with instructions
and a label indicating the intended use of the contents of the kit.
The term label includes any writing, or recorded material supplied
on or with the kit, or which otherwise accompanies the kit.
[0163] For example, in some embodiments, the kit contains the
deuterated-polymer and the biomolecule, and instructions on linking
the two prior to administration.
[0164] In certain embodiments, a kit comprises one or more reagents
necessary for forming a D-polymer-FBS protein conjugate for use as
an in vivo imaging agent, as further described herein. For example,
a kit may comprise a first vial comprising FBS protein (e.g.,
anti-glypican-3 or anti-PDL Adnectin), and a second vial comprising
D-polymer, e.g., D-PEG. A kit may comprise a first vial comprising
an FBS protein, a second vial comprising a reactive linker and a
third vial comprising D-polymer in water. The kits may further
comprise vials, solutions and optionally additional reagents
necessary for the manufacture of D-polymer-labeled FBS
proteins.
[0165] In some embodiments, the kit can further contain at least
one additional reagent (e.g., pharmaceutically acceptable carrier).
In some embodiments, the kit includes the reaction precursors to be
used to generate the labeled probe according to the methods
disclosed herein. The components of the kit can be tailored to the
particular biological condition to be monitored as described
herein. The kit can further include appropriate buffers and
reagents known in the art for administering various combinations of
the components listed above to the host cell or host organism. The
imaging agent and carrier may be provided in solution or in
lyophilized form. When the imaging agent and carrier of the kit are
in lyophilized form, the kit may optionally contain a sterile and
physiologically acceptable reconstitution medium such as water,
saline, buffered saline, and the like. Suitable containers include,
for example, bottles, vials, syringes, and test tubes. The
containers may be formed from a variety of materials such as glass
or plastic. It may further include other materials desirable from a
commercial and user standpoint, including other buffers, diluents,
filters, needles, syringes, and package inserts with instructions
for use.
INCORPORATION BY REFERENCE
[0166] All documents and references, including patent documents and
websites, described herein are individually incorporated by
reference to into this document to the same extent as if there were
written in this document in full or in part.
[0167] The invention is now described by reference to the following
examples, which are illustrative only, and are not intended to
limit the present invention. While the invention has been described
in detail and with reference to specific embodiments thereof, it
will be apparent to one of skill in the art that various changes
and modifications can be made thereto without departing from the
spirit and scope thereof.
Example 1
[0168] Deuterated imaging agents can be made by conjugating
deuterated poly(ethylene glycol) ("D-PEG") to a targeting moiety
that binds to a ligand at the organ or tissue of interest. The
targeting moiety can an adnectin or the Fab unit of an
antibody.
[0169] The D-PEG has a number average molecular weight (Mw) of
between about 2 and about 100 kDa. It is known to conjugate a large
PEG group (up to 40 kDa) to an adnectin (or another polypeptide) to
extend its half-life. The use of a lower molecular weight D-PEG
provides sufficient deuterium to generate a suitable D-MRI signal,
but does not extend the half-life of the adnectin so much that its
fast clearance from tissues or organs not of interest is precluded.
In a D-PEG, preferably at least 90%, more preferably at least 95%,
and even more preferably at least 98% of the hydrogens of the
corresponding undeuterated PEG have been replaced by deuterium.
[0170] Suitable D-PEG is available from Polymer Source Inc., Dorval
(Montreal), Canada, in a variety of Mns and having different
terminal functional groups (OH, SH, NH2) that can be used for
conjugation to a targeting moiety: [0171]
HO--(CD.sub.2CD.sub.2O).sub.n--H (Product numbers P4837-dPEO, Mn
2.7; P4836-dPEO, Mn 3.5; and P4927-dPEO, Mn 4.8). [0172]
CD.sub.3CD.sub.2O--(CD.sub.2CD.sub.2O).sub.n--H (Product number
P3864A-dPEO, Mn 2.7). [0173]
CH.sub.3O--(CD.sub.2CD.sub.2O).sub.n--H (Product numbers
P5381-dPEO-OCH3, Mn 2.2; P11450-dPEO-OCH3, Mn 5). [0174]
CD.sub.3O--(CD.sub.2CD.sub.2O).sub.n CD.sub.2CD.sub.2NH.sub.2
(Product number P11448dPEG-OCH3NH2, Mn 5). [0175]
CH.sub.3O--(CD.sub.2CD.sub.2O).sub.nCD.sub.2CD.sub.2SH (Product
number P5381A-dPEOOCH3SH, Mn 2)
[0176] Amine terminated D-PEG can be conjugated to a targeting
moiety TM using the enzyme transglutaminase, which can form an
amide bond between the D-PEG terminal amino group and the
carboxamide group of the side chain of a glutamine in TM, as
schematically shown below. An illustrative description on the use
of transglutaminase to making conjugates, in the context of
antibodies, is found in Jeger et al., Angew. Chem. Int. Ed. 2010,
49, 9995.
##STR00008##
[0177] Hydroxyl or amine-terminated D-PEG can be reacted with
3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)propanoyl chloride (or its
homolog 6-(2,5-dioxo-2, 5-dihydro-1H-pyrrol-1-yl)hexanoyl chloride)
to provide a maleimide-terminated D-PEG.
##STR00009##
[0178] The maleimide-terminated D-PEG can then be conjugated to a
targeting moiety TM by the Michael addition of a cysteine SH group
to the maleimide, as shown following. (For an example of such
maleimide-cysteine conjugation with an adnectin, see Lipovsek et
al., WO 2017/053619 A1 (2017)).
##STR00010##
[0179] Where the TM lacks an available cysteine for conjugation, a
"surrogate" cysteine can be created by reacting a lysine side chain
amino group with 2-iminothiolane. The SH group of this "surrogate"
cysteine can then be conjugated to a maleimide terminated D-PEG as
described above.
##STR00011##
[0180] Where the D-PEG has a terminal sulfhydryl (SH) group, it can
be conjugated to targeting moiety by first modifying the latter to
introduce a maleimide group thereto and then performing a maleimide
addition conjugation, as shown below:
##STR00012##
Example 2
[0181] A D-PEG-biomolecule conjugate can also be prepared as
follows:
##STR00013##
Example 3
Preparation of D-PEG-FBS Conjugate
[0182] C-PEG is conjugated to an FBS protein, which binds
glypican-3, with the following amino acid sequence:
TABLE-US-00001 (SEQ ID NO: 9)
VSDVPRDLEVVAATPTSLLISWSDDYHAHRYYRITYGETGGNSPVQEFTV
PGEHVTATISGLKPGVDYTITVYAVTYDGEKAATDWSISINYRTPC.
[0183] A deuterated PEG can be linked to the C-terminal cysteine
according to the deuterated PEG manufacturer's instructions.
[0184] The amino acid sequences of other FBS proteins, binding to
other target molecules, are provided in SEQ ID NO:2 through SEQ ID
NO:8.
Example 4
[0185] CH.sub.3O--(CD.sub.2CD.sub.2O).sub.n--H is dissolved in
solvent such as DMSO, DMF or toluene and PMPI
((N-[p-maleimidophenyl] isocyanate) is added. The desired
maleimide-linked D-PEG product is then dissolved in appropriate
buffer and exposed to a targeting moiety containing a sulfhydryl,
such as a PD-L1 or GP3 FBS polypeptide, giving rise to the desired
targeting imaging reagent.
Example 5
[0186] This examples and its accompanying figures demonstrate the
use of deuterium MRI (.sup.2H MRI) as a non-invasive means to trace
the location of the drugs in a live body.
[0187] At 7 T, the resonance frequency of deuterium (.sup.2H) is 46
MHz, a large offset from that of the proton (.sup.1H) which is 300
MHz. Deuterium is a promising nucleus for magnetic resonance in
living systems because of its negligible background signals in
biological tissue, as well as its greater stability compared to
short-lived radio tracers in the localization and quantification of
tissue uptake and deposition.
[0188] The demonstration was performed using deuterated
poly(d4-ethylene glycol) methyl ether as the D-PEG: (Product #
P11450-dPEO-OCH3, Polymer Source, Inc., Dorval (Montreal), Quebec,
Canada). It has the structure shown below. Its Mw is 5,400, with
about 84 monomer units per polymer (i.e., n=84). With four
deuteriums per monomer, there are about 337 deuteriums per polymer.
Thus a 1 mM solution of the D-PEG corresponds to 1 mM in
deuterium.
##STR00014##
[0189] C57Bl/6 mice (n=3) were used, having a body weight of around
20-25 g. They were dosed by a single oral administration of 2, 10,
and 20 mg the D-PEG (in 0.3 mL water), corresponding to 80, 400 and
800 mg/kg body weight. Imaging timepoints were at .about.30 min to
2 hours post-administration and at .about.24 h post-dosing.
[0190] The mice were anesthetized with isoflurane (0.25-2% vol. in
2 liters/min air flow), and a core temperature of approximately
37.8.degree. C. was maintained during MRI. The rectal temperature
and respiration rates were monitored using MR-compatible systems
(SA Instruments, Inc., Stony Brook, N.Y.).
[0191] MRI image acquisition was performed on a 7 Tesla/20 cm
Bruker Biospec system using a 86-mm whole-body .sup.1H RF coil
(Bruker/Biospin, Billerica, Mass.) for proton MRI and a customized
.sup.2H surface coil for Deuterium MRI (.sup.2H MRI). The mice were
placed head-first in the prone position in the system with a
respirator sensor and with the abdomen centered with respect to the
center of the .sup.2H surface coil. Anatomical .sup.1H MRI scout
images of coronal, sagittal and axial views were collected for
slice planning, followed by the .sup.2H MRI of mouse gut, and
anatomical T2-weighted .sup.1H MRI with fat suppression for
co-registration of the .sup.2H-MRI.
[0192] Three dimensional single-shot EPI (FID) was implemented at 7
T system in house, using the following parameters: TR=100 ms;
TE=6.9 ms; Flip_angle=90.degree.; 200 averages;
3.2.times.3.2.times.3.2 cm.sup.3 field of view, and
1.times.1.times.1 mm.sup.3 isotropic resolution. Respiration gating
was applied to minimize the respiration caused motion
artifacts.
[0193] A phantom study was made to understand the dosing limitation
of the D-PEG and the sensitivity of the .sup.2H MRI coil to detect
the .sup.2H signal. Deuterium phantom tubes were made at various
concentrations of D-PEG diluted in water solution (FIGS. 2A-2C).
FIG. 2A is a .sup.2H MRI of phantom tubes with D-PEG concentrations
ranging from 0.05 to .about.1 mM. FIG. 2B is a .sup.2H MRI of
phantom tubes with D-PEG concentrations ranging from 0.5 to
.about.5 mM. FIG. 2C is a .sup.1H MRI (proton MRI) of the tubes.
FIG. 3 shows the correlation between D-PEG concentration and signal
intensity, with excellent linearity.
[0194] FIG. 4 shows the D-MRI imaging of mouse gut 2 h
post-administration (20 mg oral dosing), overlaid on a proton
anatomical MRI, in sagittal, coronal, and axial views.
[0195] FIGS. 5A and 5B show the D MRI imaging of mouse gut 24 h
post-administration (20 mg oral dosing) overlaid on a proton
anatomical MRI image. The D-MRI signal was detected in the cecum
region. Both axial and coronal views are presented.
[0196] FIGS. 6A and 6B is a D-MRI image of rehydrated feces
collected 24 h post-administration (20 mg dose), overlaid on the
proton anatomical MRI, in both axial and coronal views.
EQUIVALENTS
[0197] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents of the specific embodiments described herein. Such
equivalents are intended to be encompassed by the following
claims.
REFERENCES
[0198] Turecek P L, Bossard M J, Schoetens F, Ivens I A, PEGylation
of Biopharmaceuticals: A Review of Chemistry and Nonclinical Safety
Information of Approved Drugs, Journal of Pharmaceutical Sciences
2016; 105:460-475. [0199] Swierczewska M, Lee K C, and Lee S, What
is the future of PEGylated therapies?Expert Opin Emerg Drugs. 2015;
20(4):531-536. [0200] Gant T G, Using Deuterium in Drug Discovery:
Leaving the Label in the Drug. J. Med. Chem. 2014; 57
(9):3595-3611. [0201] Pelham R W, Nix L C, Chavira R E, Cleveland M
V B, and Stetson P., Clinical trial: single- and multiple-dose
pharmacokinetics of polyethylene glycol (PEG-3350) in healthy young
and elderly subjects. Aliment Pharmacol Ther. 2008;
28(2):256-65.
TABLE-US-00002 [0201] TABLE 1 SUMMARY OF SEQUENCES SEQ ID
Description Sequence 1 WT .sup.10Fn3 domain
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF
TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT 2 PDL-1 FBS (A02)
VSDVPRDLEVVAATPTSLLISWSYDGPIDRYYRITYGETGGNSPVQEF
TVPPDQKTATISGLKPGVDYTITVYAVRLEEAHYNREFPISINYRT 3 PDL-1 FBS (E01)
VSDVPRDLEVVAATPTSLLISWRAQLSPSFYYRITYGETGGNSPVQEF
TVPNDVMTATISGLKPGVDYTITVYAVTTHGVYFYSPISINYRT 4 PDL-1 FBS (ATI-964)
VSDVPRDLEVVAATPTSLLISWSYDGSIERYYRITYGETGGNSPVQEF
TVPPDQKTATISGLKPGVDYTITVYAVRLEEAHYYRESPISINYRT 5 PDL-1 FBS
(ATI-965) VSDVPRDLEVVAATPTSLLISWTAYDSVDKYYRITYGETGGNSPVQEF
TVGPRHHTATISGLKPGVDYTITVYAVYHTEPGYHAHMPISINYRT 6 PDL-1 FBS
(ATI-966) VSDVPRDLEVVAATPTSLLISWHRFSSIMAYYRITYGETGGNSPVQEF
TVAGSVNTATISGLKPGVDYTITVYAVTIHNVSFPISINYRT 7 PDL-1 FBS (ATI-967)
VSDVPRDLEVVAATPTSLLISWQGQLSPSFYYRITYGETGGNSPVQEF
TVPVASGTATISGLKPGVDYTITVYAVTSHGIYFYAPISINYRT 8 PDL-1 FBS (ATI-968)
VSDVPRDLEVVAATPTSLLISWIAPFYNVIYYRITYGETGGNSPVQEF
TVPGTGYTATISGLKPGVDYTITVYAVTDGASIASYAFPISINYRT 9 Glypican-3 FBS
VSDVPRDLEVVAATPTSLLISWSDDYHAHRYYRITYGETGGNSPVQEF sequence
TVPGEHVTATISGLKPGVDYTITVYAVTYDGEKAATDWSISINYRTPC
Sequence CWU 1
1
9194PRTArtificial SequenceWT 10Fn3 Domain 1Val Ser Asp Val Pro Arg
Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile Ser
Trp Asp Ala Pro Ala Val Thr Val Arg Tyr Tyr 20 25 30Arg Ile Thr Tyr
Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val Pro
Gly Ser Lys Ser Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly Val
Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Gly Arg Gly Asp65 70 75
80Ser Pro Ala Ser Ser Lys Pro Ile Ser Ile Asn Tyr Arg Thr 85
90294PRTArtificial SequencePDL-1 FBS (A02) 2Val Ser Asp Val Pro Arg
Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile Ser
Trp Ser Tyr Asp Gly Pro Ile Asp Arg Tyr Tyr 20 25 30Arg Ile Thr Tyr
Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val Pro
Pro Asp Gln Lys Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly Val
Asp Tyr Thr Ile Thr Val Tyr Ala Val Arg Leu Glu Glu Ala65 70 75
80His Tyr Asn Arg Glu Phe Pro Ile Ser Ile Asn Tyr Arg Thr 85
90392PRTArtificial SequencePDL1-FBS (E01) 3Val Ser Asp Val Pro Arg
Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile Ser
Trp Arg Ala Gln Leu Ser Pro Ser Phe Tyr Tyr 20 25 30Arg Ile Thr Tyr
Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val Pro
Asn Asp Val Met Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly Val
Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Thr His Gly Val65 70 75
80Tyr Phe Tyr Ser Pro Ile Ser Ile Asn Tyr Arg Thr 85
90494PRTArtificial SequencePDL-1 FBS (ATI-964) 4Val Ser Asp Val Pro
Arg Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile
Ser Trp Ser Tyr Asp Gly Ser Ile Glu Arg Tyr Tyr 20 25 30Arg Ile Thr
Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val
Pro Pro Asp Gln Lys Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly
Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Arg Leu Glu Glu Ala65 70 75
80His Tyr Tyr Arg Glu Ser Pro Ile Ser Ile Asn Tyr Arg Thr 85
90594PRTArtificial SequencePDL-1 FBS (ATI-965) 5Val Ser Asp Val Pro
Arg Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile
Ser Trp Thr Ala Tyr Asp Ser Val Asp Lys Tyr Tyr 20 25 30Arg Ile Thr
Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val
Gly Pro Arg His His Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly
Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Tyr His Thr Glu Pro65 70 75
80Gly Tyr His Ala His Met Pro Ile Ser Ile Asn Tyr Arg Thr 85
90690PRTArtificial SequencePDL-1 FBS (ATI-966) 6Val Ser Asp Val Pro
Arg Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile
Ser Trp His Arg Phe Ser Ser Ile Met Ala Tyr Tyr 20 25 30Arg Ile Thr
Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val
Ala Gly Ser Val Asn Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly
Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Ile His Asn Val65 70 75
80Ser Phe Pro Ile Ser Ile Asn Tyr Arg Thr 85 90792PRTArtificial
SequencePDL-1 FBS (ATI-967) 7Val Ser Asp Val Pro Arg Asp Leu Glu
Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile Ser Trp Gln Gly
Gln Leu Ser Pro Ser Phe Tyr Tyr 20 25 30Arg Ile Thr Tyr Gly Glu Thr
Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val Pro Val Ala Ser
Gly Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly Val Asp Tyr Thr
Ile Thr Val Tyr Ala Val Thr Ser His Gly Ile65 70 75 80Tyr Phe Tyr
Ala Pro Ile Ser Ile Asn Tyr Arg Thr 85 90894PRTArtificial
SequencePDL-1 FBS (ATI-968) 8Val Ser Asp Val Pro Arg Asp Leu Glu
Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile Ser Trp Ile Ala
Pro Phe Tyr Asn Val Ile Tyr Tyr 20 25 30Arg Ile Thr Tyr Gly Glu Thr
Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val Pro Gly Thr Gly
Tyr Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly Val Asp Tyr Thr
Ile Thr Val Tyr Ala Val Thr Asp Gly Ala Ser65 70 75 80Ile Ala Ser
Tyr Ala Phe Pro Ile Ser Ile Asn Tyr Arg Thr 85 90996PRTArtificial
SequenceGlypican-3 FBS sequence 9Val Ser Asp Val Pro Arg Asp Leu
Glu Val Val Ala Ala Thr Pro Thr1 5 10 15Ser Leu Leu Ile Ser Trp Ser
Asp Asp Tyr His Ala His Arg Tyr Tyr 20 25 30Arg Ile Thr Tyr Gly Glu
Thr Gly Gly Asn Ser Pro Val Gln Glu Phe 35 40 45Thr Val Pro Gly Glu
His Val Thr Ala Thr Ile Ser Gly Leu Lys Pro 50 55 60Gly Val Asp Tyr
Thr Ile Thr Val Tyr Ala Val Thr Tyr Asp Gly Glu65 70 75 80Lys Ala
Ala Thr Asp Trp Ser Ile Ser Ile Asn Tyr Arg Thr Pro Cys 85 90
95
* * * * *