U.S. patent application number 16/113814 was filed with the patent office on 2019-01-24 for polynucleotides encoding methylmalonyl-coa mutase.
The applicant listed for this patent is ModernaTX, Inc.. Invention is credited to Paolo Martini, Vladimir Presnyak.
Application Number | 20190022019 16/113814 |
Document ID | / |
Family ID | 57738001 |
Filed Date | 2019-01-24 |
![](/patent/app/20190022019/US20190022019A1-20190124-C00001.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00002.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00003.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00004.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00005.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00006.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00007.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00008.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00009.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00010.png)
![](/patent/app/20190022019/US20190022019A1-20190124-C00011.png)
View All Diagrams
United States Patent
Application |
20190022019 |
Kind Code |
A1 |
Martini; Paolo ; et
al. |
January 24, 2019 |
POLYNUCLEOTIDES ENCODING METHYLMALONYL-CoA MUTASE
Abstract
The disclosure relates to polynucleotides comprising an open
reading frame of linked nucleosides encoding human
methylmalonyl-CoA mutase precursor, human methylmalonyl-CoA mutase
(MCM) mature form, or functional fragments thereof. In some
embodiments, the disclosure includes methods of treating
methylmalonic acidemia in a subject in need thereof comprising
administering an mRNA encoding an MCM polypeptide.
Inventors: |
Martini; Paolo; (Boston,
MA) ; Presnyak; Vladimir; (Cambridge, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ModernaTX, Inc. |
Cambridge |
MA |
US |
|
|
Family ID: |
57738001 |
Appl. No.: |
16/113814 |
Filed: |
August 27, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16002376 |
Jun 7, 2018 |
|
|
|
16113814 |
|
|
|
|
PCT/US2016/067393 |
Dec 16, 2016 |
|
|
|
16002376 |
|
|
|
|
62409343 |
Oct 17, 2016 |
|
|
|
62338478 |
May 18, 2016 |
|
|
|
62338456 |
May 18, 2016 |
|
|
|
62274722 |
Jan 4, 2016 |
|
|
|
62274726 |
Jan 4, 2016 |
|
|
|
62274733 |
Jan 4, 2016 |
|
|
|
62274727 |
Jan 4, 2016 |
|
|
|
62273108 |
Dec 30, 2015 |
|
|
|
62273112 |
Dec 30, 2015 |
|
|
|
62269089 |
Dec 17, 2015 |
|
|
|
62269092 |
Dec 17, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 38/00 20130101;
A61K 9/5123 20130101; A61K 38/52 20130101; A61K 48/005 20130101;
A61P 43/00 20180101; C12N 15/52 20130101; C12Y 504/99002 20130101;
A61P 3/00 20180101; A61K 9/1272 20130101; C12N 9/90 20130101 |
International
Class: |
A61K 9/51 20060101
A61K009/51; A61P 3/00 20060101 A61P003/00; C12N 9/90 20060101
C12N009/90 |
Claims
1-15. (canceled)
16. A messenger RNA (mRNA) comprising: (i) a 5'-terminal cap; (ii)
a 5' untranslated region (UTR); (iii) an open reading frame (ORF)
encoding the human methylmalonyl-CoA mutase (MCM) polypeptide of
SEQ ID NO:208, SEQ ID NO:209, SEQ ID NO:210, SEQ ID NO:211, SEQ ID
NO:212, or SEQ ID NO:213, wherein at least 95% of uracils in the
ORF are 5-methoxyuracils, and wherein the uracil content in the ORF
is below 150% of the theoretical minimum; (iv) a 3' UTR; and (v) a
poly-A tail.
17. The mRNA of claim 16, wherein the uracil content in the ORF is
above 100% of the theoretical minimum.
18. The mRNA of claim 16, wherein the uracil content in the ORF is
between 123% and 125%, between 122% and 126%, between 121% and
127%, between 120% and 128%, between 119% and 129%, between 118%
and 130%, between 117% and 131%, between 116% and 132%, between
115% and 133%, between 114% and 134%, between 113% and 135%,
between 112% and 136%, or between 111% and 137% of the theoretical
minimum.
19. The mRNA of claim 16, wherein the uracil content in the ORF is
between 118% and 129% of the theoretical minimum.
20. The mRNA of claim 16, wherein the ORF encodes the human MCM
polypeptide of SEQ ID NO:213.
21. The mRNA of claim 20, wherein the ORF is at least 80% identical
to the nucleotide sequence of SEQ ID NO:732.
22. The mRNA of claim 20, wherein the ORF is at least 85% identical
to the nucleotide sequence of SEQ ID NO:732.
23. The mRNA of claim 20, wherein the ORF is at least 90% identical
to the nucleotide sequence of SEQ ID NO:732.
24. The mRNA of claim 20, wherein the ORF is at least 95% identical
to the nucleotide sequence of SEQ ID NO:732.
25. The mRNA of claim 20, wherein the ORF is at least 98% identical
to the nucleotide sequence of SEQ ID NO:732.
26. The mRNA of claim 20, wherein the ORF is at least 99% identical
to the nucleotide sequence of SEQ ID NO:732.
27. The mRNA of claim 20, wherein the ORF is 100% identical to the
nucleotide sequence of SEQ ID NO:732.
28. The mRNA of claim 21, wherein the 5' UTR comprises the
nucleotide sequence of SEQ ID NO:215.
29. The mRNA of claim 21, wherein the mRNA comprises the miR-142-3p
binding site depicted in SEQ ID NO:722.
30. The mRNA of claim 21, wherein the 5' terminal cap is Cap1.
31. The mRNA of claim 21, wherein the poly-A tail is 100 residues
in length.
32. The mRNA of claim 27, wherein the 5' UTR comprises the
nucleotide sequence of SEQ ID NO:215.
33. The mRNA of claim 27, wherein the mRNA comprises the miR-142-3p
binding site depicted in SEQ ID NO:722.
34. The mRNA of claim 27, wherein the 5' terminal cap is Cap1.
35. The mRNA of claim 27, wherein the poly-A tail is 100 residues
in length.
36. The mRNA of claim 27, wherein the 5' UTR comprises the
nucleotide sequence of SEQ ID NO:215, wherein the mRNA comprises
the miR-142-3p binding site depicted in SEQ ID NO:722, wherein the
5' terminal cap is Cap1, and wherein the poly-A tail is 100
residues in length.
37. A pharmaceutical composition comprising the mRNA of claim 16
and a pharmaceutically acceptable excipient.
38. A pharmaceutical composition comprising the mRNA of claim 27
and a pharmaceutically acceptable excipient.
39. A pharmaceutical composition comprising the mRNA of claim 36
and a pharmaceutically acceptable excipient.
40. A lipid nanoparticle comprising the mRNA of claim 16.
41. A lipid nanoparticle comprising the mRNA of claim 27.
42. A lipid nanoparticle comprising the mRNA of claim 36.
43. A method of treating methylmalonic acidemia in a human subject
in need thereof, the method comprising administering to the human
subject an effective amount of the pharmaceutical composition of
claim 37.
44. A method of treating methylmalonic acidemia in a human subject
in need thereof, the method comprising administering to the human
subject an effective amount of the pharmaceutical composition of
claim 38.
45. A method of treating methylmalonic acidemia in a human subject
in need thereof, the method comprising administering to the human
subject an effective amount of the pharmaceutical composition of
claim 39.
Description
BACKGROUND OF THE DISCLOSURE
[0001] Methylmalonic acidemia (MMA) is a metabolic disorder
characterized by the abnormal buildup of the metabolic byproduct
methylmalonic acid in patients. MMA causes developmental delay,
intellectual disability, kidney disease, coma, or even death. MMA
is also referred to as methylmalonic aciduria. It has an estimated
incidence of 1 in 50,000 to 100,000. Current treatment for MMA is
primarily via dietary control to limit the usage of metabolic
pathways that lead to methylmalonic acid formation. In serious
cases, kidney and liver transplants have also been performed to
provide a new reservoir of cells that can properly metabolize and
remove the methylmalonic acid. However, none of these treatments
completely or reliably controls the disorder. As such there is a
need for improved therapy to treat MMA.
[0002] The principal gene associated with MMA is methylmalonyl-CoA
mutase (NM_000255; NP_000246; also referred to as MCM or MUT). MCM
is a metabolic enzyme (E.C. 5.4.99.2) that plays a critical role in
the catabolism of various amino acids, fatty acids, and
cholesterol. MCM's biological function is to isomerize
L-methylmalonyl-CoA into succinyl-CoA, a Krebs cycle intermediate.
MCM localizes to the mitochondria of cells, exists as a homodimer
in its native form and is adenosylcobalamin-dependent. The
precursor form of human MCM is 750 amino acids, while its mature
form is 718 amino acids--a 32 amino acid leader sequence is cleaved
off by mitochondrial importation and processing machinery. This
leader sequence is variously referred to as MCM's mitochondrial
targeting peptide, mitochondrial targeting sequence, or
mitochondrial transit peptide.
[0003] A complete or partial loss of MCM function leads to buildup
of abnormal metabolites and metabolic intermediates upstream of
MCM, such as methylmalonic acid, propionyl-carnitine,
acetyl-carnitine, propionyl-CoA, D-methylmalonyl-CoA and
L-methylmalonyl-CoA. For example, loss of MCM has been reported to
lead to a 1000-fold increase in the methylmalonic acid.
Nonetheless, there is no currently available therapeutic to treat
MMA.
SUMMARY OF THE DISCLOSURE
[0004] The present disclosure provides methods of treating
methylmalonic acidemia in a subject, the methods comprising
administering to the subject an effective amount of a
polynucleotide comprising an mRNA encoding an MCM polypeptide,
wherein the administration alleviates the symptoms of methylmalonic
acidemia in the subject. The present disclosure also provides
compositions comprising a polynucleotide sequence encoding an MCM
polypeptide. In some embodiments, the compositions include a
delivery agent.
[0005] In some embodiments, the composition comprises a
polynucleotide that comprises an open reading frame (ORF) encoding
an MCM polypeptide and a delivery agent, wherein the delivery agent
comprises a compound having the formula (I)
##STR00001##
[0006] or a salt or stereoisomer thereof, wherein
[0007] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', -YR'', and --R''M'R';
[0008] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0009] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR,
[0010] --CHQR, --CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl,
where Q is selected from a carbocycle, heterocycle,
--OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --N(R).sub.2,
--C(O)N(R).sub.2, --N(R)C(O)R, --N(R)S(O).sub.2R,
--N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2, and
--C(R)N(R).sub.2C(O)OR, and each n is independently selected from
1, 2, 3, 4, and 5;
[0011] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0012] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0013] M and M' are independently selected from --C(O)O--,
--OC(O)-, --C(O)N(R')--,
[0014] --N(R')C(O)--, --C(O)--, --C(S)--, --C(S)S--, --SC(S)--,
--CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--, an aryl group, and a
heteroaryl group;
[0015] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0016] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0017] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and H;
[0018] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl; [0019] each R* is
independently selected from the group consisting of C.sub.1-12
alkyl and C.sub.2-12 alkenyl; [0020] each Y is independently a
C.sub.3-6 carbocycle; [0021] each X is independently selected from
the group consisting of F, Cl, Br, and I; and [0022] m is selected
from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and provided when R.sub.4
is -(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR, or
--CQ(R).sub.2, then (i) Q is not --N(R).sub.2 when n is 1, 2, 3, 4
or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n
is 1 or 2.
[0023] In some embodiments, the delivery agent further comprises a
phospholipid, a structural lipid, a PEG lipid, or any combination
thereof.
[0024] In some embodiments, the polynucleotides comprise an ORF
having significant sequence similarity to a polynucleotide selected
from the group of SEQ ID NOs: 1-207, 732-765, and 772, wherein the
ORF encodes an MCM polypeptide. In some embodiments, the
polynucleotides comprise an ORF having significant sequence
similarity to a polynucleotide selected from the group of SEQ ID
NOs: 151, 152, 153, 154, 732, 733, and 734 (FIGS. 9-15), wherein
the ORF encodes an MCM polypeptide. In some embodiments, the
polynucleotide comprises an ORF having significant sequence
similarity to SEQ ID NO: 734 (FIG. 11), wherein the ORF encodes an
MCM polypeptide.
[0025] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 99% or 100%
sequence identity to nucleotide 97 to nucleotide 2250 of SEQ ID NO:
734, wherein the ORF encodes an MCM polypeptide.
[0026] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF sequence having at least 98%, at
least 99%, or 100% sequence identity to nucleotide 97 to nucleotide
2250 of SEQ ID NO: 732, wherein the ORF encodes an MCM
polypeptide.
[0027] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 97 to nucleotides 2250 of
SEQ ID NOs: 182, 733, and 741, wherein the ORF encodes an MCM
polypeptide.
[0028] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 97 to
nucleotides 2250 of SEQ ID NOs: 735, 736, 738, 743, 744, 748, 749,
750, 754, 755, 758, 762, and 765, wherein the ORF encodes an MCM
polypeptide.
[0029] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF sequence having at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 180, 187, 737,
739, 740, 742, 745, 746, 747, 751, 752, 753, 757, 759, 760, 761,
763, and 764, wherein the ORF encodes an MCM polypeptide.
[0030] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 89%, at least 90%,
at least 91%, at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97%, at least 98%, at least 99%, or
100% sequence identity to a sequence selected from the group
consisting of nucleotides 97 to nucleotides 2250 of SEQ ID NO: 181
and 756, wherein the ORF encodes an MCM polypeptide.
[0031] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% sequence identity to a sequence selected from
the group consisting of nucleotides 97 to nucleotides 2250 of SEQ
ID NO: 154, 165, 171, 173, and 175, wherein the ORF encodes an MCM
polypeptide.
[0032] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 97 to nucleotides
2250 of SEQ ID NO: 151, 152, 153, 163, 164, 166, 167, 168, 169,
170, 172, 177, 178, 179, 195, and 204, wherein the ORF encodes an
MCM polypeptide.
[0033] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 86%, at least 87%,
at least 88%, at least 89%, at least 90%, at least 91%, at least
92%, at least 93%, at least 94%, at least 95%, at least 96%, at
least 97%, at least 98%, at least 99%, or 100% sequence identity to
a sequence selected from the group consisting of nucleotides 97 to
nucleotides 2250 of SEQ ID NOs: 156, 157, 158, 159, 160, 161, 162,
174 and 176, wherein the ORF encodes an MCM polypeptide.
[0034] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 85%, at least 86%,
at least 87%, at least 88%, at least 89%, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 155 and 203,
wherein the ORF encodes an MCM polypeptide.
[0035] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 82%, at least 83%,
at least 84%, at least 85%, at least 86%, at least 87%, at least
88%, at least 89%, at least 90%, at least 91%, at least 92%, at
least 93%, at least 94%, at least 95%, at least 96%, at least 97%,
at least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 97 to nucleotides
2250 of SEQ ID NOs: 64, 66, 71, 91, and 128, wherein the ORF
encodes an MCM polypeptide.
[0036] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 81%, at least 82%,
at least 83%, at least 84%, at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98%, at least 99%, or 100% sequence identity
to a sequence selected from the group consisting of nucleotides 97
to nucleotides 2250 of SEQ ID NOs: 9, 11, 18, 19, 21, 22, 23, 24,
32, 33, 37, 39, 40, 44, 45, 47, 50, 51, 52, 55, 57, 61, 65, 70, 79,
84, 86, 88, 90, 92, 98, 100, 115, 117, 126, 129, 135, 136, 137,
144, 148, 150, 184, 190, 191, and 206, wherein the ORF encodes an
MCM polypeptide.
[0037] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 80%, at least 81%,
at least 82%, at least 83%, at least 84%, at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 3, 5, 6, 8,
10, 12, 14, 16, 17, 20, 27, 28, 29, 31, 34, 35, 36, 38, 41, 42, 43,
46, 48, 49, 53, 54, 56, 58, 60, 63, 68, 69, 74, 77, 78, 80, 83, 85,
87, 93, 95, 96, 97, 99, 102, 103, 104, 105, 107, 110, 112, 113,
114, 116, 119, 120, 122, 123, 124, 125, 127, 131, 132, 133, 134,
138, 139, 140, 141, 142, 143, 147, 149, 183, 186, 188, 189, 192,
193, 194, 196, 197, 198, 199, 200, 201, 202, 205, and 207, wherein
the ORF encodes an MCM polypeptide.
[0038] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 79%, at least 80%,
at least 81%, at least 82%, at least 83%, at least 84%, at least
85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% sequence identity to a sequence selected from the
group consisting of nucleotides 97 to nucleotides 2250 of SEQ ID
NOs: 1, 2, 4, 7, 13, 15, 25, 26, 30, 59, 62, 67, 72, 73, 75, 76,
81, 82, 89, 94, 101, 106, 108, 109, 111, 118, 121, 130, 145, 146,
and 185, wherein the ORF encodes an MCM polypeptide.
[0039] In some embodiments, the polynucleotides further comprise a
nucleotide sequence encoding a transit peptide, e.g., mitochondrial
transit peptide. The mitochondrial transit peptide can be any
peptide that facilitates the transport of MCM to mitochondria or
localization of MCM in mitochondria. In some embodiments, the
polynucleotide comprises a nucleotide sequence encoding a
mitochondrial transit peptide selected from the group listed in
Table 1 (SEQ ID NOs: 251 to 265). In some embodiments, the
polynucleotide comprises a nucleotide sequence encoding a
mitochondrial transit peptide selected from the group consisting of
SEQ ID NOs: 270 to 719.
[0040] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 99% or 100%
sequence identity to nucleotide 1 to nucleotide 2250 of SEQ ID NO:
734, wherein the ORF encodes an MCM polypeptide.
[0041] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 98%, at least 99%,
or 100% sequence identity to nucleotide 1 to nucleotide 2250 of SEQ
ID NO: 732, wherein the ORF encodes an MCM polypeptide.
[0042] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 1 to nucleotides 2250 of
SEQ ID NO: 182 and 733, wherein the ORF encodes an MCM
polypeptide.
[0043] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 1 to
nucleotides 2250 of SEQ ID NOs: 735, 741, 743, 744, 748, 758, 762,
and 765, wherein the ORF encodes an MCM polypeptide.
[0044] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% sequence
identity to a sequence selected from the group consisting of
nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 180, 181 , 736,
738, 739, 740, 742, 746, 747, 749, 750, 751, 752, 753, 754, 755,
757, 759, 760, 761, and 763, wherein the ORF encodes an MCM
polypeptide.
[0045] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 89%, at least 90%,
at least 91%, at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97%, at least 98%, at least 99%, or
100% sequence identity to a sequence selected from the group
consisting of nucleotides 1 to nucleotides 2250 of SEQ ID NO: 745,
756, and 764, wherein the ORF encodes an MCM polypeptide.
[0046] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% sequence identity to a sequence selected from
the group consisting of nucleotides 1 to nucleotides 2250 of SEQ ID
NO: 154, 165, 171, 173, and 175, wherein the ORF encodes an MCM
polypeptide.
[0047] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 1 to nucleotides
2250 of SEQ ID NO: 151, 152, 153, 163, 166, 167, 168, 169, 170,
172, 177, 178, 179, 187, and 204, wherein the ORF encodes an MCM
polypeptide.
[0048] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 86%, at least 87%,
at least 88%, at least 89%, at least 90%, at least 91%, at least
92%, at least 93%, at least 94%, at least 95%, at least 96%, at
least 97%, at least 98%, at least 99%, or 100% sequence identity to
a sequence selected from the group consisting of nucleotides 1 to
nucleotides 2250 of SEQ ID NO: 156, 157, 158, 159, 160, 162, 164,
174, 176, 195, and 737, wherein the ORF encodes an MCM
polypeptide.
[0049] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 85%, at least 86%,
at least 87%, at least 88%, at least 89%, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 155, 161, and
203, wherein the ORF encodes an MCM polypeptide.
[0050] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 82%, at least 83%,
at least 84%, at least 85%, at least 86%, at least 87%, at least
88%, at least 89%, at least 90%, at least 91%, at least 92%, at
least 93%, at least 94%, at least 95%, at least 96%, at least 97%,
at least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 1 to nucleotides
2250 of SEQ ID NOs: 71 and 128, wherein the ORF encodes an MCM
polypeptide.
[0051] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 81%, at least 82%,
at least 83%, at least 84%, at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98%, at least 99%, or 100% sequence identity
to a sequence selected from the group consisting of nucleotides 1
to nucleotides 2250 of SEQ ID NOs: 4, 6, 8, 9, 11, 19, 22, 23, 24,
32, 33, 37, 40, 44, 45, 47, 51, 61, 64, 65, 66, 79, 84, 86, 90, 91,
92, 100, 101, 112, 115, 117, 126, 129, 135, 136, 146, 148, 184,
190, and 191, wherein the ORF encodes an MCM polypeptide.
[0052] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 80%, at least 81%,
at least 82%, at least 83%, at least 84%, at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 2, 3, 5, 7, 10,
12, 13, 14, 15, 16, 18, 20, 21, 26, 27, 28, 29, 31, 34, 36, 38, 39,
41, 42, 43, 46, 48, 49, 52, 53, 54, 55, 56, 57, 58, 59, 60, 62, 68,
69, 70, 72, 73, 74, 76, 77, 80, 83, 85, 88, 95, 96, 97, 98, 102,
104, 105, 106, 107, 108, 109, 110, 113, 114, 120, 121, 122, 123,
124, 127, 131, 132, 133, 134, 137, 138, 139, 140, 141, 142, 144,
145, 147, 149, 150, 186, 188, 189, 192, 193, 194, 196, 198, 199,
200, 202, 205, 206, and 207, wherein the ORF encodes an MCM
polypeptide.
[0053] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 79%, at least 80%,
at least 81%, at least 82%, at least 83%, at least 84%, at least
85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% sequence identity to a sequence selected from the
group consisting of nucleotides 1 to nucleotides 2250 of SEQ ID
NOs: 1, 17, 25, 30, 35, 50, 63, 67, 75, 78, 81, 82, 87, 89, 93, 94,
99, 103, 111, 116, 118, 119, 125, 130, 143, 183, 185, 197, and 201,
wherein the ORF encodes an MCM polypeptide.
[0054] In some embodiments, the disclosure is directed to
polynucleotides that encode functional MCMs or fragments thereof.
In some embodiments, the disclosure provides polynucleotides that
encode functional human MCMs (SEQ ID NO: 208, SEQ ID NO: 209, SEQ
ID NO: 210, SEQ ID NO: 211, SEQ ID NO: 212, and SEQ ID NO: 213). In
some embodiments, the disclosure provides polynucleotides that
encode functional MCM polypeptides having at least one point
mutation in the MCM sequence, while still retaining MCM enzymatic
activity. In some embodiments, the encoded MCM polypeptide
comprises one or more of the point mutations V69, T499, H532, A598,
and V671, as defined by the polypeptide sequences in SEQ ID NO:
209, SEQ ID NO: 210, SEQ ID NO: 211, SEQ ID NO: 212, and SEQ ID NO:
213, respectively. In some embodiments, the polynucleotides are
fully or partially modified (e.g., chemically and/or structurally)
in a manner as to avoid the deficiencies of other molecules of the
art. The polynucleotides of the disclosure can be synthesized as an
IVT polynucleotide, chimeric polynucleotide or a circular
polynucleotide and such embodiments are contemplated.
[0055] In some embodiments, the polynucleotide is a DNA or RNA that
comprises at least one chemically modified nucleoside. In some
embodiments, the at least one chemically modified nucleoside is
selected from any of those described herein.
[0056] In some embodiments, the polynucleotide further comprises or
encodes a 5' UTR. In other embodiments, the polynucleotide further
comprises or encodes a 3' UTR. In some embodiments, the UTR
comprises or encodes a miRNA (e.g., miR-142-3p, miR-142-5p,
miR-126-3p, and/or miR-126-5p). In some embodiments, the
polynucleotide further comprises a 5' terminal cap. In some
embodiments, the polynucleotide further comprises or encodes a 3'
polyA tail.
[0057] In some embodiments, the polynucleotide is RNA, e.g., mRNA.
In some embodiments, the mRNA comprises the sequences listed in SEQ
ID NOs: 766-771.
[0058] In some embodiments, the polynucleotide is an RNA
polynucleotide that is formulated in a lipid nanoparticle (LNP)
carrier.
[0059] The disclosure is also directed to a method of treating
methylmalonic acidemia in a subject, the method comprising
administering to the subject an effective amount of a
polynucleotide comprising an mRNA encoding an MCM polypeptide,
wherein the administration alleviates the symptoms of methylmalonic
acidemia in the subject. In some embodiments, the polynucleotide
useful for the disclosure is any one of the polynucleotides
encoding an MCM polypeptide described herein or is formulated as
any one of the compositions described herein.
[0060] In some embodiments, the disclosure includes a method of
reducing the level of a metabolite associated with methylmalonic
acidemia in a subject in need thereof, the method comprising
administering to the subject an effective amount of a
polynucleotide comprising an mRNA encoding an MCM polypeptide. In
some embodiments, the polynucleotide is a polynucleotide described
elsewhere herein, or is formulated as a composition described
herein. In certain embodiments, the polynucleotide reduces the
level of methylmalonic acid present in the subject after the
administration by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%. In other embodiments, after the administration, the
polynucleotide reduces the level of propionyl-carnitine present in
the subject by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%. In yet other embodiments, the polynucleotide reduces
the level of acetyl-carnitine present in the subject after the
administration by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%. In certain embodiments, one or more metabolites
associated with methylmalonic acidemia are reduced after the
administration within one day, within two days, within three days,
within four days, within five days, within seven days, within one
week, within two weeks, within three weeks, or within one month of
the administration of the polynucleotide.
[0061] The details of various embodiments of the disclosure are set
forth in the description below. Other features, objects, and
advantages of the disclosure will be apparent from the description
and the drawings, and from the claims.
Embodiments
[0062] E1. A composition comprising a polynucleotide that comprises
an open reading frame (ORF) encoding an MCM polypeptide and a
delivery agent, wherein the delivery agent comprises a compound
having the formula (I)
##STR00002##
[0063] or a salt or stereoisomer thereof, wherein
[0064] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0065] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0066] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a carbocycle, heterocycle,
--OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --N(R).sub.2,
--C(O)N(R).sub.2, --N(R)C(O)R, --N(R)S(O).sub.2R,
--N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2, and
--C(R)N(R).sub.2C(O)OR, and each n is independently selected from
1, 2, 3, 4, and 5;
[0067] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0068] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0069] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--,
[0070] --N(R')C(O)--, --C(O)--, --C(S)--, --C(S)S--, --SC(S)--,
--CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--, an aryl group, and a
heteroaryl group;
[0071] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0072] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0073] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and H;
[0074] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl; [0075] each R* is
independently selected from the group consisting of C.sub.1-12
alkyl and C.sub.2-12 alkenyl; [0076] each Y is independently a
C.sub.3-6 carbocycle; [0077] each X is independently selected from
the group consisting of F, Cl, Br, and I; and [0078] m is selected
from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and provided when R.sub.4
is --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR, or
--CQ(R).sub.2, then (i) Q is not --N(R).sub.2 when n is 1, 2, 3, 4
or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n
is 1 or 2.
[0079] E2. The composition of embodiment 1, wherein the ORF has at
least 80%, at least 85%, at least 86%, at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 97 to nucleotides
2250 of SEQ ID NOs: 1 to 207, 732 to 765, and 772.
[0080] E3. The composition of embodiment 1 or 2, wherein the ORF
has
[0081] (i) at least 99% or 100% sequence identity to nucleotide 97
to nucleotide 2250 of SEQ ID NO: 734,
[0082] (ii) at least 98%, at least 99%, or 100% sequence identity
to nucleotide 97 to nucleotide 2250 of SEQ ID NO: 732,
[0083] (iii) at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97%, at least 98%, at least 99%, or
100% sequence identity to a sequence selected from the group
consisting of nucleotides 97 to nucleotides 2250 of SEQ ID NOs:
182, 733, and 741;
[0084] (iv) at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% sequence identity to a sequence selected from the
group consisting of nucleotides 97 to nucleotides 2250 of SEQ ID
NOs: 735, 736, 738, 743, 744, 748, 749, 750, 754, 755, 758, 762,
and 765;
[0085] (v) at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 97 to nucleotides 2250 of
SEQ ID NOs: 180, 187, 737, 739, 740, 742, 745, 746, 747, 751, 752,
753, 757, 759, 760, 761, 763, and 764;
[0086] (vi) at least 89%, at least 90%, at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 97 to
nucleotides 2250 of SEQ ID NOs: 181 and 756;
[0087] (vii) at least 88%, at least 89%, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 97 to nucleotides 2250 of SEQ ID NO: 154, 165, 171,
173, and 175;
[0088] (viii) at least 87%, at least 88%, at least 89%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
or 100% sequence identity to a sequence selected from the group
consisting of nucleotides 97 to nucleotides 2250 of SEQ ID NO: 151,
152, 153, 163, 164, 166, 167, 168, 169, 170, 172, 177, 178, 179,
195, and 204;
[0089] (ix) at least 86%, at least 87%, at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% sequence identity to a sequence selected from
the group consisting of nucleotides 97 to nucleotides 2250 of SEQ
ID NOs: 156, 157, 158, 159, 160, 161, 162, 174 and 176;
[0090] (x) at least 85%, at least 86%, at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 97 to nucleotides
2250 of SEQ ID NOs: 155 and 203;
[0091] (xi) at least 82%, at least 83%, at least 84%, at least 85%,
at least 86%, at least 87%, at least 88%, at least 89%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
or 100% sequence identity to a sequence selected from the group
consisting of nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 64,
66, 71, 91, and 128;
[0092] (xii) at least 81%, at least 82%, at least 83%, at least
84%, at least 85%, at least 86%, at least 87%, at least 88%, at
least 89%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 97 to nucleotides 2250 of
SEQ ID NOs: 9, 11, 18, 19, 21, 22, 23, 24, 32, 33, 37, 39, 40, 44,
45, 47, 50, 51, 52, 55, 57, 61, 65, 70, 79, 84, 86, 88, 90, 92, 98,
100, 115, 117, 126, 129, 135, 136, 137, 144, 148, 150, 184, 190,
191, and 206;
[0093] (xiii) at least 80%, at least 81%, at least 82%, at least
83%, at least 84%, at least 85%, at least 86%, at least 87%, at
least 88%, at least 89%, at least 90%, at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 97 to
nucleotides 2250 of SEQ ID NOs: 3, 5, 6, 8, 10, 12, 14, 16, 17, 20,
27, 28, 29, 31, 34, 35, 36, 38, 41, 42, 43, 46, 48, 49, 53, 54, 56,
58, 60, 63, 68, 69, 74, 77, 78, 80, 83, 85, 87, 93, 95, 96, 97, 99,
102, 103, 104, 105, 107, 110, 112, 113, 114, 116, 119, 120, 122,
123, 124, 125, 127, 131, 132, 133, 134, 138, 139, 140, 141, 142,
143, 147, 149, 183, 186, 188, 189, 192, 193, 194, 196, 197, 198,
199, 200, 201, 202, 205, and 207; or
[0094] (xiv) at least 79%, at least 80%, at least 81%, at least
82%, at least 83%, at least 84%, at least 85%, at least 86%, at
least 87%, at least 88%, at least 89%, at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% sequence
identity to a sequence selected from the group consisting of
nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 1, 2, 4, 7, 13,
15, 25, 26, 30, 59, 62, 67, 72, 73, 75, 76, 81, 82, 89, 94, 101,
106, 108, 109, 111, 118, 121, 130, 145, 146, and 185.
[0095] E4. The composition of any one of embodiments 1 to 3,
wherein the ORF further comprises a nucleic acid sequence encoding
a transit peptide.
[0096] E5. The composition of embodiment 4, wherein the transit
peptide comprises a mitochondrial transit peptide.
[0097] E6. The composition of embodiment 5, wherein the
mitochondrial transit peptide is derived from a protein selected
from the group consisting of SEQ ID NOs: 251 to 265 and 270 to
719.
[0098] E7. The composition of any one of embodiments 4 to 6,
wherein the nucleic acid sequence encoding a transit peptide has at
least about 70%, at least about 80%, at least about 90%, at least
about 95%, at least about 96%, at least about 97%, at least about
98%, at least about 99%, or about 100% sequence identity to a
sequence selected from the group consisting of nucleotides 1 to 96
of SEQ ID NOs: 1 to 207, 732 to 765, and 772.
[0099] E8. The composition of any one of embodiments 1 to 7,
wherein the ORF has
[0100] (i) at least 99% or 100% sequence identity to nucleotide 1
to nucleotide 2250 of SEQ ID NO: 734;
[0101] (ii) at least 98%, at least 99%, or 100% sequence identity
to nucleotide 1 to nucleotide 2250 of SEQ ID NO: 732;
[0102] (iii) at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97%, at least 98%, at least 99%, or
100% sequence identity to a sequence selected from the group
consisting of nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 182
and 733;
[0103] (iv) at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% sequence identity to a sequence selected from the
group consisting of nucleotides 1 to nucleotides 2250 of SEQ ID
NOs: 735, 741, 743, 744, 748, 758, 762, and 765;
[0104] (v) at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 1 to nucleotides 2250 of
SEQ ID NOs: 180, 181, 736, 738, 739, 740, 742, 746, 747, 749, 750,
751, 752, 753, 754, 755, 757, 759, 760, 761, and 763;
[0105] (vi) at least 89%, at least 90%, at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 1 to
nucleotides 2250 of SEQ ID NO: 745, 756, and 764;
[0106] (vii) at least 88%, at least 89%, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 1 to nucleotides 2250 of SEQ ID NO: 154, 165, 171,
173, and 175;
[0107] (viii) at least 87%, at least 88%, at least 89%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
or 100% sequence identity to a sequence selected from the group
consisting of nucleotides 1 to nucleotides 2250 of SEQ ID NO: 151,
152, 153, 163, 166, 167, 168, 169, 170, 172, 177, 178, 179, 187,
and 204;
[0108] (ix) at least 86%, at least 87%, at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% sequence identity to a sequence selected from
the group consisting of nucleotides 1 to nucleotides 2250 of SEQ ID
NO: 156, 157, 158, 159, 160, 162, 164, 174, 176, 195, and 737;
[0109] (x) at least 85%, at least 86%, at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 1 to nucleotides
2250 of SEQ ID NOs: 155, 161, and 203;
[0110] (xi) at least 82%, at least 83%, at least 84%, at least 85%,
at least 86%, at least 87%, at least 88%, at least 89%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
or 100% sequence identity to a sequence selected from the group
consisting of nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 71
and 128;
[0111] (xii) at least 81%, at least 82%, at least 83%, at least
84%, at least 85%, at least 86%, at least 87%, at least 88%, at
least 89%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 1 to nucleotides 2250 of
SEQ ID NOs: 4, 6, 8, 9, 11, 19, 22, 23, 24, 32, 33, 37, 40, 44, 45,
47, 51, 61, 64, 65, 66, 79, 84, 86, 90, 91, 92, 100, 101, 112, 115,
117, 126, 129, 135, 136, 146, 148, 184, 190, and 191;
[0112] (xiii) at least 80%, at least 81%, at least 82%, at least
83%, at least 84%, at least 85%, at least 86%, at least 87%, at
least 88%, at least 89%, at least 90%, at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 1 to
nucleotides 2250 of SEQ ID NOs: 2, 3, 5, 7, 10, 12, 13, 14, 15, 16,
18, 20, 21, 26, 27, 28, 29, 31, 34, 36, 38, 39, 41, 42, 43, 46, 48,
49, 52, 53, 54, 55, 56, 57, 58, 59, 60, 62, 68, 69, 70, 72, 73, 74,
76, 77, 80, 83, 85, 88, 95, 96, 97, 98, 102, 104, 105, 106, 107,
108, 109, 110, 113, 114, 120, 121, 122, 123, 124, 127, 131, 132,
133, 134, 137, 138, 139, 140, 141, 142, 144, 145, 147, 149, 150,
186, 188, 189, 192, 193, 194, 196, 198, 199, 200, 202, 205, 206,
and 207; or
[0113] (xiv) at least 79%, at least 80%, at least 81%, at least
82%, at least 83%, at least 84%, at least 85%, at least 86%, at
least 87%, at least 88%, at least 89%, at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% sequence
identity to a sequence selected from the group consisting of
nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 1, 17, 25, 30, 35,
50, 63, 67, 75, 78, 81, 82, 87, 89, 93, 94, 99, 103, 111, 116, 118,
119, 125, 130, 143, 183, 185, 197, and 201.
[0114] E9. The composition of any one of embodiments 1 to 8,
wherein the MCM polypeptide comprises an amino acid sequence at
least about 95%, at least about 96%, at least about 97%, at least
about 98%, at least about 99%, or about 100% identical to SEQ ID
NO: 208, and wherein the MCM polypeptide retains methylmalonyl-CoA
mutase activity.
[0115] E10. The composition of embodiment 9, wherein the MCM
polypeptide comprises SEQ ID NO: 209.
[0116] E11. The composition of embodiment 9, wherein the MCM
polypeptide comprises SEQ ID NO: 210.
[0117] E12. The composition of embodiment 9, wherein the MCM
polypeptide comprises SEQ ID NO: 211.
[0118] E13. The composition of embodiment 9, wherein the MCM
polypeptide comprises SEQ ID NO: 212.
[0119] E14. The composition of embodiment 9, wherein the MCM
polypeptide comprises SEQ ID NO: 213.
[0120] E15. The composition of any one of embodiments 1-14, wherein
the polynucleotide comprises at least one chemically modified
nucleobase, sugar, backbone, or any combination thereof.
[0121] E16. The composition of embodiment 15, wherein the at least
one chemically modified nucleobase is selected from the group
consisting of pseudouracil (w), methylpseudouracil (mlw),
2-thiouracil (s2U), 4'-thiouracil, 5-methylcytosine,
5-methyluracil, and any combination thereof.
[0122] E17. The composition of embodiment 16, wherein the at least
one chemically modified nucleoside is 5-methoxyuracil.
[0123] E18. The composition of any one of embodiments 1-17, wherein
the nucleosides in the polynucleotide sequence are chemically
modified by at least 10%, at least 20%, at least 30%, at least 40%,
at least 50%, at least 60%, at least 70%, at least 80%, at least
90%, at least 95%, at least 99%, or 100%.
[0124] E19. The composition of any one of embodiments 15-18,
wherein the chemically modified nucleosides in the polynucleotide
sequence are selected from the group consisting of uridine,
adenine, cytosine, guanine, and any combination thereof.
[0125] E20. The composition of any one of embodiments 1-19, wherein
the uridine nucleosides in the polynucleotide sequence are
chemically modified by at least 10%, at least 20%, at least 30%, at
least 40%, at least 50%, at least 60%, at least 70%, at least 80%,
at least 90%, at least 95%, at least 99%, or 100%.
[0126] E21. The composition of any one of embodiments 1-20, wherein
the adenine nucleosides in the polynucleotide sequence are
chemically modified by at least 10%, at least 20%, at least 30%, at
least 40%, at least 50%, at least 60%, at least 70%, at least 80%,
at least 90%, at least 95%, at least 99%, or 100%.
[0127] E22. The composition of any one of embodiments 1-21, wherein
the cytosine nucleosides in the polynucleotide sequence are
chemically modified by at least at least 10%, at least 20%, at
least 30%, at least 40%, at least 50%, at least 60%, at least 70%,
at least 80%, at least 90%, at least 95%, at least 99%, or
100%.
[0128] E23. The composition of any one of embodiments 1-22, wherein
the guanine nucleosides in the polynucleotide sequence are
chemically modified by at least at least 10%, at least 20%, at
least 30%, at least 40%, at least 50%, at least 60%, at least 70%,
at least 80%, at least 90%, at least 95%, at least 99%, or
100%.
[0129] E24. The composition of any one of embodiments 1-23, wherein
the polynucleotide further comprises a 5' UTR.
[0130] E25. The composition of embodiment 24, wherein the 5' UTR
comprises a nucleic acid sequence at least 90%, 95%, 96%, 97%, 98%,
99%, or 100% identical to a sequence selected from SEQ ID NOs:
215-231, 266, and 725-731.
[0131] E26. The composition of any one of embodiments 1 to 25,
wherein the polynucleotide further comprises a miRNA binding
site.
[0132] E27. The composition of embodiment 26, wherein the miRNA
binding site comprises one or more polynucleotide sequences
selected SEQ ID NOs: 720, 721, 722, 723, and 724.
[0133] E28. The composition of embodiment 26, wherein the miRNA
binding site binds to miR-142 or miR-126.
[0134] E29. The composition of embodiment 26, wherein the miRNA
binding site binds to miR-142-3p, miR-142-5p, miR-126-3p, or
miR-126-5p.
[0135] E30. The composition of embodiment 24, wherein the 5'UTR
comprises a sequence selected from SEQ ID NOs: 725, 726, 727, 728,
729, 730, and 731.
[0136] E31. The composition of any one of embodiments 24-30,
wherein the 5' UTR is sequence optimized.
[0137] E32. The composition of any one of embodiments 1-31, wherein
the polynucleotide further comprises a 3' UTR.
[0138] E33. The composition of embodiment 32, wherein the 3' UTR
comprises a nucleic acid sequence at least 90%, 95%, 96%, 97%, 98%,
99%, or 100% identical to a sequence selected from SEQ ID NO:
232-248 and 267.
[0139] E34. The composition of embodiment 32 or 33, wherein the 3'
UTR is codon optimized.
[0140] E35. The composition of any one of embodiments 1-34, wherein
the polynucleotide further comprises a 5' terminal cap.
[0141] E36. The composition of embodiment 35, wherein the 5'
terminal cap is a Cap0, Cap1, ARCA, inosine, N1-methyl-guanosine,
2'fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine,
2-amino-guanosine, LNA-guanosine, 2-azidoguanosine, Cap2, Cap4, 5'
methylG cap, or an analog thereof.
[0142] E37. The composition of any one of embodiments 1-36, wheren
the polynucleotide further comprises a 3' polyA tail.
[0143] E38. The composition of any one of embodiments 1-37, wherein
the polynucleotide is RNA.
[0144] E39. The composition of embodiment 38, wherein the RNA is
mRNA.
[0145] E40. The composition of any one of embodiments 1-39, wherein
the polynucleotide is in vitro transcribed (IVT).
[0146] E41. The composition of any one of embodiments 1-40, wherein
the polynucleotide is chimeric.
[0147] E42. The composition of any one of embodiments 1-41, wherein
the polynucleotide is circular.
[0148] E43. The composition of any one of embodiments 1-42, wherein
the polynucleotide is purified by strong anion exchange HPLC, weak
anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic
interaction HPLC (HIC-HPLC), liquid chromatography-mass
spectrometry (LCMS), capillary electrophoresis (CE) and capillary
gel electrophoresis (CGE).
[0149] E44. The composition of any one of embodiments 1-43, wherein
the compound is of Formula (IA):
##STR00003##
[0150] or a salt or stereoisomer thereof, wherein
[0151] l is selected from 1, 2, 3, 4, and 5;
[0152] m is selected from 5, 6, 7, 8, and 9;
[0153] M.sub.1 is a bond or M';
[0154] R.sub.4 is unsubstituted C.sub.1-3 alkyl, or
--(CH.sub.2).sub.nQ, in which n is 1, 2, 3, 4, or 5 and Q is OH,
--NHC(S)N(R).sub.2, or --NHC(O)N(R).sub.2;
[0155] M and M' are independently selected from C(O)O , OC(O) ,
C(O)N(R') , P(O)(OR')O, an aryl group, and a heteroaryl group;
and
[0156] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, and C.sub.2-14
alkenyl.
[0157] E45. The composition of any one of embodiments 1 to 44,
wherein m is 5, 7, or 9.
[0158] E46. The composition of any one of embodiments 1 to 45,
wherein the compound is of Formula (II):
##STR00004##
[0159] or a salt or stereoisomer thereof, wherein
[0160] l is selected from 1, 2, 3, 4, and 5;
[0161] M.sub.1 is a bond or M';
[0162] R.sub.4 is unsubstituted C.sub.1-3 alkyl, or
--(CH.sub.2).sub.nQ, in which n is 2, 3, or 4 and Q is OH,
--NHC(S)N(R).sub.2, or --NHC(O)N(R).sub.2;
[0163] M and M' are independently selected from --C(O)O, OC(O),
C(O)N(R'), P(O)(OR')O, an aryl group, and a heteroaryl group;
and
[0164] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, and C.sub.2-14
alkenyl.
[0165] E47. The composition of any one of embodiments 44 to 46,
wherein M.sub.1 is M'.
[0166] E48. The composition of embodiment 47, wherein M and M' are
independently --C(O)O-- or --OC(O)--.
[0167] E49. The composition of any one of embodiments 44 to 48,
wherein 1 is 1, 3, or 5.
[0168] E50. The composition of any one of embodiments 1 to 43,
wherein the compound is selected from the group consisting of
Compound 1 to Compound 147, salts and stereoisomers thereof, and
any combination thereof.
[0169] E51. The composition of any one of embodiments 1 to 43,
wherein the compound is of the Formula (IIa),
##STR00005##
or a salt or stereoisomer thereof.
[0170] E52. The composition of any one of embodiments 1 to 43,
wherein the compound is of the Formula (IIb),
##STR00006##
or a salt or stereoisomer thereof.
[0171] E53. The composition of any one of embodiments 1 to 43,
wherein the compound is of the Formula (IIc) or (IIe),
##STR00007##
[0172] or a salt or stereoisomer thereof.
[0173] E54. The composition of any one of embodiments 51 to 53,
wherein R.sub.4 is selected from --(CH.sub.2).sub.nQ and
--(CH.sub.2).sub.nCHQR.
[0174] E55. The composition of any one of embodiments 1 to 43,
wherein the compound is of the Formula (IId),
##STR00008##
or a salt or stereoisomer thereof,
[0175] wherein R.sub.2 and R.sub.3 are independently selected from
the group consisting of C.sub.5-14 alkyl and C.sub.5-14 alkenyl, n
is selected from 2, 3, and 4, and R', R'', R.sub.5, R.sub.6 and m
are as defined in embodiment 1.
[0176] E56. The composition of embodiment 55, wherein R.sub.2 is
C.sub.8 alkyl.
[0177] E57. The composition of embodiment 56, wherein R.sub.3 is
C.sub.5 alkyl, C.sub.6 alkyl, C.sub.7 alkyl, C.sub.8 alkyl, or
C.sub.9 alkyl.
[0178] E58. The composition of any one of embodiments 55 to 57,
wherein m is 5, 7, or 9.
[0179] E59. The composition of any one of embodiments 55 to 58,
wherein each R.sub.5 is H.
[0180] E60. The composition of embodiment 59, wherein each R.sub.6
is H.
[0181] E61. The composition of any one of embodiments 1 to 60,
wherein the composition is a nanoparticle composition.
[0182] E62. The composition of embodiment 61, wherein the delivery
agent further comprises a phospholipid.
[0183] E63. The composition of embodiment 62, wherein the
phospholipid is selected from the group consisting of
1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC),
1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC),
1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC),
1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-di
stearoyl-sn-glycero-3-phosphocholine (DSPC),
1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC),
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC),
1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC),
1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine
(OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC),
1,2-dilinolenoyl-sn-glycero-3-phosphocholine,
1,2-diarachidonoyl-sn-glycero-3-phosphocholine,
1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine,
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE),
1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16:0 PE),
1,2-di stearoyl-sn-glycero-3-phosphoethanolamine,
1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine,
1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine,
1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine,
1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine,
1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt
(DOPG), sphingomyelin, and any mixtures thereof.
[0184] E64. The composition of any one of embodiments 1 to 63,
wherein the delivery agent further comprises a structural
lipid.
[0185] E65. The composition of embodiment 64, wherein the
structural lipid is selected from the group consisting of
cholesterol, fecosterol, sitosterol, ergosterol, campesterol,
stigmasterol, brassicasterol, tomatidine, ursolic acid,
alpha-tocopherol, and any mixtures thereof.
[0186] E66. The composition of any one of embodiments 1 to 65,
wherein the delivery agent further comprises a PEG lipid.
[0187] E67. The composition of embodiment 66, wherein the PEG lipid
is selected from the group consisting of a PEG-modified
phosphatidylethanolamine, a PEG-modified phosphatidic acid, a
PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified
diacylglycerol, a PEG-modified dialkylglycerol, and any mixtures
thereof.
[0188] E68. The composition of any one of embodiments 1 to 67,
wherein the delivery agent further comprises an ionizable lipid
selected from the group consisting of
3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine
(KL10),
N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanami-
ne (KL22), 14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane
(KL25), 1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),
2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),
heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate
(DLin-MC3-DMA),
2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLin-KC2-DMA), 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA),
2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-
-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),
(2R)-2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z-
,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA
(2R)), and
(2S)-2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z-
,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA
(2S)).
[0189] E69. The composition of any one of embodiments 1 to 68,
wherein the delivery agent further comprises a phospholipid, a
structural lipid, a PEG lipid, or any combination thereof.
[0190] E70. The composition of any one of embodiments 1-69, wherein
the composition is formulated for in vivo delivery.
[0191] E71. The composition of embodiment 70 which is formulated
for intramuscular, subcutaneous, or intradermal delivery.
[0192] E72. The composition of any one of embodiments 1-71 which
increases cellular expression of MCM.
[0193] E73. The composition of embodiment 72, wherein the cellular
expression of MCM is increased by at least 20%, at least 25%, at
least 30%, at least 35%, at least 40%, at least 45%, or at least
50%.
[0194] E74. A method of administering the composition of any one of
embodiments 1-73, wherein the administration alleviates the
symptoms of methylmalonic acidemia in the subject.
[0195] E75. The method of embodiment 74, wherein the administration
results in a reduction of the level of a metabolite associated with
methylmalonic acidemia in a subject in need thereof.
[0196] E76. The method of embodiment 74 or 75, further comprising
measuring the level of the metabolite in the subject or in a sample
obtained from the subject before and/or after the
administering.
[0197] E77. The method of embodiment 76, wherein the sample is
taken from the subject's blood, urine, cerebrospinal fluid, or any
combination thereof.
[0198] E78. The method of any of embodiments 74 to 77, wherein the
administration reduces the level of methylmalonic acid present in
the subject by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%.
[0199] E79. The method of any of embodiments 74 to 78, wherein the
polynucleotide reduces the level of propionyl-carnitine present in
the subject by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%.
[0200] E80. The method of any of embodiments 74 to 79, wherein the
polynucleotide reduces the level of acetyl-carnitine present in the
subject by at least about 10%, at least about 20%, at least about
30%, at least about 40%, at least about 50%, at least about 60%, at
least about 70%, at least about 80%, at least about 90%, or about
100%.
[0201] E81. The method of any one of embodiments 74 to 80, wherein
one or more metabolites associated with methylmalonic acidemia are
reduced within one day, within two days, within three days, within
four days, within five days, within seven days, within one week,
within two weeks, within three weeks, or within one month of the
administration of the polynucleotide.
[0202] E82. A method of treating methylmalonic acidemia in a
subject in need thereof, the method comprising administering to the
subject an effective amount of a polynucleotide comprising an mRNA
that comprises an ORF encoding an MCM polypeptide, wherein the
administration alleviates the symptoms of methylmalonic acidemia in
the subject.
[0203] E83. The method of embodiment 82, wherein the polynucleotide
comprises the polynucleotide in the composition of any one of
embodiments 1 to 73.
[0204] E84. The method of embodiment 82 or 83, wherein the
administration reduces the level of a metabolite associated with
methylmalonic acidemia in a subject in need thereof.
[0205] E85. The method of any one of embodiments 82-84, further
comprising measuring the level of the metabolite in the subject or
in a sample obtained from the subject before and/or after the
administering.
[0206] E86. The method of embodiment 85, wherein the sample is
taken from the subject's blood, urine, cerebrospinal fluid, or any
combination thereof.
[0207] E87. The method of any of embodiments 82 to 86, wherein the
polynucleotide reduces the level of methylmalonic acid present in
the subject by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%.
[0208] E88. The method of any of embodiments 82 to 87, wherein the
polynucleotide reduces the level of propionyl-carnitine present in
the subject by at least about 10%, at least about 20%, at least
about 30%, at least about 40%, at least about 50%, at least about
60%, at least about 70%, at least about 80%, at least about 90%, or
about 100%.
[0209] E89. The method of any of embodiments 82 to 88, wherein the
polynucleotide reduces the level of acetyl-carnitine present in the
subject by at least about 10%, at least about 20%, at least about
30%, at least about 40%, at least about 50%, at least about 60%, at
least about 70%, at least about 80%, at least about 90%, or about
100%.
[0210] E90. The method of any one of embodiments 82 to 89, wherein
one or more metabolites associated with methylmalonic acidemia are
reduced within one day, within two days, within three days, within
four days, within five days, within seven days, within one week,
within two weeks, within three weeks, or within one month of the
administration of the polynucleotide.
[0211] E91. The method of any one of embodiments 82 to 90, wherein
the nucleotide is administered as a nanoparticle composition.
[0212] E92. The method of embodiment 91, wherein the composition
further comprises a delivery agent.
[0213] E93. The method of embodiment 92, wherein the delivery agent
comprises a phospholipid.
[0214] E94. The method of embodiment 93, wherein the phospholipid
is selected from the group consisting of
1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC),
1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC),
1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC),
1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-di
stearoyl-sn-glycero-3-phosphocholine (DSPC),
1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC),
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC),
1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC),
1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine
(OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC),
1,2-dilinolenoyl-sn-glycero-3-phosphocholine,
1,2-diarachidonoyl-sn-glycero-3-phosphocholine,
1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine,
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE),
1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16:0 PE),
1,2-di stearoyl-sn-glycero-3-phosphoethanolamine,
1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine,
1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine,
1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine,
1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine,
1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt
(DOPG), sphingomyelin, and any mixtures thereof.
[0215] E95. The method of any one of embodiments 92 to 94, wherein
the delivery agent further comprises a structural lipid.
[0216] E96. The method of embodiment 95, wherein the structural
lipid is selected from the group consisting of cholesterol,
fecosterol, sitosterol, ergosterol, campesterol, stigmasterol,
brassicasterol, tomatidine, ursolic acid, alpha-tocopherol, and any
mixtures thereof.
[0217] E97. The method of any one of embodiments 92 to 96, wherein
the delivery agent further comprises a PEG lipid.
[0218] E98. The method of embodiment 97, wherein the PEG lipid is
selected from the group consisting of a PEG-modified
phosphatidylethanolamine, a PEG-modified phosphatidic acid, a
PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified
diacylglycerol, a PEG-modified dialkylglycerol, and any mixtures
thereof.
[0219] E99. The method of any one of embodiments 92 to 98, wherein
the delivery agent further comprises an ionizable lipid selected
from the group consisting of
3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine
(KL10),
N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanami-
ne (KL22), 14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane
(KL25), 1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),
2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),
heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate
(DLin-MC3-DMA),
2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLin-KC2-DMA), 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA),
2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-
-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),
(2R)-2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z-
,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA
(2R)), and (2
S)-2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9-
Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA
(2S)).
[0220] E100. The method of any one of embodiments 92 to 99, wherein
the delivery agent further comprises a phospholipid, a structural
lipid, a PEG lipid, or any combination thereof.
[0221] E101. The method of any one of embodiments 92-100, wherein
the composition is formulated for in vivo delivery.
[0222] E102. The method of embodiment 101 which is formulated for
intramuscular, subcutaneous, or intradermal delivery.
[0223] E103. The method of any one of embodiments 82-102 which
increases cellular expression of MCM.
[0224] E104. The method of embodiment 103, wherein the cellular
expression of MCM is increased by at least 20%, at least 25%, at
least 30%, at least 35%, at least 40%, at least 45%, or at least
50%.
[0225] E105. The method of any one of embodiments 74 to 104,
wherein the polynucleotide is administered at a dose of 0.1 mg/kg
to 1.0 mg/kg, 0.1 mg/kg to 10 mg/kg, 0.1 mg/kg to 2 mg/kg, 0.1
mg/kg to 5 mg/kg, 1 mg/kg to 5 mg/kg, or 1 mg/kg to 3 mg/kg.
[0226] E106. The method of any one of embodiments 74 to 105,
wherein the plasma MMA level after the administration is reduced at
least 70%, at least 75%, at least 80%, at least 85%, at least 90%,
or at least 95% compared to the plasma MMA level prior to the
administration.
[0227] E107. The method of embodiment 106, wherein the plasma MMA
level is reduced about 75% to 85% compared to the plasma MMA level
prior to the administration.
[0228] E108. The method of any one of embodiments 74 to 107,
wherein the plasma MMA level after the administration is lower than
about 5 .mu.mol/L, about 4.5 .mu.mol/L, about 4 .mu.mol/L, about
3.5 .mu.mol/L, about 3 .mu.mol/L, about 2.5 .mu.mol/L, about 2
.mu.mol/L, about 1.5 .mu.mol/L, about 1 .mu.mol/L, about 0.9
.mu.mol/L, about 0.8 .mu.mol/L, about 0.7 .mu.mol/L, about 0.6
.mu.mol/L, about 0.5 .mu.mol/L, about 0.4 .mu.mol/L, about 0.3
.mu.mol/L, or 0.27 .mu.mol/L.
[0229] E109. The method of embodiments 74 to 108, wherein the
urinary MMA level is less than 2000 mmol/mol creatinine, less than
1900 mmol/mol creatinine, less than 1800 mmol/mol creatinine, less
than 1700 mmol/mol creatinine, less than 1600 mmol/mol creatinine,
less than 1500 mmol/mol creatinine, less than 1400 mmol/mol
creatinine, less than 1300 mmol/mol creatinine, less than 1200
mmol/mol creatinine, less than 1100 mmol/mol creatinine, less than
1000 mmol/mol creatinine, 900 mmol/mol creatinine, 800 mmol/mol
creatinine, 700 mmol/mol creatinine, 600 mmol/mol creatinine, 500
mmol/mol creatinine, 400 mmol/mol creatinine, 300 mmol/mol
creatinine, 200 mmol/mol creatinine, 100 mmol/mol creatinine, 90
mmol/mol creatinine, 80 mmol/mol creatinine, 70 mmol/mol
creatinine, 60 mmol/mol creatinine, 50 mmol/mol creatinine, 40
mmol/mol creatinine, 30 mmol/mol creatinine, 20 mmol/mol
creatinine, 10 mmol/mol creatinine, 9 mmol/mol creatinine, 8
mmol/mol creatinine, 7 mmol/mol creatinine, 6 mmol/mol creatinine,5
mmol/mol creatinine, 4 mmol/mol creatinine, 3 mmol/mol creatinine,
2 mmol/mol creatinine, or 1 mmol/mol creatinine.
BRIEF DESCRIPTION OF THE DRAWINGS
[0230] FIG. 1 is a Western blot analysis of endogenous
methylmalonyl-CoA mutase expression in a mouse liver mitochondrial
extract, mouse cells (Hepa1-6), and human cells (HepG2, SNU423, and
HeLa). The upper band (thin arrow) shows Mouse
.alpha.-Methymalonyl-CoA mutase, and the lower band (thick arrow)
shows Rabbit .alpha.-Citrate synthetase.
[0231] FIGS. 2A-2C show immunofluorescence analyses of the
localization of endogenous methylmalonyl-CoA mutase in HeLa cells.
FIG. 2A shows the location of mitochondria using Mitotracker and
the nucleus using DAPI. FIG. 2B shows the immunostaining of hMCM
protein using a murine monoclonal anti-MCM antibody and the
location of the nucleus using DAPI. FIG. 2C shows the merged
picture of FIGS. 2A and 2B.
[0232] FIG. 3 is a Western blot analysis comparing
methylmalonyl-CoA mutase expression in (i) HeLa cells transfected
with a control GFP expression construct, (ii) HeLa cells
transfected with a construct for expressing methylmalonyl-CoA
mutase, and (iii) a mouse liver mitochondrial extract.
[0233] FIG. 4 is a comparison of methylmalonyl-CoA mutase enzymatic
activity in (i) HeLa cells transfected with a control GFP
expression construct, (ii) HeLa cells transfected with a construct
for expressing methylmalonyl-CoA mutase, and (iii) a mouse liver
mitochondrial extract.
[0234] FIG. 5 is a Western blot analysis of methylmalonyl-CoA
mutase expression in Hepa1-6 cells, fibroblasts from normal human
subjects (NHDF), and fibroblasts from MMA patients (GM50 and
GM1573) that were transfected with control mRNA, human MCM mRNA, or
mouse MCM mRNA.
[0235] FIGS. 6A-6D show immunofluorescence analyses of the
localization of exogenously expressed methylmalonyl-CoA mutase in
human fibroblasts transfected with eGFP mRNAs or MCM mRNAs (also
referred to as "MUT"). The left panels show the location of
mitochondria using Mitotracker and the nucleus using DAPI, the
middle panels show shows the location of mitochondria using MCM
protein and the nucleus using DAPI, and the right panels show
merged images of the left panel and the right panel. FIGS. 6A and
6C are images taken of patient fibroblasts transfected with mRNA
encoding eGFP. FIGS. 6B and 6D are images taken of patient
fibroblasts transfected with mRNA encoding hMCM.
[0236] FIG. 7 is measurement of methylmalonyl-CoA mutase activity
in Hepa1-6 cells, fibroblasts from normal human subjects (NHDF),
and fibroblasts from MMA patients (GM50 and GM1573) that were
transfected with control mRNA, human MCM mRNA, or mouse MCM
mRNA.
[0237] FIGS. 8A-8B is an analysis of in vivo treatment with mRNA
encoding methylmalonyl-CoA mutase. For FIGS. 8A and 8B, C57B/L6
mice were injected intravenously with either control mRNA (NT-FIX)
or MCM mRNA at 0.5 mg mRNA/kg body weight ("mpk"). Mice were
sacrificed after 24 or 48 hours and MCM protein in mitochondria
from livers were determined by capillary electrophoresis (CE). The
upper panel (FIG. 8A) shows injection of MCM mRNA increased MCM
protein expression after 24 and 48 hours, while the lower panel
(FIG. 8B) shows the expression of the control protein citrate
synthase.
[0238] FIGS. 9-15 show exemplary codon optimized MCM sequences that
encode methylmalonyl-CoA mutase. The illustrated sequences in FIGS.
9-15 are SEQ ID NOs: 732, 733, 734, 151, 152, 153, and 154,
respectively.
[0239] FIGS. 16A-C show analysis of MMA levels and body weight in
the MCK mouse model. FIG. 16A shows plasma levels of methylmalonic
acid (MMA) in .mu.M measured by LC-MS/MS over time in mice treated
weekly with control mRNA (NT-FIX) at 0.1 mg/kg, codon optimized MCM
mRNA (encoding SEQ ID NO:734) formulated in lipid nanoparticles at
0.16 or 0.2 mg/kg for 5 injections, or codon optimized MCM mRNA
(encoding SEQ ID NO:734) formulated in lipid nanoparticles at 0.2
mg/kg for 2 injections. FIG. 16B shows the body weight of the mice
over time (measured twice a week). ***p<0.001; P-values obtained
from repeated measures ANOVA. FIG. 16C shows the the increase in
body weight over time in mice injected weekly with codon optimized
MCM mRNA.
[0240] FIG. 17 shows MCM expression in liver of wild-type CD1 mice
dosed with codon optimized MCM mRNA (SEQ ID NO: 734) formulated in
lipid nanoparticles at 0.2 mg/kg compared to endogenous human MCM
and endogenous mouse MCM.
[0241] FIGS. 18A-C show a time course of the effects of injection
of codon optimized MCM mRNA. FIG. 18A shows levels of lipid
nanoparticles after single dose injection of codon optimized MCM
mRNA. FIG. 18B shows Hepatic hMut mRNA levels in mouse liver after
single dose injection of codon optimized MCM mRNA. FIG. 18C shows
MCM protein levels after single dose injection of codon optimized
MCM mRNA
[0242] FIGS. 19A-B show MCM expression in livel of wild-type CD
mice dosed with codon optimized MCM mRNAs, where the mRNA is
formulated either with MC3 or Compound 18. NTFIX mRNA was used as a
control. FIG. 19A shows a Western blot of expression after dosing
with different formulations, and FIG. 19B shows a quantification of
that Western blot.
[0243] FIGS. 20A-B show the effects of administering codon
optimized MCM mRNA to mice on the plasma levels of MMA (FIG. 20A)
and the body weight of the mice (FIG. 20B).
DETAILED DESCRIPTION
[0244] The present disclosure provides polynucleotide sequences
that encode a sequence-optimized nucleic acid encoding a
methylmalonyl-CoA mutase polypeptide ("MCM" or "MUT"). MCM is the
principal gene associated with methylmalonic acidemia ("MMA," also
referred to as methylmalonic adicuria). Wild type nucleic acid and
amino acid sequences for human methylmalonyl-CoA mutase (MCM) are
described in NCBI sequence records gi296010795 (reference sequence
NM_000255.3, "Homo sapiens methylmalonyl-CoA mutase (MUT), mRNA";
see also, SEQ ID NO: 214) and gi156105689 (reference sequence
NP_000246.2, "methylmalonyl-CoA mutase, mitochondrial precursor
[Homo sapiens]"; see also, SEQ ID NO: 208), respectively. Accession
numbers and the associated sequences are found at the National
Center for Biotechnology Information (NCBI) website.
[0245] MCM is a metabolic enzyme (E.C. 5.4.99.2), the biological
function of which is to isomerize L-methylmalonyl-CoA into
succinyl-CoA, a Krebs cycle intermediate. MCM localizes to the
mitochondria of cells, exists as a homodimer in its native form,
and is adenosylcobalamin-dependent. The precursor form of human MCM
is 750 amino acids, while its mature form is 718 amino acids--a 32
amino acid leader sequence is cleaved off by mitochondrial
importation and processing machinery.
I. Composition
Polynucleotides Encoding MCM
[0246] In certain aspects, the present disclosure provides nucleic
acid molecules, specifically polynucleotides that encode one or
more MCM polypeptides. The MCM polypeptides that are encoded can be
mammalian MCM polypeptides, for example, human MCM peptides, or
functional fragments thereof.
[0247] In some embodiments, the polynucleotides described herein
encode at least one methylmalonyl-CoA mutase protein, functional
fragment, or variant thereof. MCM catalyzes enzymatic
transformation of methylmalonyl-CoA into succinyl-CoA, and also
comprises a cobalamin-binding domain. MCM's enzymatic activity is
dependent on its binding to its cofactor, denosylcobalamin.
[0248] MCM plays a critical role in the catabolism of fat and
protein, specifically in disposing of methylmalonyl-CoA created
during metabolism. For example, methylmalonyl-CoA is an
intermediate in the catabolism of amino acids such as isoleucine,
methionine, and threonine. Methylmalonyl-CoA is also an
intermediate in the catabolism of cholesterol and fatty acids.
Defects in the activity of this enzyme lead to inefficient
metabolism and buildup of potentially toxic metabolic intermediates
such as methylmalonic acid. The lack of MCM causes the disorder
known as methylmalonic acidemia (MMA).
[0249] Replacement of MCM has been theorized to be a cure of this
form of MMA. In some embodiments, the polynucleotides disclosed
herein comprise one or more sequences encoding a methylmalonyl-CoA
mutase protein, functional fragment, or variant thereof that is
suitable for use in such gene replacement therapy. In certain
aspects, the present application addresses the problem of the lack
of methylmalonyl-CoA mutase by providing a polynucleotide, e.g.,
mRNA, that encodes methylmalonyl-CoA mutase or functional fragment
thereof, wherein the polynucleotide is sequence-optimized. In some
embodiments, the polynucleotide, e.g., mRNA, increases MCM
expression levels in cells when introduced into those cells, e.g.,
by at least 20%, at least 20%, at least 25%, at least 35%, at least
40%, at least 50%, at least 60%, at least 70%, at least 80%, at
least 90%, or at least 100%.
[0250] In some embodiments, the polynucleotides of the disclosure
encode functional MCM polypeptides or fragments thereof. In some
embodiments, the polynucleotides of the disclosure encode an MCM
protein or variant thereof that is full length (i.e., it includes a
mitochondrial transit peptide, either native or heterologous to
that in native full-length MCM), while in other embodiments
polynucleotides of the disclosure encode a functional MCM protein
or variant thereof that is mature (i.e., it lacks the mitochondrial
transit peptide). In some embodiments, the polynucleotides encode a
human MCM, or variant thereof, linked to a heterologous or
homologous mitochondrial transit peptide.
[0251] In some embodiments, the polynucleotides of the disclosure
encode functional human MCM (SEQ ID NO: 208, SEQ ID NO: 209, SEQ ID
NO: 210, SEQ ID NO: 211, SEQ ID NO: 212, and SEQ ID NO: 213) or
fragments thereof. In some embodiments, the polynucleotides of the
disclosure encode mutant MCM. In some embodiments, the
polynucleotides encode an MCM polypeptide that comprises at least
one point mutation in the MCM sequence, while still retaining MCM
enzymatic activity. In some embodiments, the polynucleotides encode
a functional MCM polypeptide with mutations that do not alter the
function of MCM. Such functional MCM can be referred to as
function-neutral. In some embodiments, the encoded MCM polypeptide
comprises one or more of the function-neutral point mutations V69,
T499, H532, A598, and V671. In some embodiments, the
polynucleotides of the disclosure encode the polypeptide sequences
in SEQ ID NO: 209, SEQ ID NO: 210, SEQ ID NO: 211, SEQ ID NO: 212,
and SEQ ID NO: 213, which contain the function-neutral mutants V69,
T499, H532, A598, and V671, respectively. In particular
embodiments, the encoded MCM polypeptide is a V671 mutant (SEQ ID
NO: 213). Polynucleotides encoding MCM polypeptides are listed in
SEQ ID NOs: 1 to 207, 214, 732 to 765, and 772.
[0252] In some embodiments, the polynucleotides comprise a
nucleotide sequence having significant sequence similarity to a
polynucleotide selected from the group of SEQ ID NOs: 1-207,
732-765, and 772, wherein the ORF encodes an MCM polypeptide. In
some embodiments, the polynucleotide comprises a nucleotide
sequence having significant sequence similarity to SEQ ID NOs: 151,
152, 153, 154, 732, 733, and 734 (FIGS. 9-15). In some embodiments,
the polynucleotide comprises a nucleotide sequence having
significant sequence similarity to SEQ ID NO: 734 (FIG. 11).
[0253] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 99% or 100%
sequence identity to nucleotide 97 to nucleotide 2250 of SEQ ID NO:
734, wherein the ORF encodes an MCM polypeptide.
[0254] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 98%, at least 99%,
or 100% sequence identity to nucleotide 97 to nucleotide 2250 of
SEQ ID NO: 732, wherein the ORF encodes an MCM polypeptide.
[0255] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 97 to nucleotides 2250 of
SEQ ID NOs: 182, 733, and 741, wherein the ORF encodes an MCM
polypeptide.
[0256] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 97 to
nucleotides 2250 of SEQ ID NOs: 735, 736, 738, 743, 744, 748, 749,
750, 754, 755, 758, 762, and 765, wherein the ORF encodes an MCM
polypeptide.
[0257] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% sequence
identity to a sequence selected from the group consisting of
nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 180, 187, 737,
739, 740, 742, 745, 746, 747, 751, 752, 753, 757, 759, 760, 761,
763, and 764, wherein the ORF encodes an MCM polypeptide.
[0258] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 89%, at least 90%,
at least 91%, at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97%, at least 98%, at least 99%, or
100% sequence identity to a sequence selected from the group
consisting of nucleotides 97 to nucleotides 2250 of SEQ ID NO: 181
and 756, wherein the ORF encodes an MCM polypeptide.
[0259] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% sequence identity to a sequence selected from
the group consisting of nucleotides 97 to nucleotides 2250 of SEQ
ID NO: 154, 165, 171, 173, and 175, wherein the ORF encodes an MCM
polypeptide.
[0260] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 97 to nucleotides
2250 of SEQ ID NO: 151, 152, 153, 163, 164, 166, 167, 168, 169,
170, 172, 177, 178, 179, 195, and 204, wherein the ORF encodes an
MCM polypeptide.
[0261] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 86%, at least 87%,
at least 88%, at least 89%, at least 90%, at least 91%, at least
92%, at least 93%, at least 94%, at least 95%, at least 96%, at
least 97%, at least 98%, at least 99%, or 100% sequence identity to
a sequence selected from the group consisting of nucleotides 97 to
nucleotides 2250 of SEQ ID NOs: 156, 157, 158, 159, 160, 161, 162,
174 and 176, wherein the ORF encodes an MCM polypeptide.
[0262] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 85%, at least 86%,
at least 87%, at least 88%, at least 89%, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 155 and 203,
wherein the ORF encodes an MCM polypeptide.
[0263] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 82%, at least 83%,
at least 84%, at least 85%, at least 86%, at least 87%, at least
88%, at least 89%, at least 90%, at least 91%, at least 92%, at
least 93%, at least 94%, at least 95%, at least 96%, at least 97%,
at least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 97 to nucleotides
2250 of SEQ ID NOs: 64, 66, 71, 91, and 128, wherein the ORF
encodes an MCM polypeptide.
[0264] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 81%, at least 82%,
at least 83%, at least 84%, at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98%, at least 99%, or 100% sequence identity
to a sequence selected from the group consisting of nucleotides 97
to nucleotides 2250 of SEQ ID NOs: 9, 11, 18, 19, 21, 22, 23, 24,
32, 33, 37, 39, 40, 44, 45, 47, 50, 51, 52, 55, 57, 61, 65, 70, 79,
84, 86, 88, 90, 92, 98, 100, 115, 117, 126, 129, 135, 136, 137,
144, 148, 150, 184, 190, 191, and 206, wherein the ORF encodes an
MCM polypeptide.
[0265] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 80%, at least 81%,
at least 82%, at least 83%, at least 84%, at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 97 to nucleotides 2250 of SEQ ID NOs: 3, 5, 6, 8,
10, 12, 14, 16, 17, 20, 27, 28, 29, 31, 34, 35, 36, 38, 41, 42, 43,
46, 48, 49, 53, 54, 56, 58, 60, 63, 68, 69, 74, 77, 78, 80, 83, 85,
87, 93, 95, 96, 97, 99, 102, 103, 104, 105, 107, 110, 112, 113,
114, 116, 119, 120, 122, 123, 124, 125, 127, 131, 132, 133, 134,
138, 139, 140, 141, 142, 143, 147, 149, 183, 186, 188, 189, 192,
193, 194, 196, 197, 198, 199, 200, 201, 202, 205, and 207, wherein
the ORF encodes an MCM polypeptide.
[0266] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 79%, at least 80%,
at least 81%, at least 82%, at least 83%, at least 84%, at least
85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% sequence identity to a sequence selected from the
group consisting of nucleotides 97 to nucleotides 2250 of SEQ ID
NOs: 1, 2, 4, 7, 13, 15, 25, 26, 30, 59, 62, 67, 72, 73, 75, 76,
81, 82, 89, 94, 101, 106, 108, 109, 111, 118, 121, 130, 145, 146,
and 185, wherein the ORF encodes an MCM polypeptide.
[0267] The polynucleotides of the disclosure can also encode
additional features that facilitate trafficking of the polypeptides
to therapeutically relevant sites. One such feature that aids in
protein trafficking is the signal sequence, or targeting sequence.
The peptides encoded by these signal sequences are known by a
variety of names, including targeting peptides, transit peptides,
and signal peptides. The disclosure also includes a polynucleotide
comprising a sequence that encodes a mitochondrial transit peptide
operably linked to the polynucleotide described herein, i.e.,
linked to a polynucleotide comprising an ORF encoding an MCM
polypeptide.
[0268] As used herein, a "signal sequence" or "signal peptide" is a
polynucleotide or polypeptide, respectively, which is from about 9
to 200 nucleotides (3-70 amino acids) in length that, in some
embodiments, is incorporated at the 5' (or N-terminus) of the
coding region or polypeptide encoded, respectively. Addition of
these sequences result in trafficking of the encoded polypeptide to
a desired site, such as the endoplasmic reticulum or the
mitochondria through one or more targeting pathways. Some signal
peptides are cleaved from the protein, for example by a signal
peptidase after the proteins are transported.
[0269] For example, human MCM's precursor protein comprises a
32-amino acid mitochondrial transit peptide, also referred to as an
MCM mitochondrial targeting sequence or mitochondrial targeting
peptide, that facilitates delivery of the MCM protein to, and
localization in, mitochondria. The present disclosure comprises
both polynucleotides that encode a homologous targeting sequence
(i.e., MCM's native mitochondrial transit sequence) and
polynucleotides that encode a heterologous mitochondrial transit
sequences (i.e., a mitochondrial transit peptide that is not the
native targeting peptide for the operably linked MCM protein). In
some embodiments, the alternate targeting sequences facilitate
delivery of MCM to mitochondria.
[0270] Exemplary sequences of known mitochondrial transit peptides
include MLSLRQSIRFFKPATRTLCSSRYLL (SEQ ID NO: 251),
MALLRGVFVVAAKRTP (SEQ ID NO: 252) and MLRIPVRKALVGLSKSSKGCVRT (SEQ
ID NO: 253). Non-limiting examples of the mitochondrial transit
peptides are listed below in Table 1 (SEQ ID NOs: 251-265). Further
examples of mitochondrial transit peptides are provided as SEQ ID
NOs: 270-719. Additional mitochondrial transit peptides that can be
utilized in the present disclosure can be identified using
predictive tools known in the art. For example, mitochondrial
targeting can be analyzed using the methods described in Fukusawa
et al., Molecular and Cellular Proteomics 14:1113-1126 (2015), the
contents of which are incorporated herein in their entirety.
TABLE-US-00001 TABLE 1 Mitochondrial Transit Peptides ID (SEQ ID
NO) Name of the protein Sequence COX4 Saccharomyces cerevisiae
mitochondrial MLSLRQSIRFFKPATRTLCSSRYLL (SEQ ID cytochrome c
oxidase subunit IV NO: 251) ACAA2 Mitochondrial 3-ketoacyl-coa
thiolase MALLRGVFVVAAKRTP (SEQ ID NO: 252) NDUFS1 NADH-ubiquinone
oxidoreductase 75 kDa MLRIPVRKALVGLSKSSKGCVRT (SEQ ID subunit,
mitochondrial isoform 2 NO: 253) A6NK58 Putative lipoyltransferase
2, mitochondrial (EC MRQPAVRLVRLGRVPYAELLGLQDRWLR (SEQ ID
2.3.1.181) (Lipoate-protein ligase B) RLQ NO: 254) (Lipoyl/octanoyl
transferase) (Octanoyl-[acyl- carrier-protein]-protein
N-octanoyltransferase) A8K5M9 Uncharacterized protein C15orf62,
METWRKGSFRN (SEQ ID mitochondrial NO: 255) A8MUP2
Methyltransferase-like protein 12, MAALRRMLHLPSLMMGTCRPFAGSLADS
(SEQ ID mitochondrial (EC 2.1.1.-) NO: 256) O00142 Thymidine kinase
2, mitochondrial (EC MLLWPLRGWAARALRCFGPGSRGSPASG (SEQ ID 2.7.1.21)
(Mt-TK) PGPRR NO: 257) O00217 NADH dehydrogenase [ubiquinone] iron-
MRCLTTPMLLRALAQAARAGPPGGRSLH (SEQ ID sulfur protein 8,
mitochondrial (EC 1.6.5.3) SSAVAA NO: 258) (EC 1.6.99.3) (Complex
I-23kD) (CI-23kD) (NADH-ubiquinone oxidoreductase 23 kDa subunit)
(TYKY subunit) O00330 Pyruvate dehydrogenase protein X component,
MAASWRLGCDPRLLRYLVGFPGRRSVGL (SEQ ID mitochondrial
(Dihydrolipoamide VKGALGWSVSRGANWRWFHSTQWLR NO: 259)
dehydrogenase-binding protein of pyruvate dehydrogenase complex)
(E3-binding protein) (E3BP) (Lipoyl-containing pyruvate
dehydrogenase complex component X) (proX) O00411 DNA-directed RNA
polymerase, MSALCWGRGAAGLKRALRPCGRPGLPGK (SEQ ID mitochondrial
(MtRPOL) (EC 2.7.7.6) EGTAGGVCGPRRS NO: 260) O00746 Nucleoside
diphosphate kinase, mitochondrial MGGLFWRSALRGLRCGPRAPGPSLLVRH (SEQ
ID (NDK) (NDP kinase, mitochondrial) (EC GSGGP NO: 261) 2.7.4.6)
(Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4) O14521
Succinate dehydrogenase [ubiquinone] MAVLWRLSAVCGALGGRALLLRTPVVRP
(SEQ ID cytochrome b small subunit, mitochondrial
AHISAFLQDRPIPEWCGVQHIHLSPSHH NO: 262) (CybS) (CII-4) (QPs3)
(Succinate dehydrogenase complex subunit D) (Succinate- ubiquinone
oxidoreductase cytochrome b small subunit) (Succinate-ubiquinone
reductase membrane anchor subunit) O14548 Cytochrome c oxidase
subunit 7A-related MYYKFSGFTQKLAGAWASEAYSPQGLKP (SEQ ID protein,
mitochondrial (COX7a-related VVSTEAPPIIFATPTKLTSDSTVYDYA NO: 263)
protein) (Cytochrome c oxidase subunit VIIa- related protein) (EB1)
mMCM Mouse methylmalonyl-CoA mutase MLRAKNQLFLLSPHYLKQLNIPSASRWK
(SEQ ID RL NO: 264) hMCM Human methylmalonyl-CoA mutase
MLRAKNQLFLLSPHYLRQVKESSGSRLI (SEQ ID QQRL NO: 265)
[0271] In some embodiments, the nucleic acid sequence encoding a
mitochondrial transit peptide has at least about 70%, at least
about 80%, at least about 90%, at least about 95%, at least about
96%, at least about 97%, at least about 98%, at least about 99%, or
about 100% sequence identity to a sequence selected from the group
of nucleotides 1 to 96 of SEQ ID NOs: 1-207, 732-765, and 772,
wherein the transit peptide is capable of targeting or carrying the
MCM polypeptide into the mitochondria.
[0272] In some embodiments, the nucleic acid sequence encoding a
mitochondrial transit peptide has at least about 70%, at least
about 80%, at least about 90%, at least about 95%, at least about
96%, at least about 97%, at least about 98%, at least about 99%, or
about 100% sequence identity to a sequence in Table 1 (SEQ ID NOs:
251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263,
264, or 265), wherein the transit peptide is capable of targeting
or carrying the MCM polypeptide into the mitochondria. In some
embodiments, the nucleic acid sequence encoding a mitochondrial
transit peptide has at least about 70%, at least about 80%, at
least about 90%, at least about 95%, at least about 96%, at least
about 97%, at least about 98%, at least about 99%, or about 100%
sequence identity to a sequence selected from the group consisting
of SEQ ID NOs: 270 to 719, wherein the transit peptide is capable
of targeting or carrying the MCM polypeptide into the
mitochondria.
[0273] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 99% or 100%
sequence identity to nucleotide 1 to nucleotide 2250 of SEQ ID NO:
734, wherein the ORF encodes an MCM polypeptide.
[0274] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 98%, at least 99%,
or 100% sequence identity to nucleotide 1 to nucleotide 2250 of SEQ
ID NO: 732, wherein the ORF encodes an MCM polypeptide.
[0275] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, or 100% sequence identity to a sequence selected
from the group consisting of nucleotides 1 to nucleotides 2250 of
SEQ ID NO: 182 and 733, wherein the ORF encodes an MCM
polypeptide.
[0276] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 91%, at least 92%,
at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100% sequence identity to a
sequence selected from the group consisting of nucleotides 1 to
nucleotides 2250 of SEQ ID NOs: 735, 741, 743, 744, 748, 758, 762,
and 765, wherein the ORF encodes an MCM polypeptide.
[0277] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% sequence
identity to a sequence selected from the group consisting of
nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 180, 181 , 736,
738, 739, 740, 742, 746, 747, 749, 750, 751, 752, 753, 754, 755,
757, 759, 760, 761, and 763, wherein the ORF encodes an MCM
polypeptide.
[0278] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 89%, at least 90%,
at least 91%, at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97%, at least 98%, at least 99%, or
100% sequence identity to a sequence selected from the group
consisting of nucleotides 1 to nucleotides 2250 of SEQ ID NO: 745,
756, and 764, wherein the ORF encodes an MCM polypeptide.
[0279] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% sequence identity to a sequence selected from
the group consisting of nucleotides 1 to nucleotides 2250 of SEQ ID
NO: 154, 165, 171, 173, and 175, wherein the ORF encodes an MCM
polypeptide.
[0280] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 1 to nucleotides
2250 of SEQ ID NO: 151, 152, 153, 163, 166, 167, 168, 169, 170,
172, 177, 178, 179, 187, and 204, wherein the ORF encodes an MCM
polypeptide.
[0281] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 86%, at least 87%,
at least 88%, at least 89%, at least 90%, at least 91%, at least
92%, at least 93%, at least 94%, at least 95%, at least 96%, at
least 97%, at least 98%, at least 99%, or 100% sequence identity to
a sequence selected from the group consisting of nucleotides 1 to
nucleotides 2250 of SEQ ID NO: 156, 157, 158, 159, 160, 162, 164,
174, 176, 195, and 737, wherein the ORF encodes an MCM
polypeptide.
[0282] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 85%, at least 86%,
at least 87%, at least 88%, at least 89%, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 155, 161, and
203, wherein the ORF encodes an MCM polypeptide.
[0283] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 82%, at least 83%,
at least 84%, at least 85%, at least 86%, at least 87%, at least
88%, at least 89%, at least 90%, at least 91%, at least 92%, at
least 93%, at least 94%, at least 95%, at least 96%, at least 97%,
at least 98%, at least 99%, or 100% sequence identity to a sequence
selected from the group consisting of nucleotides 1 to nucleotides
2250 of SEQ ID NOs: 71 and 128, wherein the ORF encodes an MCM
polypeptide.
[0284] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 81%, at least 82%,
at least 83%, at least 84%, at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98%, at least 99%, or 100% sequence identity
to a sequence selected from the group consisting of nucleotides 1
to nucleotides 2250 of SEQ ID NOs: 4, 6, 8, 9, 11, 19, 22, 23, 24,
32, 33, 37, 40, 44, 45, 47, 51, 61, 64, 65, 66, 79, 84, 86, 90, 91,
92, 100, 101, 112, 115, 117, 126, 129, 135, 136, 146, 148, 184,
190, and 191, wherein the ORF encodes an MCM polypeptide.
[0285] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 80%, at least 81%,
at least 82%, at least 83%, at least 84%, at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, at least 99%, or 100%
sequence identity to a sequence selected from the group consisting
of nucleotides 1 to nucleotides 2250 of SEQ ID NOs: 2, 3, 5, 7, 10,
12, 13, 14, 15, 16, 18, 20, 21, 26, 27, 28, 29, 31, 34, 36, 38, 39,
41, 42, 43, 46, 48, 49, 52, 53, 54, 55, 56, 57, 58, 59, 60, 62, 68,
69, 70, 72, 73, 74, 76, 77, 80, 83, 85, 88, 95, 96, 97, 98, 102,
104, 105, 106, 107, 108, 109, 110, 113, 114, 120, 121, 122, 123,
124, 127, 131, 132, 133, 134, 137, 138, 139, 140, 141, 142, 144,
145, 147, 149, 150, 186, 188, 189, 192, 193, 194, 196, 198, 199,
200, 202, 205, 206, and 207, wherein the ORF encodes an MCM
polypeptide.
[0286] In some embodiments, the disclosure is directed to a
polynucleotide comprising an ORF having at least 79%, at least 80%,
at least 81%, at least 82%, at least 83%, at least 84%, at least
85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% sequence identity to a sequence selected from the
group consisting of nucleotides 1 to nucleotides 2250 of SEQ ID
NOs: 1, 17, 25, 30, 35, 50, 63, 67, 75, 78, 81, 82, 87, 89, 93, 94,
99, 103, 111, 116, 118, 119, 125, 130, 143, 183, 185, 197, and 201,
wherein the ORF encodes an MCM polypeptide.
[0287] In some embodiments, the polynucleotide includes from about
1500 to about 100,000 nucleotides (e.g., from about 1500 to 2500,
from about 1800 to about 2600, from about 1900 to about 2600, from
about 2000 to about 2700, from 2154 to 2,750, from 2154 to 3,000,
from 2154 to 5,000, from 2154 to 7,000, from 2154 to 10,000, from
2154 to 25,000, from 2154 to 50,000, from 2154 to 70,000, from 2154
to 100,000, from 2250 to 2750, from 2250 to 3,000, from 2250 to
5,000, from 2250 to 7,000, from 2250 to 10,000, from 2250 to
25,000, from 2250 to 50,000, from 2250 to 70,000, and from 2250 to
100,000 nucleotides).
[0288] In some embodiments, the polynucleotides of the present
disclosure can further comprise at least one nucleic acid sequence
that is non-coding.
[0289] In some embodiments, the length of a region encoding at
least one polypeptide of interest is greater than about 2154
nucleotides in length (e.g., at least or greater than about 2154,
2,250, 2,500, 3,000, 4,000, 4,100, 4,200, 4,300, 4,400, 4,500,
4,600, 4,700, 4,800, 4,900, 5,000, 5,100, 5,200, 5,300, 5,400,
5,500, 5,600, 5,700, 5,800, 5,900, 6,000, 7,000, 8,000, 9,000,
10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000,
90,000 or up to and including 100,000 nucleotides). As used herein,
such a region can be referred to as a "coding region" or "region
encoding."
[0290] In some embodiments, the polynucleotides of the present
disclosure are, or function as, a messenger RNA (mRNA). As used
herein, the term "messenger RNA" (mRNA) refers to any
polynucleotide that encodes at least one polypeptide of interest
and that is capable of being translated to produce the encoded
polypeptide of interest in vitro, in vivo, in situ or ex vivo.
Exemplary mRNAs that can be used are listed in SEQ ID NOs:
776-771.
Optimized Polynucleotides Encoding MCM
[0291] The polynucleotides of the disclosure, their regions or
parts or subregions are sequence-optimized. Sequence optimization
methods are known in the art and can be useful to achieve one or
more desired results. These results include to match codon
frequencies in target and host organisms to ensure proper folding,
bias GC content to increase mRNA stability or reduce secondary
structures, minimize tandem repeat codons or base runs that can
impair gene construction or expression, customize transcriptional
and translational control regions, insert or remove protein
trafficking sequences, remove/add post translation modification
sites in encoded protein (e.g., glycosylation sites), add, remove
or shuffle protein domains, insert or delete restriction sites,
modify ribosome binding sites and mRNA degradation sites, to adjust
translational rates to allow the various domains of the protein to
fold properly, or to reduce or eliminate problem secondary
structures within the polynucleotide. Sequence optimization tools,
algorithms and services are known in the art, non-limiting examples
include services from GeneArt (Life Technologies), DNA2.0 (Menlo
Park CA) and/or proprietary methods. In some embodiments, the ORF
sequence is optimized using optimization algorithms. Codon options
for each amino acid are given in Table 2.
TABLE-US-00002 TABLE 2 Codon Options Single Letter Amino Acid Code
Codon Options Isoleucine I ATT, ATC, ATA Leucine L CTT, CTC, CTA,
CTG, TTA, TTG Valine V GTT, GTC, GTA, GTG Phenylalanine F TTT, TTC
Methionine M ATG Cysteine C TGT, TGC Alanine A GCT, GCC, GCA, GCG
Glycine G GGT, GGC, GGA, GGG Proline P CCT, CCC, CCA, CCG Threonine
T ACT, ACC, ACA, ACG Serine S TCT, TCC, TCA, TCG, AGT, AGC Tyrosine
Y TAT, TAC Tryptophan W TGG Glutamine Q CAA, CAG Asparagine N AAT,
AAC Histidine H CAT, CAC Glutamic acid E GAA, GAG Aspartic acid D
GAT, GAC Lysine K AAA, AAG Arginine R CGT, CGC, CGA, CGG, AGA, AGG
Selenocysteine Sec UGA in mRNA in presence of Selenocysteine
insertion element (SECIS) Stop codons Stop TAA, TAG, TGA
[0292] In some embodiments, the percentage of uracil or thymine
nucleobases in a sequence-optimized nucleotide sequence (e.g.,
encoding an MCM polypeptide, a functional fragment, or a variant
thereof) is modified (e.g., reduced) with respect to the percentage
of uracil or thymine nucleobases in the reference wild-type
nucleotide sequence. Such a sequence is referred to as a
uracil-modified or thymine-modified sequence. The percentage of
uracil or thymine content in a nucleotide sequence can be
determined by dividing the number of uracils or thymines in a
sequence by the total number of nucleotides and multiplying by 100.
In some embodiments, the sequence-optimized nucleotide sequence has
a lower uracil or thymine content than the uracil or thymine
content in the reference wild-type sequence. In some embodiments,
the uracil or thymine content in a sequence-optimized nucleotide
sequence of the disclosure is greater than the uracil or thymine
content in the reference wild-type sequence and still maintain
beneficial effects, e.g., increased expression and/or reduced
Toll-Like Receptor (TLR) response when compared to the reference
wild-type sequence.
[0293] The uracil or thymine content of wild-type MCM is about
26.67%. In some embodiments, the uracil or thymine content of a
uracil- or thymine-modified sequence encoding an MCM polypeptide is
less than 26.67%. In some embodiments, the uracil or thymine
content of a uracil- or thymine-modified sequence encoding an MCM
polypeptide of the disclosure is less than 19%, less that 18%, less
than 17%, less than 16%, less than 15%, less than 14%, less than
13%, less than 12%, less than 11%, or less than 10%. In some
embodiments, the uracil or thymine content is not less than 18%,
17%, 16%, 15%, 14%, 13%, 12%, or 11%. The uracil or thymine content
of a sequence disclosed herein, i.e., its total uracil or thymine
content, is abbreviated herein as % U.sub.TL or % T.sub.TL.
[0294] In some embodiments, the uracil or thymine content (%
U.sub.TL or % T.sub.TL) of a uracil- or thymine-modified sequence
encoding an MCM polypeptide of the disclosure is between 11% and
26%, between 12% and 25%, between 12% and 24%, between 13% and 23%,
between 13% and 22%, between 14% and 21%, between 14% and 20%,
between 14% and 19%, between 14% and 18%, between 14% and 17%, or
between 14% and 16%.
[0295] In some embodiments, the uracil or thymine content (%
U.sub.TL or % T.sub.TL) of a uracil- or thymine-modified sequence
encoding an MCM polypeptide of the disclosure is between 13% and
17%, between 13% and 16%, or between 14% and 16%.
[0296] In a particular embodiment, the uracil or thymine content (%
U.sub.TL or % T.sub.TL) of a uracil- or thymine modified sequence
encoding an MCM polypeptide of the disclosure is between about 14%
and about 16%, e.g., between 14% and 15%.
[0297] A uracil- or thymine-modified sequence encoding an MCM
polypeptide of the disclosure can also be described according to
its uracil or thymine content relative to the uracil or thymine
content in the corresponding wild-type nucleic acid sequence (%
U.sub.WT or % T.sub.WT), or according to its uracil or thymine
content relative to the theoretical minimum uracil or thymine
content of a nucleic acid encoding the wild-type protein sequence
(% U.sub.TM or (% T.sub.TM).
[0298] The phrases "uracil or thymine content relative to the
uracil or thymine content in the wild type nucleic acid sequence,"
refers to a parameter determined by dividing the number of uracils
or thymines in a sequence-optimized nucleic acid by the total
number of uracils or thymines in the corresponding wild-type
nucleic acid sequence and multiplying by 100. This parameter is
abbreviated herein as % U.sub.WT or % T.sub.WT.
[0299] In some embodiments, the % U.sub.WT or % T.sub.WT of a
uracil- or thymine-modified sequence encoding an MCM polypeptide of
the disclosure is above 50%, above 55%, above 60%, above 65%, above
70%, above 75%, above 80%, above 85%, above 90%, or above 95%.
[0300] In some embodiments, the % U.sub.WT or % T.sub.WT of a
uracil- or thymine modified sequence encoding an MCM polypeptide of
the disclosure is between 42% and 68%, between 43% and 67%, between
44% and 66%, between 45% and 65%, between 46% and 64%, between 47%
and 63%, between 48% and 62%, between 49% and 61%, between 50% and
60%, between 51% and 59%, or between 52% and 58%.
[0301] In some embodiments, the % U.sub.WT or % T.sub.WT of a
uracil- or thymine-modified sequence encoding an MCM polypeptide of
the disclosure is between 51% and 60%, between 51% and 59%, between
52% and 59%, between 52% and 58%, or between 53% and 58%.
[0302] In a particular embodiment, the % U.sub.WT or % T.sub.WT of
a uracil- or thymine-modified sequence encoding an MCM polypeptide
of the disclosure is between about 53% and about 58%.
[0303] Uracil- or thymine-content relative to the uracil or thymine
theoretical minimum, refers to a parameter determined by dividing
the number of uracils or thymines in a sequence-optimized
nucleotide sequence by the total number of uracils or thymines in a
hypothetical nucleotide sequence in which all the codons in the
hypothetical sequence are replaced with synonymous codons having
the lowest possible uracil or thymine content and multiplying by
100. This parameter is abbreviated herein as % U.sub.TM or %
T.sub.TM.
[0304] For DNA it is recognized that thymine is present instead of
uracil, and one would substitute T where U appears. Thus, all the
disclosures related to, e.g., % U.sub.TM, % U.sub.WT, or %
U.sub.TL, with respect to RNA are equally applicable to % T.sub.TM,
% T.sub.WT, or % T.sub.TL with respect to DNA.
[0305] In some embodiments, the % U.sub.TM of a uracil-modified
sequence encoding an MCM polypeptide of the disclosure is below
300%, below 295%, below 290%, below 285%, below 280%, below 275%,
below 270%, below 265%, below 260%, below 255%, below 250%, below
245%, below 240%, below 235%, below 230%, below 225%, below 220%,
below 215%, below 200%, below 195%, below 190%, below 185%, below
180%, below 175%, below 170%, below 165%, below 160%, below 155%,
below 150%, below 145%, below 140%, below 139%, below 138%, below
137%, below 136%, below 135%, below 134%, below 133%, below 132%,
below 131%, below 130%, below 129%, below 128%, below 127%, below
126%, below 125%, below 124%, below 123%, below 122%, below 121%,
below 120%, below 119%, below 118%, or below 117%.
[0306] In some embodiments, the % U.sub.TM of a uracil-modified
sequence encoding an MCM polypeptide of the disclosure is above
100%, above 101%, above 102%, above 103%, above 104%, above 105%,
above 106%, above 107%, above 108%, above 109%, above 110%, above
111%, above 112%, above 113%, above 114%, above 115%, above 116%,
above 117%, above 118%, above 119%, above 120%, above 121%, above
122%, above 123%, above 124%, above 125%, or above 126%, above
127%, above 128%, or above 129%.
[0307] In some embodiments, the % U.sub.TM of a uracil-modified
sequence encoding an MCM polypeptide of the disclosure is between
123% and 125%, between 122% and 126%, between 121% and 127%,
between 120% and 128%, between 119% and 129%, between 118% and
130%, between 117% and 131%, between 116% and 132%, between 115%
and 133%, between 114% and 134%, between 113% and 135%, between
112% and 136%, or between 111% and 137%.
[0308] In some embodiments, the % U.sub.TM of a uracil-modified
sequence encoding an MCM polypeptide of the disclosure is between
about 118% and about 129%.
[0309] In some embodiments, a uracil-modified sequence encoding an
MCM polypeptide of the disclosure has a reduced number of
consecutive uracils with respect to the corresponding wild-type
nucleic acid sequence. For example, two consecutive leucines can be
encoded by the sequence CUUUUG, which includes a four uracil
cluster. Such a subsequence can be substituted, e.g., with CUGCUC,
which removes the uracil cluster.
[0310] Phenylalanine can be encoded by UUC or UUU. Thus, even if
phenylalanines encoded by UUU are replaced by UUC, the synonymous
codon still contains a uracil pair (UU). Accordingly, the number of
phenylalanines in a sequence establishes a minimum number of uracil
pairs (UU) that cannot be eliminated without altering the number of
phenylalanines in the encoded polypeptide. For example, if the
polypeptide, e.g., wild type MCM, has 27, 28, 29, or 30
phenylalanines, the absolute minimum number of uracil pairs (UU) in
that uracil-modified sequence encoding the polypeptide, e.g., wild
type MCM, can contain is 27, 28, 29, or 30, respectively.
[0311] Wild type MCM contains 82 uracil pairs (UU), and 29 uracil
triplets (UUU). In some embodiments, a uracil-modified sequence
encoding an MCM polypeptide of the disclosure has a reduced number
of uracil triplets (UUU) with respect to the wild-type nucleic acid
sequence. In some embodiments, a uracil-modified sequence encoding
an MCM polypeptide of the disclosure contains 28, 27, 26, 25, 24,
23, 22, 21, 20, 19, 18 ,17, 16, 15, 14, 13,12, 11, 10, 9, 8, 7, 6,
5, 4, 3, 2, 1 or no uracil triplets (UUU).
[0312] In some embodiments, a uracil-modified sequence encoding an
MCM polypeptide has a reduced number of uracil pairs (UU) with
respect to the number of uracil pairs (UU) in the wild-type nucleic
acid sequence. In some embodiments, a uracil-modified sequence
encoding an MCM polypeptide of the disclosure has a number of
uracil pairs (UU) corresponding to the minimum possible number of
uracil pairs (UU) in the wild-type nucleic acid sequence, e.g., 28
uracil pairs in the case of wild type MCM.
[0313] In some embodiments, a uracil-modified sequence encoding an
MCM polypeptide of the disclosure has at least 1, 2, 3, 4, 5, 6, 7,
8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41,
42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54 uracil pairs
(UU) less than the number of uracil pairs (UU) in the wild-type
nucleic acid sequence. In some embodiments, a uracil-modified
sequence encoding an MCM polypeptide of the disclosure has between
20 and 35 uracil pairs (UU).
[0314] The phrase "uracil pairs (UU) relative to the uracil pairs
(UU) in the wild type nucleic acid sequence," refers to a parameter
determined by dividing the number of uracil pairs (UU) in a
sequence-optimized nucleotide sequence by the total number of
uracil pairs (UU) in the corresponding wild-type nucleotide
sequence and multiplying by 100. This parameter is abbreviated
herein as % UU.sub.wt.
[0315] In some embodiments, a uracil-modified sequence encoding an
MCM polypeptide of the disclosure has a % UU.sub.wt less than 90%,
less than 85%, less than 80%, less than 75%, less than 70%, less
than 65%, less than 60%, less than 65%, less than 60%, less than
55%, less than 50%, less than 40%, less than 30%, or less than
20%.
[0316] In some embodiments, a uracil-modified sequence encoding an
MCM polypeptide has a % UU.sub.wt between 20% and 50%. In a
particular embodiment, a uracil-modified sequence encoding an MCM
polypeptide of the disclosure has a % UU.sub.wt between 24% and
43%.
[0317] In some embodiments, the polynucleotide of the disclosure
comprises a uracil-modified sequence encoding an MCM polypeptide
disclosed herein. In some embodiments, the uracil-modified sequence
encoding an MCM polypeptide comprises at least one chemically
modified nucleobase, e.g., 5-methoxyuracil. In some embodiments, at
least 95% of a nucleobase (e.g., uracil) in a uracil-modified
sequence encoding an MCM polypeptide of the disclosure are modified
nucleobases. In some embodiments, at least 95% of uracil in a
uracil-modified sequence encoding an MCM polypeptide is
5-methoxyuracil.
[0318] In some embodiments, the "guanine content of the sequence
optimized ORF encoding MCM with respect to the theoretical maximum
guanine content of a nucleotide sequence encoding the MCM
polypeptide," abbreviated as % G.sub.TMX is at least 69%, at least
70%, at least 75%, at least about 80%, at least about 85%, at least
about 90%, at least about 95%, or about 100%. In some embodiments,
the % G.sub.TMX is between about 70% and about 80%, between about
71% and about 79%, between about 71% and about 78%, between about
71% and about 77% or between about 71% and about 76%.
[0319] In some embodiments, the "cytosine content of the ORF
relative to the theoretical maximum cytosine content of a
nucleotide sequence encoding the MCM polypeptide," abbreviated as %
C.sub.TMX, is at least about 68%, at least about 70%, at least
about 75%, at least about 80%, at least about 85%, at least about
90%, at least about 95%, or about 100%. In some embodiments, the %
C.sub.TMX is between about 68% and about 77%, between about 69% and
about 76%, or between about 70% and about 75%.
[0320] In some embodiments, the "guanine and cytosine content (G/C)
of the ORF relative to the theoretical maximum G/C content in a
nucleotide sequence encoding the MCM polypeptide," abbreviated as %
G/C.sub.TMX is at least about 85%, at least about 90%, at least
about 95%, or about 100%. The % G/C.sub.TMX is between about 85%
and about 100%, between about 89% and about 96%, between about 90%
and about 95%, or between about 91% and about 94%.
[0321] In some embodiments, the "G/C content in the ORF relative to
the G/C content in the corresponding wild-type ORF," abbreviated as
% G/C.sub.WT is at least 120%, at least 130%, at least 140%, at
least 141%, at least 142%, at least 143%, at least 144%, at least
145%, at least 146%, at least 147%, at least 150%,or at least
155%.
[0322] In some embodiments, the average G/C content in the 3rd
codon position in the ORF is at least 50%, at least 51%, at least
52%, at least 53%, at least 54%, at least 55%, at least 56%, at
least 57%, at least 58%, at least 59%, or at least 60% higher than
the average G/C content in the 3rd codon position in the
corresponding wild-type ORF.
[0323] In some embodiments, the polynucleotide of the disclosure
comprises an open reading frame (ORF) encoding an MCM polypeptide,
wherein the ORF has been sequence optimized, and wherein each of %
U.sub.TL, % U.sub.WT, % U.sub.TM, % G.sub.TL, % G.sub.WT, %
G.sub.TMX, % C.sub.TL, % C.sub.WT, % C.sub.TMX, % G/C.sub.TL, %
G/C.sub.WT, or % G/C.sub.TMX, alone or in a combination thereof is
in a range between (i) a maximum corresponding to the parameter's
maximum value (MAX) plus about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5,
5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 standard deviations
(STD DEV), and (ii) a minimum corresponding to the parameter's
minimum value (MIN) less 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5,
5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 standard deviations (STD
DEV).
[0324] Features, which can be considered beneficial in some
embodiments of the present disclosure, can be encoded by regions of
the polynucleotide and such regions can be upstream (5') or
downstream (3') to, or within, a region that encodes a polypeptide.
These regions can be incorporated into the polynucleotide before
and/or after sequence optimization of the protein encoding region
or open reading frame (ORF). It is not required that a
polynucleotide contain both a 5' and 3' flanking region. Examples
of such features include, but are not limited to, untranslated
regions (UTRs), Kozak sequences, an oligo(dT) sequence, and
detectable tags and can include multiple cloning sites that can
have Xbal recognition.
[0325] In some embodiments, a 5' UTR and/or a 3' UTR region can be
provided as flanking regions. Multiple 5' or 3' UTRs can be
included in the flanking regions and can be the same or of
different sequences. Any portion of the flanking regions, including
none, can be sequence-optimized and any can independently contain
one or more different structural or chemical modifications, before
and/or after sequence optimization.
[0326] In some embodiments, the polynucleotide of the disclosure
comprises, consists essentially or, or consists of the sequence set
forth as SEQ ID NO: 769, wherein thymidine is changed to uridine.
In other embodiments, the polynucleotide of the disclosure
comprises, consists essentially or, or consists of the sequence set
forth as SEQ ID NO: 770, wherein thymidine is changed to uridine.
In other embodiments, the polynucleotide does not comprise a
polyC.
[0327] After optimization (if desired), the polynucleotides
components are reconstituted and transformed into a vector such as,
but not limited to, plasmids, viruses, cosmids, and artificial
chromosomes. For example, the optimized polynucleotide can be
reconstituted and transformed into chemically competent E. coli,
yeast, neurospora, maize, drosophila, etc. where high copy
plasmid-like or chromosome structures occur by methods described
herein.
[0328] Synthetic polynucleotides and their nucleic acid analogs
play an important role in the research and studies of biochemical
processes. Various enzyme-assisted and chemical-based methods have
been developed to synthesize polynucleotides and nucleic acids.
[0329] Enzymatic methods include in vitro transcription that uses
RNA polymerases to synthesize the polynucleotides of the present
disclosure. Enzymatic methods and RNA polymerases for transcription
are described in International Patent Application No.
PCT/US2014/53907, the contents of which are herein incorporated by
reference in its entirety.
[0330] Solid-phase chemical synthesis can be used to manufacture
the polynucleotides described herein or portions thereof.
Solid-phase chemical synthesis manufacturing of the polynucleotides
described herein are described in International Patent Application
No. PCT/US2014/53907, the contents of which are herein incorporated
by reference in its entirety.
[0331] Liquid phase chemical synthesis can be used to manufacture
the polynucleotides described herein or portions thereof. Liquid
phase chemical synthesis manufacturing of the polynucleotides
described herein are described in International Patent Application
No. PCT/US2014/53907, the contents of which are herein incorporated
by reference in its entirety.
[0332] Combinations of different synthetic methods can be used to
manufacture the polynucleotides described herein or portions
thereof. These combinations are described in International Patent
Application No. PCT/US2014/53907, the contents of which are herein
incorporated by reference in its entirety.
[0333] Small region synthesis can be used for regions or subregions
of the polynucleotides of the present disclosure. These synthesis
methods are described in International Patent Application No.
PCT/US2014/53907, the contents of which are herein incorporated by
reference in its entirety.
[0334] Ligation of polynucleotide regions or subregions can be used
to prepare the polynucleotides described herein. These ligation
methods are described in International Patent Application No.
PCT/US2014/53907, the contents of which are herein incorporated by
reference in its entirety.
Polypeptides Encoded by the Polynucleotides of the Disclosure
[0335] In some embodiments, the MCM polypeptides encoded by
polynucleotides of the disclosure peptide are functional MCM. As
used herein, the term "MCM" protein is used interchangeably with
"MUT" protein. Therefore, human MCM protein can be written as human
MUT or hMUT, and murine MCM protein can be written as murine MUT or
mMUT. In some embodiments, the MCM polypeptides encoded by
polynucleotides of the disclosure peptide are variants, peptides or
polypeptides containing substitutions, insertions and/or additions,
deletions and covalent modifications with respect to an MCM peptide
sequence. For example, sequence tags or amino acids, such as one or
more lysines, can be added to the peptide sequences encoded by the
polynucleotides of the disclosure (e.g., at the N-terminal or
C-terminal ends). Sequence tags can be used for peptide
purification or localization. Lysines can be used to increase
peptide solubility or to allow for biotinylation. In some
embodiments, amino acid residues located at the carboxy and amino
terminal regions of a polypeptide encoded by the polynucleotides of
the disclosure can optionally be deleted providing for truncated
sequences.
[0336] In some embodiments, the polynucleotides described herein
encode a substitutional variant of an MCM protein. The
substitutional variant can comprise one, two, three or more than
three substitutions. "Substitutional variants" when referring to
polypeptides are those that have at least one amino acid residue in
a native or starting sequence removed and a different amino acid
inserted in its place at the same position. The substitutions can
be single, where only one amino acid in the molecule has been
substituted, or they can be multiple, where two or more amino acids
have been substituted in the same molecule.
[0337] In some embodiments, the polynucleotides described herein
encode a variant of an MCM protein with one or more conservative
amino acids substitutions. As used herein the term "conservative
amino acid substitution" refers to the substitution of an amino
acid that is normally present in the sequence with a different
amino acid of similar size, charge, or polarity. Examples of
conservative substitutions include the substitution of a non-polar
(hydrophobic) residue such as isoleucine, valine and leucine for
another non-polar residue. Likewise, examples of conservative
substitutions include the substitution of one polar (hydrophilic)
residue for another such as between arginine and lysine, between
glutamine and asparagine, and between glycine and serine.
Additionally, the substitution of a basic residue such as lysine,
arginine or histidine for another, or the substitution of one
acidic residue such as aspartic acid or glutamic acid for another
acidic residue are additional examples of conservative
substitutions. Examples of non-conservative substitutions include
the substitution of a non-polar (hydrophobic) amino acid residue
such as isoleucine, valine, leucine, alanine, methionine for a
polar (hydrophilic) residue such as cysteine, glutamine, glutamic
acid or lysine and/or a polar residue for a non-polar residue.
[0338] In other embodiments, the polynucleotides encode an
insertional MCM variant. "Insertional variants" when referring to
polypeptides are those with one or more amino acids inserted
immediately adjacent to an amino acid at a particular position in a
native or starting sequence. "Immediately adjacent" to an amino
acid means connected to either the alpha-carboxy or alpha-amino
functional group of the amino acid.
[0339] In other embodiments, the polynucleotides of the disclosure
encode a deletional MCM variant. "Deletional variants" when
referring to polypeptides are those with one or more amino acids in
the native or starting amino acid sequence removed. Ordinarily,
deletional variants will have one or more amino acids deleted in a
particular region of the molecule.
[0340] In some embodiments, the polynucleotides of the disclosure
encode a covalent derivative. "Covalent derivatives" when referring
to polypeptides include modifications of a native or starting
protein with an organic proteinaceous or non-proteinaceous
derivatizing agent, and/or post-translational modifications.
Covalent modifications are traditionally introduced by reacting
targeted amino acid residues of the protein with an organic
derivatizing agent that is capable of reacting with selected
side-chains or terminal residues, or by harnessing mechanisms of
post-translational modifications that function in selected
recombinant host cells. The resultant covalent derivatives are
useful in programs directed at identifying residues important for
biological activity, for immunoassays, or for the preparation of
anti-protein antibodies for immunoaffinity purification of the
recombinant glycoprotein. Such modifications are within the
ordinary skill in the art and are performed without undue
experimentation.
[0341] Certain post-translational modifications are the result of
the action of recombinant host cells on the expressed polypeptide.
Glutaminyl and asparaginyl residues are frequently
post-translationally deamidated to the corresponding glutamyl and
aspartyl residues. Alternatively, these residues are deamidated
under mildly acidic conditions. Either form of these residues can
be present in the polypeptides produced in accordance with the
present disclosure.
[0342] Other post-translational modifications include hydroxylation
of proline and lysine, phosphorylation of hydroxyl groups of seryl
or threonyl residues, methylation of the alpha-amino groups of
lysine, arginine, and histidine side chains (T. E. Creighton,
Proteins: Structure and Molecular Properties, W.H. Freeman &
Co., San Francisco, pp. 79-86 (1983)).
[0343] "Features," when referring to polypeptides, are defined as
distinct amino acid sequence-based components of a molecule.
Features of the polypeptides encoded by the polynucleotides of the
present disclosure include surface manifestations, local
conformational shape, folds, loops, half-loops, domains,
half-domains, sites, termini or any combination thereof.
[0344] As used herein, when referring to polypeptides, the term
"domain" refers to a motif of a polypeptide having one or more
identifiable structural or functional characteristics or properties
(e.g., binding capacity, serving as a site for protein-protein
interactions).
[0345] As used herein, when referring to polypeptides, the terms
"site" as it pertains to amino acid based embodiments is used
synonymously with "amino acid residue" and "amino acid side chain."
A site represents a position within a peptide or polypeptide that
can be modified, manipulated, altered, derivatized or varied within
the polypeptide based molecules of the present disclosure.
[0346] As used herein the terms "termini" or "terminus," when
referring to polypeptides, refers to an extremity of a peptide or
polypeptide. Such extremity is not limited only to the first or
final site of the peptide or polypeptide but can include additional
amino acids in the terminal regions. The polypeptide based
molecules of the present disclosure can be characterized as having
both an N-terminus (terminated by an amino acid with a free amino
group (NH2)) and a C-terminus (terminated by an amino acid with a
free carboxyl group (COOH)). Proteins of the disclosure are in some
cases made up of multiple polypeptide chains brought together by
disulfide bonds or by non-covalent forces (multimers, oligomers).
These sorts of proteins will have multiple N- and C-termini.
Alternatively, the termini of the polypeptides can be modified such
that they begin or end, as the case can be, with a non-polypeptide
based moiety such as an organic conjugate.
[0347] Once any of the features have been identified or defined as
a desired component of a polypeptide to be encoded by the
polynucleotide of the disclosure, any of several manipulations
and/or modifications of these features can be performed by moving,
swapping, inverting, deleting, randomizing or duplicating.
Furthermore, it is understood that manipulation of features can
result in the same outcome as a modification to the molecules of
the disclosure. For example, a manipulation that involved deleting
a domain would result in the alteration of the length of a molecule
just as modification of a nucleic acid to encode less than a full
length molecule would.
[0348] Modifications and manipulations can be accomplished by
methods known in the art such as, but not limited to, site directed
mutagenesis or a priori incorporation during chemical synthesis.
The resulting modified molecules can then be tested for activity
using in vitro or in vivo assays such as those described herein or
any other suitable screening assay known in the art.
[0349] According to the present disclosure, the polypeptides can
comprise a consensus sequence that is discovered through rounds of
experimentation. As used herein a "consensus" sequence is a single
sequence that represents a collective population of sequences
allowing for variability at one or more sites.
[0350] As recognized by those skilled in the art, protein
fragments, functional protein domains, and homologous proteins are
also considered to be within the scope of polypeptides of interest
of this disclosure. For example, provided herein is any protein
fragment (meaning a polypeptide sequence at least one amino acid
residue shorter than a reference polypeptide sequence but otherwise
identical) of a reference protein 10, 20, 30, 40, 50, 60, 70, 80,
90, 100 or greater than 100 amino acids in length. In another
example, any protein that includes a stretch of about 20, about 30,
about 40, about 50, or about 100 amino acids that are about 40%,
about 50%, about 60%, about 70%, about 80%, about 90%, about 95%,
or about 100% identical to any of the sequences described herein
can be utilized in accordance with the disclosure.
[0351] In certain embodiments, a polypeptide encoded by the
polynucleotide of the disclosure includes 2, 3, 4, 5, 6, 7, 8, 9,
10, or more mutations as shown in any of the sequences provided or
referenced herein.
[0352] In some embodiments, the encoded polypeptide variant has the
same or a similar activity as the reference polypeptide.
Alternatively, the variant has an altered activity (e.g., increased
or decreased) relative to a reference polypeptide. Generally,
variants of a particular polynucleotide or polypeptide of the
disclosure will have at least about 40%, 45%, 50%, 55%, 60%, 65%,
70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99% but less than 100% sequence identity to that particular
reference polynucleotide or polypeptide as determined by sequence
alignment programs and parameters described herein and known to
those skilled in the art. Such tools for alignment include those of
the BLAST suite (Stephen F. Altschul, Thomas L. Madden, Alejandro
A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs," Nucleic Acids Res.
25:3389-3402.) Other tools are described herein, specifically in
the definition of "Identity."
[0353] Default parameters in the BLAST algorithm include, for
example, an expect threshold of 10, Word size of 28, Match/Mismatch
Scores 1, -2, Gap costs Linear. Any filter can be applied as well
as a selection for species specific repeats, e.g., Homo
sapiens.
[0354] According to the present disclosure, the protein is encoded
by a polynucleotide that can comprise at least a first region of
linked nucleosides encoding at least one polypeptide of interest.
Some polypeptides encoded by the polynucleotides of interest of the
present disclosure are listed in Table 3 below. In particular,
Table 3 shows human MCM wild type and mutant amino acid
sequences.
TABLE-US-00003 TABLE 3 MCM Polypeptides and Polynucleotides SEQ ID
No Gene Sequence SEQ ID Functional
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPED NO: 208
Human LIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTV
MCM EESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILF
DGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYI
FPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRT
GLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLR
AHCQTSGWSLTEQDPYNNIVRTAIEAMAAVEGGIQSLHINSFDEALGLPTVKSARIAR
NTQIIIQEESGIPKVADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIP
KLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIK
SSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKAND
RMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGF
ADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPD
ILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV a.a. 33 to
Mature LHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKP
750 of human
FIRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDS SEQ ID
MCM DNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQ NO:
208 GVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGY
HMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKM
RAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFG
GIQSLHINSFDEALGLPTVKSARIARNTQIIIQEESGIPKVADPWGGSYMMECLTNDV
YDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEK
EDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVD
ASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSAIKRVHKFMEREG
RRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAVDADVHAVG
VSTLAAGHKTLVPELIKELNSLGRPDILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRI
PKAAVQVLDDIEKCLEKKQQSV SEQ ID Functional
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPED NO: 209
Human LIWHTPEGISVKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTV
MCM EESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILF I69V
DGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYI
FPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRT
GLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLR
AHCQTSGWSLTEQDPYNNIVRTAIEAMAAVEGGIQSLHINSFDEALGLPTVKSARIAR
NTQIIIQEESGIPKVADPWGGSYMMECLINDVYDAALKLINEIEEMGGMAKAVAEGIP
KLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIK
SSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKAND
RMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGF
ADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPD
ILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV SEQ ID
Functional
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPED NO: 210
Human LIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTV
MCM EESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILF
A499T DGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYI
FPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRT
GLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLR
AHCQTSGWSLTEQDPYNNIVRTAIEAMAAVEGGIQSLHINSFDEALGLPTVKSARIAR
NTQIIIQEESGIPKVADPWGGSYMMECLINDVYDAALKLINEIEEMGGMAKAVAEGIP
KLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDTVEVLAIDNTSVRNRQIEKLKKIK
SSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKAND
RMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGF
ADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPD
ILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV SEQ ID
Functional
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPED NO: 211
Human LIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTV
MCM EESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILF
R532H DGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYI
FPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRT
GLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLR
AHCQTSGWSLTEQDPYNNIVRTAIEAMAAVEGGIQSLHINSFDEALGLPTVKSARIAR
NTQIIIQEESGIPKVADPWGGSYMMECLINDVYDAALKLINEIEEMGGMAKAVAEGIP
KLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIK
SSRDQALAEHCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKAND
RMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGF
ADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPD
ILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV SEQ ID
Functional
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPED NO: 212
Human LIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTV
MCM EESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILF
T598A DGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYI
FPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRT
GLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLR
AHCQTSGWSLTEQDPYNNIVRTAIEAMAAVEGGIQSLHINSFDEALGLPTVKSARIAR
NTQIIIQEESGIPKVADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIP
KLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIK
SSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKAND
RMVSGAYRQEFGESKEIASAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGF
ADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPD
ILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV SEQ ID
Functional
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPED NO: 213
Human LIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTV
MCM EESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILF
I671V DGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYI
FPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRT
GLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLR
AHCQTSGWSLTEQDPYNNIVRTAIEAMAAVEGGIQSLHINSFDEALGLPTVKSARIAR
NTQIIIQEESGIPKVADPWGGSYMMECLINDVYDAALKLINEIEEMGGMAKAVAEGIP
KLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIK
SSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKAND
RMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGF
ADLGFDVDIGPLFQTPREVAQQAVDADVHAVGVSTLAAGHKTLVPELIKELNSLGRPD
ILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV
II. Modified Polynucleotides
[0355] The disclosure also includes a modified polynucleotide
comprising the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide that
contains polynucleotides that are chemically and/or structurally
modified. When the polynucleotides of the present disclosure are
chemically and/or structurally modified the polynucleotides can be
referred to as "modified polynucleotides."
[0356] The present disclosure provides for modified nucleosides and
nucleotides of a polynucleotide (e.g., RNA polynucleotides, such as
mRNA polynucleotides). A "nucleoside" refers to a compound
containing a sugar molecule (e.g., a pentose or ribose) or a
derivative thereof in combination with an organic base (e.g., a
purine or pyrimidine) or a derivative thereof (also referred to
herein as "nucleobase"). A nucleotide" refers to a nucleoside,
including a phosphate group. Modified nucleotides can by
synthesized by any useful method, such as, for example, chemically,
enzymatically, or recombinantly, to include one or more modified or
non-natural nucleosides. Polynucleotides can comprise a region or
regions of linked nucleosides. Such regions can have variable
backbone linkages. The linkages can be standard phosphodioester
linkages, in which case the polynucleotides would comprise regions
of nucleotides.
[0357] The modifications can be various distinct modifications. In
some embodiments, the regions can contain one, two, or more
(optionally different) nucleoside or nucleotide modifications. In
some embodiments, a modified polynucleotide, introduced to a cell
can exhibit reduced degradation in the cell, as compared to an
unmodified polynucleotide.
Structural Modifications
[0358] In some embodiments, the polynucleotides of the present
disclosure are structurally modified. As used herein, a
"structural" modification is one in which two or more linked
nucleosides are inserted, deleted, duplicated, inverted or
randomized in a polynucleotide without significant chemical
modification to the nucleotides themselves. Because chemical bonds
will necessarily be broken and reformed to effect a structural
modification, structural modifications are of a chemical nature and
hence are chemical modifications. However, structural modifications
will result in a different sequence of nucleotides. For example,
the polynucleotide "ATCG" can be chemically modified to
"AT-5meC-G". The same polynucleotide can be structurally modified
from "ATCG" to "ATCCCG". Here, the dinucleotide "CC" has been
inserted, resulting in a structural modification to the
polynucleotide.
Chemical Modifications
[0359] In some embodiments, the polynucleotides of the present
disclosure are chemically modified. As used herein in reference to
a polynucleotide, the terms "chemical modification" or, as
appropriate, "chemically modified" refer to modification with
respect to adenosine (A), guanosine (G), uridine (U), thymidine (T)
or cytidine (C) ribo- or deoxyribonucleosides in one or more of
their position, pattern, percent or population. Generally, herein,
these terms are not intended to refer to the ribonucleotide
modifications in naturally occurring 5'-terminal mRNA cap
moieties.
[0360] In some embodiments, the polynucleotides of the present
disclosure can have a uniform chemical modification of all or any
of the same nucleoside type or a population of modifications
produced by mere downward titration of the same starting
modification in all or any of the same nucleoside type, or a
measured percent of a chemical modification of all any of the same
nucleoside type but with random incorporation, such as where all
uridines are replaced by a uridine analog, e.g., pseudouridine or
5-methoxyuridine. In another embodiment, the polynucleotides can
have a uniform chemical modification of two, three, or four of the
same nucleoside type throughout the entire polynucleotide (such as
all uridines and all cytosines, etc. are modified in the same
way).
[0361] Modified nucleotide base pairing encompasses not only the
standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine
base pairs, but also base pairs formed between nucleotides and/or
modified nucleotides comprising non-standard or modified bases,
wherein the arrangement of hydrogen bond donors and hydrogen bond
acceptors permits hydrogen bonding between a non-standard base and
a standard base or between two complementary non-standard base
structures. One example of such non-standard base pairing is the
base pairing between the modified nucleotide inosine and adenine,
cytosine or uracil. Any combination of base/sugar or linker can be
incorporated into polynucleotides of the present disclosure.
[0362] The skilled artisan will appreciate that, except where
otherwise noted, polynucleotide sequences set forth in the instant
application will recite "T"s in a representative DNA sequence but
where the sequence represents RNA, the "T"s would be substituted
for "U"s.
[0363] Modifications of polynucleotides (e.g., RNA polynucleotides,
such as mRNA polynucleotides) that are useful in the compositions,
methods and synthetic processes of the present disclosure include,
but are not limited to the following nucleotides, nucleosides, and
nucleobases: 2-methylthio-N6-(cis-hydroxyi sopentenyl)adenosine;
2-methylthio-N6-methyladenosine; 2-methylthio-N6-threonyl
carbamoyladenosine; N6-glycinylcarbamoyladenosine;
N6-isopentenyladenosine; N6-methyladenosine;
N6-threonylcarbamoyladenosine; 1,2'-O-dimethyladenosine;
1-methyladenosine; 2'-O-methyladenosine; 2'-O-ribosyladenosine
(phosphate); 2-methyladenosine; 2-methylthio-N6
isopentenyladenosine; 2-methylthio-N6-hydroxynorvalyl
carbamoyladenosine; 2'-O-methyladenosine; 2'-O-ribosyladenosine
(phosphate); Isopentenyladenosine;
N6-(cis-hydroxyisopentenyl)adenosine; N6,2'-O-dimethyladenosine;
N6,2'-O-dimethyladenosine; N6,N6,2'-O-trimethyladenosine;
N6,N6-dimethyladenosine; N6-acetyladenosine;
N6-hydroxynorvalylcarbamoyladenosine;
N6-methyl-N6-threonylcarbamoyladenosine; 2-methyladenosine;
2-methylthio-N6-isopentenyladenosine; 7-deaza-adenosine;
N1-methyl-adenosine; N6, N6 (dimethyl)adenine;
N6-cis-hydroxy-isopentenyl-adenosine; .alpha.-thio-adenosine; 2
(amino)adenine; 2 (aminopropyl)adenine; 2 (methylthio) N6
(isopentenyl)adenine; 2-(alkyl)adenine; 2-(aminoalkyl)adenine;
2-(aminopropyl)adenine; 2-(halo)adenine; 2-(halo)adenine;
2-(propyl)adenine; 2'-Amino-2'-deoxy-ATP; 2'-Azido-2'-deoxy-ATP;
2'-Deoxy-2'-a-aminoadenosine TP; 2'-Deoxy-2'-a-azidoadenosine TP; 6
(alkyl)adenine; 6 (methyl)adenine; 6-(alkyl)adenine;
6-(methyl)adenine; 7 (deaza)adenine; 8 (alkenyl)adenine; 8
(alkynyl)adenine; 8 (amino)adenine; 8 (thioalkyl)adenine;
8-(alkenyl)adenine; 8-(alkyl)adenine; 8-(alkynyl)adenine;
8-(amino)adenine; 8-(halo)adenine; 8-(hydroxyl)adenine;
8-(thioalkyl)adenine; 8-(thiol)adenine; 8-azido-adenosine; aza
adenine; deaza adenine; N6 (methyl)adenine; N6-(isopentyl)adenine;
7-deaza-8-aza-adenosine; 7-methyladenine; 1-Deazaadenosine TP;
2'Fluoro-N6-Bz-deoxyadenosine TP; 2'-OMe-2-Amino-ATP;
2'O-methyl-N6-Bz-deoxyadenosine TP; 2'-a-Ethynyladenosine TP;
2-aminoadenine; 2-Aminoadenosine TP; 2-Amino-ATP;
2'-a-Trifluoromethyladenosine TP; 2-Azidoadenosine TP;
2'-b-Ethynyladenosine TP; 2-Bromoadenosine TP;
2'-b-Trifluoromethyladenosine TP; 2-Chloroadenosine TP;
2'-Deoxy-2',2'-difluoroadenosine TP;
2'-Deoxy-2'-a-mercaptoadenosine TP;
2'-Deoxy-2'-a-thiomethoxyadenosine TP; 2'-Deoxy-2'-b-aminoadenosine
TP; 2'-Deoxy-2'-b-azidoadenosine TP; 2'-Deoxy-2'-b-bromoadenosine
TP; 2'-Deoxy-2'-b-chloroadenosine TP; 2'-Deoxy-2'-b-fluoroadenosine
TP; 2'-Deoxy-2'-b-iodoadenosine TP; 2'-Deoxy-2'-b-mercaptoadenosine
TP; 2'-Deoxy-2'-b-thiomethoxyadenosine TP; 2-Fluoroadenosine TP;
2-lodoadenosine TP; 2-Mercaptoadenosine TP; 2-methoxy-adenine;
2-methylthio-adenine; 2-Trifluoromethyladenosine TP;
3-Deaza-3-bromoadenosine TP; 3-Deaza-3-chloroadenosine TP;
3-Deaza-3-fluoroadenosine TP; 3-Deaza-3-iodoadenosine TP;
3-Deazaadenosine TP; 4'-Azidoadenosine TP; 4'-Carbocyclic adenosine
TP; 4'-Ethynyladenosine TP; 5'-Homo-adenosine TP; 8-Aza-ATP;
8-bromo-adenosine TP; 8-Trifluoromethyladenosine TP;
9-Deazaadenosine TP; 2-aminopurine; 7-deaza-2,6-diaminopurine;
7-deaza-8-aza-2,6-diaminopurine; 7-deaza-8-aza-2-aminopurine;
2,6-diaminopurine; 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine;
2-thiocytidine; 3-methylcytidine; 5-formylcytidine;
5-hydroxymethylcytidine; 5-methylcytidine; N4-acetylcytidine;
2'-O-methylcytidine; 2'-O-methylcytidine; 5,2'-O-dimethylcytidine;
5-formyl-2'-O-methylcytidine; Lysidine; N4,2'-O-dimethylcytidine;
N4-acetyl-2'-O-methylcytidine; N4-methylcytidine;
N4,N4-Dimethyl-2'-OMe-Cytidine TP; 4-methylcytidine;
5-aza-cytidine; Pseudo-iso-cytidine; pyrrolo-cytidine;
.alpha.-thio-cytidine; 2-(thio)cytosine; 2'-Amino-2'-deoxy-CTP;
2'-Azido-2'-deoxy-CTP; 2'-Deoxy-2'-a-aminocytidine TP;
2'-Deoxy-2'-a-azidocytidine TP; 3 (deaza) 5 (aza)cytosine; 3
(methyl)cytosine; 3-(alkyl)cytosine; 3-(deaza) 5 (aza)cytosine;
3-(methyl)cytidine; 4,2'-O-dimethylcytidine; 5 (halo)cytosine; 5
(methyl)cytosine; 5 (propynyl)cytosine; 5
(trifluoromethyl)cytosine; 5-(alkyl)cytosine; 5-(alkynyl)cytosine;
5-(halo)cytosine; 5-(propynyl)cytosine;
5-(trifluoromethyl)cytosine; 5-bromo-cytidine; 5-iodo-cytidine;
5-propynyl cytosine; 6-(azo)cytosine; 6-aza-cytidine; aza cytosine;
deaza cytosine; N4 (acetyl)cytosine; 1-methyl-1-deaza-pseudoi
socytidine; 1-methyl-pseudoi socytidine;
2-methoxy-5-methyl-cytidine; 2-methoxy-cytidine;
2-thio-5-methyl-cytidine; 4-methoxy-1-methyl-pseudoisocytidine;
4-methoxy-pseudoisocytidine;
4-thio-1-methyl-1-deaza-pseudoisocytidine;
4-thio-1-methyl-pseudoisocytidine; 4-thio-pseudoisocytidine;
5-aza-zebularine; 5-methyl-zebularine; pyrrolo-pseudoisocytidine;
Zebularine; (E)-5-(2-Bromo-vinyl)cytidine TP; 2,2'-anhydro-cytidine
TP hydrochloride; 2'Fluor-N4-Bz-cytidine TP;
2'Fluoro-N4-Acetyl-cytidine TP; 2'-O-Methyl-N4-Acetyl-cytidine TP;
2'O-methyl-N4-Bz-cytidine TP; 2'-a-Ethynylcytidine TP;
2'-a-Trifluoromethylcytidine TP; 2'-b-Ethynylcytidine TP;
2'-b-Trifluoromethylcytidine TP; 2'-Deoxy-2',2'-difluorocytidine
TP; 2'-Deoxy-2'-a-mercaptocytidine TP;
2'-Deoxy-2'-a-thiomethoxycytidine TP; 2'-Deoxy-2'-b-aminocytidine
TP; 2'-Deoxy-2'-b-azidocytidine TP; 2'-Deoxy-2'-b-bromocytidine TP;
2'-Deoxy-2'-b-chlorocytidine TP; 2'-Deoxy-2'-b-fluorocytidine TP;
2'-Deoxy-2'-b-iodocytidine TP; 2'-Deoxy-2'-b-mercaptocytidine TP;
2'-Deoxy-2'-b-thiomethoxycytidine TP;
2'-O-Methyl-5-(1-propynyl)cytidine TP; 3'-Ethynylcytidine TP;
4'-Azidocytidine TP; 4'-Carbocyclic cytidine TP; 4'-Ethynylcytidine
TP; 5-(1-Propynyl)ara-cytidine TP;
5-(2-Chloro-phenyl)-2-thiocytidine TP;
5-(4-Amino-phenyl)-2-thiocytidine TP; 5-Aminoallyl-CTP;
5-Cyanocytidine TP; 5-Ethynylara-cytidine TP; 5-Ethynylcytidine TP;
5'-Homo-cytidine TP; 5-Methoxycytidine TP;
5-Trifluoromethyl-Cytidine TP; N4-Amino-cytidine TP;
N4-Benzoyl-cytidine TP; Pseudoisocytidine; 7-methylguanosine;
N2,2'-O-dimethylguanosine; N2-methylguanosine; Wyosine;
1,2'-O-dimethylguanosine; 1-methylguanosine; 2'-O-methylguanosine;
2'-O-ribosylguanosine (phosphate); 2'-O-methylguanosine;
2'-O-ribosylguanosine (phosphate); 7-aminomethyl-7-deazaguanosine;
7-cyano-7-deazaguanosine; Archaeosine; Methylwyosine;
N2,7-dimethylguanosine; N2,N2,2'-O-trimethylguanosine;
N2,N2,7-trimethylguanosine; N2,N2-dimethylguanosine;
N2,7,2'-O-trimethylguanosine; 6-thio-guanosine; 7-deaza-guanosine;
8-oxo-guanosine; N1-methyl-guanosine; .alpha.-thio-guanosine; 2
(propyl)guanine; 2-(alkyl)guanine; 2'-Amino-2'-deoxy-GTP;
2'-Azido-2'-deoxy-GTP; 2'-Deoxy-2'-a-aminoguanosine TP;
2'-Deoxy-2'-a-azidoguanosine TP; 6 (methyl)guanine;
6-(alkyl)guanine; 6-(methyl)guanine; 6-methyl-guanosine; 7
(alkyl)guanine; 7 (deaza)guanine; 7 (methyl)guanine;
7-(alkyl)guanine; 7-(deaza)guanine; 7-(methyl)guanine; 8
(alkyl)guanine; 8 (alkynyl)guanine; 8 (halo)guanine; 8
(thioalkyl)guanine; 8-(alkenyl)guanine; 8-(alkyl)guanine;
8-(alkynyl)guanine; 8-(amino)guanine; 8-(halo)guanine;
8-(hydroxyl)guanine; 8-(thioalkyl)guanine; 8-(thiol)guanine; aza
guanine; deaza guanine; N (methyl)guanine; N-(methyl)guanine;
1-methyl-6-thio-guanosine; 6-methoxy-guanosine;
6-thio-7-deaza-8-aza-guanosine; 6-thio-7-deaza-guanosine;
6-thio-7-methyl-guanosine; 7-deaza-8-aza-guanosine;
7-methyl-8-oxo-guanosine; N2,N2-dimethyl-6-thio-guanosine;
N2-methyl-6-thio-guanosine; 1-Me-GTP;
2'Fluoro-N2-isobutyl-guanosine TP; 2'O-methyl-N2-isobutyl-guanosine
TP; 2'-a-Ethynylguanosine TP; 2'-a-Trifluoromethylguanosine TP;
2'-b-Ethynylguanosine TP; 2'-b-Trifluoromethylguanosine TP;
2'-Deoxy-2',2'-difluoroguanosine TP;
2'-Deoxy-2'-a-mercaptoguanosine TP;
2'-Deoxy-2'-a-thiomethoxyguanosine TP; 2'-Deoxy-2'-b-aminoguanosine
TP; 2'-Deoxy-2'-b-azidoguanosine TP; 2'-Deoxy-2'-b-bromoguanosine
TP; 2'-Deoxy-2'-b-chloroguanosine TP; 2'-Deoxy-2'-b-fluoroguanosine
TP; 2'-Deoxy-2'-b-iodoguanosine TP; 2'-Deoxy-2'-b-mercaptoguanosine
TP; 2'-Deoxy-2'-b-thiomethoxyguanosine TP; 4'-Azidoguanosine TP;
4'-Carbocyclic guanosine TP; 4'-Ethynylguanosine TP;
5'-Homo-guanosine TP; 8-bromo-guanosine TP; 9-Deazaguanosine TP;
N2-isobutyl-guanosine TP; 1-methylinosine; Inosine;
1,2'-O-dimethylinosine; 2'-O-methylinosine; 7-methylinosine;
2'-O-methylinosine; Epoxyqueuosine; galactosyl-queuosine;
Mannosylqueuosine; Queuosine; allyamino-thymidine; aza thymidine;
deaza thymidine; deoxy-thymidine; 2'-O-methyluridine;
2-thiouridine; 3-methyluridine; 5-carboxymethyluridine;
5-hydroxyuridine; 5-methyluridine; 5-taurinomethyl-2-thiouridine;
5-taurinomethyluridine; Dihydrouridine; Pseudouridine;
(3-(3-amino-3-carboxypropyl)uridine;
1-methyl-3-(3-amino-5-carboxypropyl)pseudouridine;
1-methylpseduouridine; 1-ethyl-pseudouridine; 2'-O-methyluridine;
2'-O-methylpseudouridine; 2'-O-methyluridine;
2-thio-2'-O-methyluridine; 3-(3-amino-3-carboxypropyl)uridine;
3,2'-O-dimethyluridine; 3-Methyl-pseudo-Uridine TP; 4-thiouridine;
5-(carboxyhydroxymethyl)uridine; 5-(carboxyhydroxymethyl)uridine
methyl ester; 5,2'-O-dimethyluridine; 5,6-dihydro-uridine;
5-aminomethyl-2-thiouridine; 5-carbamoylmethyl-2'-O-methyluridine;
5-carbamoylmethyluridine; 5-carboxyhydroxymethyluridine;
5-carboxyhydroxymethyluridine methyl ester;
5-carboxymethylaminomethyl-2'-O-methyluridine;
5-carboxymethylaminomethyl-2-thiouridine;
5-carboxymethylaminomethyl-2-thiouridine;
5-carboxymethylaminomethyluridine;
5-carboxymethylaminomethyluridine; 5-Carbamoylmethyluridine TP;
5-methoxycarbonylmethyl-2'-O-methyluridine;
5-methoxycarbonylmethyl-2-thiouridine;
5-methoxycarbonylmethyluridine; 5-methyluridine), 5-methoxyuridine;
5-methyl-2-thiouridine; 5-methylaminomethyl-2-selenouridine;
5-methylaminomethyl-2-thiouridine; 5-methylaminomethyluridine;
5-Methyldihydrouridine; 5-Oxyacetic acid-Uridine TP; 5-Oxyacetic
acid-methyl ester-Uridine TP; N1-methyl-pseudo-uracil;
N1-ethyl-pseudo-uracil; uridine 5-oxyacetic acid; uridine
5-oxyacetic acid methyl ester; 3-(3-Amino-3-carboxypropyl)-Uridine
TP; 5-(iso-Pentenylaminomethyl)-2-thiouridine TP;
5-(iso-Pentenylaminomethyl)-2'-O-methyluridine TP;
5-(iso-Pentenylaminomethyl)uridine TP; 5-propynyl uracil;
.alpha.-thio-uridine; 1
(aminoalkylamino-carbonylethylenyl)-2(thio)-pseudouracil; 1
(aminoalkylaminocarbonylethylenyl)-2,4-(dithio)pseudouracil; 1
(aminoalkylaminocarbonylethylenyl)-4 (thio)pseudouracil; 1
(aminoalkylaminocarbonylethylenyl)-pseudouracil; 1
(aminocarbonylethylenyl)-2(thio)-pseudouracil; 1
(aminocarbonylethylenyl)-2,4-(dithio)pseudouracil; 1
(aminocarbonylethylenyl)-(thio)pseudouracil; 1
(aminocarbonylethylenyl)-pseudouracil; 1 substituted
2(thio)-pseudouracil; 1 substituted 2,4-(dithio)pseudouracil; 1
substituted 4 (thio)pseudouracil; 1 substituted pseudouracil;
1-(aminoalkylamino-carbonylethylenyl)-2-(thio)-pseudouracil;
1-Methyl-3-(3-amino-3-carboxypropyl) pseudouridine TP;
1-Methyl-3-(3-amino-3-carboxypropyl)pseudo-UTP;
1-Methyl-pseudo-UTP; 1-Ethyl-pseudo-UTP; 2 (thio)pseudouracil; 2'
deoxy uridine; 2' fluorouridine; 2-(thio)uracil;
2,4-(dithio)psuedouracil; 2' methyl, 2'amino, 2'azido,
2'fluro-guanosine; 2'-Amino-2'-deoxy-UTP; 2'-Azido-2'-deoxy-UTP;
2'-Azido-deoxyuridine TP; 2'-O-methylpseudouridine; 2' deoxy
uridine; 2' fluorouridine; 2'-Deoxy-2'-a-aminouridine TP;
2'-Deoxy-2'-a-azidouridine TP; 2-methylpseudouridine; 3 (3 amino-3
carboxypropyl)uracil; 4 (thio)pseudouracil; 4-(thio)pseudouracil;
4-(thio)uracil; 4-thiouracil; 5 (1,3-diazole-1-alkyl)uracil; 5
(2-aminopropyl)uracil; 5 (aminoalkyl)uracil; 5
(dimethylaminoalkyl)uracil; 5 (guanidiniumalkyl)uracil; 5
(methoxycarbonylmethyl)-2-(thio)uracil; 5
(methoxycarbonyl-methyl)uracil; 5 (methyl) 2 (thio)uracil; 5
(methyl) 2,4 (dithio)uracil; 5 (methyl) 4 (thio)uracil; 5
(methylaminomethyl)-2 (thio)uracil; 5 (methylaminomethyl)-2,4
(dithio)uracil; 5 (methylaminomethyl)-4 (thio)uracil; 5
(propynyl)uracil; 5 (trifluoromethyl)uracil;
5-(2-aminopropyl)uracil; 5-(alkyl)-2-(thio)pseudouracil;
5-(alkyl)-2,4 (dithio)pseudouracil; 5-(alkyl)-4 (thio)pseudouracil;
5-(alkyl)pseudouracil; 5-(alkyl)uracil; 5-(alkynyl)uracil;
5-(allylamino)uracil; 5-(cyanoalkyl)uracil;
5-(dialkylaminoalkyl)uracil; 5-(dimethylaminoalkyl)uracil;
5-(guanidiniumalkyl)uracil; 5-(halo)uracil;
5-(1,3-diazole-1-alkyl)uracil; 5-(methoxy)uracil;
5-(methoxycarbonylmethyl)-2-(thio)uracil;
5-(methoxycarbonyl-methyl)uracil; 5-(methyl) 2(thio)uracil;
5-(methyl) 2,4 (dithio) uracil; 5-(methyl) 4 (thio)uracil;
5-(methyl)-2-(thio)pseudouracil; 5-(methyl)-2,4
(dithio)pseudouracil; 5-(methyl)-4(thio)pseudouracil;
5-(methyl)pseudouracil; 5-(methylaminomethyl)-2 (thio)uracil;
5-(methylaminomethyl)-2,4(dithio)uracil;
5-(methylaminomethyl)-4-(thio)uracil; 5-(propynyl)uracil;
5-(trifluoromethyl)uracil; 5-aminoallyl-uridine; 5-bromo-uridine;
5-iodo-uridine; 5-uracil; 6 (azo)uracil; 6-(azo)uracil;
6-aza-uridine; allyamino-uracil; aza uracil; deaza uracil; N3
(methyl)uracil; Pseudo-UTP-1-2-ethanoic acid; Pseudouracil;
4-Thio-pseudo-UTP; 1-carboxymethyl-pseudouridine;
1-methyl-1-deaza-pseudouridine; 1-propynyl-uridine;
1-taurinomethyl-1-methyl-uridine; 1-taurinomethyl-4-thio-uridine;
1-taurinomethyl-pseudouridine; 2-methoxy-4-thio-pseudouridine;
2-thio-1-methyl-1-deaza-pseudouridine;
2-thio-1-methyl-pseudouridine; 2-thio-5-aza-uridine;
2-thio-dihydropseudouridine; 2-thio-dihydrouridine;
2-thio-pseudouridine; 4-methoxy-2-thio-pseudouridine;
4-methoxy-pseudouridine; 4-thio-1-methyl-pseudouridine;
4-thio-pseudouridine; 5-aza-uridine; Dihydropseudouridine;
(.+-.)1-(2-Hydroxypropyl)pseudouridine TP;
(2R)-1-(2-Hydroxypropyl)pseudouridine TP;
(2S)-1-(2-Hydroxypropyl)pseudouridine TP;
(E)-5-(2-Bromo-vinyl)ara-uridine TP; (E)-5-(2-Bromo-vinyl)uridine
TP; (Z)-5-(2-Bromo-vinyl)ara-uridine TP;
(Z)-5-(2-Bromo-vinyl)uridine TP;
1-(2,2,2-Trifluoroethyl)-pseudo-UTP;
1-(2,2,3,3,3-Pentafluoropropyl)pseudouridine TP;
1-(2,2-Diethoxyethyl)pseudouridine TP;
1-(2,4,6-Trimethylbenzyl)pseudouridine TP;
1-(2,4,6-Trimethyl-benzyl)pseudo-UTP;
1-(2,4,6-Trimethyl-phenyl)pseudo-UTP;
1-(2-Amino-2-carboxyethyl)pseudo-UTP; 1-(2-Amino-ethyl)pseudo-UTP;
1-(2-Hydroxyethyl)pseudouridine TP; 1-(2-Methoxyethyl)pseudouridine
TP; 1-(3,4-Bis-trifluoromethoxybenzyl)pseudouridine TP;
1-(3,4-Dimethoxybenzyl)pseudouridine TP;
1-(3-Amino-3-carboxypropyl)pseudo-UTP;
1-(3-Amino-propyl)pseudo-UTP;
1-(3-Cyclopropyl-prop-2-ynyl)pseudouridine TP;
1-(4-Amino-4-carboxybutyl)pseudo-UTP; 1-(4-Amino-benzyl)pseudo-UTP;
1-(4-Amino-butyl)pseudo-UTP; 1-(4-Amino-phenyl)pseudo-UTP;
1-(4-Azidobenzyl)pseudouridine TP; 1-(4-Bromobenzyl)pseudouridine
TP; 1-(4-Chlorobenzyl)pseudouridine TP;
1-(4-Fluorobenzyl)pseudouridine TP; 1-(4-Iodobenzyl)pseudouridine
TP; 1-(4-Methanesulfonylbenzyl)pseudouridine TP;
1-(4-Methoxybenzyl)pseudouridine TP;
1-(4-Methoxy-benzyl)pseudo-UTP; 1-(4-Methoxy-phenyl)pseudo-UTP;
1-(4-Methylbenzyl)pseudouridine TP; 1-(4-Methyl-benzyl)pseudo-UTP;
1-(4-Nitrobenzyl)pseudouridine TP; 1-(4-Nitro-benzyl)pseudo-UTP;
1(4-Nitro-phenyl)pseudo-UTP; 1-(4-Thiomethoxybenzyl)pseudouridine
TP; 1-(4-Trifluoromethoxybenzyl)pseudouridine TP;
1-(4-Trifluoromethylbenzyl)pseudouridine TP;
1-(5-Amino-pentyl)pseudo-UTP; 1-(6-Amino-hexyl)pseudo-UTP;
1,6-Dimethyl-pseudo-UTP;
1-[3-(2-{2-[2-(2-Aminoethoxy)-ethoxy]-ethoxy}-ethoxy)-propionyl]pseudouri-
dine TP; 1-{3-[2-(2-Aminoethoxy)-ethoxy]-propionyl}pseudouridine
TP; 1-Acetylpseudouridine TP; 1-Alkyl-6-(1-propynyl)-pseudo-UTP;
1-Alkyl-6-(2-propynyl)-pseudo-UTP; 1-Alkyl-6-allyl-pseudo-UTP;
1-Alkyl-6-ethynyl-pseudo-UTP; 1-Alkyl-6-homoallyl-pseudo-UTP;
1-Alkyl-6-vinyl-pseudo-UTP; 1-Allylpseudouridine TP;
1-Aminomethyl-pseudo-UTP; 1-Benzoylpseudouridine TP;
1-Benzyloxymethylpseudouridine TP; 1-Benzyl-pseudo-UTP;
1-Biotinyl-PEG2-pseudouridine TP; 1-Biotinylpseudouridine TP;
1-Butyl-pseudo-UTP; 1-Cyanomethylpseudouridine TP;
1-Cyclobutylmethyl-pseudo-UTP; 1-Cyclobutyl-pseudo-UTP;
1-Cycloheptylmethyl-pseudo-UTP; 1-Cycloheptyl-pseudo-UTP;
1-Cyclohexylmethyl-pseudo-UTP; 1-Cyclohexyl-pseudo-UTP;
1-Cyclooctylmethyl-pseudo-UTP; 1-Cyclooctyl-pseudo-UTP;
1-Cyclopentylmethyl-pseudo-UTP; 1-Cyclopentyl-pseudo-UTP;
1-Cyclopropylmethyl-pseudo-UTP; 1-Cyclopropyl-pseudo-UTP;
1-Ethyl-pseudo-UTP; 1-Hexyl-pseudo-UTP; 1-Homoallylpseudouridine
TP; 1-Hydroxymethylpseudouridine TP; 1-iso-propyl-pseudo-UTP;
1-Me-2-thio-pseudo-UTP; 1-Me-4-thio-pseudo-UTP;
1-Me-alpha-thio-pseudo-UTP; 1-Methanesulfonylmethylpseudouridine
TP; 1-Methoxymethylpseudouridine TP;
1-Methyl-6-(2,2,2-Trifluoroethyl)pseudo-UTP;
1-Methyl-6-(4-morpholino)-pseudo-UTP;
1-Methyl-6-(4-thiomorpholino)-pseudo-UTP; 1-Methyl-6-(substituted
phenyl)pseudo-UTP; 1-Methyl-6-amino-pseudo-UTP;
1-Methyl-6-azido-pseudo-UTP; 1-Methyl-6-bromo-pseudo-UTP;
1-Methyl-6-butyl-pseudo-UTP; 1-Methyl-6-chloro-pseudo-UTP;
1-Methyl-6-cyano-pseudo-UTP; 1-Methyl-6-dimethylamino-pseudo-UTP;
1-Methyl-6-ethoxy-pseudo-UTP;
1-Methyl-6-ethylcarboxylate-pseudo-UTP;
1-Methyl-6-ethyl-pseudo-UTP; 1-Methyl-6-fluoro-pseudo-UTP;
1-Methyl-6-formyl-pseudo-UTP; 1-Methyl-6-hydroxyamino-pseudo-UTP;
1-Methyl-6-hydroxy-pseudo-UTP; 1-Methyl-6-iodo-pseudo-UTP;
1-Methyl-6-iso-propyl-pseudo-UTP; 1-Methyl-6-methoxy-pseudo-UTP;
1-Methyl-6-methylamino-pseudo-UTP; 1-Methyl-6-phenyl-pseudo-UTP;
1-Methyl-6-propyl-pseudo-UTP; 1-Methyl-6-tert-butyl-pseudo-UTP;
1-Methyl-6-trifluoromethoxy-pseudo-UTP;
1-Methyl-6-trifluoromethyl-pseudo-UTP;
1-Morpholinomethylpseudouridine TP; 1-Pentyl-pseudo-UTP;
1-Phenyl-pseudo-UTP; 1-Pivaloylpseudouridine TP;
1-Propargylpseudouridine TP; 1-Propyl-pseudo-UTP;
1-propynyl-pseudouridine; 1-p-tolyl-pseudo-UTP;
1-tert-Butyl-pseudo-UTP; 1-Thiomethoxymethylpseudouridine TP;
1-Thiomorpholinomethylpseudouridine TP;
1-Trifluoroacetylpseudouridine TP; 1-Trifluoromethyl-pseudo-UTP;
1-Vinylpseudouridine TP; 2,2'-anhydro-uridine TP;
2'-bromo-deoxyuridine TP; 2'-F-5-Methyl-2'-deoxy-UTP;
2'-OMe-5-Me-UTP; 2'-OMe-pseudo-UTP; 2'-a-Ethynyluridine TP;
2'-a-Trifluoromethyluridine TP; 2'-b-Ethynyluridine TP;
2'-b-Trifluoromethyluridine TP; 2'-Deoxy-2',2'-difluorouridine TP;
2'-Deoxy-2'-a-mercaptouridine TP; 2'-Deoxy-2'-a-thiomethoxyuridine
TP; 2'-Deoxy-2'-b-aminouridine TP; 2'-Deoxy-2'-b-azidouridine TP;
2'-Deoxy-2'-b-bromouridine TP; 2'-Deoxy-2'-b-chlorouridine TP;
2'-Deoxy-2'-b-fluorouridine TP; 2'-Deoxy-2'-b-iodouridine TP;
2'-Deoxy-2'-b-mercaptouridine TP; 2'-Deoxy-2'-b-thiomethoxyuridine
TP; 2-methoxy-4-thio-uridine; 2-methoxyuridine;
2'-O-Methyl-5-(1-propynyl)uridine TP; 3-Alkyl-pseudo-UTP;
4'-Azidouridine TP; 4'-Carbocyclic uridine TP; 4'-Ethynyluridine
TP; 5-(1-Propynyl)ara-uridine TP; 5-(2-Furanyl)uridine TP;
5-Cyanouridine TP; 5-Dimethylaminouridine TP; 5'-Homo-uridine TP;
5-iodo-2'-fluoro-deoxyuridine TP; 5-Phenylethynyluridine TP;
5-Trideuteromethyl-6-deuterouridine TP; 5-Trifluoromethyl-Uridine
TP; 5-Vinylarauridine TP; 6-(2,2,2-Trifluoroethyl)-pseudo-UTP;
6-(4-Morpholino)-pseudo-UTP; 6-(4-Thiomorpholino)-pseudo-UTP;
6-(Substituted-Phenyl)-pseudo-UTP; 6-Amino-pseudo-UTP;
6-Azido-pseudo-UTP; 6-Bromo-pseudo-UTP; 6-Butyl-pseudo-UTP;
6-Chloro-pseudo-UTP; 6-Cyano-pseudo-UTP;
6-Dimethylamino-pseudo-UTP; 6-Ethoxy-pseudo-UTP;
6-Ethylcarboxylate-pseudo-UTP; 6-Ethyl-pseudo-UTP;
6-Fluoro-pseudo-UTP; 6-Formyl-pseudo-UTP;
6-Hydroxyamino-pseudo-UTP; 6-Hydroxy-pseudo-UTP; 6-Iodo-pseudo-UTP;
6-iso-Propyl-pseudo-UTP; 6-Methoxy-pseudo-UTP;
6-Methylamino-pseudo-UTP; 6-Methyl-pseudo-UTP; 6-Phenyl-pseudo-UTP;
6-Phenyl-pseudo-UTP; 6-Propyl-pseudo-UTP; 6-tert-Butyl-pseudo-UTP;
6-Trifluoromethoxy-pseudo-UTP; 6-Trifluoromethyl-pseudo-UTP;
Alpha-thio-pseudo-UTP; Pseudouridine 1-(4-methylbenzenesulfonic
acid) TP; Pseudouridine 1-(4-methylbenzoic acid) TP; Pseudouridine
TP 1-[3-(2-ethoxy)]propionic acid; Pseudouridine TP
1-[3-{2-(2-[2-(2-ethoxy)-ethoxy}]-ethoxy)-ethoxy]propionic acid;
Pseudouridine TP
1-[3-{2-(2-[2-{2(2-ethoxy)-ethoxy}-ethoxy]-ethoxy)-ethoxyl]propionic
acid; Pseudouridine TP 1-[3-{2-(2-[2-ethoxy}]-ethoxy)-ethoxy
propionic acid; Pseudouridine TP 1-[3-{2-(2-ethoxy)-ethoxy}]
propionic acid; Pseudouridine TP 1-methylphosphonic acid;
Pseudouridine TP 1-methylphosphonic acid diethyl ester;
Pseudo-UTP-N1-3-propionic acid; Pseudo-UTP-N1-4-butanoic acid;
Pseudo-UTP-N1-5-pentanoic acid; Pseudo-UTP-N1-6-hexanoic acid;
Pseudo-UTP-N1-7-heptanoic acid; Pseudo-UTP-N1-methyl-p-benzoic
acid; Pseudo-UTP-N1-p-benzoic acid; Wybutosine; Hydroxywybutosine;
Isowyosine; Peroxywybutosine; undermodified hydroxywybutosine;
4-demethylwyosine; 2,6-(diamino)purine;
1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl:
1,3-(diaza)-2-(oxo)-phenthiazin-1-yl;
1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
1,3,5-(triaza)-2,6-(dioxa)-naphthalene;2
(amino)purine;2,4,5-(trimethyl)phenyl;2' methyl, 2'amino, 2'azido,
2'fluro-cytidine;2' methyl, 2'amino, 2'azido,
2'fluro-adenine;2'methyl, 2'amino, 2'azido,
2'fluro-uridine;2'-amino-2'-deoxyribose; 2-amino-6-Chloro-purine;
2-aza-inosinyl; 2'-azido-2'-deoxyribose; 2'fluoro-2'-deoxyribose;
2'-fluoro-modified bases; 2'-O-methyl-ribose;
2-oxo-7-aminopyridopyrimidin-3-yl; 2-oxo-pyridopyrimidine-3-yl;
2-pyridinone; 3 nitropyrrole;
3-(methyl)-7-(propynyl)isocarbostyrilyl;
3-(methyl)isocarbostyrilyl; 4-(fluoro)-6-(methyl)benzimidazole;
4-(methyl)benzimidazole; 4-(methyl)indolyl; 4,6-(dimethyl)indolyl;
5 nitroindole; 5 substituted pyrimidines;
5-(methyl)isocarbostyrilyl; 5-nitroindole; 6-(aza)pyrimidine;
6-(azo)thymine; 6-(methyl)-7-(aza)indolyl; 6-chloro-purine;
6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
7-(aminoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl;
7-(aminoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl;
7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl;
7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(aza)indolyl;
7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazinl-yl;
7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl;
7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl;
7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(guanidiniumalkyl-hydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl;
7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(propynyl)isocarbostyrilyl; 7-(propynyl)isocarbostyrilyl,
propynyl-7-(aza)indolyl; 7-deaza-inosinyl; 7-substituted
1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl; 7-substituted
1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 9-(methyl)-imidizopyridinyl;
Aminoindolyl; Anthracenyl;
bis-ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
bis-ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
Difluorotolyl; Hypoxanthine; Imidizopyridinyl; Inosinyl;
Isocarbostyrilyl; Isoguanisine; N2-substituted purines;
N6-methyl-2-amino-purine; N6-substituted purines; N-alkylated
derivative; Napthalenyl; Nitrobenzimidazolyl; Nitroimidazolyl;
Nitroindazolyl; Nitropyrazolyl; Nubularine; O6-substituted purines;
O-alkylated derivative;
ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Oxoformycin
TP; para-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
para-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Pentacenyl;
Phenanthracenyl; Phenyl; propynyl-7-(aza)indolyl; Pyrenyl;
pyridopyrimidin-3-yl; pyridopyrimidin-3-yl,
2-oxo-7-amino-pyridopyrimidin-3-yl; pyrrolo-pyrimidin-2-on-3-yl;
Pyrrolopyrimidinyl; Pyrrolopyrizinyl; Stilbenzyl; substituted
1,2,4-triazoles; Tetracenyl; Tubercidine; Xanthine;
Xanthosine-5'-TP; 2-thio-zebularine; 5-aza-2-thio-zebularine;
7-deaza-2-amino-purine; pyridin-4-one ribonucleoside;
2-Amino-riboside-TP; Formycin A TP; Formycin B TP; Pyrrolosine TP;
2'-OH-ara-adenosine TP; 2'-OH-ara-cytidine TP; 2'-OH-ara-uridine
TP; 2'-OH-ara-guanosine TP; 5-(2-carbomethoxyvinyl)uridine TP; and
N6-(19-Amino-pentaoxanonadecyl)adenosine TP.
[0364] In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) includes a combination
of at least two (e.g., 2, 3, 4 or more) of the aforementioned
modified nucleobases.
[0365] In some embodiments, the mRNA comprises at least one
chemically modified nucleoside. In some embodiments, the at least
one chemically modified nucleoside is selected from the group
consisting of pseudouridine (.psi.), 2-thiouridine (s2U),
4'-thiouridine, 5-methylcytosine,
2-thio-1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine,
2-thio-dihydropseudouridine, 2-thio-dihydrouridine,
2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine,
4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine,
4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine,
5-methyluridine, 5-methoxyuridine, 2'-O-methyl uridine,
1-methyl-pseudouridine (m1.psi.), 1-ethyl-pseudouridine (e1.psi.),
5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C),
.alpha.-thio-guanosine, .alpha.-thio-adenosine, 5-cyano uridine,
4'-thio uridine 7-deaza-adenine, 1-methyl-adenosine (m1A),
2-methyl-adenine (m2A), N6-methyl-adenosine (m6A), and
2,6-Diaminopurine, (I), 1-methyl-inosine (m1I), wyosine (imG),
methylwyosine (mimG), 7-deaza-guanosine, 7-cyano-7-deaza-guanosine
(preQ0), 7-aminomethyl-7-deaza-guanosine (preQ1),
7-methyl-guanosine (m7G), 1-methyl-guanosine (m1G),
8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 2,8-dimethyladenosine,
2-geranylthiouridine, 2-lysidine, 2-selenouridine,
3-(3-amino-3-carboxypropyl)-5,6-dihydrouridine,
3-(3-amino-3-carboxypropyl)pseudouridine, 3-methylpseudouridine,
5-(carboxyhydroxymethyl)-2'-O-methyluridine methyl ester,
5-aminomethyl-2-geranylthiouridine, 5-aminomethyl-2-selenouridine,
5-aminomethyluridine, 5-carbamoylhydroxymethyluridine,
5-carbamoylmethyl-2-thiouridine, 5-carboxymethyl-2-thiouridine,
5-carboxymethylaminomethyl-2-geranylthiouridine,
5-carboxymethylaminomethyl-2-selenouridine, 5-cyanomethyluridine,
5-hydroxycytidine, 5-methylaminomethyl-2-geranylthiouridine,
7-aminocarboxypropyl-demethylwyosine, 7-aminocarboxypropylwyosine,
7-aminocarboxypropylwyosine methyl ester, 8-methyladenosine,
N4,N4-dimethylcytidine, N6-formyladenosine,
N6-hydroxymethyladenosine, agmatidine, cyclic
N6-threonylcarbamoyladenosine, glutamyl-queuosine, methylated
undermodified hydroxywybutosine, N4,N4,2'-O-trimethylcytidine,
geranylated 5-methylaminomethyl-2-thiouridine, geranylated
5-carboxymethylaminomethyl-2-thiouridine, Qbase, preQ0base,
preQ1base, and two or more combinations thereof. In some
embodiments, the at least one chemically modified nucleoside is
selected from the group consisting of pseudouridine,
1-methyl-pseudouridine, 1-ethyl-pseudouridine, 5-methylcytosine,
5-methoxyuridine, and a combination thereof. In some embodiments,
the polynucleotide (e.g., RNA polynucleotide, such as mRNA
polynucleotide) includes a combination of at least two (e.g., 2, 3,
4 or more) of the aforementioned modified nucleobases.
Base Modifications
[0366] In certain embodiments, the chemical modification is at
nucleobases in the polynucleotides (e.g., RNA polynucleotide, such
as mRNA polynucleotide). In some embodiments, modified nucleobases
in the polynucleotide (e.g., RNA polynucleotide, such as mRNA
polynucleotide) are selected from the group consisting of
1-methyl-pseudouridine (m1.psi.), 1-ethyl-pseudouridine (e1.psi.),
5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), pseudouridine
(.psi.), .alpha.-thio-guanosine and .alpha.-thio-adenosine. In some
embodiments, the polynucleotide includes a combination of at least
two (e.g., 2, 3, 4 or more) of the aforementioned modified
nucleobases.
[0367] In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) comprises
pseudouridine (.psi.) and 5-methyl-cytidine (m5C). In some
embodiments, the polynucleotide (e.g., RNA polynucleotide, such as
mRNA polynucleotide) comprises 1-methyl-pseudouridine (m1.psi.). In
some embodiments, the polynucleotide (e.g., RNA polynucleotide,
such as mRNA polynucleotide) comprises 1-ethyl-pseudouridine
(e1.psi.). In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) comprises
1-methyl-pseudouridine (m1.psi.) and 5-methyl-cytidine (m5C). In
some embodiments, the polynucleotide (e.g., RNA polynucleotide,
such as mRNA polynucleotide) comprises 1-ethyl-pseudouridine
(e1.omega.) and 5-methyl-cytidine (m5C). In some embodiments, the
polynucleotide (e.g., RNA polynucleotide, such as mRNA
polynucleotide) comprises 2-thiouridine (s2U). In some embodiments,
the polynucleotide (e.g., RNA polynucleotide, such as mRNA
polynucleotide) comprises 2-thiouridine and 5-methyl-cytidine
(m5C). In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) comprises
methoxy-uridine (mo5U). In some embodiments, the polynucleotide
(e.g., RNA polynucleotide, such as mRNA polynucleotide) comprises
5-methoxy-uridine (mo5U) and 5-methyl-cytidine (m5C). In some
embodiments, the polynucleotide (e.g., RNA polynucleotide, such as
mRNA polynucleotide) comprises 2'-O-methyl uridine. In some
embodiments, the polynucleotide (e.g., RNA polynucleotide, such as
mRNA polynucleotide) comprises 2'-O-methyl uridine and
5-methyl-cytidine (m5C). In some embodiments, the polynucleotide
(e.g., RNA polynucleotide, such as mRNA polynucleotide) comprises
N6-methyl-adenosine (m6A). In some embodiments, the polynucleotide
(e.g., RNA polynucleotide, such as mRNA polynucleotide) comprises
N6-methyl-adenosine (m6A) and 5-methyl-cytidine (m5C).
[0368] In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) is uniformly modified
(e.g., fully modified, modified throughout the entire sequence) for
a particular modification. For example, a polynucleotide can be
uniformly modified with 5-methyl-cytidine (m5C), meaning that all
cytosine residues in the mRNA sequence are replaced with
5-methyl-cytidine (m5C). Similarly, a polynucleotide can be
uniformly modified for any type of nucleoside residue present in
the sequence by replacement with a modified residue such as any of
those set forth above.
[0369] In some embodiments, the chemically modified nucleosides in
the open reading frame are selected from the group consisting of
uridine, adenine, cytosine, guanine, and any combination
thereof.
[0370] In some embodiments, the modified nucleobase is a modified
cytosine. Examples of nucleobases and nucleosides having a modified
cytosine include N4-acetyl-cytidine (ac4C), 5-methyl-cytidine
(m5C), 5-halo-cytidine (e.g., 5-iodo-cytidine),
5-hydroxymethyl-cytidine (hm5C), 1-methyl-pseudoisocytidine,
2-thio-cytidine (s2C), 2-thio-5-methyl-cytidine.
[0371] In some embodiments, a modified nucleobase is a modified
uridine. Example nucleobases and nucleosides having a modified
uridine include 5-cyano uridine or 4'-thio uridine.
[0372] In some embodiments, a modified nucleobase is a modified
adenine. Example nucleobases and nucleosides having a modified
adenine include 7-deaza-adenine, 1-methyl-adenosine (m1A),
2-methyl-adenine (m2A), N6-methyl-adenine (m6A), and
2,6-Diaminopurine.
[0373] In some embodiments, a modified nucleobase is a modified
guanine. Example nucleobases and nucleosides having a modified
guanine include inosine (I), 1-methyl-inosine (m1I), wyosine (imG),
methylwyosine (mimG), 7-deaza-guanosine, 7-cyano-7-deaza-guanosine
(preQ0), 7-aminomethyl-7-deaza-guanosine (preQ1),
7-methyl-guanosine (m7G), 1-methyl-guanosine (m1G),
8-oxo-guanosine, 7-methyl-8-oxo-guanosine.
[0374] In some embodiments, the nucleobase modified nucleotides in
the polynucleotide (e.g., RNA polynucleotide, such as mRNA
polynucleotide) are 5-methoxyuridine.
[0375] In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) includes a combination
of at least two (e.g., 2, 3, 4 or more) of modified
nucleobases.
[0376] In some embodiments, at least 95% of a type of nucleobases
(e.g., uracil) in a polynucleotide of the disclosure (e.g., an mRNA
polynucleotide encoding MCM) are modified nucleobases. In some
embodiments, at least 95% of uracil in a polynucleotide of the
present disclosure (e.g., an mRNA polynucleotide encoding MCM) is
5-methoxyuracil.
[0377] In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) comprises
5-methoxyuridine (5mo5U) and 5-methyl-cytidine (m5C).
[0378] In some embodiments, the polynucleotide (e.g., RNA
polynucleotide, such as mRNA polynucleotide) is uniformly modified
(e.g., fully modified, modified throughout the entire sequence) for
a particular modification. For example, a polynucleotide can be
uniformly modified with 5-methoxyuridine, meaning that
substantially all uridine residues in the mRNA sequence are
replaced with 5-methoxyuridine. Similarly, a polynucleotide can be
uniformly modified for any type of nucleoside residue present in
the sequence by replacement with a modified residue such as any of
those set forth above.
[0379] In some embodiments, the modified nucleobase is a modified
cytosine.
[0380] In some embodiments, a modified nucleobase is a modified
uracil. Example nucleobases and nucleosides having a modified
uracil include 5-methoxyuracil.
[0381] In some embodiments, a modified nucleobase is a modified
adenine.
[0382] In some embodiments, a modified nucleobase is a modified
guanine.
[0383] In some embodiments, the nucleobases, sugar, backbone, or
any combination thereof in the open reading frame encoding an MCM
polypeptide are chemically modified by at least 10%, at least 20%,
at least 30%, at least 40%, at least 50%, at least 60%, at least
70%, at least 80%, at least 90%, at least 95%, at least 99%, or
100%.
[0384] In some embodiments, the uridine nucleosides in the open
reading frame encoding an MCM polypeptide are chemically modified
by at least 10%, at least 20%, at least 30%, at least 40%, at least
50%, at least 60%, at least 70%, at least 80%, at least 90%, at
least 95%, at least 99%, or 100%.
[0385] In some embodiments, the adenosine nucleosides in the open
reading frame encoding an MCM polypeptide are chemically modified
by at least 10%, at least 20%, at least 30%, at least 40%, at least
50%, at least 60%, at least 70%, at least 80%, at least 90%, at
least 95%, at least 99%, or 100%.
[0386] In some embodiments, the cytidine nucleosides in the open
reading frame encoding an MCM polypeptide are chemically modified
by at least at least 10%, at least 20%, at least 30%, at least 40%,
at least 50%, at least 60%, at least 70%, at least 80%, at least
90%, at least 95%, at least 99%, or 100%.
[0387] In some embodiments, the guanosine nucleosides in the open
reading frame encoding an MCM polypeptide are chemically modified
by at least at least 10%, at least 20%, at least 30%, at least 40%,
at least 50%, at least 60%, at least 70%, at least 80%, at least
90%, at least 95%, at least 99%, or 100%.
[0388] In some embodiments, the polynucleotides can include any
useful linker between the nucleosides. Such linkers, including
backbone modifications, that are useful in the composition of the
present disclosure include, but are not limited to the following:
3'-alkylene phosphonates, 3'-amino phosphoramidate, alkene
containing backbones, aminoalkylphosphoramidates,
aminoalkylphosphotriesters, boranophosphates,
--CH.sub.2--O--N(CH.sub.3)--CH.sub.2--,
--CH.sub.2--N(CH.sub.3)--N(CH.sub.3)--CH.sub.2--,
--CH.sub.2--NH--CH.sub.2--, chiral phosphonates, chiral
phosphorothioates, formacetyl and thioformacetyl backbones,
methylene (methylimino), methylene formacetyl and thioformacetyl
backbones, methyleneimino and methylenehydrazino backbones,
morpholino linkages, --N(CH.sub.3)--CH.sub.2--CH.sub.2--,
oligonucleosides with heteroatom internucleoside linkage,
phosphinates, phosphoramidates, phosphorodithioates,
phosphorothioate internucleoside linkages, phosphorothioates,
phosphotriesters, PNA, siloxane backbones, sulfamate backbones,
sulfide sulfoxide and sulfone backbones, sulfonate and sulfonamide
backbones, thionoalkylphosphonates, thionoalkylphosphotriesters,
and thionophosphoramidates.
Modifications on the Sugar
[0389] The modified nucleosides and nucleotides (e.g., building
block molecules), which can be incorporated into a polynucleotide
(e.g., RNA or mRNA, as described herein), can be modified on the
sugar of the ribonucleic acid. For example, the 2' hydroxyl group
(OH) can be modified or replaced with a number of different
substituents. Exemplary substitutions at the 2'-position include,
but are not limited to, H, halo, optionally substituted C.sub.1-6
alkyl; optionally substituted C.sub.1-6 alkoxy; optionally
substituted C.sub.6-10 aryloxy; optionally substituted C.sub.3-8
cycloalkyl; optionally substituted C.sub.3-8 cycloalkoxy;
optionally substituted C.sub.6-10 aryloxy; optionally substituted
C.sub.6-10 aryl-C.sub.1-6 alkoxy, optionally substituted C.sub.1-12
(heterocyclyl)oxy; a sugar (e.g., ribose, pentose, or any described
herein); a polyethyleneglycol (PEG),
-O(CH.sub.2CH.sub.2O).sub.nCH.sub.2CH.sub.2OR, where R is H or
optionally substituted alkyl, and n is an integer from 0 to 20
(e.g., from 0 to 4, from 0 to 8, from 0 to 10, from 0 to 16, from 1
to 4, from 1 to 8, from 1 to 10, from 1 to 16, from 1 to 20, from 2
to 4, from 2 to 8, from 2 to 10, from 2 to 16, from 2 to 20, from 4
to 8, from 4 to 10, from 4 to 16, and from 4 to 20); "locked"
nucleic acids (LNA) in which the 2'-hydroxyl is connected by a
C.sub.1-6 alkylene or C.sub.1-6 heteroalkylene bridge to the
4'-carbon of the same ribose sugar, where exemplary bridges
included methylene, propylene, ether, or amino bridges; aminoalkyl,
as defined herein; aminoalkoxy, as defined herein; amino as defined
herein; and amino acid, as defined herein
[0390] Generally, RNA includes the sugar group ribose, which is a
5-membered ring having an oxygen. Exemplary, non-limiting modified
nucleotides include replacement of the oxygen in ribose (e.g., with
S, Se, or alkylene, such as methylene or ethylene); addition of a
double bond (e.g., to replace ribose with cyclopentenyl or
cyclohexenyl); ring contraction of ribose (e.g., to form a
4-membered ring of cyclobutane or oxetane); ring expansion of
ribose (e.g., to form a 6- or 7-membered ring having an additional
carbon or heteroatom, such as for anhydrohexitol, altritol,
mannitol, cyclohexanyl, cyclohexenyl, and morpholino that also has
a phosphoramidate backbone); multicyclic forms (e.g., tricyclo; and
"unlocked" forms, such as glycol nucleic acid (GNA) (e.g., R-GNA or
S-GNA, where ribose is replaced by glycol units attached to
phosphodiester bonds), threose nucleic acid (TNA, where ribose is
replace with .alpha.-L-threofuranosyl-(3'.fwdarw.2')), and peptide
nucleic acid (PNA, where 2-amino-ethyl-glycine linkages replace the
ribose and phosphodiester backbone). The sugar group can also
contain one or more carbons that possess the opposite
stereochemical configuration than that of the corresponding carbon
in ribose. Thus, a polynucleotide molecule can include nucleotides
containing, e.g., arabinose, as the sugar. Such sugar modifications
are taught International Patent Publication No. WO2013052523 and
International Patent Application No. PCT/US2013/75177, the contents
of each of which are incorporated herein by reference in its
entirety.
Combinations of Modifications
[0391] The polynucleotides of the disclosure can include a
combination of modifications to the sugar, the nucleobase, and/or
the internucleoside linkage. These combinations can include any one
or more modifications described herein.
[0392] Examples of modified nucleotides and modified nucleotide
combinations are provided below in Table 4. These combinations of
modified nucleotides can be used to form the polynucleotides of the
disclosure. Unless otherwise noted, the modified nucleotides can be
completely substituted for the natural nucleotides of the
polynucleotides of the disclosure. As a non-limiting example, the
natural nucleotide uridine can be substituted with a modified
nucleoside described herein. In another non-limiting example, the
natural nucleotide uridine can be partially substituted (e.g.,
about 0.1%, 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 99.9%) with at least
one of the modified nucleoside disclosed herein. Any combination of
base/sugar or linker can be incorporated into the polynucleotides
of the disclosure and such modifications are taught in
International Patent Publication No. WO2013052523 and International
Patent Application No. PCT/US2013/75177, the contents of each of
which are incorporated herein by reference in its entirety.
TABLE-US-00004 TABLE 4 Combinations Uracil Cytosine Adenine Guanine
5-methoxy-UTP CTP ATP GTP 5-Methoxy-UTP N4Ac-CTP ATP GTP
5-Methoxy-UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP
5-Trifluoromethyl-CTP ATP GTP 5-Methoxy-UTP 5-Hydroxymethyl-CTP ATP
GTP 5-Methoxy-UTP 5-Bromo-CTP ATP GTP 5-Methoxy-UTP N4Ac-CTP ATP
GTP 5-Methoxy-UTP CTP ATP GTP 5-Methoxy-UTP 5-Methyl-CTP ATP GTP
5-Methoxy-UTP 5-Trifluoromethyl-CTP ATP GTP 5-Methoxy-UTP
5-Hydroxymethyl-CTP ATP GTP 5-Methoxy-UTP 5-Bromo-CTP ATP GTP
5-Methoxy-UTP N4-Ac-CTP ATP GTP 5-Methoxy-UTP 5-Iodo-CTP ATP GTP
5-Methoxy-UTP 5-Bromo-CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP
5-Methoxy-UTP 5-Methyl-CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP
5-Methyl-CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP 5-Methyl-CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP
75% 5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 50% 5-Methyl-CTP +
50% CTP ATP GTP 5-Methoxy-UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP
75% 5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP CTP
ATP GTP 25% 5-Methoxy-UTP + 75% UTP CTP ATP GTP 5-Methoxy-UTP CTP
ATP GTP 5-Methoxy-UTP CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP
5-Methoxy-UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP 5-Methyl-CTP ATP
GTP 5-Methoxy-UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP CTP
Alpha-thio- GTP ATP 5-Methoxy-UTP 5-Methyl-CTP Alpha-thio- GTP ATP
5-Methoxy-UTP CTP ATP Alpha- thio-GTP 5-Methoxy-UTP 5-Methyl-CTP
ATP Alpha- thio-GTP 5-Methoxy-UTP CTP N6-Me- GTP ATP 5-Methoxy-UTP
5-Methyl-CTP N6-Me- GTP ATP 5-Methoxy-UTP CTP ATP GTP 5-Methoxy-UTP
5-Methyl-CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 5-Methyl-CTP ATP
GTP 50% 5-Methoxy-UTP + 50% UTP 5-Methyl-CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 50% 5-Methyl-CTP + 50%
CTP ATP GTP 5-Methoxy-UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP CTP
ATP GTP 25% 5-Methoxy-UTP + 75% UTP CTP ATP GTP 5-Methoxy-UTP
5-Ethyl-CTP ATP GTP 5-Methoxy-UTP 5-Methoxy-CTP ATP GTP
5-Methoxy-UTP 5-Ethynyl-CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP
5-Methoxy-UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP
5-Methoxy-UTP 5-Methyl-CTP ATP GTP 75% 5-Methoxy-UTP + 25% 1-
5-Methyl-CTP ATP GTP Methyl-pseudo-UTP 50% 5-Methoxy-UTP + 50% 1-
5-Methyl-CTP ATP GTP Methyl-pseudo-UTP 25% 5-Methoxy-UTP + 75% 1-
5-Methyl-CTP ATP GTP Methyl-pseudo-UTP 5-Methoxy-UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 50% 5-Methyl-CTP + 50%
CTP ATP GTP 5-Methoxy-UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% 1- 75% 5-Methyl-CTP + 25% CTP ATP GTP
Methyl-pseudo-UTP 75% 5-Methoxy-UTP + 25% 1- 50% 5-Methyl-CTP + 50%
CTP ATP GTP Methyl-pseudo-UTP 75% 5-Methoxy-UTP + 25% 1- 25%
5-Methyl-CTP + 75% CTP ATP GTP Methyl-pseudo-UTP 50% 5-Methoxy-UTP
+ 50% 1- 75% 5-Methyl-CTP + 25% CTP ATP GTP Methyl-pseudo-UTP 50%
5-Methoxy-UTP + 50% 1- 50% 5-Methyl-CTP + 50% CTP ATP GTP
Methyl-pseudo-UTP 50% 5-Methoxy-UTP + 50% 1- 25% 5-Methyl-CTP + 75%
CTP ATP GTP Methyl-pseudo-UTP 25% 5-Methoxy-UTP + 75% 1- 75%
5-Methyl-CTP + 25% CTP ATP GTP Methyl-pseudo-UTP 25% 5-Methoxy-UTP
+ 75% 1- 50% 5-Methyl-CTP + 50% CTP ATP GTP Methyl-pseudo-UTP 25%
5-Methoxy-UTP + 75% 1- 25% 5-Methyl-CTP + 75% CTP ATP GTP
Methyl-pseudo-UTP 75% 5-Methoxy-UTP + 25% 1- CTP ATP GTP
Methyl-pseudo-UTP 50% 5-Methoxy-UTP + 50% 1- CTP ATP GTP
Methyl-pseudo-UTP 25% 5-Methoxy-UTP + 75% 1- CTP ATP GTP
Methyl-pseudo-UTP 5-methoxy-UTP CTP ATP GTP 5-methoxy-UTP CTP ATP
GTP 5-methoxy-UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP
5-Methoxy-UTP 5-Methyl-CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP
5-Methyl-CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP 5-Methyl-CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 5-Methyl-CTP ATP GTP 5-Methoxy-UTP
75% 5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 50% 5-Methyl-CTP +
50% CTP ATP GTP 5-Methoxy-UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP
75% 5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP CTP
ATP GTP 25% 5-Methoxy-UTP + 75% UTP CTP ATP GTP 5-Methoxy-UTP CTP
ATP GTP 5-Methoxy-UTP 5-Methyl-CTP ATP GTP 75% 5-Methoxy-UTP + 25%
UTP 5-Methyl-CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP 5-Methyl-CTP
ATP GTP 25% 5-Methoxy-UTP + 75% UTP 5-Methyl-CTP ATP GTP
5-Methoxy-UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 50%
5-Methyl-CTP + 50% CTP ATP GTP 5-Methoxy-UTP 25% 5-Methyl-CTP + 75%
CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP
ATP GTP 75% 5-Methoxy-UTP + 25% UTP 50% 5-Methyl-CTP + 50% CTP ATP
GTP 75% 5-Methoxy-UTP + 25% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP
50% 5-Methoxy-UTP + 50% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 50%
5-Methoxy-UTP + 50% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP CTP ATP GTP 50% 5-Methoxy-UTP + 50% UTP CTP
ATP GTP 25% 5-Methoxy-UTP + 75% UTP CTP ATP GTP 5-Methoxy-UTP CTP
ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP
25% 5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP
5-Methoxy-UTP CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 50%
5-Methyl-CTP + 50% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 25%
5-Methyl-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP
5-Methoxy-UTP CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 50%
5-Methyl-CTP + 50% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 25%
5-Methyl-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP
5-Methoxy-UTP CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 50%
5-Methyl-CTP + 50% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 25%
5-Methyl-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Methyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 50% 5-Methyl-CTP + 50% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Methyl-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Methyl-CTP + 25% CTP ATP GTP
5-Methoxy-UTP 5-Fluoro-CTP ATP GTP 5-Methoxy-UTP 5-Phenyl-CTP ATP
GTP 5-Methoxy-UTP N4-Bz-CTP ATP GTP 5-Methoxy-UTP CTP N6- GTP
Isopentenyl- ATP 5-Methoxy-UTP N4-Ac-CTP ATP GTP 25% 5-Methoxy-UTP
+ 75% UTP 25% N4-Ac-CTP + 75% CTP ATP GTP 25% 5-Methoxy-UTP + 75%
UTP 75% N4-Ac-CTP + 25% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 25%
N4-Ac-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
N4-Ac-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 5-Hydroxymethyl-CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 25% 5-Hydroxymethyl-CTP + 75% ATP
GTP CTP 25% 5-Methoxy-UTP + 75% UTP 75% 5-Hydroxymethyl-CTP + 25%
ATP GTP CTP 75% 5-Methoxy-UTP + 25% UTP 25% 5-Hydroxymethyl-CTP +
75% ATP GTP CTP 75% 5-Methoxy-UTP + 25% UTP 75% 5-Hydroxymethyl-CTP
+ 25% ATP GTP CTP 5-Methoxy-UTP N4-Methyl CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% N4-Methyl CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% N4-Methyl CTP + 25% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 25% N4-Methyl CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% N4-Methyl CTP + 25% CTP ATP GTP
5-Methoxy-UTP 5-Trifluoromethyl-CTP ATP GTP 25% 5-Methoxy-UTP + 75%
UTP 25% 5-Trifluoromethyl-CTP + 75% ATP GTP CTP 25% 5-Methoxy-UTP +
75% UTP 75% 5-Trifluoromethyl-CTP + 25% ATP GTP CTP 75%
5-Methoxy-UTP + 25% UTP 25% 5-Trifluoromethyl-CTP + 75% ATP GTP CTP
75% 5-Methoxy-UTP + 25% UTP 75% 5-Trifluoromethyl-CTP + 25% ATP GTP
CTP 5-Methoxy-UTP 5-Bromo-CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP
25% 5-Bromo-CTP + 75% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Bromo-CTP + 25% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 25%
5-Bromo-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Bromo-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 5-Iodo-CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 25% 5-Iodo-CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Iodo-CTP + 25% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 25% 5-Iodo-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Iodo-CTP + 25% CTP ATP GTP
5-Methoxy-UTP 5-Ethyl-CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 25%
5-Ethyl-CTP + 75% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Ethyl-CTP + 25% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 25%
5-Ethyl-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Ethyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 5-Methoxy-CTP ATP GTP
25% 5-Methoxy-UTP + 75% UTP 25% 5-Methoxy-CTP + 75% CTP ATP GTP 25%
5-Methoxy-UTP + 75% UTP 75% 5-Methoxy-CTP + 25% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 25% 5-Methoxy-CTP + 75% CTP ATP GTP 75%
5-Methoxy-UTP + 25% UTP 75% 5-Methoxy-CTP + 25% CTP ATP GTP
5-Methoxy-UTP 5-Ethynyl-CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 25%
5-Ethynyl-CTP + 75% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Ethynyl-CTP + 25% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 25%
5-Ethynyl-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Ethynyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 5-Pseudo-iso-CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 25% 5-Pseudo-iso-CTP + 75% CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 75% 5-Pseudo-iso-CTP + 25% CTP ATP
GTP 75% 5-Methoxy-UTP + 25% UTP 25% 5-Pseudo-iso-CTP + 75% CTP ATP
GTP 75% 5-Methoxy-UTP + 25% UTP 75% 5-Pseudo-iso-CTP + 25% CTP ATP
GTP 5-Methoxy-UTP 5-Formyl-CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP
25% 5-Formyl-CTP + 75% CTP ATP GTP 25% 5-Methoxy-UTP + 75% UTP 75%
5-Formyl-CTP + 25% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 25%
5-Formyl-CTP + 75% CTP ATP GTP 75% 5-Methoxy-UTP + 25% UTP 75%
5-Formyl-CTP + 25% CTP ATP GTP 5-Methoxy-UTP 5-Aminoallyl-CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 25% 5-Aminoallyl-CTP + 75% CTP ATP
GTP 25% 5-Methoxy-UTP + 75% UTP 75% 5-Aminoallyl-CTP + 25% CTP ATP
GTP 75% 5-Methoxy-UTP + 25% UTP 25% 5-Aminoallyl-CTP + 75% CTP ATP
GTP 75% 5-Methoxy-UTP + 25% UTP 75% 5-Aminoallyl-CTP + 25% CTP ATP
GTP
III. Polynucleotide Architecture
[0393] Traditionally, the basic components of an mRNA molecule
include at least a coding region, a 5'UTR, a 3'UTR, a 5' cap and a
poly-A tail. The polynucleotides of the present disclosure can
function as mRNA but are distinguished from wild-type mRNA in their
functional and/or structural design features that serve, e.g., to
overcome existing problems of effective polypeptide production
using nucleic-acid based therapeutics.
In Vitro Transcribed Polynucleotides
[0394] The disclosure also includes an in vitro transcribed
polynucleotide comprising the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide.
[0395] Polynucleotides which are made using only in vitro
transcription (IVT) enzymatic synthesis methods are referred to as
"IVT polynucleotides." Methods of making IVT polynucleotides are
known in the art and are described, e.g., in International
Publication Nos. WO2013151666, WO2013151667, WO2013151668,
WO2013151663, WO2013151669, WO2013151670, WO2013151664,
WO2013151665, WO2013151671, WO2013151672 and WO2013151736; the
contents of each of which are herein incorporated by reference in
their entireties.
[0396] The shortest length of the first region of the primary
construct of the IVT polynucleotide can be the length of a nucleic
acid sequence that is sufficient to encode for MCM, a fragment
thereof, or variant thereof. The length of the first region of the
primary construct of the IVT polynucleotide encoding the
polypeptide of interest can be greater than about 30 nucleotides in
length (e.g., at least or greater than about 2,154, 2,250, 2,500,
and 3,000, 4,000, 4,100, 4,200, 4,300, 4,400, 4,500, 4,600, 4,700,
4,800, 4,900, 5,000, 5,100, 5,200, 5,300, 5,400, 5,500, 6,000,
7,000, 8,000, 9,000, 10,000, 20,000, 30,000, 40,000, 50,000,
60,000, 70,000, 80,000, 90,000 or up to and including 100,000
nucleotides).
[0397] In some embodiments, the first and second flanking regions
of the IVT polynucleotide can range independently from 15-1,000
nucleotides in length (e.g., greater than 30, 40, 45, 50, 55, 60,
70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450,
500, 600, 700, 800, 900, 1,000, 1,500, 2,000, 2,500, 3,000, 3,500,
4,000, 4,500, 5,000, 5,500 nucleotides or at least 30, 40, 45, 50,
55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350,
400, 450, 500, 600, 700, 800, 900, 1,000, 1,500, 2,000, 2,500,
3,000, 3,500, 4,000, 4,500, 5,000, 5,500 nucleotides).
[0398] In some embodiments, the tailing sequence of the IVT
polynucleotide can range from absent to 500 nucleotides in length
(e.g., at least 60, 70, 80, 90, 120, 140, 160, 180, 200, 250, 300,
350, 400, 450, or 500 nucleotides). Where the tailing region is a
polyA tail, the length can be determined in units of or as a
function of polyA Binding Protein binding. In this embodiment, the
polyA tail is long enough to bind at least 4 monomers of PolyA
Binding Protein. PolyA Binding Protein monomers bind to stretches
of approximately 38 nucleotides. As such, it has been observed that
polyA tails of about 80 nucleotides and 160 nucleotides are
functional.
[0399] In some embodiments, the capping region of the IVT
polynucleotide can comprise a single cap or a series of nucleotides
forming the cap. In this embodiment the capping region can be from
1 to 10, e.g., 2-9, 3-8, 4-7, 1-5, 5-10, or at least 2, or 10 or
fewer nucleotides in length. In some embodiments, the cap is
absent.
[0400] In some embodiments, the first and second operational
regions of the IVT polynucleotide can range from 3 to 40, e.g.,
5-30, 10-20, 15, or at least 4, or 30 or fewer nucleotides in
length and can comprise, in addition to a Start and/or Stop codon,
one or more signal and/or restriction sequences.
[0401] In some embodiments, the IVT polynucleotides can be
structurally modified or chemically modified. When the IVT
polynucleotides are chemically and/or structurally modified, the
polynucleotides can be referred to as "modified IVT
polynucleotides."
[0402] In some embodiments, if the IVT polynucleotides are
chemically modified they can have a uniform chemical modification
of all or any of the same nucleoside type or a population of
modifications produced by mere downward titration of the same
starting modification in all or any of the same nucleoside type, or
a measured percent of a chemical modification of all any of the
same nucleoside type but with random incorporation, such as where
all uridines are replaced by a uridine analog, e.g., pseudouridine
or 5-methoxyuridine. In another embodiment, the IVT polynucleotides
can have a uniform chemical modification of two, three, or four of
the same nucleoside type throughout the entire polynucleotide (such
as all uridines and all cytosines, etc. are modified in the same
way).
[0403] In some embodiments, the IVT polynucleotide can encode MCM
and at least one additional peptide or polypeptide of interest. In
another embodiment, the IVT polynucleotide can encode MCM and two
or more peptides or polypeptides of interest. Non-limiting examples
of peptides or polypeptides of interest include an enzyme and its
substrate, a label and its binding molecule, a second messenger and
its enzyme or the components of multimeric proteins or
complexes.
[0404] In some embodiments, the IVT polynucleotide encodes an MCM
protein or a functional fragment thereof. In some embodiments, the
IVT polynucleotides of the disclosure comprise any one of the human
MCM nucleic acid sequences selected from SEQ ID NOs: 1 to 207, 732
to 765, and 772. In some embodiments, the IVT polynucleotide
encodes a human MCM or functional fragment thereof comprising at
least one amino acid mutation from the wild type sequence. In some
embodiments, the IVT polynucleotide encodes an MCM mutant
comprising one or more of the point mutations V69, T499, H532,
A598, and V671. In some embodiments, the expression of the encoded
polypeptide is increased. In some embodiments, the IVT
polynucleotide increases MCM expression levels in cells when
introduced into those cells, e.g., by 20-50%, at least 20%, at
least 25%, at least 30%, at least 35%, at least 40%, at least 45%,
or at least 50%.
Chimeric Polynucleotide Architecture
[0405] The disclosure also includes a chimeric polynucleotide
comprising the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0406] Polynucleotides which have portions or regions which differ
in size and/or chemical modification pattern, chemical modification
position, chemical modification percent or chemical modification
population and combinations of the foregoing are known as "chimeric
polynucleotides." A "chimera" according to the present disclosure
is an entity having two or more incongruous or heterogeneous parts
or regions. As used herein a "part" or "region" of a polynucleotide
is defined as any portion of the polynucleotide which is less than
the entire length of the polynucleotide. Chimeric polynucleotides
which are modified mRNA molecules are termed "chimeric modified
mRNA" or "chimeric mRNA."
[0407] Chimeric polynucleotides have portions or regions that
differ in size and/or chemical modification pattern, chemical
modification position, chemical modification percent or chemical
modification population and combinations of the foregoing.
[0408] Examples of parts or regions, where the chimeric
polynucleotide functions as an mRNA and encodes a polypeptide of
interest include, but are not limited to, untranslated regions
(UTRs, such as the 5' UTR or 3' UTR), coding regions, cap regions,
polyA tail regions, start regions, stop regions, signal or target
sequence regions, and combinations thereof.
[0409] In some embodiments, the chimeric polynucleotides of the
disclosure have a structure comprising Formula I.
5' [A.sub.n].sub.x-L1-[B.sub.o].sub.y-L2-[C.sub.p].sub.z-L3 3'
Formula I
wherein: [0410] each of A and B independently comprise a region of
linked nucleosides; [0411] either A or B or both A and B encode MCM
as described elsewhere herein; [0412] C is an optional region of
linked nucleosides; [0413] at least one of regions A, B, or C is
positionally modified, wherein said positionally modified region
comprises at least two chemically modified nucleosides of one or
more of the same nucleoside type of adenosine, thymidine,
guanosine, cytidine, or uridine, and wherein at least two of the
chemical modifications of nucleosides of the same type are
different chemical modifications; [0414] n, o and p are
independently an integer between 15-10,000, representing the number
of nucleosides in regions A, B, and C, respectively; [0415] x and y
are independently 1-20; [0416] z is 0-5; [0417] L1 and L2 are
independently optional linker moieties, said linker moieties being
either nucleic acid based or non-nucleic acid based; and [0418] L3
is an optional conjugate or an optional linker moiety, said linker
moiety being either nucleic acid based or non-nucleic acid
based.
[0419] In some embodiments, at least one of the regions of linked
nucleosides of A can comprise a sequence of linked nucleosides that
can function as a 5' untranslated region (UTR). The sequence of
linked nucleosides can be a natural or synthetic 5' UTR. As a
non-limiting example, the chimeric polynucleotide can encode MCM
and the sequence of linked nucleosides of A can encode the native
5' UTR of the MCM protein or a non-heterologous 5' UTR such as, but
not limited to a synthetic UTR.
[0420] In another embodiment, at least one of the regions of linked
nucleosides of A can be a cap region. The cap region can be located
5' to a region of linked nucleosides of A functioning as a 5'UTR.
The cap region can comprise at least one cap such as, but not
limited to, Cap0, Cap1, ARCA, inosine, N1-methyl-guanosine,
2'fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine,
2-amino-guanosine, LNA-guanosine, 2-azido-guanosine, Cap2 and
Cap4.
[0421] In some embodiments, the polynucleotide of the disclosure
comprises a Cap1 5'UTR. In some embodiments, a polynucleotide
comprises the Cap1 5'UTR, wherein the polynucleotide encodes human
MCM or functional fragment thereof. In some embodiments, a
polynucleotide comprising 5'UTR sequence, e.g., Cap1, for encoding
an MCM protein as disclosed herein increases expression of MCM
compared to polynucleotides encoding MCM comprising a different
5'UTR (e.g., Cap0, ARCA, inosine, N1-methyl-guanosine,
2'fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine,
2-amino-guanosine, LNA-guanosine, 2-azido-guanosine, Cap2 or Cap4).
In some embodiments, polynucleotide comprising the Cap1 5'UTR,
increases MCM expression levels in cells when introduced into those
cells, e.g., by at least 20%, e.g., at least 20%, at least 25%, at
least 35%, or at least 40%.
[0422] In some embodiments, at least one of the regions of linked
nucleosides of C can comprise a sequence of linked nucleosides that
can function as a 3' UTR. The sequence of linked nucleosides can be
a natural or synthetic 3' UTR. As a non-limiting example, the
chimeric polynucleotide can encode MCM and the sequence of linked
nucleosides of C can encode the native 3' UTR of MCM or a
non-heterologous 3' UTR such as, but not limited to a synthetic
UTR.
[0423] In some embodiments, at least one of the regions of linked
nucleosides of A comprises a sequence of linked nucleosides that
functions as a 5' UTR and at least one of the regions of linked
nucleosides of C comprises a sequence of linked nucleosides that
functions as a 3' UTR. In some embodiments, the 5' UTR and the 3'
UTR can be from the same or different species. In another
embodiment, the 5' UTR and the 3' UTR can encode the native
untranslated regions from different proteins from the same or
different species.
[0424] Chimeric polynucleotides, including the parts or regions
thereof, of the present disclosure can be classified as hemimers,
gapmers, wingmers, or blockmers.
[0425] As used herein, a "hemimer" is a chimeric polynucleotide
comprising a region or part that comprises half of one pattern,
percent, position or population of a chemical modification(s) and
half of a second pattern, percent, position or population of a
chemical modification(s). Chimeric polynucleotides of the present
disclosure can also comprise hemimer subregions. In some
embodiments, a part or region is 50% of one and 50% of another.
[0426] In some embodiments, the entire chimeric polynucleotide can
be 50% of one and 50% of the other. Any region or part of any
chimeric polynucleotide of the disclosure can be a hemimer. Types
of hemimers include pattern hemimers, population hemimers or
position hemimers. By definition, hemimers are 50:50 percent
hemimers.
[0427] As used herein, a "gapmer" is a chimeric polynucleotide
having at least three parts or regions with a gap between the parts
or regions. The "gap" can comprise a region of linked nucleosides
or a single nucleoside that differs from the chimeric nature of the
two parts or regions flanking it. The two parts or regions of a
gapmer can be the same or different from each other.
[0428] As used herein, a "wingmer" is a chimeric polynucleotide
having at least three parts or regions with a gap between the parts
or regions. Unlike a gapmer, the two flanking parts or regions
surrounding the gap in a wingmer are the same in degree or kind.
Such similarity can be in the length of number of units of
different modifications or in the number of modifications. The
wings of a wingmer can be longer or shorter than the gap. The wing
parts or regions can be 20, 30, 40, 50, 60 70, 80, 90 or 95%
greater or shorter in length than the region that comprises the
gap.
[0429] As used herein, a "blockmer" is a patterned polynucleotide
where parts or regions are of equivalent size or number and type of
modifications. Regions or subregions in a blockmer can be 50, 51,
52, 53, 54, 55, 56, 57, 58, 59, 60, 61 62, 63, 64, 65, 66, 67, 68,
69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85,
86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101,
102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114,
115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127,
128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140,
141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153,
154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166,
167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205,
206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218,
219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231,
232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244,
245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257,
258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270,
271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283,
284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296,
297, 298, 299, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390,
400, 410, 420, 430, 440, 450, 460, 470, 480, 490 or 500,
nucleosides long.
[0430] Chimeric polynucleotides, including the parts or regions
thereof, of the present disclosure having a chemical modification
pattern are referred to as "pattern chimeras." Pattern chimeras can
also be referred to as blockmers. Pattern chimeras are those
polynucleotides having a pattern of modifications within, across or
among regions or parts.
[0431] Patterns of modifications within a part or region are those
that start and stop within a defined region. Patterns of
modifications across a part or region are those patterns that start
in on part or region and end in another adjacent part or region.
Patterns of modifications among parts or regions are those that
begin and end in one part or region and are repeated in a different
part or region, which is not necessarily adjacent to the first
region or part.
[0432] The regions or subregions of pattern chimeras or blockmers
can have simple alternating patterns such as ABAB[AB]n where each
"A" and each "B" represent different chemical modifications (at
least one of the base, sugar or backbone linker), different types
of chemical modifications (e.g., naturally occurring and
non-naturally occurring), different percentages of modifications or
different populations of modifications. The pattern can repeat n
number of times where n=3-300. Further, each A or B can represent
from 1-2500 units (e.g., nucleosides) in the pattern. Patterns can
also be alternating multiples such as AABBAABB[AABB]n (an
alternating double multiple) or AAABBBAAABBB[AAABBB]n (an
alternating triple multiple) pattern. The pattern can repeat n
number of times where n=3-300.
[0433] Different patterns can also be mixed together to form a
second order pattern. For example, a single alternating pattern can
be combined with a triple alternating pattern to form a second
order alternating pattern A'B'. One example would be
[ABABAB][AAABBBAAABBB] [ABABAB][AAABBBAAABBB]
[ABABAB][AAABBBAAABBB], where [ABABAB] is A' and [AAABBBAAABBB] is
B'. In like fashion, these patterns can be repeated n number of
times, where n=3-300.
[0434] Patterns can include three or more different modifications
to form an ABCABC[ABC]n pattern. These three component patterns can
also be multiples, such as AABBCCAABBCC[AABBCC]n and can be
designed as combinations with other patterns such as
ABCABCAABBCCABCABCAABBCC, and can be higher order patterns.
[0435] Regions or subregions of position, percent, and population
modifications need not reflect an equal contribution from each
modification type. They can form series such as "1-2-3-4,"
"1-2-4-8," where each integer represents the number of units of a
particular modification type. Alternatively, they can be odd only,
such as `1-3-3-1-3-1-5'' or even only "2-4-2-4-6-4-8" or a mixture
of both odd and even number of units such as
"1-3-4-2-5-7-3-3-4".
[0436] Pattern chimeras can vary in their chemical modification by
degree (such as those described above) or by kind (e.g., different
modifications).
[0437] Chimeric polynucleotides, including the parts or regions
thereof, of the present disclosure having at least one region with
two or more different chemical modifications of two or more
nucleoside members of the same nucleoside type (A, C, G, T, or U)
are referred to as "positionally modified" chimeras. Positionally
modified chimeras are also referred to herein as "selective
placement" chimeras or "selective placement polynucleotides". As
the name implies, selective placement refers to the design of
polynucleotides that, unlike polynucleotides in the art where the
modification to any A, C, G, T or U is the same by virtue of the
method of synthesis, can have different modifications to the
individual As, Cs, Gs, Ts or Us in a polynucleotide or region
thereof. For example, in a positionally modified chimeric
polynucleotide, there can be two or more different chemical
modifications to any of the nucleoside types of As, Cs, Gs, Ts, or
Us. There can also be combinations of two or more to any two or
more of the same nucleoside type. For example, a positionally
modified or selective placement chimeric polynucleotide can
comprise 3 different modifications to the population of adenines in
the molecule and also have 3 different modifications to the
population of cytosines in the construct--all of which can have a
unique, non-random, placement.
[0438] Chimeric polynucleotides, including the parts or regions
thereof, of the present disclosure having a chemical modification
percent are referred to as "percent chimeras." Percent chimeras can
have regions or parts that comprise at least 1%, at least 2%, at
least 5%, at least 8%, at least 10%, at least 20%, at least 30%, at
least 40%, at least 50%, at least 60%, at least 70%, at least 80%,
at least 90%, at least 95%, or at least 99% positional, pattern or
population of modifications. Alternatively, the percent chimera can
be completely modified as to modification position, pattern, or
population. The percent of modification of a percent chimera can be
split between naturally occurring and non-naturally occurring
modifications.
[0439] Chimeric polynucleotides, including the parts or regions
thereof, of the present disclosure having a chemical modification
population are referred to as "population chimeras." A population
chimera can comprise a region or part where nucleosides (their
base, sugar or backbone linkage, or combination thereof) have a
select population of modifications. Such modifications can be
selected from functional populations such as modifications that
induce, alter or modulate a phenotypic outcome. For example, a
functional population can be a population or selection of chemical
modifications that increase the level of a cytokine. Other
functional populations can individually or collectively function to
decrease the level of one or more cytokines. Use of a selection of
these like-function modifications in a chimeric polynucleotide
would therefore constitute a "functional population chimera." As
used herein, a "functional population chimera" can be one whose
unique functional feature is defined by the population of
modifications as described above or the term can apply to the
overall function of the chimeric polynucleotide itself. For
example, as a whole the chimeric polynucleotide can function in a
different or superior way as compared to an unmodified or
non-chimeric polynucleotide.
[0440] It should be noted that polynucleotides that have a uniform
chemical modification of all of any of the same nucleoside type or
a population of modifications produced by mere downward titration
of the same starting modification in all of any of the same
nucleoside type, or a measured percent of a chemical modification
of all any of the same nucleoside type but with random
incorporation, such as where all uridines are replaced by a uridine
analog, e.g., pseudouridine or 5-methoxyuridine, are not considered
chimeric polynucleotides. Likewise, polynucleotides having a
uniform chemical modification of two, three, or four of the same
nucleoside type throughout the entire polynucleotide (such as all
uridines and all cytosines, etc. are modified in the same way) are
not considered chimeric polynucleotides. One example of a
polynucleotide that is not chimeric is the canonical
pseudouridine/5-methyl cytosine modified polynucleotide. These
uniform polynucleotides are arrived at entirely via in vitro
transcription (IVT) enzymatic synthesis; and due to the limitations
of the synthesizing enzymes, they contain only one kind of
modification at the occurrence of each of the same nucleoside type,
i.e., adenosine (A), thymidine (T), guanosine (G), cytidine (C) or
uridine (U), found in the polynucleotide. Such polynucleotides can
be characterized as IVT polynucleotides.
[0441] The chimeric polynucleotides of the present disclosure can
be structurally modified or chemically modified. When the chimeric
polynucleotides of the present disclosure are chemically and/or
structurally modified, the polynucleotides can be referred to as
"modified chimeric polynucleotides."
[0442] In some embodiments, the chimeric polynucleotides can encode
two or more peptides or polypeptides of interest. Such peptides or
polypeptides of interest include an enzyme and its substrate, a
label and its binding molecule, a second messenger and its enzyme,
or the components of multimeric proteins or complexes.
[0443] The regions or parts of the chimeric polynucleotides can be
separated by a linker or spacer moiety. Such linkers or spaces can
be nucleic acid based or non-nucleosidic.
[0444] In some embodiments, the chimeric polynucleotides can
include a sequence encoding a self-cleaving peptide described
herein, such as, but not limited to, a 2A peptide. The
polynucleotide sequence of the 2A peptide in the chimeric
polynucleotide can be modified or sequence-optimized by the methods
described herein and/or are known in the art.
[0445] Notwithstanding the foregoing, the chimeric polynucleotides
of the present disclosure can comprise a region or part that is not
positionally modified or not chimeric as defined herein. For
example, a region or part of a chimeric polynucleotide can be
uniformly modified at one or more A, T, C, G, or U, but the
polynucleotides will not be uniformly modified throughout the
entire region or part.
[0446] Regions or parts of chimeric polynucleotides can be, in some
embodiments, from 15-10,000 nucleosides in length and, in some
embodiments, a polynucleotide can have from 2-100 different regions
or patterns of regions as described herein.
[0447] In some embodiments, chimeric polynucleotides encode one or
more polypeptides of interest. In another embodiment, the chimeric
polynucleotides are substantially non-coding. In another
embodiment, the chimeric polynucleotides have both coding and
non-coding regions and parts.
[0448] In some embodiments, regions or subregions of the
polynucleotides can range from being absent to 500 nucleotides in
length (e.g., at least 60, 70, 80, 90, 100, 110, 120, 130, 140,
150, 160, 170, 180, 190, 200, 250, 300, 350, 400, 450, or 500
nucleotides). Where the region is a polyA tail, the length can be
determined in units of, or as a function of, polyA Binding Protein
binding. In this embodiment, the polyA tail is long enough to bind
at least 4 monomers of PolyA Binding Protein. PolyA Binding Protein
monomers bind to stretches of approximately 38 nucleotides. As
such, it has been observed that polyA tails of about 80 nucleotides
to about 160 nucleotides are functional. The chimeric
polynucleotides of the present disclosure that function as an mRNA
need not comprise a polyA tail.
[0449] In some embodiments of the present disclosure, chimeric
polynucleotides that function as an mRNA have a capping region. The
capping region can comprise a single cap or a series of nucleotides
forming the cap. In this embodiment the capping region can be from
1 to 10, e.g., 2-9, 3-8, 4-7, 1-5, 5-10, or at least 2, or 10 or
fewer nucleotides in length. In some embodiments, the cap is
absent.
[0450] The present disclosure contemplates chimeric polynucleotides
that are circular or cyclic. As the name implies circular
polynucleotides are circular in nature meaning that the termini are
joined in some fashion, whether by ligation, covalent bond, common
association with the same protein or other molecule or complex or
by hybridization.
[0451] Chimeric polynucleotides, formulations and compositions
comprising chimeric polynucleotides, and methods of making, using
and administering chimeric polynucleotides are also described in
International Patent Application No. PCT/US2014/53907, the contents
of which is incorporated by reference in its entirety.
[0452] In some embodiments, the chimeric polynucleotide encodes an
MCM protein or a functional fragment thereof. In some embodiments,
the chimeric polynucleotides of the disclosure comprise any one of
the human MCM nucleic acid sequences selected from SEQ ID NOs:
1-207, 732-765, and 772. In some embodiments, the chimeric
polynucleotide encodes a human MCM or functional fragment thereof
comprising at least one amino acid mutation from the wild type
sequence. In some embodiments, the chimeric polynucleotide encodes
an MCM mutant comprising one or more of the point mutations V69,
T499, H532, A598, and V671. In some embodiments, the expression of
the encoded polypeptide is increased. In some embodiments, the
chimeric polynucleotide increases MCM expression levels in cells
when introduced into those cells, e.g., by 20-50%, at least 20%, at
least 25%, at least 30%, at least 35%, at least 40%, at least 45%,
or at least 50%.
Circular Polynucleotide Architecture
[0453] The disclosure also includes a circular polynucleotide
comprising the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0454] Polynucleotides that are circular are known as "circular
polynucleotides" or "circP." As used herein, "circular
polynucleotides" or "circP" means a single stranded circular
polynucleotide which acts substantially like, and has the
properties of, an RNA. The term "circular" is also meant to
encompass any secondary or tertiary configuration of the circP.
[0455] The present disclosure contemplates polynucleotides encoding
MCM that are circular or cyclic. As the name implies circular
polynucleotides are circular in nature meaning that the termini are
joined in some fashion, whether by ligation, covalent bond, common
association with the same protein or other molecule or complex or
by hybridization.
[0456] The circular polynucleotides or circPs that encode at least
one peptide or polypeptide of interest are known as circular RNAs
or circRNA. As used herein, "circular RNA" or "circRNA" means a
circular polynucleotide that can encode at least one peptide or
polypeptide of interest.
[0457] The circPs that comprise at least one sensor sequence and do
not encode a peptide or polypeptide of interest are known as
circular sponges or circSP. As used herein, "circular sponges,"
"circular polynucleotide sponges" or "circSP" means a circular
polynucleotide that comprises at least one sensor sequence and does
not encode a polypeptide of interest.
[0458] As used herein, "sensor sequence" means a receptor or
pseudo-receptor for endogenous nucleic acid binding molecules.
Non-limiting examples of sensor sequences include, microRNA binding
sites, microRNA seed sequences, microRNA binding sites without the
seed sequence, transcription factor binding sites and artificial
binding sites engineered to act as pseudo-receptors and portions
and fragments thereof.
[0459] The circPs that comprise at least one sensor sequence and
encode at least one peptide or polypeptide of interest are known as
circular RNA sponges or circRNA-SP. As used herein, "circular RNA
sponges" or "circRNA-SP" means a circular polynucleotide that
comprises at least one sensor sequence and at least one region
encoding at least one peptide or polypeptide of interest.
[0460] As used herein, the term "circular construct" refers to a
circular polynucleotide transcript that can act substantially
similar to and have properties of a RNA molecule. In some
embodiments, the circular construct acts as an mRNA. If the
circular construct encodes one or more peptides or polypeptides of
interest (e.g., a circRNA or circRNA-SP) then the polynucleotide
transcript retains sufficient structural and/or chemical features
to allow the polypeptide of interest encoded therein to be
translated. Circular constructs can be polynucleotides of the
disclosure. When structurally or chemically modified, the construct
can be referred to as a modified circP, modified circSP, modified
circRNA or modified circRNA-SP.
[0461] Circular polynucleotides, formulations and compositions
comprising circular polynucleotides, and methods of making, using
and administering circular polynucleotides are also disclosed in
International Patent Application No. PCT/US2014/53904 the contents
of which is incorporated by reference in its entirety.
[0462] In some embodiments, the circular polynucleotide encodes an
MCM protein or a functional fragment thereof. In some embodiments,
the circular polynucleotides of the disclosure comprise any one of
the human MCM nucleic acid selected from SEQ ID NOs: 1-207,
732-765, and 772. In some embodiments, the circular polynucleotide
encodes a human MCM or functional fragment thereof comprising at
least one amino acid mutation from the wild type sequence. In some
embodiments, the circular polynucleotide encodes an MCM mutant
comprising one or more of the point mutations V69, T499, H532,
A598, and V671. In some embodiments, the expression of the encoded
polypeptide is increased. In some embodiments, the circular
polynucleotide increases MCM expression levels in cells when
introduced into those cells, e.g., by 20-50%, at least 20%, at
least 25%, at least 30%, at least 35%, at least 40%, at least 45%,
or at least 50%.
Multimers of Polynucleotides
[0463] The disclosure also includes multimers of polynucleotides
comprising the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0464] In some embodiments, multiple distinct chimeric
polynucleotides and/or IVT polynucleotides can be linked together
through the 3'-end using nucleotides that are modified at the
3'-terminus. Chemical conjugation can be used to control the
stoichiometry of delivery into cells. For example, the glyoxylate
cycle enzymes, isocitrate lyase and malate synthase, can be
supplied into cells at a 1:1 ratio to alter cellular fatty acid
metabolism. This ratio can be controlled by chemically linking
chimeric polynucleotides and/or IVT polynucleotides using a
3'-azido terminated nucleotide on one polynucleotides species and a
C5-ethynyl or alkynyl-containing nucleotide on the opposite
polynucleotide species. The modified nucleotide is added
post-transcriptionally using terminal transferase (New England
Biolabs, Ipswich, Mass.) according to the manufacturer's protocol.
After the addition of the 3'-modified nucleotide, the two
polynucleotides species can be combined in an aqueous solution, in
the presence or absence of copper, to form a new covalent linkage
via a click chemistry mechanism as described in the literature.
[0465] In another example, more than two chimeric polynucleotides
and/or IVT polynucleotides can be linked together using a
functionalized linker molecule. For example, a functionalized
saccharide molecule can be chemically modified to contain multiple
chemical reactive groups (SH--, NH.sub.2--, N.sub.3, etc. . . . )
to react with the cognate moiety on a 3'-functionalized mRNA
molecule (i.e., a 3'-maleimide ester, 3'-NHS-ester, alkynyl). The
number of reactive groups on the modified saccharide can be
controlled in a stoichiometric fashion to directly control the
stoichiometric ratio of conjugated chimeric polynucleotides and/or
IVT polynucleotides.
[0466] In some embodiments, the chimeric polynucleotides and/or IVT
polynucleotides can be linked together in a pattern. The pattern
can be a simple alternating pattern such as CD[CD].sub.x where each
"C" and each "D" represent a chimeric polynucleotide, IVT
polynucleotide, different chimeric polynucleotides or different IVT
polynucleotides. The pattern can repeat x number of times, where
x=1-300. Patterns can also be alternating multiples such as
CCDD[CCDD].sub.x (an alternating double multiple) or
CCCDDD[CCCDDD].sub.x (an alternating triple multiple) pattern. The
alternating double multiple or alternating triple multiple can
repeat x number of times, where x=1-300.
Conjugates and Combinations of Polynucleotides
[0467] The disclosure also includes conjugates and combinations of
polynucleotides comprising the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide.
[0468] In order to further enhance protein production,
polynucleotides of the present disclosure can be designed to be
conjugated to other polynucleotides, dyes, or other agents.
[0469] Conjugation can result in increased stability and/or
half-life and can be particularly useful in targeting the
polynucleotides to specific sites in the cell, tissue or
organism.
[0470] In some embodiments, the polynucleotides can be administered
with, conjugated to or further encode one or more of RNAi agents,
siRNAs, shRNAs, miRNAs, miRNA binding sites, antisense RNAs,
ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix
formation, aptamers or vectors, and the like.
Bifunctional Polynucleotides
[0471] The disclosure also includes bifunctional polynucleotides
comprising the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0472] In some embodiments of the disclosure are bifunctional
polynucleotides (e.g., bifunctional IVT polynucleotides,
bifunctional chimeric polynucleotides or bifunctional circular
polynucleotides). As the name implies, bifunctional polynucleotides
are those having or capable of at least two functions. These
molecules are also by convention be referred to as
multi-functional.
[0473] The multiple functionalities of bifunctional polynucleotides
can be encoded by the RNA (the function cannot manifest until the
encoded product is translated) or can be a property of the
polynucleotide itself. It can be structural or chemical.
Bifunctional modified polynucleotides can comprise a function that
is covalently or electrostatically associated with the
polynucleotides. Further, the two functions can be provided in the
context of a complex of a chimeric polynucleotide and another
molecule.
[0474] Bifunctional polynucleotides can encode peptides that are
anti-proliferative. These peptides can be linear, cyclic,
constrained or random coil. They can function as aptamers,
signaling molecules, ligands or mimics or mimetics thereof.
Anti-proliferative peptides can, as translated, be from 3 to 50
amino acids in length. They can be 5-40, 10-30, or approximately 15
amino acids long. They can be single chain, multichain or branched
and can form complexes, aggregates or any multi-unit structure once
translated.
Noncoding Polynucleotides
[0475] The disclosure also includes a noncoding polynucleotide
comprising the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0476] The polynucleotides described herein can further comprise
sequences that are partially or substantially not translatable,
e.g., having a noncoding region. As one non-limiting example, the
noncoding region can be the first region of the IVT polynucleotide
or the circular polynucleotide. Alternatively, the noncoding region
can be a region other than the first region. As another
non-limiting example, the noncoding region can be the A, B and/or C
region of the chimeric polynucleotide.
[0477] Such molecules are generally not translated, but can exert
an effect on protein production by one or more of binding to and
sequestering one or more translational machinery components such as
a ribosomal protein or a transfer RNA (tRNA), thereby effectively
reducing protein expression in the cell or modulating one or more
pathways or cascades in a cell that in turn alters protein levels.
The polynucleotide can contain or encode one or more long noncoding
RNA (lncRNA, or lincRNA) or portion thereof, a small nucleolar RNA
(sno-RNA), micro RNA (miRNA), small interfering RNA (siRNA) or
Piwi-interacting RNA (piRNA). Examples of such lncRNA molecules and
RNAi constructs designed to target such lncRNA any of which can be
encoded in the polynucleotides are disclosed in International
Publication, WO2012/018881 A2, the contents of which are
incorporated herein by reference in their entirety.
Cytotoxic Nucleosides
[0478] In some embodiments, the polynucleotides of the present
disclosure (i.e., a polynucleotide comprising an ORF encoding an
MCM polypeptide) can further incorporate one or more cytotoxic
nucleosides.
Untranslated Regions (UTRs)
[0479] Untranslated regions (UTRs) are nucleic acid sections of a
polynucleotide before a start codon (5'UTR) and after a stop codon
(3'UTR) that are not translated. In some embodiments, a
polynucleotide (e.g., a ribonucleic acid (RNA), e.g., a messenger
RNA (mRNA)) of the disclosure comprising an open reading frame
(ORF) encoding an MCM polypeptide further comprises UTR (e.g., a
5'UTR or functional fragment thereof, a 3'UTR or functional
fragment thereof, or a combination thereof).
[0480] A UTR can be homologous or heterologous to the coding region
in a polynucleotide. In some embodiments, the UTR is homologous to
the ORF encoding the MCM polypeptide. In some embodiments, the UTR
is heterologous to the ORF encoding the MCM polypeptide. In some
embodiments, the polynucleotide comprises two or more 5'UTRs or
functional fragments thereof, each of which have the same or
different nucleotide sequences. In some embodiments, the
polynucleotide comprises two or more 3 'UTRs or functional
fragments thereof, each of which have the same or different
nucleotide sequences.
[0481] In some embodiments, the 5'UTR or functional fragment
thereof, 3' UTR or functional fragment thereof, or any combination
thereof is sequence optimized.
[0482] In some embodiments, the 5'UTR or functional fragment
thereof, 3' UTR or functional fragment thereof, or any combination
thereof comprises at least one chemically modified nucleobase,
e.g., 5-methoxyuracil.
[0483] UTRs can have features that provide a regulatory role, e.g.,
increased or decreased stability, localization and/or translation
efficiency. A polynucleotide comprising a UTR can be administered
to a cell, tissue, or organism, and one or more regulatory features
can be measured using routine methods. In some embodiments, a
functional fragment of a 5'UTR or 3'UTR comprises one or more
regulatory features of a full length 5' or 3' UTR,
respectively.
[0484] Natural 5'UTRs bear features that play roles in translation
initiation. They harbor signatures like Kozak sequences that are
commonly known to be involved in the process by which the ribosome
initiates translation of many genes. Kozak sequences have the
consensus CCR(A/G)CCAUGG, where R is a purine (adenine or guanine)
three bases upstream of the start codon (AUG), which is followed by
another `G`. 5'UTRs also have been known to form secondary
structures that are involved in elongation factor binding.
[0485] By engineering the features typically found in abundantly
expressed genes of specific target organs, one can enhance the
stability and protein production of a polynucleotide. For example,
introduction of 5'UTR of liver-expressed mRNA, such as albumin,
serum amyloid A, Apolipoprotein AB/E, transferrin, alpha
fetoprotein, erythropoietin, or Factor VIII, can enhance expression
of polynucleotides in hepatic cell lines or liver. Likewise, use of
5'UTR from other tissue-specific mRNA to improve expression in that
tissue is possible for muscle (e.g., MyoD, Myosin, Myoglobin,
Myogenin, Herculin), for endothelial cells (e.g., Tie-1, CD36), for
myeloid cells (e.g., C/EBP, AML1, G-CSF, GM-CSF, CD11b, MSR, Fr-1,
i-NOS), for leukocytes (e.g., CD45, CD18), for adipose tissue
(e.g., CD36, GLUT4, ACRP30, adiponectin) and for lung epithelial
cells (e.g., SP-A/B/C/D).
[0486] In some embodiments, UTRs are selected from a family of
transcripts whose proteins share a common function, structure,
feature or property. For example, an encoded polypeptide can belong
to a family of proteins (i.e., that share at least one function,
structure, feature, localization, origin, or expression pattern),
which are expressed in a particular cell, tissue or at some time
during development. The UTRs from any of the genes or mRNA can be
swapped for any other UTR of the same or different family of
proteins to create a new polynucleotide.
[0487] In some embodiments, the 5'UTR and the 3'UTR can be
heterologous. In some embodiments, the 5'UTR can be derived from a
different species than the 3'UTR. In some embodiments, the 3'UTR
can be derived from a different species than the 5'UTR.
[0488] Co-owned International Patent Application No.
PCT/US2014/021522 (Publ. No. WO/2014/164253, incorporated herein by
reference in its entirety) provides a listing of exemplary UTRs
that can be utilized in the polynucleotide of the present
disclosure as flanking regions to an ORF.
[0489] Exemplary UTRs of the application include, but are not
limited to, one or more 5'UTR and/or 3'UTR derived from the nucleic
acid sequence of: a globin, such as an .alpha.- or .beta.-globin
(e.g., a Xenopus, mouse, rabbit, or human globin); a strong Kozak
translational initiation signal; a CYBA (e.g., human cytochrome
b-245 .alpha. polypeptide); an albumin (e.g., human albumin7); a
HSD17B4 (hydroxysteroid (17-.beta.) dehydrogenase); a virus (e.g.,
a tobacco etch virus (TEV), a Venezuelan equine encephalitis virus
(VEEV), a Dengue virus, a cytomegalovirus (CMV) (e.g., CMV
immediate early 1 (IE1)), a hepatitis virus (e.g., hepatitis B
virus), a sindbis virus, or a PAV barley yellow dwarf virus); a
heat shock protein (e.g., hsp70); a translation initiation factor
(e.g., elF4G); a glucose transporter (e.g., hGLUT1 (human glucose
transporter 1)); an actin (e.g., human .alpha. or .beta. actin); a
GAPDH; a tubulin; a histone; a citric acid cycle enzyme; a
topoisomerase (e.g., a 5'UTR of a TOP gene lacking the 5' TOP motif
(the oligopyrimidine tract)); a ribosomal protein Large 32 (L32); a
ribosomal protein (e.g., human or mouse ribosomal protein, such as,
for example, rps9); an ATP synthase (e.g., ATP5A1 or the .beta.
subunit of mitochondrial H.sup.+-ATP synthase); a growth hormone e
(e.g., bovine (bGH) or human (hGH)); an elongation factor (e.g.,
elongation factor 1 .alpha.1 (EEF1A1)); a manganese superoxide
dismutase (MnSOD); a myocyte enhancer factor 2A (MEF2A); a
.beta.-F1-ATPase, a creatine kinase, a myoglobin, a
granulocyte-colony stimulating factor (G-CSF); a collagen (e.g.,
collagen type I, alpha 2 (Col1A2), collagen type I, alpha 1
(Col1A1), collagen type VI, alpha 2 (Col6A2), collagen type VI,
alpha 1 (Col6A1)); a ribophorin (e.g., ribophorin I (RPNI)); a low
density lipoprotein receptor-related protein (e.g., LRP1); a
cardiotrophin-like cytokine factor (e.g., Nntl); calreticulin
(Calr); a procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1
(Plod1); and a nucleobindin (e.g., Nucb1).
[0490] Other exemplary 5' and 3' UTRs include, but are not limited
to, those described in Kariko et al., Mol. Ther. 2008
16(11):1833-1840; Kariko et al., Mol. Ther. 2012 20(5):948-953;
Kariko et al., Nucleic Acids Res. 2011 39(21):e142; Strong et al.,
Gene Therapy 1997 4:624-627; Hansson et al., J. Biol. Chem. 2015
290(9):5661-5672; Yu et al., Vaccine 2007 25(10):1701-1711; Cafri
et al., Mol. Ther. 2015 23(8):1391-1400; Andries et al., Mol.
Pharm. 2012 9(8):2136-2145; Crowley et al., Gene Ther. 2015 Jun.
30, doi:10.1038/gt.2015.68; Ramunas et al., FASEB J. 2015
29(5):1930-1939; Wang et al., Curr. Gene Ther. 2015 15(4):428-435;
Holtkamp et al., Blood 2006 108(13):4009-4017; Kormann et al., Nat.
Biotechnol. 2011 29(2):154-157; Poleganov et al., Hum. Gen. Ther.
2015 26(11):751-766; Warren et al., Cell Stem Cell 2010
7(5):618-630; Mandal and Rossi, Nat. Protoc. 2013 8(3):568-582;
Holcik and Liebhaber, PNAS 1997 94(6):2410-2414; Ferizi et al., Lab
Chip. 2015 15(17):3561-3571; Thess et al., Mol. Ther. 2015
23(9):1456-1464; Boros et al., PLoS One 2015 10(6):e0131141; Boros
et al., J. Photochem. Photobiol. B. 2013 129:93-99; Andries et al.,
J. Control. Release 2015 217:337-344; Zinckgraf et al., Vaccine
2003 21(15):1640-9; Garneau et al., J. Virol. 2008 82(2):880-892;
Holden and Harris, Virology 2004 329(1):119-133; Chiu et al., J.
Virol. 2005 79(13):8303-8315; Wang et al., EMBO J. 1997
16(13):4107-4116; Al-Zoghaibi et al., Gene 2007 391(1-2):130-9;
Vivinus et al., Eur. J. Biochem. 2001 268(7):1908-1917; Gan and
Rhoads, J. Biol. Chem. 1996 271(2):623-626; Boado et al., J.
Neurochem. 1996 67(4):1335-1343; Knirsch and Clerch, Biochem.
Biophys. Res. Commun. 2000 272(1):164-168; Chung et al.,
Biochemistry 1998 37(46):16298-16306; Izquierdo and Cuevza,
Biochem. J. 2000 346 Pt 3:849-855; Dwyer et al., J. Neurochem. 1996
66(2):449-458; Black et al., Mol. Cell. Biol. 1997 17(5):2756-2763;
Izquierdo and Cuevza, Mol. Cell. Biol. 1997 17(9):5255-5268; U.S.
Pat. No. 8,278,036; U.S. Pat. No. 8,748,089; U.S. Pat. No.
8,835,108; U.S. Pat. No. 9,012,219; US2010/0129877; US2011/0065103;
US2011/0086904; US2012/0195936; US2014/020675; US2013/0195967;
US2014/029490; US2014/0206753; WO2007/036366; WO2011/015347;
WO02012/072096; WO2013/143555; WO2014/071963; WO2013/185067;
WO2013/182623; WO2014/089486; WO2013/185069; WO2014/144196;
WO2014/152659; 2014/152673; WO2014/152940; WO2014/152774;
WO2014/153052; WO2014/152966, WO2014/152513; WO2015/101414;
WO2015/101415; WO2015/062738; and WO2015/024667; the contents of
each of which are incorporated herein by reference in their
entirety.
[0491] In some embodiments, the 5'UTR is selected from the group
consisting of a .beta.-globin 5'UTR; a 5'UTR containing a strong
Kozak translational initiation signal; a cytochrome b-245 .alpha.
polypeptide (CYBA) 5'UTR; a hydroxysteroid (17-.beta.)
dehydrogenase (HSD17B4) 5'UTR; a Tobacco etch virus (TEV) 5'UTR; a
Venezuelen equine encephalitis virus (TEEV) 5'UTR; a 5' proximal
open reading frame of rubella virus (RV) RNA encoding nonstructural
proteins; a Dengue virus (DEN) 5'UTR; a heat shock protein 70
(Hsp70) 5'UTR; a eIF4G 5'UTR; a GLUT1 5'UTR; functional fragments
thereof and any combination thereof.
[0492] In some embodiments, the 3'UTR is selected from the group
consisting of a .beta.-globin 3'UTR; a CYBA 3'UTR; an albumin
3'UTR; a growth hormone (GH) 3'UTR; a VEEV 3'UTR; a hepatitis B
virus (HBV) 3'UTR; .alpha.-globin 3'UTR; a DEN 3'UTR; a PAV barley
yellow dwarf virus (BYDV-PAV) 3'UTR; an elongation factor 1
.alpha.1 (EEF1A1) 3'UTR; a manganese superoxide dismutase (MnSOD)
3'UTR; a .beta. subunit of mitochondrial H(+)-ATP synthase
(.beta.-mRNA) 3'UTR; a GLUT1 3'UTR; a MEF2A 3'UTR; a
.beta.-F1-ATPase 3'UTR; functional fragments thereof and
combinations thereof.
[0493] Other exemplary UTRs include, but are not limited to, one or
more of the UTRs, including any combination of UTRs, disclosed in
WO2014/164253, the contents of which are incorporated herein by
reference in their entirety. Shown in Table 21 of U.S. Provisional
Application No. 61/775,509 and in Table 22 of U.S. Provisional
Application No. 61/829,372, the contents of each are incorporated
herein by reference in their entirety, is a listing start and stop
sites for 5'UTRs and 3'UTRs. In Table 21, each 5'UTR (5'-UTR-005 to
5'-UTR 68511) is identified by its start and stop site relative to
its native or wild-type (homologous) transcript (ENST; the
identifier used in the ENSEMBL database).
[0494] Wild-type UTRs derived from any gene or mRNA can be
incorporated into the polynucleotides of the disclosure. In some
embodiments, a UTR can be altered relative to a wild type or native
UTR to produce a variant UTR, e.g., by changing the orientation or
location of the UTR relative to the ORF; or by inclusion of
additional nucleotides, deletion of nucleotides, swapping or
transposition of nucleotides. In some embodiments, variants of 5'
or 3' UTRs can be utilized, for example, mutants of wild type UTRs,
or variants wherein one or more nucleotides are added to or removed
from a terminus of the UTR.
[0495] Additionally, one or more synthetic UTRs can be used in
combination with one or more non-synthetic UTRs. See, e.g., Mandal
and Rossi, Nat. Protoc. 2013 8(3):568-82, the contents of which are
incorporated herein by reference in their entirety, and sequences
available at www.addgene.org/Derrick_Rossi/. UTRs or portions
thereof can be placed in the same orientation as in the transcript
from which they were selected or can be altered in orientation or
location. Hence, a 5' and/or 3' UTR can be inverted, shortened,
lengthened, or combined with one or more other 5' UTRs or 3'
UTRs.
[0496] In some embodiments, the polynucleotide comprises multiple
UTRs, e.g., a double, a triple or a quadruple 5'UTR or 3'UTR. For
example, a double UTR comprises two copies of the same UTR either
in series or substantially in series. For example, a double
beta-globin 3'UTR can be used (see US2010/0129877, the contents of
which are incorporated herein by reference in its entirety).
[0497] Tables 5 and 6 provide a listing of exemplary UTRs that can
be utilized in the polynucleotides of the present disclosure. Shown
in Table 5 is a listing of a 5'-untranslated region of the
disclosure. Variants of 5' UTRs can be utilized wherein one or more
nucleotides are added or removed to the termini, including A, T, C
or G.
TABLE-US-00005 TABLE 5 5'-Untranslated Regions 5' UTR Name/ SEQ ID
Identifier Description Sequence NO. 5UTR-001 Upstream UTR
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATAT 215 AAGAGCCACC 5UTR-002
Upstream UTR GGGAGATCAGAGAGAAAAGAAGAGTAAGAAGAAATAT 216 AAGAGCCACC
5UTR-003 Upstream UTR GGAATAAAAGTCTCAACACAACATATACAAAACAAAC 217
GAATCTCAAGCAATCAAGCATTCTACTTCTATTGCAG
CAATTTAAATCATTTCTTTTAAAGCAAAAGCAATTTT
CTGAAAATTTTCACCATTTACGAACGATAGCAAC 5UTR-004 Upstream UTR
GGGAGACAAGCUUGGCAUUCCGGUACUGUUGGUAAAG 218 CCACC 5UTR-005 Upstream
UTR GGGAGATCAGAGAGAAAAGAAGAGTAAGAAGAAATAT 219 AAGAGCCACC 5UTR-006
Upstream UTR GGAATAAAAGTCTCAACACAACATATACAAAACAAAC 220
GAATCTCAAGCAATCAAGCATTCTACTTCTATTGCAG
CAATTTAAATCATTTCTTTTAAAGCAAAAGCAATTTT
CTGAAAATTTTCACCATTTACGAACGATAGCAAC 5UTR-007 Upstream UTR
GGGAGACAAGCUUGGCAUUCCGGUACUGUUGGUAAAG 221 CCACC 5UTR-008 Upstream
UTR GGGAATTAACAGAGAAAAGAAGAGTAAGAAGAAATAT 222 AAGAGCCACC 5UTR-009
Upstream UTR GGGAAATTAGACAGAAAAGAAGAGTAAGAAGAAATAT 223 AAGAGCCACC
5UTR-010 Upstream UTR GGGAAATAAGAGAGTAAAGAACAGTAAGAAGAAATAT 224
AAGAGCCACC 5UTR-011 Upstream UTR
GGGAAAAAAGAGAGAAAAGAAGACTAAGAAGAAATAT 225 AAGAGCCACC 5UTR-012
Upstream UTR GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGATATAT 226 AAGAGCCACC
5UTR-013 Upstream UTR GGGAAATAAGAGACAAAACAAGAGTAAGAAGAAATAT 227
AAGAGCCACC 5UTR-014 Upstream UTR
GGGAAATTAGAGAGTAAAGAACAGTAAGTAGAATTAA 228 AAGAGCCACC 5UTR-015
Upstream UTR GGGAAATAAGAGAGAATAGAAGAGTAAGAAGAAATAT 229 AAGAGCCACC
5UTR-016 Upstream UTR GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAAATT 230
AAGAGCCACC 5UTR-017 Upstream UTR
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATTT 231 AAGAGCCACC 5UTR-018
Upstream UTR TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGAC 266
TCACTATAGGGAAATAAGAGAGAAAAGAAGAGTAAGA AGAAATATAAGAGCCACC 142-3p
Upstream UTR TGATAATAGTCCATAAAGTAGGAAACACTACAGCTGG 725 UTR-001
including AGCCTCGGTGGCCATGCTTCTTGCCCCTTGGGCCTCC miR142-3p
CCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCC
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 142-3p Upstream UTR
TGATAATAGGCTGGAGCCTCGGTGGCTCCATAAAGTA 726 UTR-002 including
GGAAACACTACACATGCTTCTTGCCCCTTGGGCCTCC miR142-3p
CCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCC
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 142-3p Upstream UTR
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTG 727 UTR-003 including
CCCCTTCCATAAAGTAGGAAACACTACATGGGCCTCC miR142-3p
CCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCC
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 142-3p Upstream UTR
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTG 728 UTR-004 including
CCCCTTGGGCCTCCCCCCAGTCCATAAAGTAGGAAAC miR142-3p
ACTACACCCCTCCTCCCCTTCCTGCACCCGTACCCCC
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 142-3p Upstream UTR
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTG 729 UTR-005 including
CCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCTC miR142-3p
CATAAAGTAGGAAACACTACACTGCACCCGTACCCCC
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 142-3p Upstream UTR
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTG 730 UTR-006 including
CCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCT miR142-3p
GCACCCGTACCCCCTCCATAAAGTAGGAAACACTACA
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 142-3p Upstream UTR
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTG 731 UTR-007 including
CCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCT miR142-3p
GCACCCGTACCCCCGTGGTCTTTGAATAAAGTTCCAT
AAAGTAGGAAACACTACACTGAGTGGGCGGC
[0498] In a particular embodiment, the 5' UTR useful for the
polynucleotides comprises SEQ ID NO: 266.
[0499] Shown in Table 6 is a listing of 3'-untranslated regions of
the disclosure. Variants of 3' UTRs can be utilized wherein one or
more nucleotides are added or removed to the termini, including A,
T, C or G.
TABLE-US-00006 TABLE 6 3'-Untranslated Regions SEQ 3' UTR Name/ ID
Identifier Description Sequence NO. 3UTR-001 Creatine
GCGCCTGCCCACCTGCCACCGACTGCTGGAACCCAGCCAGTGG 232 Kinase
GAGGGCCTGGCCCACCAGAGTCCTGCTCCCTCACTCCTCGCCC
CGCCCCCTGTCCCAGAGTCCCACCTGGGGGCTCTCTCCACCCT
TCTCAGAGTTCCAGTTTCAACCAGAGTTCCAACCAATGGGCTC
CATCCTCTGGATTCTGGCCAATGAAATATCTCCCTGGCAGGGT
CCTCTTCTTTTCCCAGAGCTCCACCCCAACCAGGAGCTCTAGT
TAATGGAGAGCTCCCAGCACACTCGGAGCTTGTGCTTTGTCTC
CACGCAAAGCGATAAATAAAAGCATTGGTGGCCTTTGGTCTTT
GAATAAAGCCTGAGTAGGAAGTCTAGA 3UTR-002 Myoglobin
GCCCCTGCCGCTCCCACCCCCACCCATCTGGGCCCCGGGTTCA 233
AGAGAGAGCGGGGTCTGATCTCGTGTAGCCATATAGAGTTTGC
TTCTGAGTGTCTGCTTTGTTTAGTAGAGGTGGGCAGGAGGAGC
TGAGGGGCTGGGGCTGGGGTGTTGAAGTTGGCTTTGCATGCCC
AGCGATGCGCCTCCCTGTGGGATGTCATCACCCTGGGAACCGG
GAGTGGCCCTTGGCTCACTGTGTTCTGCATGGTTTGGATCTGA
TATAATTGTCCTTTCTTCTAAATCCCAACCGAACTTCTTCCAA
CCTCCAAACTGGCTGTAACCCCAAATCCAAGCCATTAACTACA
CCTGACAGTAGCAATTGTCTGATTAATCACTGGCCCCTTGAAG
ACAGCAGAATGTCCCTTTGCAATGAGGAGGAGATCTGGGCTGG
GCGGGCCAGCTGGGGAAGCATTTGACTATCTGGAACTTGTGTG
TGCCTCCTCAGGTATGGCAGTGACTCACCTGGTTTTAATAAAA
CAACCTGCAACATCTCATGGTCTTTGAATAAAGCCTGAGTAGG AAGTCTAGA 3UTR-003
.alpha.-actin ACACACTCCACCTCCAGCACGCGACTTCTCAGGACGACGAATC 234
TTCTCAATGGGGGGGCGGCTGAGCTCCAGCCACCCCGCAGTCA
CTTTCTTTGTAACAACTTCCGTTGCTGCCATCGTAAACTGACA
CAGTGTTTATAACGTGTACATACATTAACTTATTACCTCATTT
TGTTATTTTTCGAAACAAAGCCCTGTGGAAGAAAATGGAAAAC
TTGAAGAAGCATTAAAGTCATTCTGTTAAGCTGCGTAAATGGT
CTTTGAATAAAGCCTGAGTAGGAAGTCTAGA 3UTR-004 Albumin
CATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGA 235
AAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTT
CGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTC
TTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAA
AATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTC
AAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAA
GTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTA
GTTTCTTGTGGGCTAATTAAATAAATCATTAATACTCTTCTAA
TGGTCTTTGAATAAAGCCTGAGTAGGAAGTCTAGA 3UTR-005 .alpha.-globin
GCTGCCTTCTGCGGGGCTTGCCTTCTGGCCATGCCCTTCTTCT 236
CTCCCTTGCACCTGTACCTCTTGGTCTTTGAATAAAGCCTGAG
TAGGAAGGCGGCCGCTCGAGCATGCATCTAGA 3UTR-006 G-CSF
GCCAAGCCCTCCCCATCCCATGTATTTATCTCTATTTAATATT 237
TATGTCTATTTAAGCCTCATATTTAAAGACAGGGAAGAGCAGA
ACGGAGCCCCAGGCCTCTGTGTCCTTCCCTGCATTTCTGAGTT
TCATTCTCCTGCCTGTAGCAGTGAGAAAAAGCTCCTGTCCTCC
CATCCCCTGGACTGGGAGGTAGATAGGTAAATACCAAGTATTT
ATTACTATGACTGCTCCCCAGCCCTGGCTCTGCAATGGGCACT
GGGATGAGCCGCTGTGAGCCCCTGGTCCTGAGGGTCCCCACCT
GGGACCCTTGAGAGTATCAGGTCTCCCACGTGGGAGACAAGAA
ATCCCTGTTTAATATTTAAACAGCAGTGTTCCCCATCTGGGTC
CTTGCACCCCTCACTCTGGCCTCAGCCGACTGCACAGCGGCCC
CTGCATCCCCTTGGCTGTGAGGCCCCTGGACAAGCAGAGGTGG
CCAGAGCTGGGAGGCATGGCCCTGGGGTCCCACGAATTTGCTG
GGGAATCTCGTTTTTCTTCTTAAGACTTTTGGGACATGGTTTG
ACTCCCGAACATCACCGACGCGTCTCCTGTTTTTCTGGGTGGC
CTCGGGACACCTGCCCTGCCCCCACGAGGGTCAGGACTGTGAC
TCTTTTTAGGGCCAGGCAGGTGCCTGGACATTTGCCTTGCTGG
ACGGGGACTGGGGATGTGGGAGGGAGCAGACAGGAGGAATCAT
GTCAGGCCTGTGTGTGAAAGGAAGCTCCACTGTCACCCTCCAC
CTCTTCACCCCCCACTCACCAGTGTCCCCTCCACTGTCACATT
GTAACTGAACTTCAGGATAATAAAGTGTTTGCCTCCATGGTCT
TTGAATAAAGCCTGAGTAGGAAGGCGGCCGCTCGAGCATGCAT CTAGA 3UTR-007 Col1a2;
ACTCAATCTAAATTAAAAAAGAAAGAAATTTGAAAAAACTTTC 238 collagen,
TCTTTGCCATTTCTTCTTCTTCTTTTTTAACTGAAAGCTGAAT type I,
CCTTCCATTTCTTCTGCACATCTACTTGCTTAAATTGTGGGCA alpha 2
AAAGAGAAAAAGAAGGATTGATCAGAGCATTGTGCAATACAGT
TTCATTAACTCCTTCCCCCGCTCCCCCAAAAATTTGAATTTTT
TTTTCAACACTCTTACACCTGTTATGGAAAATGTCAACCTTTG
TAAGAAAACCAAAATAAAAATTGAAAAATAAAAACCATAAACA
TTTGCACCACTTGTGGCTTTTGAATATCTTCCACAGAGGGAAG
TTTAAAACCCAAACTTCCAAAGGTTTAAACTACCTCAAAACAC
TTTCCCATGAGTGTGATCCACATTGTTAGGTGCTGACCTAGAC
AGAGATGAACTGAGGTCCTTGTTTTGTTTTGTTCATAATACAA
AGGTGCTAATTAATAGTATTTCAGATACTTGAAGAATGTTGAT
GGTGCTAGAAGAATTTGAGAAGAAATACTCCTGTATTGAGTTG
TATCGTGTGGTGTATTTTTTAAAAAATTTGATTTAGCATTCAT
ATTTTCCATCTTATTCCCAATTAAAAGTATGCAGATTATTTGC
CCAAATCTTCTTCAGATTCAGCATTTGTTCTTTGCCAGTCTCA
TTTTCATCTTCTTCCATGGTTCCACAGAAGCTTTGTTTCTTGG
GCAAGCAGAAAAATTAAATTGTACCTATTTTGTATATGTGAGA
TGTTTAAATAAATTGTGAAAAAAATGAAATAAAGCATGTTTGG TTTTCCAAAAGAACATAT
3UTR-008 Col6a2; CGCCGCCGCCCGGGCCCCGCAGTCGAGGGTCGTGAGCCCACCC 239
collagen, CGTCCATGGTGCTAAGCGGGCCCGGGTCCCACACGGCCAGCAC type VI,
CGCTGCTCACTCGGACGACGCCCTGGGCCTGCACCTCTCCAGC alpha 2
TCCTCCCACGGGGTCCCCGTAGCCCCGGCCCCCGCCCAGCCCC
AGGTCTCCCCAGGCCCTCCGCAGGCTGCCCGGCCTCCCTCCCC
CTGCAGCCATCCCAAGGCTCCTGACCTACCTGGCCCCTGAGCT
CTGGAGCAAGCCCTGACCCAATAAAGGCTTTGAACCCAT 3UTR-009 RPN1;
GGGGCTAGAGCCCTCTCCGCACAGCGTGGAGACGGGGCAAGGA 240 ribophorin I
GGGGGGTTATTAGGATTGGTGGTTTTGTTTTGCTTTGTTTAAA
GCCGTGGGAAAATGGCACAACTTTACCTCTGTGGGAGATGCAA
CACTGAGAGCCAAGGGGTGGGAGTTGGGATAATTTTTATATAA
AAGAAGTTTTTCCACTTTGAATTGCTAAAAGTGGCATTTTTCC
TATGTGCAGTCACTCCTCTCATTTCTAAAATAGGGACGTGGCC
AGGCACGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGC
CGAGGCAGGCGGCTCACGAGGTCAGGAGATCGAGACTATCCTG
GCTAACACGGTAAAACCCTGTCTCTACTAAAAGTACAAAAAAT
TAGCTGGGCGTGGTGGTGGGCACCTGTAGTCCCAGCTACTCGG
GAGGCTGAGGCAGGAGAAAGGCATGAATCCAAGAGGCAGAGCT
TGCAGTGAGCTGAGATCACGCCATTGCACTCCAGCCTGGGCAA
CAGTGTTAAGACTCTGTCTCAAATATAAATAAATAAATAAATA
AATAAATAAATAAATAAAAATAAAGCGAGATGTTGCCCTCAAA 3UTR-010 LRP1; low
GGCCCTGCCCCGTCGGACTGCCCCCAGAAAGCCTCCTGCCCCC 241 density
TGCCAGTGAAGTCCTTCAGTGAGCCCCTCCCCAGCCAGCCCTT lipoprotein
CCCTGGCCCCGCCGGATGTATAAATGTAAAAATGAAGGAATTA receptor-
CATTTTATATGTGAGCGAGCAAGCCGGCAAGCGAGCACAGTAT related
TATTTCTCCATCCCCTCCCTGCCTGCTCCTTGGCACCCCCATG protein 1
CTGCCTTCAGGGAGACAGGCAGGGAGGGCTTGGGGCTGCACCT
CCTACCCTCCCACCAGAACGCACCCCACTGGGAGAGCTGGTGG
TGCAGCCTTCCCCTCCCTGTATAAGACACTTTGCCAAGGCTCT
CCCCTCTCGCCCCATCCCTGCTTGCCCGCTCCCACAGCTTCCT
GAGGGCTAATTCTGGGAAGGGAGAGTTCTTTGCTGCCCCTGTC
TGGAAGACGTGGCTCTGGGTGAGGTAGGCGGGAAAGGATGGAG
TGTTTTAGTTCTTGGGGGAGGCCACCCCAAACCCCAGCCCCAA
CTCCAGGGGCACCTATGAGATGGCCATGCTCAACCCCCCTCCC
AGACAGGCCCTCCCTGTCTCCAGGGCCCCCACCGAGGTTCCCA
GGGCTGGAGACTTCCTCTGGTAAACATTCCTCCAGCCTCCCCT
CCCCTGGGGACGCCAAGGAGGTGGGCCACACCCAGGAAGGGAA
AGCGGGCAGCCCCGTTTTGGGGACGTGAACGTTTTAATAATTT
TTGCTGAATTCCTTTACAACTAAATAACACAGATATTGTTATA AATAAAATTGT 3UTR-011
Nnt1; ATATTAAGGATCAAGCTGTTAGCTAATAATGCCACCTCTGCAG 242 cardio-
TTTTGGGAACAGGCAAATAAAGTATCAGTATACATGGTGATGT trophin-like
ACATCTGTAGCAAAGCTCTTGGAGAAAATGAAGACTGAAGAAA cytokine
GCAAAGCAAAAACTGTATAGAGAGATTTTTCAAAAGCAGTAAT factor 1
CCCTCAATTTTAAAAAAGGATTGAAAATTCTAAATGTCTTTCT
GTGCATATTTTTTGTGTTAGGAATCAAAAGTATTTTATAAAAG
GAGAAAGAACAGCCTCATTTTAGATGTAGTCCTGTTGGATTTT
TTATGCCTCCTCAGTAACCAGAAATGTTTTAAAAAACTAAGTG
TTTAGGATTTCAAGACAACATTATACATGGCTCTGAAATATCT
GACACAATGTAAACATTGCAGGCACCTGCATTTTATGTTTTTT
TTTTCAACAAATGTGACTAATTTGAAACTTTTATGAACTTCTG
AGCTGTCCCCTTGCAATTCAACCGCAGTTTGAATTAATCATAT
CAAATCAGTTTTAATTTTTTAAATTGTACTTCAGAGTCTATAT
TTCAAGGGCACATTTTCTCACTACTATTTTAATACATTAAAGG
ACTAAATAATCTTTCAGAGATGCTGGAAACAAATCATTTGCTT
TATATGTTTCATTAGAATACCAATGAAACATACAACTTGAAAA
TTAGTAATAGTATTTTTGAAGATCCCATTTCTAATTGGAGATC
TCTTTAATTTCGATCAACTTATAATGTGTAGTACTATATTAAG
TGCACTTGAGTGGAATTCAACATTTGACTAATAAAATGAGTTC
ATCATGTTGGCAAGTGATGTGGCAATTATCTCTGGTGACAAAA
GAGTAAAATCAAATATTTCTGCCTGTTACAAATATCAAGGAAG
ACCTGCTACTATGAAATAGATGACATTAATCTGTCTTCACTGT
TTATAATACGGATGGATTTTTTTTCAAATCAGTGTGTGTTTTG
AGGTCTTATGTAATTGATGACATTTGAGAGAAATGGTGGCTTT
TTTTAGCTACCTCTTTGTTCATTTAAGCACCAGTAAAGATCAT
GTCTTTTTATAGAAGTGTAGATTTTCTTTGTGACTTTGCTATC
GTGCCTAAAGCTCTAAATATAGGTGAATGTGTGATGAATACTC
AGATTATTTGTCTCTCTATATAATTAGTTTGGTACTAAGTTTC
TCAAAAAATTATTAACACATGAAAGACAATCTCTAAACCAGAA
AAAGAAGTAGTACAAATTTTGTTACTGTAATGCTCGCGTTTAG
TGAGTTTAAAACACACAGTATCTTTTGGTTTTATAATCAGTTT
CTATTTTGCTGTGCCTGAGATTAAGATCTGTGTATGTGTGTGT
GTGTGTGTGTGCGTTTGTGTGTTAAAGCAGAAAAGACTTTTTT
AAAAGTTTTAAGTGATAAATGCAATTTGTTAATTGATCTTAGA
TCACTAGTAAACTCAGGGCTGAATTATACCATGTATATTCTAT
TAGAAGAAAGTAAACACCATCTTTATTCCTGCCCTTTTTCTTC
TCTCAAAGTAGTTGTAGTTATATCTAGAAAGAAGCAATTTTGA
TTTCTTGAAAAGGTAGTTCCTGCACTCAGTTTAAACTAAAAAT
AATCATACTTGGATTTTATTTATTTTTGTCATAGTAAAAATTT
TAATTTATATATATTTTTATTTAGTATTATCTTATTCTTTGCT
ATTTGCCAATCCTTTGTCATCAATTGTGTTAAATGAATTGAAA
ATTCATGCCCTGTTCATTTTATTTTACTTTATTGGTTAGGATA
TTTAAAGGATTTTTGTATATATAATTTCTTAAATTAATATTCC
AAAAGGTTAGTGGACTTAGATTATAAATTATGGCAAAAATCTA
AAAACAACAAAAATGATTTTTATACATTCTATTTCATTATTCC
TCTTTTTCCAATAAGTCATACAATTGGTAGATATGACTTATTT
TATTTTTGTATTATTCACTATATCTTTATGATATTTAAGTATA
AATAATTAAAAAAATTTATTGTACCTTATAGTCTGTCACCAAA
AAAAAAAAATTATCTGTAGGTAGTGAAATGCTAATGTTGATTT
GTCTTTAAGGGCTTGTTAACTATCCTTTATTTTCTCATTTGTC
TTAAATTAGGAGTTTGTGTTTAAATTACTCATCTAAGCAAAAA
ATGTATATAAATCCCATTACTGGGTATATACCCAAAGGATTAT
AAATCATGCTGCTATAAAGACACATGCACACGTATGTTTATTG
CAGCACTATTCACAATAGCAAAGACTTGGAACCAACCCAAATG
TCCATCAATGATAGACTTGATTAAGAAAATGTGCACATATACA
CCATGGAATACTATGCAGCCATAAAAAAGGATGAGTTCATGTC
CTTTGTAGGGACATGGATAAAGCTGGAAACCATCATTCTGAGC
AAACTATTGCAAGGACAGAAAACCAAACACTGCATGTTCTCAC
TCATAGGTGGGAATTGAACAATGAGAACACTTGGACACAAGGT
GGGGAACACCACACACCAGGGCCTGTCATGGGGTGGGGGGAGT
GGGGAGGGATAGCATTAGGAGATATACCTAATGTAAATGATGA
GTTAATGGGTGCAGCACACCAACATGGCACATGTATACATATG
TAGCAAACCTGCACGTTGTGCACATGTACCCTAGAACTTAAAG
TATAATTAAAAAAAAAAAGAAAACAGAAGCTATTTATAAAGAA
GTTATTTGCTGAAATAAATGTGATCTTTCCCATTAAAAAAATA
AAGAAATTTTGGGGTAAAAAAACACAATATATTGTATTCTTGA
AAAATTCTAAGAGAGTGGATGTGAAGTGTTCTCACCACAAAAG
TGATAACTAATTGAGGTAATGCACATATTAATTAGAAAGATTT
TGTCATTCCACAATGTATATATACTTAAAAATATGTTATACAC
AATAAATACATACATTAAAAAATAAGTAAATGTA 3UTR-012 Col6a1;
CCCACCCTGCACGCCGGCACCAAACCCTGTCCTCCCACCCCTC 243 collagen,
CCCACTCATCACTAAACAGAGTAAAATGTGATGCGAATTTTCC type VI,
CGACCAACCTGATTCGCTAGATTTTTTTTAAGGAAAAGCTTGG alpha 1
AAAGCCAGGACACAACGCTGCTGCCTGCTTTGTGCAGGGTCCT
CCGGGGCTCAGCCCTGAGTTGGCATCACCTGCGCAGGGCCCTC
TGGGGCTCAGCCCTGAGCTAGTGTCACCTGCACAGGGCCCTCT
GAGGCTCAGCCCTGAGCTGGCGTCACCTGTGCAGGGCCCTCTG
GGGCTCAGCCCTGAGCTGGCCTCACCTGGGTTCCCCACCCCGG
GCTCTCCTGCCCTGCCCTCCTGCCCGCCCTCCCTCCTGCCTGC
GCAGCTCCTTCCCTAGGCACCTCTGTGCTGCATCCCACCAGCC
TGAGCAAGACGCCCTCTCGGGGCCTGTGCCGCACTAGCCTCCC
TCTCCTCTGTCCCCATAGCTGGTTTTTCCCACCAATCCTCACC
TAACAGTTACTTTACAATTAAACTCAAAGCAAGCTCTTCTCCT
CAGCTTGGGGCAGCCATTGGCCTCTGTCTCGTTTTGGGAAACC
AAGGTCAGGAGGCCGTTGCAGACATAAATCTCGGCGACTCGGC
CCCGTCTCCTGAGGGTCCTGCTGGTGACCGGCCTGGACCTTGG
CCCTACAGCCCTGGAGGCCGCTGCTGACCAGCACTGACCCCGA
CCTCAGAGAGTACTCGCAGGGGCGCTGGCTGCACTCAAGACCC
TCGAGATTAACGGTGCTAACCCCGTCTGCTCCTCCCTCCCGCA
GAGACTGGGGCCTGGACTGGACATGAGAGCCCCTTGGTGCCAC
AGAGGGCTGTGTCTTACTAGAAACAACGCAAACCTCTCCTTCC
TCAGAATAGTGATGTGTTCGACGTTTTATCAAAGGCCCCCTTT
CTATGTTCATGTTAGTTTTGCTCCTTCTGTGTTTTTTTCTGAA
CCATATCCATGTTGCTGACTTTTCCAAATAAAGGTTTTCACTC CTCTC 3UTR-013 Calr;
AGAGGCCTGCCTCCAGGGCTGGACTGAGGCCTGAGCGCTCCTG 244 calreticulin
CCGCAGAGCTGGCCGCGCCAAATAATGTCTCTGTGAGACTCGA
GAACTTTCATTTTTTTCCAGGCTGGTTCGGATTTGGGGTGGAT
TTTGGTTTTGTTCCCCTCCTCCACTCTCCCCCACCCCCTCCCC
GCCCTTTTTTTTTTTTTTTTTTAAACTGGTATTTTATCTTTGA
TTCTCCTTCAGCCCTCACCCCTGGTTCTCATCTTTCTTGATCA
ACATCTTTTCTTGCCTCTGTCCCCTTCTCTCATCTCTTAGCTC
CCCTCCAACCTGGGGGGCAGTGGTGTGGAGAAGCCACAGGCCT
GAGATTTCATCTGCTCTCCTTCCTGGAGCCCAGAGGAGGGCAG
CAGAAGGGGGTGGTGTCTCCAACCCCCCAGCACTGAGGAAGAA
CGGGGCTCTTCTCATTTCACCCCTCCCTTTCTCCCCTGCCCCC
AGGACTGGGCCACTTCTGGGTGGGGCAGTGGGTCCCAGATTGG
CTCACACTGAGAATGTAAGAACTACAAACAAAATTTCTATTAA ATTAAATTTTGTGTCTCC
3UTR-014 Col1a1; CTCCCTCCATCCCAACCTGGCTCCCTCCCACCCAACCAACTTT 245
collagen, CCCCCCAACCCGGAAACAGACAAGCAACCCAAACTGAACCCCC type I,
TCAAAAGCCAAAAAATGGGAGACAATTTCACATGGACTTTGGA alpha 1
AAATATTTTTTTCCTTTGCATTCATCTCTCAAACTTAGTTTTT
ATCTTTGACCAACCGAACATGACCAAAAACCAAAAGTGCATTC
AACCTTACCAAAAAAAAAAAAAAAAAAAGAATAAATAAATAAC
TTTTTAAAAAAGGAAGCTTGGTCCACTTGCTTGAAGACCCATG
CGGGGGTAAGTCCCTTTCTGCCCGTTGGGCTTATGAAACCCCA
ATGCTGCCCTTTCTGCTCCTTTCTCCACACCCCCCTTGGGGCC
TCCCCTCCACTCCTTCCCAAATCTGTCTCCCCAGAAGACACAG
GAAACAATGTATTGTCTGCCCAGCAATCAAAGGCAATGCTCAA
ACACCCAAGTGGCCCCCACCCTCAGCCCGCTCCTGCCCGCCCA
GCACCCCCAGGCCCTGGGGGACCTGGGGTTCTCAGACTGCCAA
AGAAGCCTTGCCATCTGGCGCTCCCATGGCTCTTGCAACATCT
CCCCTTCGTTTTTGAGGGGGTCATGCCGGGGGAGCCACCAGCC
CCTCACTGGGTTCGGAGGAGAGTCAGGAAGGGCCACGACAAAG
CAGAAACATCGGATTTGGGGAACGCGTGTCAATCCCTTGTGCC
GCAGGGCTGGGCGGGAGAGACTGTTCTGTTCCTTGTGTAACTG
TGTTGCTGAAAGACTACCTCGTTCTTGTCTTGATGTGTCACCG
GGGCAACTGCCTGGGGGCGGGGATGGGGGCAGGGTGGAAGCGG
CTCCCCATTTTATACCAAAGGTGCTACATCTATGTGATGGGTG
GGGTGGGGAGGGAATCACTGGTGCTATAGAAATTGAGATGCCC
CCCCAGGCCAGCAAATGTTCCTTTTTGTTCAAAGTCTATTTTT
ATTCCTTGATATTTTTCTTTTTTTTTTTTTTTTTTTGTGGATG
GGGACTTGTGAATTTTTCTAAAGGTGCTATTTAACATGGGAGG
AGAGCGTGTGCGGCTCCAGCCCAGCCCGCTGCTCACTTTCCAC
CCTCTCTCCACCTGCCTCTGGCTTCTCAGGCCTCTGCTCTCCG
ACCTCTCTCCTCTGAAACCCTCCTCCACAGCTGCAGCCCATCC
TCCCGGCTCCCTCCTAGTCTGTCCTGCGTCCTCTGTCCCCGGG
TTTCAGAGACAACTTCCCAAAGCACAAAGCAGTTTTTCCCCCT
AGGGGTGGGAGGAAGCAAAAGACTCTGTACCTATTTTGTATGT
GTATAATAATTTGAGATGTTTTTAATTATTTTGATTGCTGGAA
TAAAGCATGTGGAAATGACCCAAACATAATCCGCAGTGGCCTC
CTAATTTCCTTCTTTGGAGTTGGGGGAGGGGTAGACATGGGGA
AGGGGCTTTGGGGTGATGGGCTTGCCTTCCATTCCTGCCCTTT
CCCTCCCCACTATTCTCTTCTAGATCCCTCCATAACCCCACTC
CCCTTTCTCTCACCCTTCTTATACCGCAAACCTTTCTACTTCC
TCTTTCATTTTCTATTCTTGCAATTTCCTTGCACCTTTTCCAA
ATCCTCTTCTCCCCTGCAATACCATACAGGCAATCCACGTGCA
CAACACACACACACACTCTTCACATCTGGGGTTGTCCAAACCT
CATACCCACTCCCCTTCAAGCCCATCCACTCTCCACCCCCTGG
ATGCCCTGCACTTGGTGGCGGTGGGATGCTCATGGATACTGGG
AGGGTGAGGGGAGTGGAACCCGTGAGGAGGACCTGGGGGCCTC
TCCTTGAACTGACATGAAGGGTCATCTGGCCTCTGCTCCCTTC
TCACCCACGCTGACCTCCTGCCGAAGGAGCAACGCAACAGGAG
AGGGGTCTGCTGAGCCTGGCGAGGGTCTGGGAGGGACCAGGAG
GAAGGCGTGCTCCCTGCTCGCTGTCCTGGCCCTGGGGGAGTGA
GGGAGACAGACACCTGGGAGAGCTGTGGGGAAGGCACTCGCAC
CGTGCTCTTGGGAAGGAAGGAGACCTGGCCCTGCTCACCACGG
ACTGGGTGCCTCGACCTCCTGAATCCCCAGAACACAACCCCCC
TGGGCTGGGGTGGTCTGGGGAACCATCGTGCCCCCGCCTCCCG CCTACTCCTTTTTAAGCTT
3UTR-015 Plod1; TTGGCCAGGCCTGACCCTCTTGGACCTTTCTTCTTTGCCGACA 246
procollagen- ACCACTGCCCAGCAGCCTCTGGGACCTCGGGGTCCCAGGGAAC lysine, 2-
CCAGTCCAGCCTCCTGGCTGTTGACTTCCCATTGCTCTTGGAG oxoglutarate
CCACCAATCAAAGAGATTCAAAGAGATTCCTGCAGGCCAGAGG 5-
CGGAACACACCTTTATGGCTGGGGCTCTCCGTGGTGTTCTGGA dioxygenase
CCCAGCCCCTGGAGACACCATTCACTTTTACTGCTTTGTAGTG 1
ACTCGTGCTCTCCAACCTGTCTTCCTGAAAAACCAAGGCCCCC
TTCCCCCACCTCTTCCATGGGGTGAGACTTGAGCAGAACAGGG
GCTTCCCCAAGTTGCCCAGAAAGACTGTCTGGGTGAGAAGCCA
TGGCCAGAGCTTCTCCCAGGCACAGGTGTTGCACCAGGGACTT
CTGCTTCAAGTTTTGGGGTAAAGACACCTGGATCAGACTCCAA
GGGCTGCCCTGAGTCTGGGACTTCTGCCTCCATGGCTGGTCAT
GAGAGCAAACCGTAGTCCCCTGGAGACAGCGACTCCAGAGAAC
CTCTTGGGAGACAGAAGAGGCATCTGTGCACAGCTCGATCTTC
TACTTGCCTGTGGGGAGGGGAGTGACAGGTCCACACACCACAC
TGGGTCACCCTGTCCTGGATGCCTCTGAAGAGAGGGACAGACC
GTCAGAAACTGGAGAGTTTCTATTAAAGGTCATTTAAACCA 3UTR-016 Nucb1;
TCCTCCGGGACCCCAGCCCTCAGGATTCCTGATGCTCCAAGGC 247 nucleo-
GACTGATGGGCGCTGGATGAAGTGGCACAGTCAGCTTCCCTGG bindin 1
GGGCTGGTGTCATGTTGGGCTCCTGGGGCGGGGGCACGGCCTG
GCATTTCACGCATTGCTGCCACCCCAGGTCCACCTGTCTCCAC
TTTCACAGCCTCCAAGTCTGTGGCTCTTCCCTTCTGTCCTCCG
AGGGGCTTGCCTTCTCTCGTGTCCAGTGAGGTGCTCAGTGATC
GGCTTAACTTAGAGAAGCCCGCCCCCTCCCCTTCTCCGTCTGT
CCCAAGAGGGTCTGCTCTGAGCCTGCGTTCCTAGGTGGCTCGG
CCTCAGCTGCCTGGGTTGTGGCCGCCCTAGCATCCTGTATGCC
ACCAGCTACTGGAATCCCCGCTGCTGCTCCGGGCCAAGCTTCT
GGTTGATTAATGAGGGCATGGGGTGGTCCCTCAAGACCTTCCC
CTACCTTTTGTGGAACCAGTGATGCCTCAAAGACAGTGTCCCC
TCCACAGCTGGGTGCCAGGGGCAGGGGATCCTCAGTATAGCCG
GTGAACCCTGATACCAGGAGCCTGGGCCTCCCTGAACCCCTGG
CTTCCAGCCATCTCATCGCCAGCCTCCTCCTGGACCTCTTGGC
CCCCAGCCCCTTCCCCACACAGCCCCAGAAGGGTCCCAGAGCT
GACCCCACTCCAGGACCTAGGCCCAGCCCCTCAGCCTCATCTG
GAGCCCCTGAAGACCAGTCCCACCCACCTTTCTGGCCTCATCT
GACACTGCTCCGCATCCTGCTGTGTGTCCTGTTCCATGTTCCG
GTTCCATCCAAATACACTTTCTGGAACAAA 3UTR-017 .alpha.-globin
GCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTTGGGCCTCCC 248
CCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCT
TTGAATAAAGTCTGAGTGGGCGGC 3UTR-018
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTT 267
GGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCC
CCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 3UTR-019
TGATAATAGTCCATAAAGTAGGAAACACTACAGCTGGAGCCTC 773
GGTGGCCATGCTTCTTGCCCCTTGGGCCTCCCCCCAGCCCCTC
CTCCCCTTCCTGCACCCGTACCCCCCGCATTATTACTCACGGT
ACGAGTGGTCTTTGAATAAAGTCTGAGTGGGCGGC 3UTR-020
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTT 774
GGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCC
CCCGCATTATTACTCACGGTACGAGTGGTCTTTGAATAAAGTC TGAGTGGGCGGC
[0500] In certain embodiments, the 3' UTR useful for the
polynucleotides comprises SEQ ID NO: 267.
[0501] In certain embodiments, the 5'UTR and/or 3'UTR sequence of
the disclosure comprises a nucleotide sequence at least about 60%,
at least about 70%, at least about 80%, at least about 90%, at
least about 95%, at least about 96%, at least about 97%, at least
about 98%, at least about 99%, or about 100% identical to a
sequence selected from the group consisting of 5'UTR sequences
comprising any of SEQ ID NOs: 215-231 and/or 3'UTR sequences
comprises any of SEQ ID NOs: 232-248, and any combination thereof.
The polynucleotides of the disclosure can comprise combinations of
features. For example, the ORF can be flanked by a 5'UTR that
comprises a strong Kozak translational initiation signal and/or a
3'UTR comprising an oligo(dT) sequence for templated addition of a
poly-A tail. A 5'UTR can comprise a first polynucleotide fragment
and a second polynucleotide fragment from the same and/or different
UTRs (see, e.g., US2010/0293625, herein incorporated by reference
in its entirety).
[0502] It is also within the scope of the present disclosure to
have patterned UTRs. As used herein "patterned UTRs" include a
repeating or alternating pattern, such as ABABAB or AABBAABBAABB or
ABCABCABC or variants thereof repeated once, twice, or more than 3
times. In these patterns, each letter, A, B, or C represent a
different UTR nucleic acid sequence.
[0503] Other non-UTR sequences can be used as regions or subregions
within the polynucleotides of the disclosure. For example, introns
or portions of intron sequences can be incorporated into the
polynucleotides of the disclosure. Incorporation of intronic
sequences can increase protein production as well as polynucleotide
expression levels. In some embodiments, the polynucleotide of the
disclosure comprises an internal ribosome entry site (IRES) instead
of or in addition to a UTR (see, e.g., Yakubov et al., Biochem.
Biophys. Res. Commun. 2010 394(1):189-193, the contents of which
are incorporated herein by reference in their entirety). In some
embodiments, the polynucleotide of the disclosure comprises 5'
and/or 3' sequence associated with the 5' and/or 3' ends of rubella
virus (RV) genomic RNA, respectively, or deletion derivatives
thereof, including the 5' proximal open reading frame of RV RNA
encoding nonstructural proteins (e.g., see Pogue et al., J. Virol.
67(12):7106-7117, the contents of which are incorporated herein by
reference in their entirety). Viral capsid sequences can also be
used as a translational enhancer, e.g., the 5' portion of a capsid
sequence, (e.g., semliki forest virus and sindbis virus capsid RNAs
as described in Sjoberg et al., Biotechnology (NY) 1994
12(11):1127-1131, and Frolov and Schlesinger J. Virol. 1996
70(2):1182-1190, the contents of each of which are incorporated
herein by reference in their entirety). In some embodiments, the
polynucleotide comprises an IRES instead of a 5'UTR sequence. In
some embodiments, the polynucleotide comprises an ORF and a viral
capsid sequence. In some embodiments, the polynucleotide comprises
a synthetic 5'UTR in combination with a non-synthetic 3'UTR.
[0504] In some embodiments, the UTR can also include at least one
translation enhancer polynucleotide, translation enhancer element,
or translational enhancer elements (collectively, "TEE," which
refers to nucleic acid sequences that increase the amount of
polypeptide or protein produced from a polynucleotide. As a
non-limiting example, the TEE can include those described in
US2009/0226470, incorporated herein by reference in its entirety,
and others known in the art. As a non-limiting example, the TEE can
be located between the transcription promoter and the start codon.
In some embodiments, the 5'UTR comprises a TEE.
[0505] In one aspect, a TEE is a conserved element in a UTR that
can promote translational activity of a nucleic acid such as, but
not limited to, cap-dependent or cap-independent translation. The
conservation of these sequences has been shown across 14 species
including humans. See, e.g., Panek et al., "An evolutionary
conserved pattern of 18S rRNA sequence complementarity to mRNA
5'UTRs and its implications for eukaryotic gene translation
regulation," Nucleic Acids Research 2013, doi:10.1093/nar/gkt548,
incorporated herein by reference in its entirety.
[0506] In one non-limiting example, the TEE comprises the TEE
sequence in the 5'-leader of the Gtx homeodomain protein. See
Chappell et al., PNAS 2004 101:9590-9594, incorporated herein by
reference in its entirety.
[0507] In another non-limiting example, the TEE comprises a TEE
having one or more of the sequences of SEQ ID NOs: 1-35 in
US2009/0226470, US2013/0177581, and WO2009/075886; SEQ ID NOs: 1-5
and 7-645 in WO2012/009644; and SEQ ID NO: 1 WO1999/024595, U.S.
Pat. No. 6,310,197, and U.S. Pat. No. 6,849,405; the contents of
each of which are incorporated herein by reference in their
entirety.
[0508] In some embodiments, the TEE is an internal ribosome entry
site (IRES), HCV-IRES, or an IRES element such as, but not limited
to, those described in: U.S. Pat. No. 7,468,275, US2007/0048776,
US2011/0124100, WO2007/025008, and WO2001/055369; the contents of
each of which re incorporated herein by reference in their
entirety. The IRES elements can include, but are not limited to,
the Gtx sequences (e.g., Gtx9-nt, Gtx8-nt, Gtx7-nt) as described by
Chappell et al., PNAS 2004 101:9590-9594, Zhou et al., PNAS 2005
102:6273-6278, US2007/0048776, US2011/0124100, and WO2007/025008;
the contents of each of which are incorporated herein by reference
in their entirety.
[0509] "Translational enhancer polynucleotide" or "translation
enhancer polynucleotide sequence" refer to a polynucleotide that
includes one or more of the TEE provided herein and/or known in the
art (see. e.g., U.S. Pat. No. 6,310,197, U.S. Pat. No. 6,849,405,
U.S. Pat. No. 7,456,273, U.S. Pat. No. 7,183,395, US2009/0226470,
US2007/0048776, US2011/0124100, US2009/0093049, US2013/0177581,
WO2009/075886, WO2007/025008, WO2012/009644, WO2001/055371,
WO1999/024595, EP2610341A1, and EP2610340A1; the contents of each
of which are incorporated herein by reference in their entirety),
or their variants, homologs, or functional derivatives. In some
embodiments, the polynucleotide of the disclosure comprises one or
multiple copies of a TEE. The TEE in a translational enhancer
polynucleotide can be organized in one or more sequence segments. A
sequence segment can harbor one or more of the TEEs provided
herein, with each TEE being present in one or more copies. When
multiple sequence segments are present in a translational enhancer
polynucleotide, they can be homogenous or heterogeneous. Thus, the
multiple sequence segments in a translational enhancer
polynucleotide can harbor identical or different types of the TEE
provided herein, identical or different number of copies of each of
the TEE, and/or identical or different organization of the TEE
within each sequence segment. In one embodiment, the polynucleotide
of the disclosure comprises a translational enhancer polynucleotide
sequence.
[0510] In some embodiments, a 5'UTR and/or 3'UTR of a
polynucleotide of the disclosure comprises at least one TEE or
portion thereof that is disclosed in: WO1999/024595, WO2012/009644,
WO2009/075886, WO2007/025008, WO1999/024595, WO2001/055371,
EP2610341A1, EP2610340A1, U.S. Pat. No. 6,310,197, U.S. Pat. No.
6,849,405, U.S. Pat. No. 7,456,273, U.S. Pat. No. 7,183,395,
US2009/0226470, US2011/0124100, US2007/0048776, US2009/0093049, or
US2013/0177581, the contents of each are incorporated herein by
reference in their entirety.
[0511] In some embodiments, a 5'UTR and/or 3'UTR of a
polynucleotide of the disclosure comprises a TEE that is at least
5%, at least 10%, at least 15%, at least 20%, at least 25%, at
least 30%, at least 35%, at least 40%, at least 45%, at least 50%,
at least 55%, at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
identical to a TEE disclosed in: US2009/0226470, US2007/0048776,
US2013/0177581, US2011/0124100, WO1999/024595, WO2012/009644,
WO2009/075886, WO2007/025008, EP2610341A1, EP2610340A1, U.S. Pat.
No. 6,310,197, U.S. Pat. No. 6,849,405, U.S. Pat. No. 7,456,273,
U.S. Pat. No. 7,183,395, Chappell et al., PNAS 2004 101:9590-9594,
Zhou et al., PNAS 2005 102:6273-6278, and Supplemental Table 1 and
in Supplemental Table 2 of Wellensiek et al., "Genome-wide
profiling of human cap-independent translation-enhancing elements,"
Nature Methods 2013, DOI:10.1038/NMETH.2522; the contents of each
of which are incorporated herein by reference in their
entirety.
[0512] In some embodiments, a 5'UTR and/or 3'UTR of a
polynucleotide of the disclosure comprises a TEE which is selected
from a 5-30 nucleotide fragment, a 5-25 nucleotide fragment, a 5-20
nucleotide fragment, a 5-15 nucleotide fragment, or a 5-10
nucleotide fragment (including a fragment of 5, 6, 7, 8, 9, 10, 11,
12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
29, or 30 nucleotides) of a TEE sequence disclosed in:
US2009/0226470, US2007/0048776, US2013/0177581, US2011/0124100,
WO1999/024595, WO2012/009644, WO2009/075886, WO2007/025008,
EP2610341A1, EP2610340A1, U.S. Pat. No. 6,310,197, U.S. Pat. No.
6,849,405, U.S. Pat. No. 7,456,273, U.S. Pat. No. 7,183,395,
Chappell et al., PNAS 2004 101:9590-9594, Zhou et al., PNAS 2005
102:6273-6278, and Supplemental Table 1 and in Supplemental Table 2
of Wellensiek et al., "Genome-wide profiling of human
cap-independent translation-enhancing elements," Nature Methods
2013, DOI:10.1038/NMETH.2522.
[0513] In some embodiments, a 5'UTR and/or 3'UTR of a
polynucleotide of the disclosure comprises a TEE which is a
transcription regulatory element described in any of U.S. Pat. No.
7,456,273, U.S. Pat. No. 7,183,395, US2009/0093049, and
WO2001/055371, the contents of each of which are incorporated
herein by reference in their entirety. The transcription regulatory
elements can be identified by methods known in the art, such as,
but not limited to, the methods described in U.S. Pat. No.
7,456,273, U.S. Pat. No. 7,183,395, US2009/0093049, and
WO2001/055371.
[0514] In some embodiments, a 5'UTR and/or 3'UTR comprising at
least one TEE described herein can be incorporated in a
monocistronic sequence such as, but not limited to, a vector system
or a nucleic acid vector. As non-limiting examples, the vector
systems and nucleic acid vectors can include those described in
U.S. Pat. No. 7,456,273, U.S. Pat. No. 7,183,395, US2007/0048776,
US2009/0093049, US2011/0124100, WO2007/025008, and
WO2001/055371.
[0515] In some embodiments, a 5'UTR and/or 3'UTR of a
polynucleotide of the disclosure comprises a TEE or portion thereof
described herein. In some embodiments, the TEEs in the 3'UTR can be
the same and/or different from the TEE located in the 5'UTR.
[0516] In some embodiments, a 5'UTR and/or 3'UTR of a
polynucleotide of the disclosure can include at least 1, at least
2, at least 3, at least 4, at least 5, at least 6, at least 7, at
least 8, at least 9, at least 10, at least 11, at least 12, at
least 13, at least 14, at least 15, at least 16, at least 17, at
least 18 at least 19, at least 20, at least 21, at least 22, at
least 23, at least 24, at least 25, at least 30, at least 35, at
least 40, at least 45, at least 50, at least 55 or more than 60 TEE
sequences. In one embodiment, the 5'UTR of a polynucleotide of the
disclosure can include 1-60, 1-55, 1-50, 1-45, 1-40, 1-35, 1-30,
1-25, 1-20, 1-15, 1-10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 TEE sequences.
The TEE sequences in the 5'UTR of the polynucleotide of the
disclosure can be the same or different TEE sequences. A
combination of different TEE sequences in the 5'UTR of the
polynucleotide of the disclosure can include combinations in which
more than one copy of any of the different TEE sequences are
incorporated. The TEE sequences can be in a pattern such as ABABAB
or AABBAABBAABB or ABCABCABC or variants thereof repeated one, two,
three, or more than three times. In these patterns, each letter, A,
B, or C represent a different TEE nucleotide sequence.
[0517] In some embodiments, the TEE can be identified by the
methods described in US2007/0048776, US2011/0124100, WO2007/025008,
WO2012/009644, the contents of each of which are incorporated
herein by reference in their entirety.
[0518] In some embodiments, the 5'UTR and/or 3'UTR comprises a
spacer to separate two TEE sequences. As a non-limiting example,
the spacer can be a 15 nucleotide spacer and/or other spacers known
in the art. As another non-limiting example, the 5'UTR and/or 3'UTR
comprises a TEE sequence-spacer module repeated at least once, at
least twice, at least 3 times, at least 4 times, at least 5 times,
at least 6 times, at least 7 times, at least 8 times, at least 9
times, at least 10 times, or more than 10 times in the 5'UTR and/or
3'UTR, respectively. In some embodiments, the 5'UTR and/or 3'UTR
comprises a TEE sequence-spacer module repeated 1, 2, 3, 4, 5, 6,
7, 8, 9, or 10 times.
[0519] In some embodiments, the spacer separating two TEE sequences
can include other sequences known in the art that can regulate the
translation of the polynucleotide of the disclosure, e.g., miR
sequences described herein (e.g., miR binding sites and miR seeds).
As a non-limiting example, each spacer used to separate two TEE
sequences can include a different miR sequence or component of a
miR sequence (e.g., miR seed sequence).
[0520] In some embodiments, a polynucleotide of the disclosure
comprises a miR and/or TEE sequence. In some embodiments, the
incorporation of a miR sequence and/or a TEE sequence into a
polynucleotide of the disclosure can change the shape of the stem
loop region, which can increase and/or decrease translation. See
e.g., Kedde et al., Nature Cell Biology 2010 12(10):1014-20, herein
incorporated by reference in its entirety).
Sensor Sequences and MicroRNA (miRNA) Binding Sites
[0521] Polynucleotides of the disclosure can include regulatory
elements, for example, microRNA (miRNA) binding sites,
transcription factor binding sites, structured mRNA sequences
and/or motifs, artificial binding sites engineered to act as
pseudo-receptors for endogenous nucleic acid binding molecules, and
combinations thereof. In some embodiments, polynucleotides
including such regulatory elements are referred to as including
"sensor sequences". Non-limiting examples of sensor sequences are
described in U.S. Publication 2014/0200261, the contents of which
are incorporated herein by reference in their entirety.
[0522] In some embodiments, a polynucleotide (e.g., a ribonucleic
acid (RNA), e.g., a messenger RNA (mRNA)) of the disclosure
comprises an open reading frame (ORF) encoding a polypeptide of
interest and further comprises one or more miRNA binding site(s).
Inclusion or incorporation of miRNA binding site(s) provides for
regulation of polynucleotides of the disclosure, and in turn, of
the polypeptides encoded therefrom, based on tissue-specific and/or
cell-type specific expression of naturally-occurring miRNAs.
[0523] A miRNA, e.g., a natural-occurring miRNA, is a 19-25
nucleotide long noncoding RNA that binds to a polynucleotide and
down-regulates gene expression either by reducing stability or by
inhibiting translation of the polynucleotide. A miRNA sequence
comprises a "seed" region, i.e., a sequence in the region of
positions 2-8 of the mature miRNA. A miRNA seed can comprise
positions 2-8 or 2-7 of the mature miRNA. In some embodiments, a
miRNA seed can comprise 7 nucleotides (e.g., nucleotides 2-8 of the
mature miRNA), wherein the seed-complementary site in the
corresponding miRNA binding site is flanked by an adenosine (A)
opposed to miRNA position 1. In some embodiments, a miRNA seed can
comprise 6 nucleotides (e.g., nucleotides 2-7 of the mature miRNA),
wherein the seed-complementary site in the corresponding miRNA
binding site is flanked by an adenosine (A) opposed to miRNA
position 1. See, for example, Grimson A, Farh K K, Johnston W K,
Garrett-Engele P, Lim L P, Bartel D P; Mol Cell. 2007 Jul. 6;
27(1):91-105. miRNA profiling of the target cells or tissues can be
conducted to determine the presence or absence of miRNA in the
cells or tissues. In some embodiments, a polynucleotide (e.g., a
ribonucleic acid (RNA), e.g., a messenger RNA (mRNA)) of the
disclosure comprises one or more microRNA binding sites, microRNA
target sequences, microRNA complementary sequences, or microRNA
seed complementary sequences. Such sequences can correspond to,
e.g., have complementarity to, any known microRNA such as those
taught in US Publication US2005/0261218 and US Publication
US2005/0059005, the contents of each of which are incorporated
herein by reference in their entirety.
[0524] As used herein, the term "microRNA (miRNA or miR) binding
site" refers to a sequence within a polynucleotide, e.g., within a
DNA or within an RNA transcript, including in the 5'UTR and/or
3'UTR, that has sufficient complementarity to all or a region of a
miRNA to interact with, associate with or bind to the miRNA. In
some embodiments, a polynucleotide of the disclosure comprising an
ORF encoding a polypeptide of interest and further comprises one or
more miRNA binding site(s). In exemplary embodiments, a 5'UTR
and/or 3'UTR of the polynucleotide (e.g., a ribonucleic acid (RNA),
e.g., a messenger RNA (mRNA)) comprises the one or more miRNA
binding site(s).
[0525] A miRNA binding site having sufficient complementarity to a
miRNA refers to a degree of complementarity sufficient to
facilitate miRNA-mediated regulation of a polynucleotide, e.g.,
miRNA-mediated translational repression or degradation of the
polynucleotide. In exemplary aspects of the disclosure, a miRNA
binding site having sufficient complementarity to the miRNA refers
to a degree of complementarity sufficient to facilitate
miRNA-mediated degradation of the polynucleotide, e.g.,
miRNA-guided RNA-induced silencing complex (RISC)-mediated cleavage
of mRNA. The miRNA binding site can have complementarity to, for
example, a 19-25 nucleotide miRNA sequence, to a 19-23 nucleotide
miRNA sequence, or to a 22 nucleotide miRNA sequence. A miRNA
binding site can be complementary to only a portion of a miRNA,
e.g., to a portion less than 1, 2, 3, or 4 nucleotides of the full
length of a naturally-occurring miRNA sequence. Full or complete
complementarity (e.g., full complementarity or complete
complementarity over all or a significant portion of the length of
a naturally-occurring miRNA) is preferred when the desired
regulation is mRNA degradation.
[0526] In some embodiments, a miRNA binding site includes a
sequence that has complementarity (e.g., partial or complete
complementarity) with an miRNA seed sequence. In some embodiments,
the miRNA binding site includes a sequence that has complete
complementarity with a miRNA seed sequence. In some embodiments, a
miRNA binding site includes a sequence that has complementarity
(e.g., partial or complete complementarity) with an miRNA sequence.
In some embodiments, the miRNA binding site includes a sequence
that has complete complementarity with a miRNA sequence. In some
embodiments, a miRNA binding site has complete complementarity with
a miRNA sequence but for 1, 2, or 3 nucleotide substitutions,
terminal additions, and/or truncations.
[0527] In some embodiments, the miRNA binding site is the same
length as the corresponding miRNA. In other embodiments, the miRNA
binding site is one, two, three, four, five, six, seven, eight,
nine, ten, eleven or twelve nucleotide(s) shorter than the
corresponding miRNA at the 5' terminus, the 3' terminus, or both.
In still other embodiments, the microRNA binding site is two
nucleotides shorter than the corresponding microRNA at the 5'
terminus, the 3' terminus, or both. The miRNA binding sites that
are shorter than the corresponding miRNAs are still capable of
degrading the mRNA incorporating one or more of the miRNA binding
sites or preventing the mRNA from translation.
[0528] In some embodiments, the miRNA binding site binds the
corresponding mature miRNA that is part of an active RISC
containing Dicer. In another embodiment, binding of the miRNA
binding site to the corresponding miRNA in RISC degrades the mRNA
containing the miRNA binding site or prevents the mRNA from being
translated. In some embodiments, the miRNA binding site has
sufficient complementarity to miRNA so that a RISC complex
comprising the miRNA cleaves the polynucleotide comprising the
miRNA binding site. In other embodiments, the miRNA binding site
has imperfect complementarity so that a RISC complex comprising the
miRNA induces instability in the polynucleotide comprising the
miRNA binding site. In another embodiment, the miRNA binding site
has imperfect complementarity so that a RISC complex comprising the
miRNA represses transcription of the polynucleotide comprising the
miRNA binding site.
[0529] In some embodiments, the miRNA binding site has one, two,
three, four, five, six, seven, eight, nine, ten, eleven or twelve
mismatch(es) from the corresponding miRNA.
[0530] In some embodiments, the miRNA binding site has at least
about ten, at least about eleven, at least about twelve, at least
about thirteen, at least about fourteen, at least about fifteen, at
least about sixteen, at least about seventeen, at least about
eighteen, at least about nineteen, at least about twenty, or at
least about twenty-one contiguous nucleotides complementary to at
least about ten, at least about eleven, at least about twelve, at
least about thirteen, at least about fourteen, at least about
fifteen, at least about sixteen, at least about seventeen, at least
about eighteen, at least about nineteen, at least about twenty, or
at least about twenty-one, respectively, contiguous nucleotides of
the corresponding miRNA.
[0531] By engineering one or more miRNA binding sites into a
polynucleotide of the disclosure, the polynucleotide can be
targeted for degradation or reduced translation, provided the miRNA
in question is available. This can reduce off-target effects upon
delivery of the polynucleotide. For example, if a polynucleotide of
the disclosure is not intended to be delivered to a tissue or cell
but ends up is said tissue or cell, then a miRNA abundant in the
tissue or cell can inhibit the expression of the gene of interest
if one or multiple binding sites of the miRNA are engineered into
the 5'UTR and/or 3'UTR of the polynucleotide.
[0532] Conversely, miRNA binding sites can be removed from
polynucleotide sequences in which they naturally occur in order to
increase protein expression in specific tissues. For example, a
binding site for a specific miRNA can be removed from a
polynucleotide to improve protein expression in tissues or cells
containing the miRNA.
[0533] In one embodiment, a polynucleotide of the disclosure can
include at least one miRNA-binding site in the 5'UTR and/or 3 'UTR
in order to regulate cytotoxic or cytoprotective mRNA therapeutics
to specific cells such as, but not limited to, normal and/or
cancerous cells. In another embodiment, a polynucleotide of the
disclosure can include two, three, four, five, six, seven, eight,
nine, ten, or more miRNA-binding sites in the 5'-UTR and/or 3 '-UTR
in order to regulate cytotoxic or cytoprotective mRNA therapeutics
to specific cells such as, but not limited to, normal and/or
cancerous cells.
[0534] Regulation of expression in multiple tissues can be
accomplished through introduction or removal of one or more miRNA
binding sites, e.g., one or more distinct miRNA binding sites. The
decision whether to remove or insert a miRNA binding site can be
made based on miRNA expression patterns and/or their profilings in
tissues and/or cells in development and/or disease. Identification
of miRNAs, miRNA binding sites, and their expression patterns and
role in biology have been reported (e.g., Bonauer et al., Curr Drug
Targets 2010 11:943-949; Anand and Cheresh Curr Opin Hematol 2011
18:171-176; Contreras and Rao Leukemia 2012 26:404-413 (2011 Dec.
20. doi: 10.1038/1eu.2011.356); Bartel Cell 2009 136:215-233;
Landgraf et al, Cell, 2007 129:1401-1414; Gentner and Naldini,
Tissue Antigens. 2012 80:393-403 and all references therein; each
of which is incorporated herein by reference in its entirety).
[0535] miRNAs and miRNA binding sites can correspond to any known
sequence, including non-limiting examples described in U.S.
Publication Nos. 2014/0200261, 2005/0261218, and 2005/0059005, each
of which are incorporated herein by reference in their
entirety.
[0536] Examples of tissues where miRNA are known to regulate mRNA,
and thereby protein expression, include, but are not limited to,
liver (miR-122), muscle (miR-133, miR-206, miR-208), endothelial
cells (miR-17-92, miR-126), myeloid cells (miR-142-3p, miR-142-5p,
miR-16, miR-21, miR-223, miR-24, miR-27), adipose tissue (let-7,
miR-30c), heart (miR-1d, miR-149), kidney (miR-192, miR-194,
miR-204), and lung epithelial cells (let-7, miR-133, miR-126).
[0537] Specifically, miRNAs are known to be differentially
expressed in immune cells (also called hematopoietic cells), such
as antigen presenting cells (APCs) (e.g., dendritic cells and
macrophages), macrophages, monocytes, B lymphocytes, T lymphocytes,
granulocytes, natural killer cells, etc. Immune cell specific
miRNAs are involved in immunogenicity, autoimmunity, the
immune-response to infection, inflammation, as well as unwanted
immune response after gene therapy and tissue/organ
transplantation. Immune cells specific miRNAs also regulate many
aspects of development, proliferation, differentiation and
apoptosis of hematopoietic cells (immune cells). For example,
miR-142 and miR-146 are exclusively expressed in immune cells,
particularly abundant in myeloid dendritic cells. It has been
demonstrated that the immune response to a polynucleotide can be
shut-off by adding miR-142 binding sites to the 3'-UTR of the
polynucleotide, enabling more stable gene transfer in tissues and
cells. miR-142 efficiently degrades exogenous polynucleotides in
antigen presenting cells and suppresses cytotoxic elimination of
transduced cells (e.g., Annoni A et al., blood, 2009, 114,
5152-5161; Brown B D, et al., Nat med. 2006, 12(5), 585-591; Brown
B D, et al., blood, 2007, 110(13): 4144-4152, each of which is
incorporated herein by reference in its entirety).
[0538] An antigen-mediated immune response can refer to an immune
response triggered by foreign antigens, which, when entering an
organism, are processed by the antigen presenting cells and
displayed on the surface of the antigen presenting cells. T cells
can recognize the presented antigen and induce a cytotoxic
elimination of cells that express the antigen.
[0539] Introducing a miR-142 binding site into the 5'UTR and/or
3'UTR of a polynucleotide of the disclosure can selectively repress
gene expression in antigen presenting cells through miR-142
mediated degradation, limiting antigen presentation in antigen
presenting cells (e.g., dendritic cells) and thereby preventing
antigen-mediated immune response after the delivery of the
polynucleotide. The polynucleotide is then stably expressed in
target tissues or cells without triggering cytotoxic
elimination.
[0540] In one embodiment, binding sites for miRNAs that are known
to be expressed in immune cells, in particular, antigen presenting
cells, can be engineered into a polynucleotide of the disclosure to
suppress the expression of the polynucleotide in antigen presenting
cells through miRNA mediated RNA degradation, subduing the
antigen-mediated immune response. Expression of the polynucleotide
is maintained in non-immune cells where the immune cell specific
miRNAs are not expressed. For example, in some embodiments, to
prevent an immunogenic reaction against a liver specific protein,
any miR-122 binding site can be removed and a miR-142 (and/or
mirR-146) binding site can be engineered into the 5'UTR and/or
3'UTR of a polynucleotide of the disclosure.
[0541] To further drive the selective degradation and suppression
in APCs and macrophage, a polynucleotide of the disclosure can
include a further negative regulatory element in the 5'UTR and/or
3'UTR, either alone or in combination with miR-142 and/or miR-146
binding sites. As a non-limiting example, the further negative
regulatory element is a Constitutive Decay Element (CDE).
[0542] Immune cell specific miRNAs include, but are not limited to,
hsa-let-7a-2-3p, hsa-let-7a-3p, hsa-7a-5p, hsa-let-7c,
hsa-let-7e-3p, hsa-let-7e-5p, hsa-let-7g-3p, hsa-let-7g-5p,
hsa-let-7i-3p, hsa-let-7i-5p, miR-10a-3p, miR-10a-5p, miR-1184,
hsa-let-7f-1-3p, hsa-let-7f-2-5p, hsa-let-7f-5p, miR-125b-1-3p,
miR-125b-2-3p, miR-125b-5p, miR-1279, miR-130a-3p, miR-130a-5p,
miR-132-3p, miR-132-5p, miR-142-3p, miR-142-5p, miR-143-3p,
miR-143-5p, miR-146a-3p, miR-146a-5p, miR-146b-3p, miR-146b-5p,
miR-147a, miR-147b, miR-148a-5p, miR-148a-3p, miR-150-3p,
miR-150-5p, miR-151b, miR-155-3p, miR-155-5p, miR-15a-3p,
miR-15a-5p, miR-15b-5p, miR-15b-3p, miR-16-1-3p, miR-16-2-3p,
miR-16-5p, miR-17-5p, miR-181a-3p, miR-181a-5p, miR-181a-2-3p,
miR-182-3p, miR-182-5p, miR-197-3p, miR-197-5p, miR-21-5p,
miR-21-3p, miR-214-3p, miR-214-5p, miR-223-3p, miR-223-5p,
miR-221-3p, miR-221-5p, miR-23b-3p, miR-23b-5p,
miR-24-1-5p,miR-24-2-5p, miR-24-3p, miR-26a-1-3p, miR-26a-2-3p,
miR-26a-5p, miR-26b-3p, miR-26b-5p, miR-27a-3p, miR-27a-5p,
miR-27b-3p,miR-27b-5p, miR-28-3p, miR-28-5p, miR-2909, miR-29a-3p,
miR-29a-5p, miR-29b-1-5p, miR-29b-2-5p, miR-29c-3p, miR-29c-5p,
miR-30e-3p, miR-30e-5p, miR-331-5p, miR-339-3p, miR-339-5p,
miR-345-3p, miR-345-5p, miR-346, miR-34a-3p, miR-34a-5p,
miR-363-3p, miR-363-5p, miR-372, miR-377-3p, miR-377-5p,
miR-493-3p, miR-493-5p, miR-542, miR-548b-5p, miR548c-5p, miR-548i,
miR-548j, miR-548n, miR-574-3p, miR-598, miR-718, miR-935,
miR-99a-3p, miR-99a-5p, miR-99b-3p, and miR-99b-5p. Furthermore,
novel miRNAs can be identified in immune cell through micro-array
hybridization and microtome analysis (e.g., Jima D D et al, Blood,
2010, 116:e118-e127; Vaz C et al., BMC Genomics, 2010, 11,288, the
content of each of which is incorporated herein by reference in its
entirety.)
[0543] miRNAs that are known to be expressed in the liver include,
but are not limited to, miR-107, miR-122-3p, miR-122-5p,
miR-1228-3p, miR-1228-5p, miR-1249, miR-129-5p, miR-1303,
miR-151a-3p, miR-151a-5p, miR-152, miR-194-3p, miR-194-5p,
miR-199a-3p, miR-199a-5p, miR-199b-3p, miR-199b-5p, miR-296-5p,
miR-557, miR-581, miR-939-3p, and miR-939-5p. MiRNA binding sites
from any liver specific miRNA can be introduced to or removed from
a polynucleotide of the disclosure to regulate expression of the
polynucleotide in the liver. Liver specific miRNA binding sites can
be engineered alone or further in combination with immune cell
(e.g., APC) miRNA binding sites in a polynucleotide of the
disclosure.
[0544] miRNAs that are known to be expressed in the lung include,
but are not limited to, let-7a-2-3p, let-7a-3p, let-7a-5p,
miR-126-3p, miR-126-5p, miR-127-3p, miR-127-5p, miR-130a-3p,
miR-130a-5p, miR-130b-3p, miR-130b-5p, miR-133a, miR-133b, miR-134,
miR-18a-3p, miR-18a-5p, miR-18b-3p, miR-18b-5p, miR-24-1-5p,
miR-24-2-5p, miR-24-3p, miR-296-3p, miR-296-5p, miR-32-3p,
miR-337-3p, miR-337-5p, miR-381-3p, and miR-381-5p. miRNA binding
sites from any lung specific miRNA can be introduced to or removed
from a polynucleotide of the disclosure to regulate expression of
the polynucleotide in the lung. Lung specific miRNA binding sites
can be engineered alone or further in combination with immune cell
(e.g., APC) miRNA binding sites in a polynucleotide of the
disclosure.
[0545] miRNAs that are known to be expressed in the heart include,
but are not limited to, miR-1, miR-133a, miR-133b, miR-149-3p,
miR-149-5p, miR-186-3p, miR-186-5p, miR-208a, miR-208b, miR-210,
miR-296-3p, miR-320, miR-451a, miR-451b, miR-499a-3p, miR-499a-5p,
miR-499b-3p, miR-499b-5p, miR-744-3p, miR-744-5p, miR-92b-3p, and
miR-92b-5p. mMiRNA binding sites from any heart specific microRNA
can be introduced to or removed from a polynucleotide of the
disclosure to regulate expression of the polynucleotide in the
heart. Heart specific miRNA binding sites can be engineered alone
or further in combination with immune cell (e.g., APC) miRNA
binding sites in a polynucleotide of the disclosure.
[0546] miRNAs that are known to be expressed in the nervous system
include, but are not limited to, miR-124-5p, miR-125a-3p,
miR-125a-5p, miR-125b-1-3p, miR-125b-2-3p, miR-125b-5p,miR-1271-3p,
miR-1271-5p, miR-128, miR-132-5p, miR-135a-3p, miR-135a-5p,
miR-135b-3p, miR-135b-5p, miR-137, miR-139-5p, miR-139-3p,
miR-149-3p, miR-149-5p, miR-153, miR-181c-3p, miR-181c-5p,
miR-183-3p, miR-183-5p, miR-190a, miR-190b, miR-212-3p, miR-212-5p,
miR-219-1-3p, miR-219-2-3p, miR-23a-3p, miR-23a-5p,miR-30a-5p,
miR-30b-3p, miR-30b-5p, miR-30c-1-3p, miR-30c-2-3p, miR-30c-5p,
miR-30d-3p, miR-30d-5p, miR-329, miR-342-3p, miR-3665, miR-3666,
miR-380-3p, miR-380-5p, miR-383, miR-410, miR-425-3p, miR-425-5p,
miR-454-3p, miR-454-5p, miR-483, miR-510, miR-516a-3p, miR-548b-5p,
miR-548c-5p, miR-571, miR-7-1-3p, miR-7-2-3p, miR-7-5p, miR-802,
miR-922, miR-9-3p, and miR-9-5p. miRNAs enriched in the nervous
system further include those specifically expressed in neurons,
including, but not limited to, miR-132-3p, miR-132-3p, miR-148b-3p,
miR-148b-5p, miR-151a-3p, miR-151a-5p, miR-212-3p, miR-212-5p,
miR-320b, miR-320e, miR-323a-3p, miR-323a-5p, miR-324-5p, miR-325,
miR-326, miR-328, miR-922 and those specifically expressed in glial
cells, including, but not limited to, miR-1250, miR-219-1-3p,
miR-219-2-3p, miR-219-5p, miR-23a-3p, miR-23a-5p, miR-3065-3p,
miR-3065-5p, miR-30e-3p, miR-30e-5p, miR-32-5p, miR-338-5p, and
miR-657. miRNA binding sites from any CNS specific miRNA can be
introduced to or removed from a polynucleotide of the disclosure to
regulate expression of the polynucleotide in the nervous system.
Nervous system specific miRNA binding sites can be engineered alone
or further in combination with immune cell (e.g., APC) miRNA
binding sites in a polynucleotide of the disclosure.
[0547] miRNAs that are known to be expressed in the pancreas
include, but are not limited to, miR-105-3p, miR-105-5p, miR-184,
miR-195-3p, miR-195-5p, miR-196a-3p, miR-196a-5p, miR-214-3p,
miR-214-5p, miR-216a-3p, miR-216a-5p, miR-30a-3p, miR-33a-3p,
miR-33a-5p, miR-375, miR-7-1-3p, miR-7-2-3p, miR-493-3p,
miR-493-5p, and miR-944. MiRNA binding sites from any pancreas
specific miRNA can be introduced to or removed from a
polynucleotide of the disclosure to regulate expression of the
polynucleotide in the pancreas. Pancreas specific miRNA binding
sites can be engineered alone or further in combination with immune
cell (e.g. APC) miRNA binding sites in a polynucleotide of the
disclosure.
[0548] miRNAs that are known to be expressed in the kidney include,
but are not limited to, miR-122-3p, miR-145-5p, miR-17-5p,
miR-192-3p, miR-192-5p, miR-194-3p, miR-194-5p, miR-20a-3p,
miR-20a-5p, miR-204-3p, miR-204-5p, miR-210, miR-216a-3p,
miR-216a-5p, miR-296-3p, miR-30a-3p, miR-30a-5p, miR-30b-3p,
miR-30b-5p, miR-30c-1-3p, miR-30c-2-3p, miR30c-5p, miR-324-3p,
miR-335-3p, miR-335-5p, miR-363-3p, miR-363-5p, and miR-562. miRNA
binding sites from any kidney specific miRNA can be introduced to
or removed from a polynucleotide of the disclosure to regulate
expression of the polynucleotide in the kidney. Kidney specific
miRNA binding sites can be engineered alone or further in
combination with immune cell (e.g., APC) miRNA binding sites in a
polynucleotide of the disclosure.
[0549] miRNAs that are known to be expressed in the muscle include,
but are not limited to, let-7g-3p, let-7g-5p, miR-1, miR-1286,
miR-133a, miR-133b, miR-140-3p, miR-143-3p, miR-143-5p, miR-145-3p,
miR-145-5p, miR-188-3p, miR-188-5p, miR-206, miR-208a, miR-208b,
miR-25-3p, and miR-25-5p. MiRNA binding sites from any muscle
specific miRNA can be introduced to or removed from a
polynucleotide of the disclosure to regulate expression of the
polynucleotide in the muscle. Muscle specific miRNA binding sites
can be engineered alone or further in combination with immune cell
(e.g., APC) miRNA binding sites in a polynucleotide of the
disclosure.
[0550] miRNAs are also differentially expressed in different types
of cells, such as, but not limited to, endothelial cells,
epithelial cells, and adipocytes.
[0551] miRNAs that are known to be expressed in endothelial cells
include, but are not limited to, let-7b-3p, let-7b-5p, miR-100-3p,
miR-100-5p, miR-101-3p, miR-101-5p, miR-126-3p, miR-126-5p,
miR-1236-3p, miR-1236-5p, miR-130a-3p, miR-130a-5p, miR-17-5p,
miR-17-3p, miR-18a-3p, miR-18a-5p, miR-19a-3p, miR-19a-5p,
miR-19b-1-5p, miR-19b-2-5p, miR-19b-3p, miR-20a-3p, miR-20a-5p,
miR-217, miR-210, miR-21-3p, miR-21-5p, miR-221-3p, miR-221-5p,
miR-222-3p, miR-222-5p, miR-23a-3p, miR-23a-5p, miR-296-5p,
miR-361-3p, miR-361-5p, miR-421, miR-424-3p, miR-424-5p,
miR-513a-5p, miR-92a-1-5p, miR-92a-2-5p, miR-92a-3p, miR-92b-3p,
and miR-92b-5p. Many novel miRNAs are discovered in endothelial
cells from deep-sequencing analysis (e.g., Voellenkle C et al.,
RNA, 2012, 18, 472-484, herein incorporated by reference in its
entirety). miRNA binding sites from any endothelial cell specific
miRNA can be introduced to or removed from a polynucleotide of the
disclosure to regulate expression of the polynucleotide in the
endothelial cells.
[0552] miRNAs that are known to be expressed in epithelial cells
include, but are not limited to, let-7b-3p, let-7b-5p, miR-1246,
miR-200a-3p, miR-200a-5p, miR-200b-3p, miR-200b-5p, miR-200c-3p,
miR-200c-5p, miR-338-3p, miR-429, miR-451a, miR-451b, miR-494,
miR-802 and miR-34a, miR-34b-5p, miR-34c-5p, miR-449a, miR-449b-3p,
miR-449b-5p specific in respiratory ciliated epithelial cells,
let-7 family, miR-133a, miR-133b, miR-126 specific in lung
epithelial cells, miR-382-3p, miR-382-5p specific in renal
epithelial cells, and miR-762 specific in corneal epithelial cells.
miRNA binding sites from any epithelial cell specific miRNA can be
introduced to or removed from a polynucleotide of the disclosure to
regulate expression of the polynucleotide in the epithelial
cells.
[0553] In addition, a large group of miRNAs are enriched in
embryonic stem cells, controlling stem cell self-renewal as well as
the development and/or differentiation of various cell lineages,
such as neural cells, cardiac, hematopoietic cells, skin cells,
osteogenic cells and muscle cells (e.g., Kuppusamy K T et al.,
Curr. Mol Med, 2013, 13(5), 757-764; Vidigal J A and Ventura A,
Semin Cancer Biol. 2012, 22(5-6), 428-436; Goff L A et al., PLoS
One, 2009, 4:e7192; Morin R D et al., Genome Res,2008,18, 610-621;
Yoo J K et al., Stem Cells Dev. 2012, 21(11), 2049-2057, each of
which is herein incorporated by reference in its entirety). MiRNAs
abundant in embryonic stem cells include, but are not limited to,
let-7a-2-3p, let-a-3p, let-7a-5p, let7d-3p, let-7d-5p,
miR-103a-2-3p, miR-103a-5p, miR-106b-3p, miR-106b-5p, miR-1246,
miR-1275, miR-138-1-3p, miR-138-2-3p, miR-138-5p, miR-154-3p,
miR-154-5p, miR-200c-3p, miR-200c-5p, miR-290, miR-301a-3p,
miR-301a-5p, miR-302a-3p, miR-302a-5p, miR-302b-3p, miR-302b-5p,
miR-302c-3p, miR-302c-5p, miR-302d-3p, miR-302d-5p, miR-302e,
miR-367-3p, miR-367-5p, miR-369-3p, miR-369-5p, miR-370, miR-371,
miR-373, miR-380-5p, miR-423-3p, miR-423-5p, miR-486-5p,
miR-520c-3p, miR-548e, miR-548f, miR-548g-3p, miR-548g-5p,
miR-548i, miR-548k, miR-5481, miR-548m, miR-548n, miR-5480-3p,
miR-5480-5p, miR-548p, miR-664a-3p, miR-664a-5p, miR-664b-3p,
miR-664b-5p, miR-766-3p, miR-766-5p, miR-885-3p,
miR-885-5p,miR-93-3p, miR-93-5p, miR-941, miR-96-3p, miR-96-5p,
miR-99b-3p and miR-99b-5p. Many predicted novel miRNAs are
discovered by deep sequencing in human embryonic stem cells (e.g.,
Morin R D et al., Genome Res, 2008,18, 610-621; Goff L A et al.,
PLoS One, 2009, 4:e7192; Bar M et al., Stem cells, 2008, 26,
2496-2505, the content of each of which is incorporated herein by
reference in its entirety).
[0554] In one embodiment, the binding sites of embryonic stem cell
specific miRNAs can be included in or removed from the 3'UTR of a
polynucleotide of the disclosure to modulate the development and/or
differentiation of embryonic stem cells, to inhibit the senescence
of stem cells in a degenerative condition (e.g. degenerative
diseases), or to stimulate the senescence and apoptosis of stem
cells in a disease condition (e.g. cancer stem cells).
[0555] Many miRNA expression studies are conducted to profile the
differential expression of miRNAs in various cancer cells/tissues
and other diseases. Some miRNAs are abnormally over-expressed in
certain cancer cells and others are under-expressed. For example,
miRNAs are differentially expressed in cancer cells (WO2008/154098,
US2013/0059015, US2013/0042333, WO2011/157294); cancer stem cells
(US2012/0053224); pancreatic cancers and diseases (US2009/0131348,
US2011/0171646, US2010/0286232, U.S. Pat. No. 8,389,210); asthma
and inflammation (U.S. Pat. No. 8,415,096); prostate cancer
(US2013/0053264); hepatocellular carcinoma (WO2012/151212,
US2012/0329672, WO2008/054828, U.S. Pat. No. 8,252,538); lung
cancer cells (WO2011/076143, WO2013/033640, WO2009/070653,
US2010/0323357); cutaneous T cell lymphoma (WO2013/011378);
colorectal cancer cells (WO2011/0281756, WO2011/076142); cancer
positive lymph nodes (WO2009/100430, US2009/0263803);
nasopharyngeal carcinoma (EP2112235); chronic obstructive pulmonary
disease (US2012/0264626, US2013/0053263); thyroid cancer
(WO2013/066678); ovarian cancer cells (US2012/0309645,
WO2011/095623); breast cancer cells (WO2008/154098, WO2007/081740,
US2012/0214699), leukemia and lymphoma (WO2008/073915,
US2009/0092974, US2012/0316081, US2012/0283310, WO2010/018563, the
content of each of which is incorporated herein by reference in its
entirety.)
[0556] As a non-limiting example, miRNA binding sites for miRNAs
that are over-expressed in certain cancer and/or tumor cells can be
removed from the 3'UTR of a polynucleotide of the disclosure,
restoring the expression suppressed by the over-expressed miRNAs in
cancer cells, thus ameliorating the corresponsive biological
function, for instance, transcription stimulation and/or
repression, cell cycle arrest, apoptosis and cell death. Normal
cells and tissues, wherein miRNAs expression is not up-regulated,
will remain unaffected.
[0557] miRNA can also regulate complex biological processes such as
angiogenesis (e.g., miR-132) (Anand and Cheresh Curr Opin Hematol
2011 18:171-176). In the polynucleotides of the disclosure, miRNA
binding sites that are involved in such processes can be removed or
introduced, in order to tailor the expression of the
polynucleotides to biologically relevant cell types or relevant
biological processes. In this context, the polynucleotides of the
disclosure are defined as auxotrophic polynucleotides.
[0558] In some embodiments, a polynucleotide of the disclosure
comprises a miRNA binding site, wherein the miRNA binding site
comprises one or more nucleotide sequences selected from Table 7,
including one or more copies of any one or more of the miRNA
binding site sequences. In some embodiments, a polynucleotide of
the disclosure further comprises at least one, two, three, four,
five, six, seven, eight, nine, ten, or more of the same or
different miRNA binding sites selected from Table 7, including any
combination thereof. In some embodiments, the miRNA binding site
binds to miR-142 or is complementary to miR-142. In some
embodiments, the miR-142 comprises SEQ ID NO: 720. In some
embodiments, the miRNA binding site binds to miR-142-3p or
miR-142-5p. In some embodiments, the miR-142-3p binding site
comprises SEQ ID NO: 721. In some embodiments, the miR-142-5p
binding site comprises SEQ ID NO: 723. In some embodiments, the
miRNA binding site comprises a nucleotide sequence at least 80%, at
least 85%, at least 90%, at least 95%, or 100% identical to SEQ ID
NO: 722 or SEQ ID NO: 724.
TABLE-US-00007 TABLE 7 miR-142 and miR-142 binding sites SEQ ID NO.
Description Sequence 720 miR-142 GACAGUGCAGUCACCCAUAAAGUAGAAAG
CACUACUAACAGCACUGGAGGGUGUAGUG UUUCCUACUUUAUGGAUGAGUGUACUGUG 721
miR-142-3p UGUAGUGUUUCCUACUUUAUGGA 722 miR-142-3p
UCCAUAAAGUAGGAAACACUACA binding site 723 miR-142-5p
CAUAAAGUAGAAAGCACUACU 724 miR-142-5p AGUAGUGCUUUCUACUUUAUG binding
site
[0559] In some embodiments, a miRNA binding site is inserted in the
polynucleotide of the disclosure in any position of the
polynucleotide (e.g., the 5'UTR and/or 3'UTR). In some embodiments,
the 5'UTR comprises a miRNA binding site. In some embodiments, the
3'UTR comprises a miRNA binding site. In some embodiments, the
5'UTR and the 3'UTR comprise a miRNA binding site. The insertion
site in the polynucleotide can be anywhere in the polynucleotide as
long as the insertion of the miRNA binding site in the
polynucleotide does not interfere with the translation of a
functional polypeptide in the absence of the corresponding miRNA;
and in the presence of the miRNA, the insertion of the miRNA
binding site in the polynucleotide and the binding of the miRNA
binding site to the corresponding miRNA are capable of degrading
the polynucleotide or preventing the translation of the
polynucleotide.
[0560] In some embodiments, a miRNA binding site is inserted in at
least about 30 nucleotides downstream from the stop codon of an ORF
in a polynucleotide of the disclosure comprising the ORF. In some
embodiments, a miRNA binding site is inserted in at least about 10
nucleotides, at least about 15 nucleotides, at least about 20
nucleotides, at least about 25 nucleotides, at least about 30
nucleotides, at least about 35 nucleotides, at least about 40
nucleotides, at least about 45 nucleotides, at least about 50
nucleotides, at least about 55 nucleotides, at least about 60
nucleotides, at least about 65 nucleotides, at least about 70
nucleotides, at least about 75 nucleotides, at least about 80
nucleotides, at least about 85 nucleotides, at least about 90
nucleotides, at least about 95 nucleotides, or at least about 100
nucleotides downstream from the stop codon of an ORF in a
polynucleotide of the disclosure. In some embodiments, a miRNA
binding site is inserted in about 10 nucleotides to about 100
nucleotides, about 20 nucleotides to about 90 nucleotides, about 30
nucleotides to about 80 nucleotides, about 40 nucleotides to about
70 nucleotides, about 50 nucleotides to about 60 nucleotides, about
45 nucleotides to about 65 nucleotides downstream from the stop
codon of an ORF in a polynucleotide of the disclosure.
[0561] miRNA gene regulation can be influenced by the sequence
surrounding the miRNA such as, but not limited to, the species of
the surrounding sequence, the type of sequence (e.g., heterologous,
homologous, exogenous, endogenous, or artificial), regulatory
elements in the surrounding sequence and/or structural elements in
the surrounding sequence. The miRNA can be influenced by the 5'UTR
and/or 3'UTR. As a non-limiting example, a non-human 3'UTR can
increase the regulatory effect of the miRNA sequence on the
expression of a polypeptide of interest compared to a human 3'UTR
of the same sequence type.
[0562] In one embodiment, other regulatory elements and/or
structural elements of the 5'UTR can influence miRNA mediated gene
regulation. One example of a regulatory element and/or structural
element is a structured IRES (Internal Ribosome Entry Site) in the
5'UTR, which is necessary for the binding of translational
elongation factors to initiate protein translation. EIF4A2 binding
to this secondarily structured element in the 5'-UTR is necessary
for miRNA mediated gene expression (Meijer H A et al., Science,
2013, 340, 82-85, herein incorporated by reference in its
entirety). The polynucleotides of the disclosure can further
include this structured 5'UTR in order to enhance microRNA mediated
gene regulation.
[0563] At least one miRNA binding site can be engineered into the
3'UTR of a polynucleotide of the disclosure. In this context, at
least two, at least three, at least four, at least five, at least
six, at least seven, at least eight, at least nine, at least ten,
or more miRNA binding sites can be engineered into a 3'UTR of a
polynucleotide of the disclosure. For example, 1 to 10, 1 to 9, 1
to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 2, or 1 miRNA binding
sites can be engineered into the 3'UTR of a polynucleotide of the
disclosure. In one embodiment, miRNA binding sites incorporated
into a polynucleotide of the disclosure can be the same or can be
different miRNA sites. A combination of different miRNA binding
sites incorporated into a polynucleotide of the disclosure can
include combinations in which more than one copy of any of the
different miRNA sites are incorporated. In another embodiment,
miRNA binding sites incorporated into a polynucleotide of the
disclosure can target the same or different tissues in the body. As
a non-limiting example, through the introduction of tissue-,
cell-type-, or disease-specific miRNA binding sites in the 3'-UTR
of a polynucleotide of the disclosure, the degree of expression in
specific cell types (e.g., hepatocytes, myeloid cells, endothelial
cells, cancer cells, etc.) can be reduced.
[0564] In one embodiment, a miRNA binding site can be engineered
near the 5' terminus of the 3'UTR, about halfway between the 5'
terminus and 3' terminus of the 3'UTR and/or near the 3' terminus
of the 3'UTR in a polynucleotide of the disclosure. As a
non-limiting example, a miRNA binding site can be engineered near
the 5' terminus of the 3'UTR and about halfway between the 5'
terminus and 3' terminus of the 3'UTR. As another non-limiting
example, a miRNA binding site can be engineered near the 3'
terminus of the 3'UTR and about halfway between the 5' terminus and
3' terminus of the 3'UTR. As yet another non-limiting example, a
miRNA binding site can be engineered near the 5' terminus of the
3'UTR and near the 3' terminus of the 3'UTR.
[0565] In another embodiment, a 3'UTR can comprise 1, 2, 3, 4, 5,
6, 7, 8, 9, or 10 miRNA binding sites. The miRNA binding sites can
be complementary to a miRNA, miRNA seed sequence, and/or miRNA
sequences flanking the seed sequence.
[0566] In one embodiment, a polynucleotide of the disclosure can be
engineered to include more than one miRNA site expressed in
different tissues or different cell types of a subject. As a
non-limiting example, a polynucleotide of the disclosure can be
engineered to include miR-192 and miR-122 to regulate expression of
the polynucleotide in the liver and kidneys of a subject. In
another embodiment, a polynucleotide of the disclosure can be
engineered to include more than one miRNA site for the same
tissue.
[0567] In some embodiments, the therapeutic window and or
differential expression associated with the polypeptide encoded by
a polynucleotide of the disclosure can be altered with a miRNA
binding site. For example, a polynucleotide encoding a polypeptide
that provides a death signal can be designed to be more highly
expressed in cancer cells by virtue of the miRNA signature of those
cells. Where a cancer cell expresses a lower level of a particular
miRNA, the polynucleotide encoding the binding site for that miRNA
(or miRNAs) would be more highly expressed. Hence, the polypeptide
that provides a death signal triggers or induces cell death in the
cancer cell. Neighboring noncancer cells, harboring a higher
expression of the same miRNA would be less affected by the encoded
death signal as the polynucleotide would be expressed at a lower
level due to the effects of the miRNA binding to the binding site
or "sensor" encoded in the 3'UTR. Conversely, cell survival or
cytoprotective signals can be delivered to tissues containing
cancer and non-cancerous cells where a miRNA has a higher
expression in the cancer cells--the result being a lower survival
signal to the cancer cell and a larger survival signal to the
normal cell. Multiple polynucleotides can be designed and
administered having different signals based on the use of miRNA
binding sites as described herein.
[0568] In some embodiments, the expression of a polynucleotide of
the disclosure can be controlled by incorporating at least one
sensor sequence in the polynucleotide and formulating the
polynucleotide for administration. As a non-limiting example, a
polynucleotide of the disclosure can be targeted to a tissue or
cell by incorporating a miRNA binding site and formulating the
polynucleotide in a lipid nanoparticle comprising a cationic lipid,
including any of the lipids described herein.
[0569] A polynucleotide of the disclosure can be engineered for
more targeted expression in specific tissues, cell types, or
biological conditions based on the expression patterns of miRNAs in
the different tissues, cell types, or biological conditions.
Through introduction of tissue-specific miRNA binding sites, a
polynucleotide of the disclosure can be designed for optimal
protein expression in a tissue or cell, or in the context of a
biological condition.
[0570] In some embodiments, a polynucleotide of the disclosure can
be designed to incorporate miRNA binding sites that either have
100% identity to known miRNA seed sequences or have less than 100%
identity to miRNA seed sequences. In some embodiments, a
polynucleotide of the disclosure can be designed to incorporate
miRNA binding sites that have at least: 60%, 65%, 70%, 75%, 80%,
85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to known miRNA seed
sequences. The miRNA seed sequence can be partially mutated to
decrease miRNA binding affinity and as such result in reduced
downmodulation of the polynucleotide. In essence, the degree of
match or mis-match between the miRNA binding site and the miRNA
seed can act as a rheostat to more finely tune the ability of the
miRNA to modulate protein expression. In addition, mutation in the
non-seed region of a miRNA binding site can also impact the ability
of a miRNA to modulate protein expression.
[0571] In one embodiment, a miRNA sequence can be incorporated into
the loop of a stem loop.
[0572] In another embodiment, a miRNA seed sequence can be
incorporated in the loop of a stem loop and a miRNA binding site
can be incorporated into the 5' or 3' stem of the stem loop.
[0573] In one embodiment, a translation enhancer element (TEE) can
be incorporated on the 5'end of the stem of a stem loop and a miRNA
seed can be incorporated into the stem of the stem loop. In another
embodiment, a TEE can be incorporated on the 5' end of the stem of
a stem loop, a miRNA seed can be incorporated into the stem of the
stem loop and a miRNA binding site can be incorporated into the 3'
end of the stem or the sequence after the stem loop. The miRNA seed
and the miRNA binding site can be for the same and/or different
miRNA sequences.
[0574] In one embodiment, the incorporation of a miRNA sequence
and/or a TEE sequence changes the shape of the stem loop region
which can increase and/or decrease translation. (see e.g, Kedde et
al., "A Pumilio-induced RNA structure switch in p27-3'UTR controls
miR-221 and miR-22 accessibility." Nature Cell Biology. 2010,
incorporated herein by reference in its entirety).
[0575] In one embodiment, the 5'-UTR of a polynucleotide of the
disclosure can comprise at least one miRNA sequence. The miRNA
sequence can be, but is not limited to, a 19 or 22 nucleotide
sequence and/or a miRNA sequence without the seed.
[0576] In one embodiment the miRNA sequence in the 5'UTR can be
used to stabilize a polynucleotide of the disclosure described
herein.
[0577] In another embodiment, a miRNA sequence in the 5'UTR of a
polynucleotide of the disclosure can be used to decrease the
accessibility of the site of translation initiation such as, but
not limited to a start codon. See, e.g., Matsuda et al., PLoS One.
2010 11(5):e15057; incorporated herein by reference in its
entirety, which used antisense locked nucleic acid (LNA)
oligonucleotides and exon-junction complexes (EJCs) around a start
codon (-4 to +37 where the A of the AUG codons is +1) in order to
decrease the accessibility to the first start codon (AUG). Matsuda
showed that altering the sequence around the start codon with an
LNA or EJC affected the efficiency, length and structural stability
of a polynucleotide. A polynucleotide of the disclosure can
comprise a miRNA sequence, instead of the LNA or EJC sequence
described by Matsuda et al, near the site of translation initiation
in order to decrease the accessibility to the site of translation
initiation. The site of translation initiation can be prior to,
after or within the miRNA sequence. As a non-limiting example, the
site of translation initiation can be located within a miRNA
sequence such as a seed sequence or binding site. As another
non-limiting example, the site of translation initiation can be
located within a miR-122 sequence such as the seed sequence or the
mir-122 binding site.
[0578] In some embodiments, a polynucleotide of the disclosure can
include at least one miRNA in order to dampen the antigen
presentation by antigen presenting cells. The miRNA can be the
complete miRNA sequence, the miRNA seed sequence, the miRNA
sequence without the seed, or a combination thereof. As a
non-limiting example, a miRNA incorporated into a polynucleotide of
the disclosure can be specific to the hematopoietic system. As
another non-limiting example, a miRNA incorporated into a
polynucleotide of the disclosure to dampen antigen presentation is
miR-142-3p.
[0579] In some embodiments, a polynucleotide of the disclosure can
include at least one miRNA in order to dampen expression of the
encoded polypeptide in a tissue or cell of interest. As a
non-limiting example, a polynucleotide of the disclosure can
include at least one miR-122 binding site in order to dampen
expression of an encoded polypeptide of interest in the liver. As
another non-limiting example a polynucleotide of the disclosure can
include at least one miR-142-3p binding site, miR-142-3p seed
sequence, miR-142-3p binding site without the seed, miR-142-5p
binding site, miR-142-5p seed sequence, miR-142-5p binding site
without the seed, miR-146 binding site, miR-146 seed sequence
and/or miR-146 binding site without the seed sequence.
[0580] In some embodiments, a polynucleotide of the disclosure can
comprise at least one miRNA binding site in the 3'UTR in order to
selectively degrade mRNA therapeutics in the immune cells to subdue
unwanted immunogenic reactions caused by therapeutic delivery. As a
non-limiting example, the miRNA binding site can make a
polynucleotide of the disclosure more unstable in antigen
presenting cells. Non-limiting examples of these miRNAs include
mir-142-5p, mir-142-3p, mir-146a-5p, and mir-146-3p.
[0581] In one embodiment, a polynucleotide of the disclosure
comprises at least one miRNA sequence in a region of the
polynucleotide that can interact with a RNA binding protein.
[0582] In some embodiments, the polynucleotide of the disclosure
(e.g., a RNA, e.g., a mRNA) comprising (i) a sequence-optimized
nucleotide sequence (e.g., an ORF) encoding a MCM polypeptide
(e.g., the wild-type sequence, functional fragment, or variant
thereof) and (ii) a miRNA binding site (e.g., a miRNA binding site
that binds to miR-142).
[0583] In some embodiments, the polynucleotide of the disclosure
comprises a uracil-modified sequence encoding a MCM polypeptide
disclosed herein and a miRNA binding site disclosed herein, e.g., a
miRNA binding site that binds to miR-142. In some embodiments, the
uracil-modified sequence encoding a MCM polypeptide comprises at
least one chemically modified nucleobase, e.g., 5-methoxyuracil. In
some embodiments, at least 95% of a type of nucleobase (e.g.,
uracil) in a uracil-modified sequence encoding a MCM polypeptide of
the disclosure are modified nucleobases. In some embodiments, at
least 95% of uracil in a uracil-modified sequence encoding a MCM
polypeptide is 5-methoxyuridine. In some embodiments, the
polynucleotide comprising a nucleotide sequence encoding a MCM
polypeptide disclosed herein and a miRNA binding site is formulated
with a delivery agent, e.g., a compound having the Formula (I),
e.g., any of Compounds 1-147.
3' UTR and the AU Rich Elements
[0584] The disclosure also includes a polynucleotide that comprises
both one or more 3' untranslated regions as well as the
polynucleotide described herein, i.e., a polynucleotide comprising
an ORF encoding an MCM polypeptide.
[0585] Natural or wild type 3' UTRs are known to have stretches of
Adenosines and Uridines embedded in them. These AU rich signatures
are particularly prevalent in genes with high rates of turnover.
Based on their sequence features and functional properties, the AU
rich elements (AREs) can be separated into three classes (Chen et
al, 1995): Class I AREs contain several dispersed copies of an
AUUUA motif within U-rich regions. C-Myc and MyoD contain class I
AREs. Class II AREs possess two or more overlapping
UUAUUUA(U/A)(U/A) nonamers. Molecules containing this type of AREs
include GM-CSF and TNF-a. Class III ARES are less well defined.
These U rich regions do not contain an AUUUA motif. c-Jun and
Myogenin are two well-studied examples of this class. Most proteins
binding to the AREs are known to destabilize the messenger, whereas
members of the ELAV family, most notably HuR, have been documented
to increase the stability of mRNA. HuR binds to AREs of all the
three classes. Engineering the HuR specific binding sites into the
3' UTR of nucleic acid molecules will lead to HuR binding and thus,
stabilization of the message in vivo.
[0586] Introduction, removal or modification of 3' UTR AU rich
elements (AREs) can be used to modulate the stability of
polynucleotides of the disclosure. When engineering specific
polynucleotides, one or more copies of an ARE can be introduced to
make polynucleotides of the disclosure less stable and thereby
curtail translation and decrease production of the resultant
protein. Likewise, AREs can be identified and removed or mutated to
increase the intracellular stability and thus increase translation
and production of the resultant protein. Transfection experiments
can be conducted in relevant cell lines, using polynucleotides of
the disclosure and protein production can be assayed at various
time points post-transfection. For example, cells can be
transfected with different ARE-engineering molecules and by using
an ELISA kit to the relevant protein and assaying protein produced
at 6 hour, 12 hour, 24 hour, 48 hour, and 7 days
post-transfection.
Regions having a 5' Cap
[0587] The disclosure also includes a polynucleotide that comprises
both a 5' Cap and the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0588] The 5' cap structure of a natural mRNA is involved in
nuclear export, increasing mRNA stability and binds the mRNA Cap
Binding Protein (CBP), which is responsible for mRNA stability in
the cell and translation competency through the association of CBP
with poly(A) binding protein to form the mature cyclic mRNA
species. The cap further assists the removal of 5' proximal introns
during mRNA splicing.
[0589] Endogenous mRNA molecules can be 5'-end capped generating a
5'-ppp-5'-triphosphate linkage between a terminal guanosine cap
residue and the 5'-terminal transcribed sense nucleotide of the
mRNA molecule. This 5'-guanylate cap can then be methylated to
generate an N7-methyl-guanylate residue. The ribose sugars of the
terminal and/or anteterminal transcribed nucleotides of the 5' end
of the mRNA can optionally also be 2'-O-methylated. 5'-decapping
through hydrolysis and cleavage of the guanylate cap structure can
target a nucleic acid molecule, such as an mRNA molecule, for
degradation.
[0590] In some embodiments, polynucleotides can be designed to
incorporate a cap moiety. Modifications to the polynucleotides of
the present disclosure can generate a non-hydrolyzable cap
structure preventing decapping and thus increasing mRNA half-life.
Because cap structure hydrolysis requires cleavage of 5'-ppp-5'
phosphorodiester linkages, modified nucleotides can be used during
the capping reaction. For example, a Vaccinia Capping Enzyme from
New England Biolabs (Ipswich, Mass.) can be used with
.alpha.-thio-guanosine nucleotides according to the manufacturer's
instructions to create a phosphorothioate linkage in the 5'-ppp-5'
cap. Additional modified guanosine nucleotides can be used such as
.alpha.-methyl-phosphonate and seleno-phosphate nucleotides.
[0591] Additional modifications include, but are not limited to,
2'-O-methylation of the ribose sugars of 5'-terminal and/or
5'-anteterminal nucleotides of the polynucleotide (as mentioned
above) on the 2'-hydroxyl group of the sugar ring. Multiple
distinct 5'-cap structures can be used to generate the 5'-cap of a
nucleic acid molecule, such as a polynucleotide that functions as
an mRNA molecule.
[0592] Cap analogs, which herein are also referred to as synthetic
cap analogs, chemical caps, chemical cap analogs, or structural or
functional cap analogs, differ from natural (i.e., endogenous,
wild-type or physiological) 5'-caps in their chemical structure,
while retaining cap function. Cap analogs can be chemically (i.e.,
non-enzymatically) or enzymatically synthesized and/or linked to
the polynucleotides of the disclosure.
[0593] For example, the Anti-Reverse Cap Analog (ARCA) cap contains
two guanines linked by a 5'-5'-triphosphate group, wherein one
guanine contains an N7 methyl group as well as a 3'-O-methyl group
(i.e., N7,3'-O-dimethyl-guanosine-5'-triphosphate-5'-guanosine
(m.sup.7G-3'mppp-G; which can equivalently be designated 3'
O-Me-m7G(5)ppp(5')G). The 3'-O atom of the other, unmodified,
guanine becomes linked to the 5'-terminal nucleotide of the capped
polynucleotide. The N7- and 3'-O-methlyated guanine provides the
terminal moiety of the capped polynucleotide.
[0594] Another exemplary cap is mCAP, which is similar to ARCA but
has a 2'-O-methyl group on guanosine (i.e.,
N7,2'-O-dimethyl-guanosine-5'-triphosphate-5'-guanosine,
m.sup.7Gm-ppp-G).
[0595] In some embodiments, the cap is a dinucleotide cap analog.
As a non-limiting example, the dinucleotide cap analog can be
modified at different phosphate positions with a boranophosphate
group or a phophoroselenoate group such as the dinucleotide cap
analogs described in U.S. Pat. No. 8,519,110, the contents of which
are herein incorporated by reference in its entirety.
[0596] In another embodiment, the cap is a cap analog is a
N7-(4-chlorophenoxyethyl) substituted dicucleotide form of a cap
analog known in the art and/or described herein. Non-limiting
examples of a N7-(4-chlorophenoxyethyl) substituted dicucleotide
form of a cap analog include a
N7-(4-chlorophenoxyethyl)-G(5)ppp(5')G and a
N7-(4-chlorophenoxyethyl)-m.sup.3'-OG(5)ppp(5')G cap analog (See,
e.g., the various cap analogs and the methods of synthesizing cap
analogs described in Kore et al. Bioorganic & Medicinal
Chemistry 2013 21:4570-4574; the contents of which are herein
incorporated by reference in its entirety). In another embodiment,
a cap analog of the present disclosure is a
4-chloro/bromophenoxyethyl analog.
[0597] While cap analogs allow for the concomitant capping of a
polynucleotide or a region thereof, in an in vitro transcription
reaction, up to 20% of transcripts can remain uncapped. This, as
well as the structural differences of a cap analog from an
endogenous 5'-cap structures of nucleic acids produced by the
endogenous, cellular transcription machinery, can lead to reduced
translational competency and reduced cellular stability.
[0598] Polynucleotides of the disclosure can also be capped
post-manufacture (whether IVT or chemical synthesis), using
enzymes, in order to generate more authentic 5'-cap structures. As
used herein, the phrase "more authentic" refers to a feature that
closely mirrors or mimics, either structurally or functionally, an
endogenous or wild type feature. That is, a "more authentic"
feature is better representative of an endogenous, wild-type,
natural or physiological cellular function and/or structure as
compared to synthetic features or analogs, etc., of the prior art,
or which outperforms the corresponding endogenous, wild-type,
natural or physiological feature in one or more respects.
Non-limiting examples of more authentic 5'cap structures of the
present disclosure are those that, among other things, have
enhanced binding of cap binding proteins, increased half-life,
reduced susceptibility to 5' endonucleases and/or reduced
5'decapping, as compared to synthetic 5'cap structures known in the
art (or to a wild-type, natural or physiological 5'cap structure).
For example, recombinant Vaccinia Virus Capping Enzyme and
recombinant 2'-O-methyltransferase enzyme can create a canonical
5'-5'-triphosphate linkage between the 5'-terminal nucleotide of a
polynucleotide and a guanine cap nucleotide wherein the cap guanine
contains an N7 methylation and the 5'-terminal nucleotide of the
mRNA contains a 2'-O-methyl. Such a structure is termed the Cap1
structure. This cap results in a higher translational-competency
and cellular stability and a reduced activation of cellular
pro-inflammatory cytokines, as compared, e.g., to other 5'cap
analog structures known in the art. Cap structures include, but are
not limited to, 7mG(5')ppp(5')N,pN2p (cap 0), 7mG(5')ppp(5')NlmpNp
(cap 1), and 7mG(5')-ppp(5')NlmpN2mp (cap 2).
[0599] As a non-limiting example, capping chimeric polynucleotides
post-manufacture can be more efficient as nearly 100% of the
chimeric polynucleotides can be capped. This is in contrast to
.about.80% when a cap analog is linked to a chimeric polynucleotide
in the course of an in vitro transcription reaction.
[0600] According to the present disclosure, 5' terminal caps can
include endogenous caps or cap analogs. According to the present
disclosure, a 5' terminal cap can comprise a guanine analog. Useful
guanine analogs include, but are not limited to, inosine,
N1-methyl-guanosine, 2'fluoro-guanosine, 7-deaza-guanosine,
8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine, and
2-azido-guanosine.
Poly-A Tails
[0601] The disclosure also includes a polynucleotide that comprises
both a poly-A tail and the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide.
[0602] During RNA processing, a long chain of adenine nucleotides
(poly-A tail) can be added to a polynucleotide such as an mRNA
molecule in order to increase stability. Immediately after
transcription, the 3' end of the transcript can be cleaved to free
a 3' hydroxyl. Then poly-A polymerase adds a chain of adenine
nucleotides to the RNA. The process, called polyadenylation, adds a
poly-A tail that can be between, for example, approximately 80 to
approximately 250 residues long, including approximately 80, 90,
100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220,
230, 240 or 250 residues long.
[0603] PolyA tails can also be added after the construct is
exported from the nucleus.
[0604] According to the present disclosure, terminal groups on the
poly A tail can be incorporated for stabilization. Polynucleotides
of the present disclosure can include des-3' hydroxyl tails. They
can also include structural moieties or 2'-Omethyl modifications as
taught by Junjie Li, et al. (Current Biology, Vol. 15, 1501-1507,
Aug. 23, 2005, the contents of which are incorporated herein by
reference in its entirety).
[0605] The polynucleotides of the present disclosure can be
designed to encode transcripts with alternative polyA tail
structures including histone mRNA. According to Norbury, "Terminal
uridylation has also been detected on human replication-dependent
histone mRNAs. The turnover of these mRNAs is thought to be
important for the prevention of potentially toxic histone
accumulation following the completion or inhibition of chromosomal
DNA replication. These mRNAs are distinguished by their lack of a
3' poly(A) tail, the function of which is instead assumed by a
stable stem-loop structure and its cognate stem-loop binding
protein (SLBP); the latter carries out the same functions as those
of PABP on polyadenylated mRNAs" (Norbury, "Cytoplasmic RNA: a case
of the tail wagging the dog," Nature Reviews Molecular Cell
Biology; AOP, published online 29 Aug. 2013; doi:10.1038/nrm3645)
the contents of which are incorporated herein by reference in its
entirety.
[0606] Unique poly-A tail lengths provide certain advantages to the
polynucleotides of the present disclosure.
[0607] Generally, the length of a poly-A tail, when present, is
greater than 30 nucleotides in length. In another embodiment, the
poly-A tail is greater than 35 nucleotides in length (e.g., at
least or greater than about 35, 40, 45, 50, 55, 60, 70, 80, 90,
100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600,
700, 800, 900, 1,000, 1,100, 1,200, 1,300, 1,400, 1,500, 1,600,
1,700, 1,800, 1,900, 2,000, 2,500, and 3,000 nucleotides). In some
embodiments, the polynucleotide or region thereof includes from
about 30 to about 3,000 nucleotides (e.g., from 30 to 50, from 30
to 100, from 30 to 250, from 30 to 500, from 30 to 750, from 30 to
1,000, from 30 to 1,500, from 30 to 2,000, from 30 to 2,500, from
50 to 100, from 50 to 250, from 50 to 500, from 50 to 750, from 50
to 1,000, from 50 to 1,500, from 50 to 2,000, from 50 to 2,500,
from 50 to 3,000, from 100 to 500, from 100 to 750, from 100 to
1,000, from 100 to 1,500, from 100 to 2,000, from 100 to 2,500,
from 100 to 3,000, from 500 to 750, from 500 to 1,000, from 500 to
1,500, from 500 to 2,000, from 500 to 2,500, from 500 to 3,000,
from 1,000 to 1,500, from 1,000 to 2,000, from 1,000 to 2,500, from
1,000 to 3,000, from 1,500 to 2,000, from 1,500 to 2,500, from
1,500 to 3,000, from 2,000 to 3,000, from 2,000 to 2,500, and from
2,500 to 3,000).
[0608] In some embodiments, the poly-A tail is designed relative to
the length of the overall polynucleotide or the length of a
particular region of the polynucleotide. This design can be based
on the length of a coding region, the length of a particular
feature or region or based on the length of the ultimate product
expressed from the polynucleotides.
[0609] In this context, the poly-A tail can be 10, 20, 30, 40, 50,
60, 70, 80, 90, or 100% greater in length than the polynucleotide
or feature thereof. The poly-A tail can also be designed as a
fraction of the polynucleotides to which it belongs. In this
context, the poly-A tail can be 10, 20, 30, 40, 50, 60, 70, 80, or
90% or more of the total length of the construct, a construct
region or the total length of the construct minus the poly-A tail.
Further, engineered binding sites and conjugation of
polynucleotides for Poly-A binding protein can enhance
expression.
[0610] Additionally, multiple distinct polynucleotides can be
linked together via the PABP (Poly-A binding protein) through the
3'-end using modified nucleotides at the 3'-terminus of the poly-A
tail. Transfection experiments can be conducted in relevant cell
lines at and protein production can be assayed by ELISA at 12 hr,
24 hr, 48 hr, 72 hr and day 7 post-transfection.
[0611] In some embodiments, the polynucleotides of the present
disclosure are designed to include a polyA-G Quartet region. The
G-quartet is a cyclic hydrogen bonded array of four guanine
nucleotides that can be formed by G-rich sequences in both DNA and
RNA. In this embodiment, the G-quartet is incorporated at the end
of the poly-A tail. The resultant polynucleotide is assayed for
stability, protein production and other parameters including
half-life at various time points. It has been discovered that the
polyA-G quartet results in protein production from an mRNA
equivalent to at least 75% of that seen using a poly-A tail of 120
nucleotides alone.
Start Codon Region
[0612] The disclosure also includes a polynucleotide that comprises
both a start codon region and the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide. In some embodiments, the polynucleotides of the
present disclosure can have regions that are analogous to or
function like a start codon region.
[0613] In some embodiments, the translation of a polynucleotide can
initiate on a codon that is not the start codon AUG. Translation of
the polynucleotide can initiate on an alternative start codon such
as, but not limited to, ACG, AGG, AAG, CTG/CUG, GTG/GUG, ATA/AUA,
ATT/AUU, TTG/UUG (see Touriol et al. Biology of the Cell 95 (2003)
169-178 and Matsuda and Mauro PLoS ONE, 2010 5:11; the contents of
each of which are herein incorporated by reference in its
entirety). As a non-limiting example, the translation of a
polynucleotide begins on the alternative start codon ACG. As
another non-limiting example, polynucleotide translation begins on
the alternative start codon CTG or CUG. As yet another non-limiting
example, the translation of a polynucleotide begins on the
alternative start codon GTG or GUG.
[0614] Nucleotides flanking a codon that initiates translation such
as, but not limited to, a start codon or an alternative start
codon, are known to affect the translation efficiency, the length
and/or the structure of the polynucleotide. (See, e.g., Matsuda and
Mauro PLoS ONE, 2010 5:11; the contents of which are herein
incorporated by reference in its entirety). Masking any of the
nucleotides flanking a codon that initiates translation can be used
to alter the position of translation initiation, translation
efficiency, length and/or structure of a polynucleotide.
[0615] In some embodiments, a masking agent can be used near the
start codon or alternative start codon in order to mask or hide the
codon to reduce the probability of translation initiation at the
masked start codon or alternative start codon. Non-limiting
examples of masking agents include antisense locked nucleic acids
(LNA) polynucleotides and exon-junction complexes (EJCs) (See,
e.g., Matsuda and Mauro describing masking agents LNA
polynucleotides and EJCs (PLoS ONE, 2010 5:11); the contents of
which are herein incorporated by reference in its entirety).
[0616] In another embodiment, a masking agent can be used to mask a
start codon of a polynucleotide in order to increase the likelihood
that translation will initiate on an alternative start codon.
[0617] In some embodiments, a masking agent can be used to mask a
first start codon or alternative start codon in order to increase
the chance that translation will initiate on a start codon or
alternative start codon downstream to the masked start codon or
alternative start codon.
[0618] In some embodiments, a start codon or alternative start
codon can be located within a perfect complement for a miR binding
site. The perfect complement of a miR binding site can help control
the translation, length and/or structure of the polynucleotide
similar to a masking agent. As a non-limiting example, the start
codon or alternative start codon can be located in the middle of a
perfect complement for a miR-122 binding site. The start codon or
alternative start codon can be located after the first nucleotide,
second nucleotide, third nucleotide, fourth nucleotide, fifth
nucleotide, sixth nucleotide, seventh nucleotide, eighth
nucleotide, ninth nucleotide, tenth nucleotide, eleventh
nucleotide, twelfth nucleotide, thirteenth nucleotide, fourteenth
nucleotide, fifteenth nucleotide, sixteenth nucleotide, seventeenth
nucleotide, eighteenth nucleotide, nineteenth nucleotide, twentieth
nucleotide or twenty-first nucleotide.
[0619] In another embodiment, the start codon of a polynucleotide
can be removed from the polynucleotide sequence in order to have
the translation of the polynucleotide begin on a codon that is not
the start codon. Translation of the polynucleotide can begin on the
codon following the removed start codon or on a downstream start
codon or an alternative start codon. In a non-limiting example, the
start codon ATG or AUG is removed as the first 3 nucleotides of the
polynucleotide sequence in order to have translation initiate on a
downstream start codon or alternative start codon. The
polynucleotide sequence where the start codon was removed can
further comprise at least one masking agent for the downstream
start codon and/or alternative start codons in order to control or
attempt to control the initiation of translation, the length of the
polynucleotide and/or the structure of the polynucleotide.
Stop Codon Region
[0620] The disclosure also includes a polynucleotide that comprises
both a stop codon region and the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide. In some embodiments, the polynucleotides of the
present disclosure can include at least two stop codons before the
3' untranslated region (UTR). The stop codon can be selected from
TGA, TAA and TAG. In some embodiments, the polynucleotides of the
present disclosure include the stop codon TGA and one additional
stop codon. In a further embodiment the addition stop codon can be
TAA. In another embodiment, the polynucleotides of the present
disclosure include three stop codons.
Insertions and Substitutions
[0621] The disclosure also includes a polynucleotide that comprises
insertions and/or substitutions in the polynucleotide described
herein, i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide.
[0622] In some embodiments, the 5'UTR of the polynucleotide can be
replaced by the insertion of at least one region and/or string of
nucleosides of the same base. The region and/or string of
nucleotides can include, but is not limited to, at least 3, at
least 4, at least 5, at least 6, at least 7 or at least 8
nucleotides and the nucleotides can be natural and/or unnatural. As
a non-limiting example, the group of nucleotides can include 5-8
adenine, cytosine, thymine, a string of any of the other
nucleotides disclosed herein and/or combinations thereof.
[0623] In some embodiments, the 5'UTR of the polynucleotide can be
replaced by the insertion of at least two regions and/or strings of
nucleotides of two different bases such as, but not limited to,
adenine, cytosine, thymine, any of the other nucleotides disclosed
herein and/or combinations thereof. For example, the 5'UTR can be
replaced by inserting 5-8 adenine bases followed by the insertion
of 5-8 cytosine bases. In another example, the 5'UTR can be
replaced by inserting 5-8 cytosine bases followed by the insertion
of 5-8 adenine bases.
[0624] In some embodiments, the polynucleotide can include at least
one substitution and/or insertion downstream of the transcription
start site that can be recognized by an RNA polymerase. As a
non-limiting example, at least one substitution and/or insertion
can occur downstream of the transcription start site by
substituting at least one nucleic acid in the region just
downstream of the transcription start site (such as, but not
limited to, +1 to +6). Changes to region of nucleotides just
downstream of the transcription start site can affect initiation
rates, increase apparent nucleotide triphosphate (NTP) reaction
constant values, and increase the dissociation of short transcripts
from the transcription complex curing initial transcription (Brieba
et al, Biochemistry (2002) 41: 5144-5149; herein incorporated by
reference in its entirety). The modification, substitution and/or
insertion of at least one nucleoside can cause a silent mutation of
the sequence or can cause a mutation in the amino acid
sequence.
[0625] In some embodiments, the polynucleotide can include the
substitution of at least 1, at least 2, at least 3, at least 4, at
least 5, at least 6, at least 7, at least 8, at least 9, at least
10, at least 11, at least 12 or at least 13 guanine bases
downstream of the transcription start site.
[0626] In some embodiments, the polynucleotide can include the
substitution of at least 1, at least 2, at least 3, at least 4, at
least 5 or at least 6 guanine bases in the region just downstream
of the transcription start site. As a non-limiting example, if the
nucleotides in the region are GGGAGA, the guanine bases can be
substituted by at least 1, at least 2, at least 3 or at least 4
adenine nucleotides. In another non-limiting example, if the
nucleotides in the region are GGGAGA the guanine bases can be
substituted by at least 1, at least 2, at least 3 or at least 4
cytosine bases. In another non-limiting example, if the nucleotides
in the region are GGGAGA the guanine bases can be substituted by at
least 1, at least 2, at least 3 or at least 4 thymine, and/or any
of the nucleotides described herein.
[0627] In some embodiments, the polynucleotide can include at least
one substitution and/or insertion upstream of the start codon. For
the purpose of clarity, one of skill in the art would appreciate
that the start codon is the first codon of the protein coding
region whereas the transcription start site is the site where
transcription begins. The polynucleotide can include, but is not
limited to, at least 1, at least 2, at least 3, at least 4, at
least 5, at least 6, at least 7 or at least 8 substitutions and/or
insertions of nucleotide bases. The nucleotide bases can be
inserted or substituted at 1, at least 1, at least 2, at least 3,
at least 4 or at least 5 locations upstream of the start codon. The
nucleotides inserted and/or substituted can be the same base (e.g.,
all A or all C or all T or all G), two different bases (e.g., A and
C, A and T, or C and T), three different bases (e.g., A, C and T or
A, C and T) or at least four different bases. As a non-limiting
example, the guanine base upstream of the coding region in the
polynucleotide can be substituted with adenine, cytosine, thymine,
or any of the nucleotides described herein. In another non-limiting
example the substitution of guanine bases in the polynucleotide can
be designed so as to leave one guanine base in the region
downstream of the transcription start site and before the start
codon (see Esvelt et al. Nature (2011) 472(7344):499-503; the
contents of which is herein incorporated by reference in its
entirety). As a non-limiting example, at least 5 nucleotides can be
inserted at 1 location downstream of the transcription start site
but upstream of the start codon and the at least 5 nucleotides can
be the same base type.
IV. Methods of making Polynucleotides
[0628] The present disclosure also provides methods for making a
polynucleotide disclosed herein or a complement thereof. In some
aspects, a polynucleotide (e.g., an mRNA) disclosed herein, and
encoding an MCM polypeptide or a functional fragment thereof, can
be constructed using in vitro transcription. In other aspects, a
polynucleotide (e.g., an mRNA) disclosed herein, and encoding an
MCM polypeptide or a functional fragment thereof, can be
constructed by chemical synthesis using an oligonucleotide
synthesizer. In other aspects, a polynucleotide (e.g., an mRNA)
disclosed herein, and encoding an MCM polypeptide or a functional
fragment thereof is made by using a host cell. In certain aspects,
a polynucleotide (e.g., an mRNA) disclosed herein, and encoding an
MCM polypeptide or a functional fragment thereof is made by one or
more combination of the IVT, chemical synthesis, host cell
expression, or any other methods known in the art.
[0629] Naturally occurring nucleosides, non-naturally occurring
nucleosides, or combinations thereof, can totally or partially
naturally replace occurring nucleosides present in the candidate
nucleotide sequence and can be incorporated into a
sequence-optimized nucleotide sequence (e.g., an mRNA) encoding an
MCM polypeptide. The resultant mRNAs can then be examined for their
ability to produce protein and/or produce a therapeutic
outcome.
In Vitro Transcription-Enzymatic Synthesis
[0630] A polynucleotide disclosed herein can be transcribed using
an in vitro transcription (IVT) system. The system typically
comprises a transcription buffer, nucleotide triphosphates (NTPs),
an RNase inhibitor and a polymerase. The NTPs can be selected from,
but are not limited to, those described herein including natural
and unnatural (modified) NTPs. The polymerase can be selected from,
but is not limited to, T7 RNA polymerase, T3 RNA polymerase and
mutant polymerases such as, but not limited to, polymerases able to
incorporate modified nucleic acids. See U.S. Publ. No.
US20130259923, which is herein incorporated by reference in its
entirety.
[0631] The IVT system typically comprises a transcription buffer,
nucleotide triphosphates (NTPs), an RNase inhibitor and a
polymerase. The NTPs can be selected from, but are not limited to,
those described herein including natural and unnatural (modified)
NTPs. The polymerase can be selected from, but is not limited to,
T7 RNA polymerase, T3 RNA polymerase and mutant polymerases such
as, but not limited to, polymerases able to incorporate
polynucleotides disclosed herein.
[0632] Any number of RNA polymerases or variants can be used in the
synthesis of the polynucleotides of the present disclosure.
[0633] RNA polymerases can be modified by inserting or deleting
amino acids of the RNA polymerase sequence. As a non-limiting
example, the RNA polymerase can be modified to exhibit an increased
ability to incorporate a 2'-modified nucleotide triphosphate
compared to an unmodified RNA polymerase (see International
Publication WO2008078180 and U.S. Pat. No. 8,101,385; herein
incorporated by reference in their entireties).
[0634] Variants can be obtained by evolving an RNA polymerase,
optimizing the RNA polymerase amino acid and/or nucleic acid
sequence and/or by using other methods known in the art. As a
non-limiting example, T7 RNA polymerase variants can be evolved
using the continuous directed evolution system set out by Esvelt et
al. (Nature (2011) 472(7344):499-503; herein incorporated by
reference in its entirety) where clones of T7 RNA polymerase can
encode at least one mutation such as, but not limited to, lysine at
position 93 substituted for threonine (K93T), I4M, A7T, E63V, V64D,
A65E, D66Y, T76N, C125R, S128R, A136T, N165S, G175R, H176L, Y178H,
F182L, L196F, G198V, D208Y, E222K, S228A, Q239R, T243N, G259D,
M267I, G280C, H300R, D351A, A354S, E356D, L360P, A383V, Y385C,
D388Y, S397R, M401T, N410S, K450R, P451T, G452V, E484A, H523L,
H524N, G542V, E565K, K577E, K577M, N601S, S684Y, L699I, K713E,
N748D, Q754R, E775K, A827V, D851N or L864F. As another non-limiting
example, T7 RNA polymerase variants can encode at least mutation as
described in U.S. Pub. Nos. 20100120024 and 20070117112; herein
incorporated by reference in their entireties. Variants of RNA
polymerase can also include, but are not limited to, substitutional
variants, conservative amino acid substitution, insertional
variants, deletional variants and/or covalent derivatives.
[0635] In one aspect, the polynucleotide can be designed to be
recognized by the wild type or variant RNA polymerases. In doing
so, the polynucleotide can be modified to contain sites or regions
of sequence changes from the wild type or parent chimeric
polynucleotide.
[0636] Polynucleotide or nucleic acid synthesis reactions can be
carried out by enzymatic methods utilizing polymerases. Polymerases
catalyze the creation of phosphodiester bonds between nucleotides
in a polynucleotide or nucleic acid chain. Currently known DNA
polymerases can be divided into different families based on amino
acid sequence comparison and crystal structure analysis. DNA
polymerase I (pol I) or A polymerase family, including the Klenow
fragments of E. Coli, Bacillus DNA polymerase I, Thermus aquaticus
(Taq) DNA polymerases, and the T7 RNA and DNA polymerases, is among
the best studied of these families. Another large family is DNA
polymerase a (pol a) or B polymerase family, including all
eukaryotic replicating DNA polymerases and polymerases from phages
T4 and RB69. Although they employ similar catalytic mechanism,
these families of polymerases differ in substrate specificity,
substrate analog-incorporating efficiency, degree and rate for
primer extension, mode of DNA synthesis, exonuclease activity, and
sensitivity against inhibitors.
[0637] DNA polymerases are also selected based on the optimum
reaction conditions they require, such as reaction temperature, pH,
and template and primer concentrations. Sometimes a combination of
more than one DNA polymerases is employed to achieve the desired
DNA fragment size and synthesis efficiency. For example, Cheng et
al. increase pH, add glycerol and dimethyl sulfoxide, decrease
denaturation times, increase extension times, and utilize a
secondary thermostable DNA polymerase that possesses a 3' to 5'
exonuclease activity to effectively amplify long targets from
cloned inserts and human genomic DNA. (Cheng et al., PNAS, Vol. 91,
5695-5699 (1994), the contents of which are incorporated herein by
reference in their entirety). RNA polymerases from bacteriophage
T3, T7, and SP6 have been widely used to prepare RNAs for
biochemical and biophysical studies. RNA polymerases, capping
enzymes, and poly-A polymerases are disclosed in the co-pending
International Publication No. WO2014028429, the contents of which
are incorporated herein by reference in their entirety.
[0638] In one aspect, the RNA polymerase which can be used in the
synthesis of the polynucleotides described herein is a Syn5 RNA
polymerase. (see Zhu et al. Nucleic Acids Research 2013, the
contents of which is herein incorporated by reference in its
entirety). The Syn5 RNA polymerase was recently characterized from
marine cyanophage Syn5 by Zhu et al. where they also identified the
promoter sequence (see Zhu et al. Nucleic Acids Research 2013, the
contents of which is herein incorporated by reference in its
entirety). Zhu et al. found that Syn5 RNA polymerase catalyzed RNA
synthesis over a wider range of temperatures and salinity as
compared to T7 RNA polymerase. Additionally, the requirement for
the initiating nucleotide at the promoter was found to be less
stringent for Syn5 RNA polymerase as compared to the T7 RNA
polymerase making Syn5 RNA polymerase promising for RNA
synthesis.
[0639] In one aspect, a Syn5 RNA polymerase can be used in the
synthesis of the polynucleotides described herein. As a
non-limiting example, a Syn5 RNA polymerase can be used in the
synthesis of the polynucleotide requiring a precise 3'-termini.
[0640] In one aspect, a Syn5 promoter can be used in the synthesis
of the polynucleotides. As a non-limiting example, the Syn5
promoter can be 5'-ATTGGGCACCCGTAAGGG-3' as described by Zhu et al.
(Nucleic Acids Research 2013, the contents of which is herein
incorporated by reference in its entirety).
[0641] In one aspect, a Syn5 RNA polymerase can be used in the
synthesis of polynucleotides comprising at least one chemical
modification described herein and/or known in the art. (see e.g.,
the incorporation of pseudo-UTP and 5Me-CTP described in Zhu et al.
Nucleic Acids Research 2013, the contents of which is herein
incorporated by reference in its entirety).
[0642] In one aspect, the polynucleotides described herein can be
synthesized using a Syn5 RNA polymerase which has been purified
using modified and improved purification procedure described by Zhu
et al. (Nucleic Acids Research 2013, the contents of which is
herein incorporated by reference in its entirety).
[0643] Various tools in genetic engineering are based on the
enzymatic amplification of a target gene which acts as a template.
For the study of sequences of individual genes or specific regions
of interest and other research needs, it is necessary to generate
multiple copies of a target gene from a small sample of
polynucleotides or nucleic acids. Such methods can be applied in
the manufacture of the polynucleotides of the disclosure.
[0644] Polymerase chain reaction (PCR) has wide applications in
rapid amplification of a target gene, as well as genome mapping and
sequencing. The key components for synthesizing DNA comprise target
DNA molecules as a template, primers complementary to the ends of
target DNA strands, deoxynucleoside triphosphates (dNTPs) as
building blocks, and a DNA polymerase. As PCR progresses through
denaturation, annealing and extension steps, the newly produced DNA
molecules can act as a template for the next circle of replication,
achieving exponentially amplification of the target DNA. PCR
requires a cycle of heating and cooling for denaturation and
annealing. Variations of the basic PCR include asymmetric PCR
[Innis et al., PNAS, vol. 85, 9436-9440 (1988)], inverse PCR
[Ochman et al., Genetics, vol. 120(3), 621-623, (1988)], reverse
transcription PCR (RT-PCR) (Freeman et al., BioTechniques, vol.
26(1), 112-22, 124-5 (1999), the contents of which are incorporated
herein by reference in their entirety and so on). In RT-PCR, a
single stranded RNA is the desired target and is converted to a
double stranded DNA first by reverse transcriptase.
[0645] A variety of isothermal in vitro nucleic acid amplification
techniques have been developed as alternatives or complements of
PCR. For example, strand displacement amplification (SDA) is based
on the ability of a restriction enzyme to form a nick. (Walker et
al., PNAS, vol. 89, 392-396 (1992), the contents of which are
incorporated herein by reference in their entirety)). A restriction
enzyme recognition sequence is inserted into an annealed primer
sequence. Primers are extended by a DNA polymerase and dNTPs to
form a duplex. Only one strand of the duplex is cleaved by the
restriction enzyme. Each single strand chain is then available as a
template for subsequent synthesis. SDA does not require the
complicated temperature control cycle of PCR.
[0646] Nucleic acid sequence-based amplification (NASBA), also
called transcription mediated amplification (TMA), is also an
isothermal amplification method that utilizes a combination of DNA
polymerase, reverse transcriptase, RNAse H, and T7 RNA polymerase.
[Compton, Nature, vol. 350, 91-92 (1991)] the contents of which are
incorporated herein by reference in their entirety. A target RNA is
used as a template and a reverse transcriptase synthesizes its
complementary DNA strand. RNAse H hydrolyzes the RNA template,
making space for a DNA polymerase to synthesize a DNA strand
complementary to the first DNA strand which is complementary to the
RNA target, forming a DNA duplex. T7 RNA polymerase continuously
generates complementary RNA strands of this DNA duplex. These RNA
strands act as templates for new cycles of DNA synthesis, resulting
in amplification of the target gene.
[0647] Rolling-circle amplification (RCA) amplifies a single
stranded circular polynucleotide and involves numerous rounds of
isothermal enzymatic synthesis where 029 DNA polymerase extends a
primer by continuously progressing around the polynucleotide circle
to replicate its sequence over and over again. Therefore, a linear
copy of the circular template is achieved. A primer can then be
annealed to this linear copy and its complementary chain can be
synthesized. [See Lizardi et al., Nature Genetics, vol. 19, 225-232
(1998)] the contents of which are incorporated herein by reference
in their entirety. A single stranded circular DNA can also serve as
a template for RNA synthesis in the presence of an RNA polymerase.
(Daubendiek et al., JACS, vol. 117, 7818-7819 (1995), the contents
of which are incorporated herein by reference in their entirety).
An inverse rapid amplification of cDNA ends (RACE) RCA is described
by Polidoros et al. A messenger RNA (mRNA) is reverse transcribed
into cDNA, followed by RNAse H treatment to separate the cDNA. The
cDNA is then circularized by CircLigase into a circular DNA. The
amplification of the resulting circular DNA is achieved with RCA.
(Polidoros et al., BioTechniques, vol. 41, 35-42 (2006), the
contents of which are incorporated herein by reference in their
entirety).
[0648] Any of the foregoing methods can be utilized in the
manufacture of one or more regions of the polynucleotides of the
present disclosure.
[0649] Assembling polynucleotides or nucleic acids by a ligase is
also widely used. DNA or RNA ligases promote intermolecular
ligation of the 5' and 3' ends of polynucleotide chains through the
formation of a phosphodiester bond. Ligase chain reaction (LCR) is
a promising diagnosing technique based on the principle that two
adjacent polynucleotide probes hybridize to one strand of a target
gene and couple to each other by a ligase. If a target gene is not
present, or if there is a mismatch at the target gene, such as a
single-nucleotide polymorphism (SNP), the probes cannot ligase.
(Wiedmann et al., PCR Methods and Application, vol. 3 (4), s51-s64
(1994), the contents of which are incorporated herein by reference
in their entirety). LCR can be combined with various amplification
techniques to increase sensitivity of detection or to increase the
amount of products if it is used in synthesizing polynucleotides
and nucleic acids.
[0650] Several library preparation kits for nucleic acids are now
commercially available. They include enzymes and buffers to convert
a small amount of nucleic acid samples into an indexed library for
downstream applications. For example, DNA fragments can be placed
in a NEBNEXT.RTM. ULTRA.TM. DNA Library Prep Kit by NEWENGLAND
BIOLABS.RTM. for end preparation, ligation, size selection,
clean-up, PCR amplification and final clean-up.
[0651] Continued development is going on to improvement the
amplification techniques. For example, U.S. Pat. No. 8,367,328 to
Asada et al. the contents of which are incorporated herein by
reference in their entirety, teaches utilizing a reaction enhancer
to increase the efficiency of DNA synthesis reactions by DNA
polymerases. The reaction enhancer comprises an acidic substance or
cationic complexes of an acidic substance. US Pat. 7.384,739 to
Kitabayashi et al. the contents of which are incorporated herein by
reference in their entirety, teaches a carboxylate ion-supplying
substance that promotes enzymatic DNA synthesis, wherein the
carboxylate ion-supplying substance is selected from oxalic acid,
malonic acid, esters of oxalic acid, esters of malonic acid, salts
of malonic acid, and esters of maleic acid. U.S. Pat. No. 7,378,262
to Sobek et al. the contents of which are incorporated herein by
reference in their entirety, discloses an enzyme composition to
increase fidelity of DNA amplifications. The composition comprises
one enzyme with 3' exonuclease activity but no polymerase activity
and another enzyme that is a polymerase. Both of the enzymes are
thermostable and are reversibly modified to be inactive at lower
temperatures.
[0652] U.S. Pat. No. 7,550,264 to Getts et al. teaches multiple
round of synthesis of sense RNA molecules are performed by
attaching oligodeoxynucleotides tails onto the 3' end of cDNA
molecules and initiating RNA transcription using RNA polymerase,
the contents of which are incorporated herein by reference in their
entirety. US Pat. Publication No. 2013/0183718 to Rohayem teaches
RNA synthesis by RNA-dependent RNA polymerases (RdRp) displaying an
RNA polymerase activity on single-stranded DNA templates, the
contents of which are incorporated herein by reference in their
entirety. Oligonucleotides with non-standard nucleotides can be
synthesized with enzymatic polymerization by contacting a template
comprising non-standard nucleotides with a mixture of nucleotides
that are complementary to the nucleotides of the template as
disclosed in U.S. Pat. No. 6,617,106 to Benner, the contents of
which are incorporated herein by reference in their entirety.
Chemical Synthesis
[0653] Standard methods can be applied to synthesize an isolated
polynucleotide sequence encoding an isolated polypeptide of
interest. For example, a single DNA or RNA oligomer containing a
codon-optimized nucleotide sequence coding for the particular
isolated polypeptide can be synthesized. In other aspects, several
small oligonucleotides coding for portions of the desired
polypeptide can be synthesized and then ligated. In some aspects,
the individual oligonucleotides typically contain 5' or 3'
overhangs for complementary assembly.
[0654] A polynucleotide disclosed herein (e.g., mRNA) can be
chemically synthesized using chemical synthesis methods and
potential nucleobase substitutions known in the art. See, for
example, International Publication Nos. WO2014093924, WO2013052523;
WO2013039857, WO2012135805, WO2013151671; U.S. Publ. No.
US20130115272; or U.S. Pat. No. 8,999,380, U.S. Pat. No. 8,710,200,
all of which are herein incorporated by reference in their
entireties.
V. Purification and Quantitation of Polynucleotides
Purification
[0655] Purification of the polynucleotides described herein (i.e.,
a polynucleotide comprising an ORF encoding an MCM polypeptide) can
include, but is not limited to, polynucleotide clean-up, quality
assurance and quality control. Clean-up can be performed by methods
known in the arts such as, but not limited to, AGENCOURT.RTM. beads
(Beckman Coulter Genomics, Danvers, Mass.), poly-T beads, LNA.TM.
oligo-T capture probes (EXIQON.RTM. Inc., Vedbaek, Denmark) or HPLC
based purification methods such as, but not limited to, strong
anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC
(RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC). The term
"purified" when used in relation to a polynucleotide such as a
"purified polynucleotide" refers to one that is separated from at
least one contaminant. As used herein, a "contaminant" is any
substance that makes another unfit, impure or inferior. Thus, a
purified polynucleotide (e.g., DNA and RNA) is present in a form or
setting different from that in which it is found in nature, or a
form or setting different from that which existed prior to
subjecting it to a treatment or purification method.
[0656] In some embodiments, purification of a polynucleotide of the
disclosure removes impurities that can reduce or remove an unwanted
immune response, e.g., reducing cytokine activity.
[0657] In some embodiments, the polynucleotide of the disclosure is
purified prior to administration using column chromatography (e.g.,
strong anion exchange HPLC, weak anion exchange HPLC, reverse phase
HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), or
(LCMS)). In some embodiments, a column chromatography (e.g., strong
anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC
(RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), or (LCMS))
purified polynucleotide, that encodes an MCM polypeptide disclosed
herein increases expression of MCM compared to polynucleotides
encoding MCM purified by a different purification method. In some
embodiments, a column chromatography (e.g., strong anion exchange
HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and
hydrophobic interaction HPLC (HIC-HPLC), or (LCMS)) purified
polynucleotide encodes an MCM polypeptide or functional fragment
thereof comprising one or more of the point mutations V69, T499,
H532, A598, and V671. In some embodiments, the RP-HPLC purified
polynucleotide increases MCM expression (e.g., by 20-50%, at least
20%, at least 25%, at least 30%, at least 35%, at least 40%, at
least 45%, or at least 50%).
[0658] A quality assurance and/or quality control check can be
conducted using methods such as, but not limited to, gel
electrophoresis, UV absorbance, or analytical HPLC.
[0659] In another embodiment, the polynucleotides can be sequenced
by methods including, but not limited to
reverse-transcriptase-PCR.
Quantification
[0660] In some embodiments, the polynucleotides of the present
disclosure (i.e., a polynucleotide comprising an ORF encoding an
MCM polypeptide) can be quantified in exosomes or when derived from
one or more bodily fluid. As used herein "bodily fluids" include
peripheral blood, serum, plasma, ascites, urine, cerebrospinal
fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous
humor, amniotic fluid, cerumen, breast milk, broncheoalveolar
lavage fluid, semen, prostatic fluid, cowper's fluid or
pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst
fluid, pleural and peritoneal fluid, pericardial fluid, lymph,
chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit,
vaginal secretions, mucosal secretion, stool water, pancreatic
juice, lavage fluids from sinus cavities, bronchopulmonary
aspirates, blastocyl cavity fluid, and umbilical cord blood.
Alternatively, exosomes can be retrieved from an organ selected
from the group consisting of lung, heart, pancreas, stomach,
intestine, bladder, kidney, ovary, testis, skin, colon, breast,
prostate, brain, esophagus, liver, and placenta.
[0661] In the exosome quantification method, a sample of not more
than 2 mL is obtained from the subject and the exosomes isolated by
size exclusion chromatography, density gradient centrifugation,
differential centrifugation, nanomembrane ultrafiltration,
immunoabsorbent capture, affinity purification, microfluidic
separation, or combinations thereof. In the analysis, the level or
concentration of a polynucleotide can be an expression level,
presence, absence, truncation or alteration of the administered
construct. It is advantageous to correlate the level with one or
more clinical phenotypes or with an assay for a human disease
biomarker. The assay can be performed using construct specific
probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry,
electrophoresis, mass spectrometry, or combinations thereof while
the exosomes can be isolated using immunohistochemical methods such
as enzyme linked immunosorbent assay (ELISA) methods. Exosomes can
also be isolated by size exclusion chromatography, density gradient
centrifugation, differential centrifugation, nanomembrane
ultrafiltration, immunoabsorbent capture, affinity purification,
microfluidic separation, or combinations thereof.
[0662] These methods afford the investigator the ability to
monitor, in real time, the level of polynucleotides remaining or
delivered. This is possible because the polynucleotides of the
present disclosure differ from the endogenous forms due to the
structural or chemical modifications.
[0663] In some embodiments, the polynucleotide can be quantified
using methods such as, but not limited to, ultraviolet visible
spectroscopy (UV/Vis). A non-limiting example of a UV/Vis
spectrometer is a NANODROP.RTM. spectrometer (ThermoFisher,
Waltham, Mass.). The quantified polynucleotide can be analyzed in
order to determine if the polynucleotide can be of proper size,
check that no degradation of the polynucleotide has occurred.
Degradation of the polynucleotide can be checked by methods such
as, but not limited to, agarose gel electrophoresis, HPLC based
purification methods such as, but not limited to, strong anion
exchange HPLC, weak anion exchange HPLC, reverse phase HPLC
(RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid
chromatography-mass spectrometry (LCMS), capillary electrophoresis
(CE) and capillary gel electrophoresis (CGE).
VI. Pharmaceutical Compositions
[0664] The disclosure includes pharmaceutical compositions that
comprise the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide. In
some embodiments, the formulation can contain polynucleotide
encoding wild type MCM or MCM comprising a nucleotide sequence
having significant sequence similarity to a polynucleotide selected
from the group of SEQ ID NOs: 1-207, 732-765, and 772, wherein the
ORF encodes an MCM polypeptide.
[0665] Pharmaceutical compositions can optionally comprise one or
more additional active substances, e.g., therapeutically and/or
prophylactically active substances. Pharmaceutical compositions of
the present disclosure can be sterile and/or pyrogen-free. General
considerations in the formulation and/or manufacture of
pharmaceutical agents can be found, for example, in Remington: The
Science and Practice of Pharmacy 21.sup.st ed., Lippincott Williams
& Wilkins, 2005 (incorporated herein by reference in its
entirety). For the purposes of the present disclosure, the phrase
"active ingredient" generally refers to polynucleotides to be
delivered as described herein.
[0666] Formulations of the pharmaceutical compositions described
herein can be prepared by any method known or hereafter developed
in the art of pharmacology. In general, such preparatory methods
include the step of associating the active ingredient with an
excipient and/or one or more other accessory ingredients.
[0667] A pharmaceutical composition in accordance with the present
disclosure can be prepared, packaged, and/or sold in bulk, as a
single unit dose, and/or as a plurality of single unit doses. As
used herein, a "unit dose" refers to a discrete amount of the
pharmaceutical composition comprising a predetermined amount of the
active ingredient. The amount of the active ingredient is generally
equal to the dosage of the active ingredient that would be
administered to a subject and/or a convenient fraction of such a
dosage such as, for example, one-half or one-third of such a
dosage.
[0668] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition in accordance with the
present disclosure can vary, depending upon the identity, size,
and/or condition of the subject being treated and further depending
upon the route by which the composition is to be administered. For
example, the composition can comprise between 0.1% and 99% (w/w) of
the active ingredient. By way of example, the composition can
comprise between 0.1% and 100%, e.g., between 0.5 and 50%, between
1-30%, between 5-80%, at least 80% (w/w) active ingredient.
[0669] In some embodiments, the formulations described herein can
contain at least one polynucleotide. As a non-limiting example, the
formulations can contain 1, 2, 3, 4 or 5 polynucleotides.
[0670] In some embodiments, the formulations described herein can
comprise more than one type of polynucleotide. In some embodiments,
the formulation can comprise a polynucleotide in linear and
circular form. In another embodiment, the formulation can comprise
a circular polynucleotide and an IVT polynucleotide. In yet another
embodiment, the formulation can comprise an IVT polynucleotide, a
chimeric polynucleotide and a circular polynucleotide.
[0671] In some embodiments, compositions are administered to
humans, human patients or subjects. Although the descriptions of
pharmaceutical compositions provided herein are principally
directed to pharmaceutical compositions that are suitable for
administration to humans, it will be understood by the skilled
artisan that such compositions are generally suitable for
administration to any other animal, e.g., to non-human animals,
e.g. non-human mammals. Modification of pharmaceutical compositions
suitable for administration to humans in order to render the
compositions suitable for administration to various animals is well
understood, and the ordinarily skilled veterinary pharmacologist
can design and/or perform such modification with merely ordinary,
if any, experimentation. Subjects to which administration of the
pharmaceutical compositions is contemplated include, but are not
limited to, humans and/or other primates; mammals, including
commercially relevant mammals such as cattle, pigs, horses, sheep,
cats, dogs, mice, and/or rats; and/or birds, including commercially
relevant birds such as poultry, chickens, ducks, geese, and/or
turkeys.
Delivery Agents
[0672] a. Lipid Compound
[0673] The present disclosure provides pharmaceutical compositions
with advantageous properties. In particular, the present
application provides pharmaceutical compositions comprising:
[0674] (a) a polynucleotide comprising an ORF encoding an MCM
polypeptide; and
[0675] (b) a lipid compound having the formula (I)
##STR00009##
[0676] wherein
[0677] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0678] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0679] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, -CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a carbocycle, heterocycle, --OR,
--O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R, --CX.sub.3,
--CX.sub.2H, --CXH.sub.2, --CN, --N(R).sub.2, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, and --C(R)N(R).sub.2C(O)OR, and each n is
independently selected from 1, 2, 3, 4, and 5;
[0680] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0681] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0682] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group;
[0683] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0684] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0685] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0686] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0687] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0688] each Y is independently a C.sub.3-6 carbocycle;
[0689] each X is independently selected from the group consisting
of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11,
12, and 13,
[0690] or salts or stereoisomers thereof, wherein alkyl and alkenyl
groups can be linear or branched.
[0691] In some embodiments, a subset of compounds of Formula (I)
includes those in which when R.sub.4 is --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHQR, or --CQ(R).sub.2, then (i) Q is not
--N(R).sub.2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or
7-membered heterocycloalkyl when n is 1 or 2.
[0692] In another embodiments, another subset of compounds of
Formula (I) includes those in which
[0693] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0694] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0695] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --CRN(R).sub.2C(O)OR, and a 5- to 14-membered
heterocycloalkyl having one or more heteroatoms selected from N, O,
and S which is substituted with one or more substituents selected
from oxo (.dbd.O), OH, amino, and C.sub.1-3 alkyl, and each n is
independently selected from 1, 2, 3, 4, and 5;
[0696] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0697] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0698] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group;
[0699] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0700] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0701] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0702] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0703] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0704] each Y is independently a C.sub.3-6 carbocycle;
[0705] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0706] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[0707] or salts or stereoisomers thereof.
[0708] In yet another embodiments, another subset of compounds of
Formula (I) includes those in which
[0709] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0710] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0711] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heterocycle having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --CRN(R).sub.2C(O)OR, and each n is
independently selected from 1, 2, 3, 4, and 5; and when Q is a 5-
to 14-membered heterocycle and (i) R.sub.4 is --(CH.sub.2).sub.nQ
in which n is 1 or 2, or (ii) R.sub.4 is --(CH.sub.2).sub.nCHQR in
which n is 1, or (iii) R.sub.4 is --CHQR, and --CQ(R).sub.2, then Q
is either a 5- to 14-membered heteroaryl or 8- to 14-membered
heterocycloalkyl;
[0712] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0713] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0714] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group;
[0715] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0716] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0717] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0718] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0719] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0720] each Y is independently a C.sub.3-6 carbocycle;
[0721] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0722] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[0723] or salts or stereoisomers thereof.
[0724] In still another embodiments, another subset of compounds of
Formula (I) includes those in which
[0725] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0726] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0727] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --CRN(R).sub.2C(O)OR, and each n is
independently selected from 1, 2, 3, 4, and 5;
[0728] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0729] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0730] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group;
[0731] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0732] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0733] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0734] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0735] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0736] each Y is independently a C.sub.3-6 carbocycle;
[0737] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0738] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[0739] or salts or stereoisomers thereof.
[0740] In yet another embodiments, another subset of compounds of
Formula (I) includes those in which
[0741] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0742] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.2-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0743] R.sub.4 is --(CH.sub.2).sub.nQ or --(CH.sub.2).sub.nCHQR,
where Q is --N(R).sub.2, and n is selected from 3, 4, and 5;
[0744] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0745] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0746] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group;
[0747] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0748] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0749] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0750] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0751] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.1-12 alkenyl;
[0752] each Y is independently a C.sub.3-6 carbocycle;
[0753] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0754] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[0755] or salts or stereoisomers thereof.
[0756] In still another embodiments, another subset of compounds of
Formula (I) includes those in which
[0757] R.sub.1 is selected from the group consisting of C.sub.5-20
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0758] R.sub.2 and R.sub.3 are independently selected from the
group consisting of C.sub.1-14 alkyl, C.sub.2-14 alkenyl, --R*YR'',
--YR'', and --R*OR'', or R.sub.2 and R.sub.3, together with the
atom to which they are attached, form a heterocycle or
carbocycle;
[0759] R.sub.4 is selected from the group consisting of
--(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR, and
--CQ(R).sub.2, where Q is --N(R).sub.2, and n is selected from 1,
2, 3, 4, and 5;
[0760] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0761] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0762] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group;
[0763] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0764] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0765] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0766] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0767] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.1-12 alkenyl;
[0768] each Y is independently a C.sub.3-6 carbocycle;
[0769] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0770] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[0771] or salts or stereoisomers thereof.
[0772] In certain embodiments, a subset of compounds of Formula (I)
includes those of Formula (IA):
##STR00010##
[0773] or a salt or stereoisomer thereof, wherein 1 is selected
from 1, 2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; Mi is
a bond or M'; R.sub.4 is unsubstituted C.sub.1-3 alkyl, or
--(CH.sub.2).sub.nQ, in which Q is OH, --NHC(S)N(R).sub.2, or
--NHC(O)N(R).sub.2; M and M' are independently selected from
--C(O)O--, --OC(O)--, --C(O)N(R')--, --P(O)(OR')O--, an aryl group,
and a heteroaryl group; and
[0774] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, and C.sub.2-14
alkenyl.
[0775] In certain embodiments, a subset of compounds of Formula (I)
includes those of Formula (II):
##STR00011##
[0776] or a salt or stereoisomer thereof, wherein 1 is selected
from 1, 2, 3, 4, and 5; M.sub.1 is a bond or M'; R.sub.4 is
unsubstituted C.sub.1-3 alkyl, or --(CH.sub.2).sub.nQ, in which n
is 2, 3, or 4, and Q is OH, --NHC(S)N(R).sub.2, or
--NHC(O)N(R).sub.2; M and M' are independently selected from
--C(O)O--, --OC(O)--, --C(O)N(R')--, --P(O)(OR')O--, an aryl group,
and a heteroaryl group; and
[0777] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, and C.sub.2-14
alkenyl.
[0778] In some embodiments, the compound of formula (I) is of the
formula (IIa),
##STR00012##
[0779] or a salt thereof, wherein R.sub.4 is as described
above.
[0780] In some embodiments, the compound of formula (I) is of the
formula (IIb),
##STR00013##
[0781] or a salt thereof, wherein R.sub.4 is as described
above.
[0782] In some embodiments, the compound of formula (I) is of the
formula (IIc),
##STR00014##
[0783] or a salt thereof, wherein R.sub.4 is as described
above.
[0784] In some embodiments, the compound of formula (I) is of the
formula (IIe):
##STR00015##
[0785] or a salt thereof, wherein R.sub.4 is as described
above.
[0786] In some embodiments, the compound of formula (IIa), (IIb),
(IIc), or (IIe) comprises an R.sub.4 which is selected from
--(CH.sub.2).sub.nQ and --(CH.sub.2).sub.nCHQR, wherein Q, R and n
are as defined above.
[0787] In some embodiments, Q is selected from the group consisting
of --OR, --OH, --O(CH.sub.2).sub.nN(R).sub.2, --OC(O)R, --CX.sub.3,
--CN, --N(R)C(O)R, --N(H)C(O)R, --N(R)S(O).sub.2R,
--N(H)S(O).sub.2R, --N(R)C(O)N(R).sub.2, --N(H)C(O)N(R).sub.2,
--N(H)C(O)N(H)(R), --N(R)C(S)N(R).sub.2, --N(H)C(S)N(R).sub.2,
--N(H)C(S)N(H)(R), and a heterocycle, wherein R is as defined
above. In some aspects, n is 1 or 2. In some embodiments, Q is OH,
--NHC(S)N(R).sub.2, or --NHC(O)N(R).sub.2.
[0788] In some embodiments, the compound of formula (I) is of the
formula (IId),
##STR00016##
[0789] or a salt thereof, wherein R.sub.2 and R.sub.3 are
independently selected from the group consisting of C.sub.5-14
alkyl and C.sub.5-14 alkenyl, n is selected from 2, 3, and 4, and
R', R'', R.sub.5, R.sub.6 and m are as defined above.
[0790] In some aspects of the compound of formula (IId), R.sub.2 is
C.sub.8 alkyl. In some aspects of the compound of formula (IId),
R.sub.3 is C.sub.5-C.sub.9 alkyl. In some aspects of the compound
of formula (IId), m is 5, 7, or 9. In some aspects of the compound
of formula (IId), each R.sub.5 is H. In some aspects of the
compound of formula (IId), each R.sub.6 is H.
[0791] In another aspect, the present application provides a lipid
composition (e.g., a lipid nanoparticle (LNP)) comprising: (1) a
compound having the formula (I); (2) optionally a helper lipid
(e.g. a phospholipid); (3) optionally a structural lipid (e.g. a
sterol); (4) optionally a lipid conjugate (e.g. a PEG-lipid); and
(5) optionally a quaternary amine compound. In exemplary
embodiments, the lipid composition (e.g., LNP) further comprises a
polynucleotide encoding an MCM polypeptide, e.g., a polynucleotide
encapsulated therein.
[0792] As used herein, the term "alkyl" or "alkyl group" means a
linear or branched, saturated hydrocarbon including one or more
carbon atoms (e.g., one, two, three, four, five, six, seven, eight,
nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen,
seventeen, eighteen, nineteen, twenty, or more carbon atoms).
[0793] The notation "C.sub.1-14 alkyl" means a linear or branched,
saturated hydrocarbon including 1-14 carbon atoms. An alkyl group
can be optionally substituted.
[0794] As used herein, the term "alkenyl" or "alkenyl group" means
a linear or branched hydrocarbon including two or more carbon atoms
(e.g., two, three, four, five, six, seven, eight, nine, ten,
eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen,
eighteen, nineteen, twenty, or more carbon atoms) and at least one
double bond.
[0795] The notation "C.sub.2-14 alkenyl" means a linear or branched
hydrocarbon including 2-14 carbon atoms and at least one double
bond. An alkenyl group can include one, two, three, four, or more
double bonds. For example, C.sub.18 alkenyl can include one or more
double bonds. A C.sub.18 alkenyl group including two double bonds
can be a linoleyl group. An alkenyl group can be optionally
substituted.
[0796] As used herein, the term "carbocycle" or "carbocyclic group"
means a mono- or multi-cyclic system including one or more rings of
carbon atoms. Rings can be three, four, five, six, seven, eight,
nine, ten, eleven, twelve, thirteen, fourteen, or fifteen membered
rings.
[0797] The notation "C.sub.3-6 carbocycle" means a carbocycle
including a single ring having 3-6 carbon atoms. Carbocycles can
include one or more double bonds and can be aromatic (e.g., aryl
groups). Examples of carbocycles include cyclopropyl, cyclopentyl,
cyclohexyl, phenyl, naphthyl, and 1,2-dihydronaphthyl groups.
Carbocycles can be optionally substituted.
[0798] As used herein, the term "heterocycle" or "heterocyclic
group" means a mono- or multi-cyclic system including one or more
rings, where at least one ring includes at least one heteroatom.
Heteroatoms can be, for example, nitrogen, oxygen, or sulfur atoms.
Rings can be three, four, five, six, seven, eight, nine, ten,
eleven, or twelve membered rings. Heterocycles can include one or
more double bonds and can be aromatic (e.g., heteroaryl groups).
Examples of heterocycles include imidazolyl, imidazolidinyl,
oxazolyl, oxazolidinyl, thiazolyl, thiazolidinyl, pyrazolidinyl,
pyrazolyl, isoxazolidinyl, isoxazolyl, isothiazolidinyl,
isothiazolyl, morpholinyl, pyrrolyl, pyrrolidinyl, furyl,
tetrahydrofuryl, thiophenyl, pyridinyl, piperidinyl, quinolyl, and
isoquinolyl groups. Heterocycles can be optionally substituted.
[0799] As used herein, a "biodegradable group" is a group that can
facilitate faster metabolism of a lipid in a subject. A
biodegradable group can be, but is not limited to, --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
an aryl group, and a heteroaryl group.
[0800] As used herein, an "aryl group" is a carbocyclic group
including one or more aromatic rings. Examples of aryl groups
include phenyl and naphthyl groups.
[0801] As used herein, a "heteroaryl group" is a heterocyclic group
including one or more aromatic rings. Examples of heteroaryl groups
include pyrrolyl, furyl, thiophenyl, imidazolyl, oxazolyl, and
thiazolyl. Both aryl and heteroaryl groups can be optionally
substituted. For example, M and M' can be selected from the
non-limiting group consisting of optionally substituted phenyl,
oxazole, and thiazole. In the formulas herein, M and M' can be
independently selected from the list of biodegradable groups
above.
[0802] Alkyl, alkenyl, and cyclyl (e.g., carbocyclyl and
heterocyclyl) groups can be optionally substituted unless otherwise
specified. Optional substituents can be selected from the group
consisting of, but are not limited to, a halogen atom (e.g., a
chloride, bromide, fluoride, or iodide group), a carboxylic acid
(e.g., --C(O)OH), an alcohol (e.g., a hydroxyl, --OH), an ester
(e.g., --C(O)OR or --OC(O)R), an aldehyde (e.g., --C(O)H), a
carbonyl (e.g., --C(O)R, alternatively represented by C.dbd.O), an
acyl halide (e.g., --C(O)X, in which X is a halide selected from
bromide, fluoride, chloride, and iodide), a carbonate (e.g.,
--OC(O)OR), an alkoxy (e.g., --OR), an acetal (e.g.,
--C(OR).sub.2R'''', in which each OR are alkoxy groups that can be
the same or different and R'''' is an alkyl or alkenyl group), a
phosphate (e.g., P(O).sub.4.sup.3-), a thiol (e.g., --SH), a
sulfoxide (e.g., --S(O)R), a sulfinic acid (e.g., --S(O)OH), a
sulfonic acid (e.g., --S(O).sub.2OH), a thial (e.g., --C(S)H), a
sulfate (e.g., S(O).sub.4.sup.2-), a sulfonyl (e.g.,
--S(O).sub.2--), an amide (e.g., --C(O)NR.sub.2, or --N(R)C(O)R),
an azido (e.g., --N.sub.3), a nitro (e.g., --NO.sub.2), a cyano
(e.g., --CN), an isocyano (e.g., --NC), an acyloxy (e.g.,
--OC(O)R), an amino (e.g., --NR.sub.2, --NRH, or --NH.sub.2), a
carbamoyl (e.g., --OC(O)NR.sub.2, --OC(O)NRH, or --OC(O)NH.sub.2),
a sulfonamide (e.g., --S(O).sub.2NR.sub.2, --S(O).sub.2NRH,
--S(O).sub.2NH.sub.2, --N(R)S(O).sub.2R, --N(H)S(O).sub.2R,
--N(R)S(O).sub.2H, or --N(H)S(O).sub.2H), an alkyl group, an
alkenyl group, and a cyclyl (e.g., carbocyclyl or heterocyclyl)
group.
[0803] In any of the preceding, R is an alkyl or alkenyl group, as
defined herein. In some embodiments, the substituent groups
themselves can be further substituted with, for example, one, two,
three, four, five, or six substituents as defined herein. For
example, a C.sub.1-6 alkyl group can be further substituted with
one, two, three, four, five, or six substituents as described
herein.
[0804] The compounds of any one of formulae (I), (IA), (II), (IIa),
(IIb), (IIc), (IId), and (IIe) include one or more of the following
features when applicable.
[0805] In some embodiments, R.sub.4 is selected from the group
consisting of a C.sub.3-6 carbocycle, --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHQR, and --CQ(R).sub.2, where Q is
selected from a C.sub.3-6 carbocycle, 5- to 14-membered aromatic or
non-aromatic heterocycle having one or more heteroatoms selected
from N, O, S, and P, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR,
--OC(O)R, --CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --N(R).sub.2,
--C(O)N(R).sub.2, --N(R)C(O)R, --N(R)S(O).sub.2R,
--N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2, and
--C(R)N(R).sub.2C(O)OR, and each n is independently selected from
1, 2, 3, 4, and 5.
[0806] In another embodiment, R.sub.4 is selected from the group
consisting of a C.sub.3-6 carbocycle, --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHQR, and --CQ(R).sub.2, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --C(R)N(R).sub.2C(O)OR, and a 5- to
14-membered heterocycloalkyl having one or more heteroatoms
selected from N, O, and S which is substituted with one or more
substituents selected from oxo (.dbd.O), OH, amino, and C.sub.1-3
alkyl, and each n is independently selected from 1, 2, 3, 4, and
5.
[0807] In another embodiment, R.sub.4 is selected from the group
consisting of a C.sub.3-6 carbocycle, --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHQR, and --CQ(R).sub.2, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heterocycle having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --C(R)N(R).sub.2C(O)OR, and each n is
independently selected from 1, 2, 3, 4, and 5; and when Q is a 5-
to 14-membered heterocycle and (i) R.sub.4 is --(CH.sub.2).sub.nQ
in which n is 1 or 2, or (ii) R.sub.4 is --(CH.sub.2).sub.nCHQR in
which n is 1, or (iii) R.sub.4 is --CHQR, and --CQ(R).sub.2, then Q
is either a 5- to 14-membered heteroaryl or 8- to 14-membered
heterocycloalkyl.
[0808] In another embodiment, R.sub.4 is selected from the group
consisting of a C.sub.3-6 carbocycle, --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHQR, and --CQ(R).sub.2, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --C(R)N(R).sub.2C(O)OR, and each n is
independently selected from 1, 2, 3, 4, and 5.
[0809] In another embodiment, R.sub.4 is unsubstituted C.sub.1-4
alkyl, e.g., unsubstituted methyl.
[0810] In certain embodiments, the disclosure provides a compound
having the Formula (I), wherein R.sub.4 is --(CH.sub.2).sub.nQ or
--(CH.sub.2).sub.nCHQR, where Q is --N(R).sub.2, and n is selected
from 3, 4, and 5.
[0811] In certain embodiments, the disclosure provides a compound
having the Formula (I), wherein R.sub.4 is selected from the group
consisting of --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
and --CQ(R).sub.2, where Q is --N(R).sub.2, and n is selected from
1, 2, 3, 4, and 5.
[0812] In certain embodiments, the disclosure provides a compound
having the Formula (I), wherein R.sub.2 and R.sub.3 are
independently selected from the group consisting of C.sub.2-14
alkyl, C.sub.2-14 alkenyl, --R*YR'', --YR'', and --R*OR'', or
R.sub.2 and R.sub.3, together with the atom to which they are
attached, form a heterocycle or carbocycle, and R.sub.4 is
--(CH.sub.2).sub.nQ or --(CH.sub.2).sub.nCHQR, where Q is
--N(R).sub.2, and n is selected from 3, 4, and 5.
[0813] In certain embodiments, R.sub.2 and R.sub.3 are
independently selected from the group consisting of C.sub.2-14
alkyl, C.sub.2-14 alkenyl, --R*YR'', --YR'', and --R*OR'', or
R.sub.2 and R.sub.3, together with the atom to which they are
attached, form a heterocycle or carbocycle.
[0814] In some embodiments, R.sub.1 is selected from the group
consisting of C.sub.5-20 alkyl and C.sub.5-20 alkenyl.
[0815] In other embodiments, R.sub.1 is selected from the group
consisting of --R*YR'', --YR'', and --R''M'R'.
[0816] In certain embodiments, R.sub.1 is selected from --R*YR''
and --YR''. In some embodiments, Y is a cyclopropyl group. In some
embodiments, R* is C.sub.8 alkyl or C.sub.8 alkenyl. In certain
embodiments, R'' is C.sub.3-12 alkyl. For example, R'' can be
C.sub.3 alkyl. For example, R'' can be C.sub.4-8 alkyl (e.g.,
C.sub.4, C.sub.5, C.sub.6, C.sub.7, or C.sub.8 alkyl).
[0817] In some embodiments, R.sub.1 is C.sub.5-20 alkyl. In some
embodiments, R.sub.1 is C.sub.6 alkyl. In some embodiments, R.sub.1
is C.sub.8 alkyl. In other embodiments, R.sub.1 is C.sub.9 alkyl.
In certain embodiments, R.sub.1 is C.sub.14 alkyl. In other
embodiments, R.sub.1 is C.sub.18 alkyl.
[0818] In some embodiments, R.sub.1 is C.sub.5-20 alkenyl. In
certain embodiments, R.sub.1 is C.sub.18 alkenyl. In some
embodiments, R.sub.1 is linoleyl.
[0819] In certain embodiments, R.sub.1 is branched (e.g.,
decan-2-yl, undecan-3-yl, dodecan-4-yl, tridecan-5-yl,
tetradecan-6-yl, 2-methylundecan-3-yl, 2-methyldecan-2-yl,
3-methylundecan-3-yl, 4-methyldodecan-4-yl, or heptadeca-9-yl). In
certain embodiments, R.sub.1 is
##STR00017##
[0820] In certain embodiments, R.sub.1 is unsubstituted C.sub.5-20
alkyl or C.sub.5-20 alkenyl. In certain embodiments, R' is
substituted C.sub.5-20 alkyl or C.sub.5-20 alkenyl (e.g.,
substituted with a C.sub.3-6 carbocycle such as
1-cyclopropylnonyl).
[0821] In other embodiments, R.sub.1 is --R''M'R'.
[0822] In some embodiments, R' is selected from --R*YR'' and
--YR''. In some embodiments, Y is C.sub.3-8 cycloalkyl. In some
embodiments, Y is C.sub.6-10 aryl. In some embodiments, Y is a
cyclopropyl group. In some embodiments, Y is a cyclohexyl group. In
certain embodiments, R* is C.sub.1 alkyl.
[0823] In some embodiments, R'' is selected from the group
consisting of C.sub.3-12 alkyl and C.sub.3-12 alkenyl. In some
embodiments, R'' adjacent to Y is C.sub.1 alkyl. In some
embodiments, R'' adjacent to Y is C.sub.4-9 alkyl (e.g., C.sub.4,
C.sub.5, C.sub.6, C.sub.7 or C.sub.8 or C.sub.9 alkyl).
[0824] In some embodiments, R' is selected from C.sub.4 alkyl and
C.sub.4 alkenyl. In certain embodiments, R' is selected from
C.sub.5 alkyl and C.sub.5 alkenyl. In some embodiments, R' is
selected from C.sub.6 alkyl and C.sub.6 alkenyl. In some
embodiments, R' is selected from C.sub.7 alkyl and C.sub.7 alkenyl.
In some embodiments, R' is selected from C.sub.9 alkyl and C.sub.9
alkenyl.
[0825] In other embodiments, R' is selected from C.sub.11 alkyl and
C.sub.11 alkenyl. In other embodiments, R' is selected from
C.sub.12 alkyl, C.sub.12 alkenyl, C.sub.13 alkyl, C.sub.13 alkenyl,
C.sub.14 alkyl, C.sub.14 alkenyl, C.sub.15 alkyl, C.sub.15 alkenyl,
C.sub.16 alkyl, C.sub.16 alkenyl, C.sub.17 alkyl, C.sub.17 alkenyl,
C.sub.18 alkyl, and C.sub.18 alkenyl. In certain embodiments, R' is
branched (e.g., decan-2-yl, undecan-3-yl, dodecan-4-yl,
tridecan-5-yl, tetradecan-6-yl, 2-methylundecan-3-yl,
2-methyldecan-2-yl, 3-methylundecan-3-yl, 4-methyldodecan-4-yl or
heptadeca-9-yl). In certain embodiments, R' is
##STR00018##
[0826] In certain embodiments, R' is unsubstituted C.sub.1-18
alkyl. In certain embodiments, R' is substituted C.sub.1-18 alkyl
(e.g., C.sub.1-15 alkyl substituted with a C.sub.3-6 carbocycle
such as 1-cyclopropylnonyl).
[0827] In some embodiments, R'' is selected from the group
consisting of C.sub.3-14 alkyl and C.sub.3-14 alkenyl. In some
embodiments, R'' is C.sub.3 alkyl, C.sub.4 alkyl, C.sub.5 alkyl,
C.sub.6 alkyl, C.sub.7 alkyl, or C.sub.8 alkyl. In some
embodiments, R'' is C.sub.9 alkyl, C.sub.10 alkyl, C.sub.11 alkyl,
C.sub.12 alkyl, C.sub.13 alkyl, or C.sub.14 alkyl.
[0828] In some embodiments, M' is --C(O)O--. In some embodiments,
M' is --OC(O)--.
[0829] In other embodiments, M' is an aryl group or heteroaryl
group. For example, M' can be selected from the group consisting of
phenyl, oxazole, and thiazole.
[0830] In some embodiments, M is --C(O)O-- In some embodiments, M
is --OC(O)--. In some embodiments, M is --C(O)N(R')--. In some
embodiments, M is --P(O)(OR')O--.
[0831] In other embodiments, M is an aryl group or heteroaryl
group. For example, M can be selected from the group consisting of
phenyl, oxazole, and thiazole.
[0832] In some embodiments, M is the same as M'. In other
embodiments, M is different from M'.
[0833] In some embodiments, each R.sub.5 is H. In certain such
embodiments, each R.sub.6 is also H.
[0834] In some embodiments, R.sub.7 is H. In other embodiments,
R.sub.7 is C.sub.1-3 alkyl (e.g., methyl, ethyl, propyl, or
i-propyl).
[0835] In some embodiments, R.sub.2 and R.sub.3 are independently
C.sub.5-14 alkyl or C.sub.5-14 alkenyl.
[0836] In some embodiments, R.sub.2 and R.sub.3 are the same. In
some embodiments, R.sub.2 and R.sub.3 are C.sub.8 alkyl. In certain
embodiments, R.sub.2 and R.sub.3 are C.sub.2 alkyl. In other
embodiments, R.sub.2 and R.sub.3 are C.sub.3 alkyl. In some
embodiments, R.sub.2 and R.sub.3 are C.sub.4 alkyl. In certain
embodiments, R.sub.2 and R.sub.3 are C.sub.5 alkyl. In other
embodiments, R.sub.2 and R.sub.3 are C.sub.6 alkyl. In some
embodiments, R.sub.2 and R.sub.3 are C.sub.7 alkyl.
[0837] In other embodiments, R.sub.2 and R.sub.3 are different. In
certain embodiments, R.sub.2 is C.sub.8 alkyl. In some embodiments,
R.sub.3 is C.sub.1-7 (e.g., C.sub.1, C.sub.2, C.sub.3, C.sub.4,
C.sub.5, C.sub.6, or C.sub.7 alkyl) or C.sub.9 alkyl.
[0838] In some embodiments, R.sub.7 and R.sub.3 are H.
[0839] In certain embodiments, R.sub.2 is H.
[0840] In some embodiments, m is 5, 7, or 9.
[0841] In some embodiments, R.sub.4 is selected from
--(CH.sub.2).sub.nQ and --(CH.sub.2).sub.nCHQR.
[0842] In some embodiments, Q is selected from the group consisting
of --OR, --OH, --O(CH.sub.2).sub.nN(R).sub.2, --OC(O)R, --CX.sub.3,
--CN, --N(R)C(O)R, --N(H)C(O)R, --N(R)S(O).sub.2R,
--N(H)S(O).sub.2R, --N(R)C(O)N(R).sub.2, --N(H)C(O)N(R).sub.2,
--N(H)C(O)N(H)(R), --N(R)C(S)N(R).sub.2, --N(H)C(S)N(R).sub.2,
--N(H)C(S)N(H)(R), --C(R)N(R).sub.2C(O)OR, a carbocycle, and a
heterocycle.
[0843] In certain embodiments, Q is --OH.
[0844] In certain embodiments, Q is a substituted or unsubstituted
5- to 10-membered heteroaryl, e.g., Q is an imidazole, a
pyrimidine, a purine, 2-amino-1,9-dihydro-6H-purin-6-one-9-yl (or
guanin-9-yl), adenin-9-yl, cytosin-1-yl, or uracil-1-yl. In certain
embodiments, Q is a substituted 5- to 14-membered heterocycloalkyl,
e.g., substituted with one or more substituents selected from oxo
(.dbd.O), OH, amino, and C.sub.1-3 alkyl. For example, Q is
4-methylpiperazinyl, 4-(4-methoxybenzyl)piperazinyl, or
isoindolin-2-yl-1,3-dione.
[0845] In certain embodiments, Q is an unsubstituted or substituted
C.sub.6-10 aryl (such as phenyl) or C.sub.3-6 cycloalkyl.
[0846] In some embodiments, n is 1. In other embodiments, n is 2.
In further embodiments, n is 3. In certain other embodiments, n is
4. For example, R.sub.4 can be --(CH.sub.2).sub.2OH. For example,
R.sub.4 can be --(CH.sub.2).sub.3OH. For example, R.sub.4 can be
--(CH.sub.2).sub.4OH. For example, R.sub.4 can be benzyl. For
example, R.sub.4 can be 4-methoxybenzyl.
[0847] In some embodiments, R.sub.4 is a C.sub.3-6 carbocycle. In
some embodiments, R.sub.4 is a C.sub.3-6 cycloalkyl. For example,
R.sub.4 can be cyclohexyl optionally substituted with e.g., OH,
halo, C.sub.1-6 alkyl, etc. For example, R.sub.4 can be
2-hydroxycyclohexyl.
[0848] In some embodiments, R is H.
[0849] In some embodiments, R is unsubstituted C.sub.1-3 alkyl or
unsubstituted C.sub.2-3 alkenyl. For example, R.sub.4 can be
--CH.sub.2CH(OH)CH.sub.3 or --CH.sub.2CH(OH)CH.sub.2CH.sub.3.
[0850] In some embodiments, R is substituted C.sub.1-3 alkyl, e.g.,
CH.sub.2OH. For example, R.sub.4 can be
--CH.sub.2CH(OH)CH.sub.2OH.
[0851] In some embodiments, R.sub.2 and R.sub.3, together with the
atom to which they are attached, form a heterocycle or carbocycle.
In some embodiments, R.sub.2 and R.sub.3, together with the atom to
which they are attached, form a 5- to 14-membered aromatic or
non-aromatic heterocycle having one or more heteroatoms selected
from N, O, S, and P. In some embodiments, R.sub.2 and R.sub.3,
together with the atom to which they are attached, form an
optionally substituted C.sub.3-20 carbocycle (e.g., C.sub.3-18
carbocycle, C.sub.3-15 carbocycle, C.sub.3-12 carbocycle, or
C.sub.3-10 carbocycle), either aromatic or non-aromatic. In some
embodiments, R.sub.2 and R.sub.3, together with the atom to which
they are attached, form a C.sub.3-6 carbocycle. In other
embodiments, R.sub.2 and R.sub.3, together with the atom to which
they are attached, form a C.sub.6 carbocycle, such as a cyclohexyl
or phenyl group. In certain embodiments, the heterocycle or
C.sub.3-6 carbocycle is substituted with one or more alkyl groups
(e.g., at the same ring atom or at adjacent or non-adjacent ring
atoms). For example, R.sub.2 and R.sub.3, together with the atom to
which they are attached, can form a cyclohexyl or phenyl group
bearing one or more C.sub.5 alkyl substitutions. In certain
embodiments, the heterocycle or C.sub.3-6 carbocycle formed by
R.sub.2 and R.sub.3, is substituted with a carbocycle groups. For
example, R.sub.2 and R.sub.3, together with the atom to which they
are attached, can form a cyclohexyl or phenyl group that is
substituted with cyclohexyl. In some embodiments, R.sub.2 and
R.sub.3, together with the atom to which they are attached, form a
C.sub.7-15 carbocycle, such as a cycloheptyl, cyclopentadecanyl, or
naphthyl group.
[0852] In some embodiments, R.sub.4 is selected from
--(CH.sub.2).sub.nQ and --(CH.sub.2).sub.nCHQR. In some
embodiments, Q is selected from the group consisting of --OR, --OH,
--O(CH.sub.2).sub.nN(R).sub.2, --OC(O)R, --CX.sub.3, --CN,
--N(R)C(O)R, --N(H)C(O)R, --N(R)S(O).sub.2R, --N(H)S(O).sub.2R,
--N(R)C(O)N(R).sub.2, --N(H)C(O)N(R).sub.2, --N(H)C(O)N(H)(R),
--N(R)C(S)N(R).sub.2, --N(H)C(S)N(R).sub.2, --N(H)C(S)N(H)(R), and
a heterocycle. In other embodiments, Q is selected from the group
consisting of an imidazole, a pyrimidine, and a purine.
[0853] In some embodiments, R.sub.2 and R.sub.3, together with the
atom to which they are attached, form a heterocycle or carbocycle.
In some embodiments, R.sub.2 and R.sub.3, together with the atom to
which they are attached, form a C.sub.3-6 carbocycle, such as a
phenyl group. In certain embodiments, the heterocycle or C.sub.3-6
carbocycle is substituted with one or more alkyl groups (e.g., at
the same ring atom or at adjacent or non-adjacent ring atoms). For
example, R.sub.2 and R.sub.3, together with the atom to which they
are attached, can form a phenyl group bearing one or more C.sub.5
alkyl substitutions.
[0854] In some embodiments, the pharmaceutical compositions of the
present disclosure, the compound of formula (I) is selected from
the group consisting of:
##STR00019## ##STR00020## ##STR00021## ##STR00022## ##STR00023##
##STR00024## ##STR00025## ##STR00026## ##STR00027## ##STR00028##
##STR00029## ##STR00030## ##STR00031## ##STR00032## ##STR00033##
##STR00034## ##STR00035## ##STR00036## ##STR00037## ##STR00038##
##STR00039## ##STR00040## ##STR00041## ##STR00042## ##STR00043##
##STR00044## ##STR00045## ##STR00046## ##STR00047##
and salts or stereoisomers thereof.
[0855] The central amine moiety of a lipid according to formula (I)
is typically protonated (i.e., positively charged) at a pH below
the pKa of the amino moiety and is substantially not charged at a
pH above the pKa. Such lipids can be referred to ionizable amino
lipids.
[0856] In one specific embodiment, the compound of formula (I) is
Compound 18.
[0857] In some embodiments, the amount of the compound of formula
(I) ranges from about 1 mol % to 99 mol % in the lipid
composition.
[0858] In one embodiment, the amount of the compound of formula (I)
is at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,
15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48,
49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65,
66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82,
83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or
99 mol % in the lipid composition.
[0859] In one embodiment, the amount of the compound of formula (I)
ranges from about 30 mol % to about 70 mol %, from about 35 mol %
to about 65 mol %, from about 40 mol % to about 60 mol %, and from
about 45 mol % to about 55 mol % in the lipid composition.
[0860] In one specific embodiment, the amount of the compound of
formula (I) is about 50 mol % in the lipid composition.
[0861] In addition to the compound of formula (I), the lipid
composition of the pharmaceutical compositions disclosed herein can
comprise additional components such as phospholipids, structural
lipids, quaternary amine compounds, PEG-lipids, and any combination
thereof.
[0862] b. Additional Components in the Lipid Composition
[0863] (i) Phospholipids
[0864] The lipid composition of the pharmaceutical composition
disclosed herein can comprise one or more phospholipids, for
example, one or more saturated or (poly)unsaturated phospholipids
or a combination thereof. In general, phospholipids comprise a
phospholipid moiety and one or more fatty acid moieties. For
example, a phospholipid can be a lipid according to formula
(III):
##STR00048##
in which R.sub.p represents a phospholipid moiety and R.sub.1 and
R.sub.2 represent fatty acid moieties with or without unsaturation
that can be the same or different.
[0865] A phospholipid moiety can be selected, for example, from the
non-limiting group consisting of phosphatidyl choline, phosphatidyl
ethanolamine, phosphatidyl glycerol, phosphatidyl serine,
phosphatidic acid, 2-lysophosphatidyl choline, and a
sphingomyelin.
[0866] A fatty acid moiety can be selected, for example, from the
non-limiting group consisting of lauric acid, myristic acid,
myristoleic acid, palmitic acid, palmitoleic acid, stearic acid,
oleic acid, linoleic acid, alpha-linolenic acid, erucic acid,
phytanoic acid, arachidic acid, arachidonic acid, eicosapentaenoic
acid, behenic acid, docosapentaenoic acid, and docosahexaenoic
acid.
[0867] Particular phospholipids can facilitate fusion to a
membrane. For example, a cationic phospholipid can interact with
one or more negatively charged phospholipids of a membrane (e.g., a
cellular or intracellular membrane). Fusion of a phospholipid to a
membrane can allow one or more elements (e.g., a therapeutic agent)
of a lipid-containing composition (e.g., LNPs) to pass through the
membrane permitting, e.g., delivery of the one or more elements to
a target tissue (e.g., tumoral tissue).
[0868] Non-natural phospholipid species including natural species
with modifications and substitutions including branching,
oxidation, cyclization, and alkynes are also contemplated. For
example, a phospholipid can be functionalized with or cross-linked
to one or more alkynes (e.g., an alkenyl group in which one or more
double bonds is replaced with a triple bond). Under appropriate
reaction conditions, an alkyne group can undergo a copper-catalyzed
cycloaddition upon exposure to an azide. Such reactions can be
useful in functionalizing a lipid bilayer of a nanoparticle
composition to facilitate membrane permeation or cellular
recognition or in conjugating a nanoparticle composition to a
useful component such as a targeting or imaging moiety (e.g., a
dye).
[0869] Phospholipids include, but are not limited to,
glycerophospholipids such as phosphatidylcholines,
phosphatidylethanolamines, phosphatidylserines,
phosphatidylinositols, phosphatidy glycerols, and phosphatidic
acids. Phospholipids also include phosphosphingolipid, such as
sphingomyelin. In some embodiments, a pharmaceutical composition
for intratumoral delivery disclosed herein can comprise more than
one phospholipid. When more than one phospholipid is used, such
phospholipids can belong to the same phospholipid class (e.g., MSPC
and DSPC) or different classes (e.g., MSPC and MSPE).
[0870] Phospholipids can be of a symmetric or an asymmetric type.
As used herein, the term "symmetric phospholipid" includes
glycerophospholipids having matching fatty acid moieties and
sphingolipids in which the variable fatty acid moiety and the
hydrocarbon chain of the sphingosine backbone include a comparable
number of carbon atoms. As used herein, the term "asymmetric
phospholipid" includes lysolipids, glycerophospholipids having
different fatty acid moieties (e.g., fatty acid moieties with
different numbers of carbon atoms and/or unsaturations (e.g.,
double bonds)), and sphingolipids in which the variable fatty acid
moiety and the hydrocarbon chain of the sphingosine backbone
include a dissimilar number of carbon atoms (e.g., the variable
fatty acid moiety include at least two more carbon atoms than the
hydrocarbon chain or at least two fewer carbon atoms than the
hydrocarbon chain).
[0871] In some embodiments, the lipid composition of a
pharmaceutical composition disclosed herein comprises at least one
symmetric phospholipid. Symmetric phospholipids can be selected
from the non-limiting group consisting of
[0872] 1,2-dipropionyl-sn-glycero-3-phosphocholine (03:0 PC),
[0873] 1,2-dibutyryl-sn-glycero-3-phosphocholine (04:0 PC),
[0874] 1,2-dipentanoyl-sn-glycero-3-phosphocholine (05:0 PC),
[0875] 1,2-dihexanoyl-sn-glycero-3-phosphocholine (06:0 PC),
[0876] 1,2-diheptanoyl-sn-glycero-3-phosphocholine (07:0 PC),
[0877] 1,2-dioctanoyl-sn-glycero-3-phosphocholine (08:0 PC),
[0878] 1,2-dinonanoyl-sn-glycero-3-phosphocholine (09:0 PC),
[0879] 1,2-didecanoyl-sn-glycero-3-phosphocholine (10:0 PC),
[0880] 1,2-diundecanoyl-sn-glycero-3-phosphocholine (11:0 PC,
DUPC),
[0881] 1,2-dilauroyl-sn-glycero-3-phosphocholine (12:0 PC),
[0882] 1,2-ditridecanoyl-sn-glycero-3-phosphocholine (13:0 PC),
[0883] 1,2-dimyristoyl-sn-glycero-3-phosphocholine (14:0 PC,
DMPC),
[0884] 1,2-dipentadecanoyl-sn-glycero-3-phosphocholine (15:0
PC),
[0885] 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (16:0 PC,
DPPC),
[0886] 1,2-diphytanoyl-sn-glycero-3-phosphocholine (4ME 16:0
PC),
[0887] 1,2-diheptadecanoyl-sn-glycero-3-phosphocholine (17:0
PC),
[0888] 1,2-distearoyl-sn-glycero-3-phosphocholine (18:0 PC,
DSPC),
[0889] 1,2-dinonadecanoyl-sn-glycero-3-phosphocholine (19:0
PC),
[0890] 1,2-diarachidoyl-sn-glycero-3-phosphocholine (20:0 PC),
[0891] 1,2-dihenarachidoyl-sn-glycero-3-phosphocholine (21:0
PC),
[0892] 1,2-dibehenoyl-sn-glycero-3-phosphocholine (22:0 PC),
[0893] 1,2-ditricosanoyl-sn-glycero-3-phosphocholine (23:0 PC),
[0894] 1,2-dilignoceroyl-sn-glycero-3-phosphocholine (24:0 PC),
[0895] 1,2-dimyristoleoyl-sn-glycero-3-phosphocholine (14:1
(.DELTA.9-Cis) PC),
[0896] 1,2-dimyristelaidoyl-sn-glycero-3-phosphocholine (14:1
(.DELTA.9-Trans) PC),
[0897] 1,2-dipalmitoleoyl-sn-glycero-3-phosphocholine (16:1
(.DELTA.9-Cis) PC),
[0898] 1,2-dipalmitelaidoyl-sn-glycero-3-phosphocholine (16:1
(.DELTA.9-Trans) PC),
[0899] 1,2-dipetroselenoyl-sn-glycero-3-phosphocholine (18:1
(.DELTA.6-Cis) PC),
[0900] 1,2-dioleoyl-sn-glycero-3-phosphocholine (18:1
(.DELTA.9-Cis) PC, DOPC),
[0901] 1,2-dielaidoyl-sn-glycero-3-phosphocholine (18:1
(.DELTA.9-Trans) PC),
[0902] 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (18:2 (Cis) PC,
DLPC),
[0903] 1,2-dilinolenoyl-sn-glycero-3-phosphocholine (18:3 (Cis) PC,
DLnPC),
[0904] 1,2-dieicosenoyl-sn-glycero-3-phosphocholine (20:1 (Cis)
PC),
[0905] 1,2-diarachidonoyl-sn-glycero-3-phosphocholine (20:4 (Cis)
PC, DAPC),
[0906] 1,2-dierucoyl-sn-glycero-3-phosphocholine (22:1 (Cis)
PC),
[0907] 1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine (22:6
(Cis) PC, DHAPC),
[0908] 1,2-dinervonoyl-sn-glycero-3-phosphocholine (24:1 (Cis)
PC),
[0909] 1,2-dihexanoyl-sn-glycero-3-phosphoethanolamine (06:0
PE),
[0910] 1,2-dioctanoyl-sn-glycero-3-phosphoethanolamine (08:0
PE),
[0911] 1,2-didecanoyl-sn-glycero-3-phosphoethanolamine (10:0
PE),
[0912] 1,2-dilauroyl-sn-glycero-3-phosphoethanolamine (12:0
PE),
[0913] 1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine (14:0
PE),
[0914] 1,2-dipentadecanoyl-sn-glycero-3-phosphoethanolamine (15:0
PE),
[0915] 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (16:0
PE),
[0916] 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (4ME 16:0
PE),
[0917] 1,2-diheptadecanoyl-sn-glycero-3-phosphoethanolamine (17:0
PE),
[0918] 1,2-distearoyl-sn-glycero-3-phosphoethanolamine (18:0 PE,
DSPE),
[0919] 1,2-dipalmitoleoyl-sn-glycero-3-phosphoethanolamine (16:1
PE),
[0920] 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (18:1
(.DELTA.9-Cis) PE, DOPE),
[0921] 1,2-dielaidoyl-sn-glycero-3-phosphoethanolamine (18:1
(.DELTA.9-Trans) PE),
[0922] 1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine (18:2 PE,
DLPE),
[0923] 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine (18:3 PE,
DLnPE),
[0924] 1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine (20:4
PE, DAPE),
[0925] 1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine (22:6
PE, DHAPE),
[0926] 1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0
Diether PC),
[0927] 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium
salt (DOPG), and
[0928] any combination thereof.
[0929] In some embodiments, the lipid composition of a
pharmaceutical composition disclosed herein comprises at least one
symmetric phospholipid selected from the non-limiting group
consisting of DLPC, DMPC, DOPC, DPPC, DSPC, DUPC, 18:0 Diether PC,
DLnPC, DAPC, DHAPC, DOPE, 4ME 16:0 PE, DSPE, DLPE, DLnPE, DAPE,
DHAPE, DOPG, and any combination thereof.
[0930] In some embodiments, the lipid composition of a
pharmaceutical composition disclosed herein comprises at least one
asymmetric phospholipid. Asymmetric phospholipids can be selected
from the non-limiting group consisting of
[0931] 1-myristoyl-2-palmitoyl-sn-glycero-3-phosphocholine
(14:0-16:0 PC, MPPC),
[0932] 1-myristoyl-2-stearoyl-sn-glycero-3-phosphocholine
(14:0-18:0 PC, MSPC),
[0933] 1-palmitoyl-2-acetyl-sn-glycero-3-phosphocholine (16:0-02:0
PC),
[0934] 1-palmitoyl-2-myristoyl-sn-glycero-3-phosphocholine
(16:0-14:0 PC, PMPC),
[0935] 1-palmitoyl-2-stearoyl-sn-glycero-3-phosphocholine
(16:0-18:0 PC, PSPC),
[0936] 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (16:0-18:1
PC, POPC),
[0937] 1-palmitoyl-2-linoleoyl-sn-glycero-3-phosphocholine
(16:0-18:2 PC, PLPC),
[0938] 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine
(16:0-20:4 PC),
[0939] 1-palmitoyl-2-docosahexaenoyl-sn-glycero-3-phosphocholine
(14:0-22:6 PC),
[0940] 1-stearoyl-2-myristoyl-sn-glycero-3-phosphocholine
(18:0-14:0 PC, SMPC),
[0941] 1-stearoyl-2-palmitoyl-sn-glycero-3-phosphocholine
(18:0-16:0 PC, SPPC),
[0942] 1-stearoyl-2-oleoyl-sn-glycero-3-phosphocholine (18:0-18:1
PC, SOPC),
[0943] 1-stearoyl-2-linoleoyl-sn-glycero-3-phosphocholine
(18:0-18:2 PC),
[0944] 1-stearoyl-2-arachidonoyl-sn-glycero-3-phosphocholine
(18:0-20:4 PC),
[0945] 1-stearoyl-2-docosahexaenoyl-sn-glycero-3-phosphocholine
(18:0-22:6 PC),
[0946] 1-oleoyl-2-myristoyl-sn-glycero-3-phosphocholine (18:1-14:0
PC, OMPC),
[0947] 1-oleoyl-2-palmitoyl-sn-glycero-3-phosphocholine (18:1-16:0
PC, OPPC),
[0948] 1-oleoyl-2-stearoyl-sn-glycero-3-phosphocholine (18:1-18:0
PC, OSPC),
[0949] 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
(16:0-18:1 PE, POPE),
[0950] 1-palmitoyl-2-linoleoyl-sn-glycero-3-phosphoethanolamine
(16:0-18:2 PE),
[0951] 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphoethanolamine
(16:0-20:4 PE),
[0952]
1-palmitoyl-2-docosahexaenoyl-sn-glycero-3-phosphoethanolamine
(16:0-22:6 PE),
[0953] 1-stearoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
(18:0-18:1 PE),
[0954] 1-stearoyl-2-linoleoyl-sn-glycero-3-phosphoethanolamine
(18:0-18:2 PE),
[0955] 1-stearoyl-2-arachidonoyl-sn-glycero-3-phosphoethanolamine
(18:0-20:4 PE),
[0956]
1-stearoyl-2-docosahexaenoyl-sn-glycero-3-phosphoethanolamine
(18:0-22:6 PE),
[0957]
1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine
(OChemsPC), and
[0958] any combination thereof.
[0959] Asymmetric lipids useful in the lipid composition can also
be lysolipids. Lysolipids can be selected from the non-limiting
group consisting of
[0960] 1-hexanoyl-2-hydroxy-sn-glycero-3-phosphocholine (06:0 Lyso
PC),
[0961] 1-heptanoyl-2-hydroxy-sn-glycero-3-phosphocholine (07:0 Lyso
PC),
[0962] 1-octanoyl-2-hydroxy-sn-glycero-3-phosphocholine (08:0 Lyso
PC),
[0963] 1-nonanoyl-2-hydroxy-sn-glycero-3-phosphocholine (09:0 Lyso
PC),
[0964] 1-decanoyl-2-hydroxy-sn-glycero-3-phosphocholine (10:0 Lyso
PC),
[0965] 1-undecanoyl-2-hydroxy-sn-glycero-3-phosphocholine (11:0
Lyso PC),
[0966] 1-lauroyl-2-hydroxy-sn-glycero-3-phosphocholine (12:0 Lyso
PC),
[0967] 1-tridecanoyl-2-hydroxy-sn-glycero-3-phosphocholine (13:0
Lyso PC),
[0968] 1-myristoyl-2-hydroxy-sn-glycero-3-phosphocholine (14:0 Lyso
PC),
[0969] 1-pentadecanoyl-2-hydroxy-sn-glycero-3-phosphocholine (15:0
Lyso PC),
[0970] 1-palmitoyl-2-hydroxy-sn-glycero-3-phosphocholine (16:0 Lyso
PC),
[0971] 1-heptadecanoyl-2-hydroxy-sn-glycero-3-phosphocholine (17:0
Lyso PC),
[0972] 1-stearoyl-2-hydroxy-sn-glycero-3-phosphocholine (18:0 Lyso
PC),
[0973] 1-oleoyl-2-hydroxy-sn-glycero-3-phosphocholine (18:1 Lyso
PC),
[0974] 1-nonadecanoyl-2-hydroxy-sn-glycero-3-phosphocholine (19:0
Lyso PC),
[0975] 1-arachidoyl-2-hydroxy-sn-glycero-3-phosphocholine (20:0
Lyso PC),
[0976] 1-behenoyl-2-hydroxy-sn-glycero-3-phosphocholine (22:0 Lyso
PC),
[0977] 1-lignoceroyl-2-hydroxy-sn-glycero-3-phosphocholine (24:0
Lyso PC),
[0978] 1-hexacosanoyl-2-hydroxy-sn-glycero-3-phosphocholine (26:0
Lyso PC),
[0979] 1-myristoyl-2-hydroxy-sn-glycero-3-phosphoethanolamine (14:0
Lyso PE),
[0980] 1-palmitoyl-2-hydroxy-sn-glycero-3-phosphoethanolamine (16:0
Lyso PE),
[0981] 1-stearoyl-2-hydroxy-sn-glycero-3-phosphoethanolamine (18:0
Lyso PE),
[0982] 1-oleoyl-2-hydroxy-sn-glycero-3-phosphoethanolamine (18:1
Lyso PE),
[0983] 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC),
and
[0984] any combination thereof.
[0985] In some embodiment, the lipid composition of a
pharmaceutical composition disclosed herein comprises at least one
asymmetric phospholipid selected from the group consisting of MPPC,
MSPC, PMPC, PSPC, SMPC, SPPC, and any combination thereof. In some
embodiments, the asymmetric phospholipid is
1-myristoyl-2-stearoyl-sn-glycero-3-phosphocholine (MSPC).
[0986] In some embodiments, the lipid compositions disclosed herein
can contain one or more symmetric phospholipids, one or more
asymmetric phospholipids, or a combination thereof. When multiple
phospholipids are present, they can be present in equimolar ratios,
or non-equimolar ratios.
[0987] In one embodiment, the lipid composition of a pharmaceutical
composition disclosed herein comprises a total amount of
phospholipid (e.g., MSPC) which ranges from about 1 mol % to about
20 mol %, from about 5 mol %to about 20 mol %, from about 10 mol %
to about 20 mol %, from about 15 mol % to about 20 mol %, from
about 1 mol % to about 15 mol %, from about 5 mol % to about 15 mol
%, from about 10 mol % to about 15 mol %, from about 5 mol % to
about 10 mol % in the lipid composition. In one embodiment, the
amount of the phospholipid is from about 8 mol % to about 15 mol %
in the lipid composition. In one embodiment, the amount of the
phospholipid (e.g., MSPC) is about 10 mol % in the lipid
composition.
[0988] In some aspects, the amount of a specific phospholipid
(e.g., MSPC) is at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14, 15, 16, 17, 18, 19 or 20 mol % in the lipid
composition.
[0989] (ii) Quaternary Amine Compounds
[0990] The lipid composition of a pharmaceutical composition
disclosed herein can comprise one or more quaternary amine
compounds (e.g., DOTAP). The term "quaternary amine compound" is
used to include those compounds having one or more quaternary amine
groups (e.g., trialkylamino groups) and permanently carrying a
positive charge and existing in a form of a salt. For example, the
one or more quaternary amine groups can be present in a lipid or a
polymer (e.g., PEG). In some embodiments, the quaternary amine
compound comprises (1) a quaternary amine group and (2) at least
one hydrophobic tail group comprising (i) a hydrocarbon chain,
linear or branched, and saturated or unsaturated, and (ii)
optionally an ether, ester, carbonyl, or ketal linkage between the
quaternary amine group and the hydrocarbon chain. In some
embodiments, the quaternary amine group can be a trimethylammonium
group. In some embodiments, the quaternary amine compound comprises
two identical hydrocarbon chains. In some embodiments, the
quaternary amine compound comprises two different hydrocarbon
chains.
[0991] In some embodiments, the lipid composition of a
pharmaceutical composition disclosed herein comprises at least one
quaternary amine compound. Quaternary amine compound can be
selected from the non-limiting group consisting of [0992]
1,2-dioleoyl-3-trimethylammonium-propane (DOTAP), [0993]
N-[1-(2,3-dioleoyloxy)propyl]-N,N,N-trimethylammonium chloride
(DOTMA), [0994]
1-[2-(oleoyloxy)ethyl]-2-oleyl-3-(2-hydroxyethyl)imidazolinium
chloride (DOTIM), [0995]
2,3-dioleyloxy-N-[2(sperminecarboxamido)ethyl]-N,N-dimethyl-1-propanamini-
um trifluoroacetate (DOSPA), [0996]
N,N-distearyl-N,N-dimethylammonium bromide (DDAB), [0997]
N-(1,2-dimyristyloxyprop-3-yl)-N,N-dimethyl-N-hydroxyethyl ammonium
bromide (DMRIE), [0998]
N-(1,2-dioleoyloxyprop-3-yl)-N,N-dimethyl-N-hydroxyethyl ammonium
bromide (DORIE), [0999] N,N-dioleyl-N,N-dimethylammonium chloride
(DODAC), [1000] 1,2-dilauroyl-sn-glycero-3-ethylphosphocholine
(DLePC), [1001] 1,2-distearoyl-3-trimethylammonium-propane (DSTAP),
[1002] 1,2-dipalmitoyl-3-trimethylammonium-propane (DPTAP), [1003]
1,2-dilinoleoyl-3-trimethylammonium-propane (DLTAP), [1004]
1,2-dimyristoyl-3-trimethylammonium-propane (DMTAP) [1005]
1,2-distearoyl -sn-glycero-3-ethylphosphocholine (DSePC) [1006]
1,2-dipalmitoyl-sn-glycero-3-ethylphosphocholine (DPePC), [1007]
1,2-dimyristoyl -sn-glycero-3-ethylphosphocholine (DMePC), [1008]
1,2-dioleoyl-sn-glycero-3-ethylphosphocholine (DOePC), [1009]
1,2-di-(9Z-tetradecenoyl)-sn-glycero-3-ethylphosphocholine (14:1
EPC), [1010] 1-palmitoyl-2-oleoyl-sn-glycero-3-ethylphosphocholine
(16:0-18:1 EPC), [1011] and any combination thereof.
[1012] In one embodiment, the quaternary amine compound is
1,2-dioleoyl-3-trimethylammonium-propane (DOTAP).
[1013] Quaternary amine compounds are known in the art, such as
those described in US 2013/0245107 A1, US 2014/0363493 A1, U.S.
Pat. No. 8,158,601, WO 2015/123264 A1, and WO 2015/148247 A1, which
are incorporated herein by reference in their entirety.
[1014] In one embodiment, the amount of the quaternary amine
compound (e.g., DOTAP) in the lipid composition disclosed herein
ranges from about 0.01 mol % to about 20 mol %.
[1015] In one embodiment, the amount of the quaternary amine
compound (e.g., DOTAP) in the lipid composition disclosed herein
ranges from about 0.5 mol % to about 20 mol %, from about 0.5 mol %
to about 15 mol %, from about 0.5 mol % to about 10 mol %, from
about 1 mol % to about 20 mol %, from about 1 mol % to about 15 mol
%, from about 1 mol % to about 10 mol %, from about 2 mol % to
about 20 mol %, from about 2 mol % to about 15 mol %, from about 2
mol % to about 10 mol %, from about 3 mol % to about 20 mol %, from
about 3 mol % to about 15 mol %, from about 3 mol % to about 10 mol
%, from about 4 mol % to about 20 mol %, from about 4 mol % to
about 15 mol %, from about 4 mol % to about 10 mol %, from about 5
mol % to about 20 mol %, from about 5 mol % to about 15 mol %, from
about 5 mol % to about 10 mol %, from about 6 mol % to about 20 mol
%, from about 6 mol % to about 15 mol %, from about 6 mol % to
about 10 mol %, from about 7 mol % to about 20 mol %, from about 7
mol % to about 15 mol %, from about 7 mol % to about 10 mol %, from
about 8 mol % to about 20 mol %, from about 8 mol % to about 15 mol
%, from about 8 mol % to about 10 mol %, from about 9 mol % to
about 20 mol %, from about 9 mol % to about 15 mol %, from about 9
mol % to about 10 mol %.
[1016] In one embodiment, the amount of the quaternary amine
compound (e.g., DOTAP) in the lipid composition disclosed herein
ranges from about 5 mol % to about 10 mol %.
[1017] In one embodiment, the amount of the quaternary amine
compound (e.g., DOTAP) in the lipid composition disclosed herein is
about 5 mol %. In one embodiment, the amount of the quaternary
amine compound (e.g., DOTAP) in the lipid composition disclosed
herein is about 10 mol %.
[1018] In some embodiments, the amount of the quaternary amine
compound (e.g., DOTAP) is at least about 0.01, 0.02, 0.03, 0.04,
0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7,
0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5,
8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 12.5, 13, 13.5, 14, 14.5,
15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5 or 20 mol % in the
lipid composition disclosed herein.
[1019] In one embodiment, the mole ratio of the compound of formula
(I) (e.g., Compounds 18, 25, 26 or 48) to the quaternary amine
compound (e.g., DOTA) is about 100:1 to about 2.5:1. In one
embodiment, the mole ratio of the compound of formula (I) (e.g.,
Compounds 18, 25, 26 or 48) to the quaternary amine compound (e.g.,
DOTAP) is about 90:1, about 80:1, about 70:1, about 60:1, about
50:1, about 40:1, about 30:1, about 20:1, about 15:1, about 10:1,
about 9:1, about 8:1, about 7:1, about 6:1, about 5:1, or about
2.5:1. In one embodiment, the mole ratio of the compound of formula
(I) (e.g., Compounds 18, 25, 26 or 48) to the quaternary amine
compound (e.g., DOTAP) in the lipid composition disclosed herein is
about 10:1.
[1020] In some aspects, the lipid composition the pharmaceutical
compositions disclosed herein does not comprise a quaternary amine
compound. In some aspects, the lipid composition of the
pharmaceutical compositions disclosed does not comprise DOTAP.
[1021] (iii) Structural Lipids
[1022] The lipid composition of a pharmaceutical composition
disclosed herein can comprise one or more structural lipids. As
used herein, the term "structural lipid" refers to sterols and also
to lipids containing sterol moieties. In some embodiments, the
structural lipid is selected from the group consisting of
cholesterol, fecosterol, sitosterol, ergosterol, campesterol,
stigmasterol, brassicasterol, tomatidine, tomatine, ursolic acid,
alpha-tocopherol, and mixtures thereof. In some embodiments, the
structural lipid is cholesterol.
[1023] In one embodiment, the amount of the structural lipid (e.g.,
an sterol such as cholesterol) in the lipid composition of a
pharmaceutical composition disclosed herein ranges from about 20
mol % to about 60 mol %, from about 25 mol % to about 55 mol %,
from about 30 mol % to about 50 mol %, or from about 35 mol % to
about 45 mol %.
[1024] In one embodiment, the amount of the structural lipid (e.g.,
an sterol such as cholesterol) in the lipid composition disclosed
herein ranges from about 25 mol % to about 30 mol %, from about 30
mol % to about 35 mol %, or from about 35 mol % to about 40 mol
%.
[1025] In one embodiment, the amount of the structural lipid (e.g.,
a sterol such as cholesterol) in the lipid composition disclosed
herein is about 23.5 mol %, about 28.5 mol %, about 33.5 mol %, or
about 38.5 mol %.
[1026] In some embodiments, the amount of the structural lipid
(e.g., an sterol such as cholesterol) in the lipid composition
disclosed herein is at least about 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44,
45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60
mol %.
[1027] In some aspects, the lipid composition component of the
pharmaceutical compositions for intratumoral delivery disclosed
does not comprise cholesterol.
[1028] (iv) Polyethylene Glycol (PEG)-Lipids
[1029] The lipid composition of a pharmaceutical composition
disclosed herein can comprise one or more a polyethylene glycol
(PEG) lipid.
[1030] As used herein, the term "PEG-lipid" refers to polyethylene
glycol (PEG)-modified lipids. Non-limiting examples of PEG-lipids
include PEG-modified phosphatidylethanolamine and phosphatidic
acid, PEG-ceramide conjugates (e.g., PEG-CerC14 or PEG-CerC20),
PEG-modified dialkylamines and PEG-modified
1,2-diacyloxypropan-3-amines. Such lipids are also referred to as
PEGylated lipids. For example, a PEG lipid can be PEG-c-DOMG,
PEG-DMG, PEG-DLPE, PEG-DMPE, PEG-DPPC, or a PEG-DSPE lipid.
[1031] In some embodiments, the PEG-lipid includes, but not limited
to 1,2-dimyristoyl-sn-glycerol methoxypolyethylene glycol
(PEG-DMG),
1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene
glycol)] (PEG-DSPE), PEG-disteryl glycerol (PEG-DSG),
PEG-dipalmetoleyl, PEG-dioleyl, PEG-distearyl, PEG-diacylglycamide
(PEG-DAG), PEG-dipalmitoyl phosphatidylethanolamine (PEG-DPPE), or
PEG-1,2-dimyristyloxlpropyl-3-amine (PEG-c-DMA).
[1032] In one embodiment, the PEG-lipid is selected from the group
consisting of a PEG-modified phosphatidylethanolamine, a
PEG-modified phosphatidic acid, a PEG-modified ceramide, a
PEG-modified dialkylamine, a PEG-modified diacylglycerol, a
PEG-modified dialkylglycerol, and mixtures thereof.
[1033] In some embodiments, the lipid moiety of the PEG-lipids
includes those having lengths of from about C.sub.14 to about
C.sub.22, preferably from about C.sub.14 to about C.sub.16. In some
embodiments, a PEG moiety, for example an mPEG-NH.sub.2, has a size
of about 1000, 2000, 5000, 10,000, 15,000 or 20,000 daltons. In one
embodiment, the PEG-lipid is PEG.sub.2k-DMG.
[1034] In one embodiment, the lipid nanoparticles described herein
can comprise a PEG lipid which is a non-diffusible PEG.
Non-limiting examples of non-diffusible PEGs include PEG-DSG and
PEG-DSPE.
[1035] PEG-lipids are known in the art, such as those described in
U.S. Pat. No. 8,158,601 and International Publ. No. WO 2015/130584
A2, which are incorporated herein by reference in their
entirety.
[1036] In one embodiment, the amount of PEG-lipid in the lipid
composition of a pharmaceutical composition disclosed herein ranges
from about 0.1 mol % to about 5 mol %, from about 0.5 mol % to
about 5 mol %, from about 1 mol % to about 5 mol %, from about 1.5
mol % to about 5 mol %, from about 2 mol % to about 5 mol % mol %,
from about 0.1 mol % to about 4 mol %, from about 0.5 mol % to
about 4 mol %, from about 1 mol % to about 4 mol %, from about 1.5
mol % to about 4 mol %, from about 2 mol % to about 4 mol %, from
about 0.1 mol % to about 3 mol %, from about 0.5 mol % to about 3
mol %, from about 1 mol % to about 3 mol %, from about 1.5 mol % to
about 3 mol %, from about 2 mol % to about 3 mol %, from about 0.1
mol % to about 2 mol %, from about 0.5 mol % to about 2 mol %, from
about 1 mol % to about 2 mol %, from about 1.5 mol % to about 2 mol
%, from about 0.1 mol % to about 1.5 mol %, from about 0.5 mol % to
about 1.5 mol %, or from about 1 mol % to about 1.5 mol %.
[1037] In one embodiment, the amount of PEG-lipid in the lipid
composition disclosed herein is about 1.5 mol %.
[1038] In one embodiment, the amount of PEG-lipid in the lipid
composition disclosed herein is at least about 0.1, 0.2, 0.3, 0.4,
0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8,
1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2,
3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6,
4.7, 4.8, 4.9, or 5 mol %.
[1039] In some aspects, the lipid composition of the pharmaceutical
compositions disclosed herein does not comprise a PEG-lipid.
[1040] In some embodiments, the lipid composition disclosed herein
comprises a compound of formula (I) and an asymmetric phospholipid.
In some embodiments, the lipid composition comprises compound 18
and MSPC.
[1041] In some embodiments, the lipid composition disclosed herein
comprises a compound of formula (I) and a quaternary amine
compound. In some embodiments, the lipid composition comprises
compound 18 and DOTAP.
[1042] In some embodiments, the lipid composition disclosed herein
comprises a compound of formula (I), an asymmetric phospholipid,
and a quaternary amine compound. In some embodiments, the lipid
composition comprises compound 18, MSPC and DOTAP.
[1043] In one embodiment, the lipid composition comprises about 50
mol % of a compound of formula (I) (e.g., Compounds 18, 25, 26 or
48), about 10 mol % of DSPC or MSPC, about 33.5 mol % of
cholesterol, about 1.5 mol % of PEG-DMG, and about 5 mol % of
DOTAP. In one embodiment, the lipid composition comprises about 50
mol % of a compound of formula (I) (e.g. Compounds 18, 25, 26 or
48), about 10 mol % of DSPC or MSPC, about 28.5 mol % of
cholesterol, about 1.5 mol % of PEG-DMG, and about 10 mol % of
DOTAP.
[1044] The components of the lipid nanoparticle can be tailored for
optimal delivery of the polynucleotides based on the desired
outcome. As a non-limiting example, the lipid nanoparticle can
comprise 40-60 mol % a compound of formula (I), 8-16 mol %
phospholipid, 30-45 mol % cholesterol, 1-5 mol % PEG lipid, and
optionally 1-15 mol % quaternary amine compound.
[1045] In some embodiments, the lipid nanoparticle can comprise
45-65 mol % of a compound of formula (I), 5-10 mol % phospholipid,
25-40 mol % cholesterol, 0.5-5 mol % PEG lipid, and optionally 1-15
mol % quaternary amine compound.
[1046] Non-limiting examples of nucleic acid lipid particles are
disclosed in U.S. Patent Publication No. 20140121263, herein
incorporated by reference in its entirety.
[1047] (v) Other Ionizable Amino Lipids
[1048] The lipid composition of the pharmaceutical composition
disclosed herein can comprise one or more ionizable amino lipids in
addition to a lipid according to formula (I).
[1049] Ionizable lipids can be selected from the non-limiting group
consisting of
3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine
(KL10),
N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanami-
ne (KL22), 14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane
(KL25), 1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),
2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),
heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate
(DLin-MC3-DMA),
2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLin-KC2-DMA), 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA),
(13Z,165Z)-N,N-dimethyl-3-nonydocosa-13-16-dien-1-amine (L608),
2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-
-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),
(2R)-2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z-
,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA
(2R)), and
(2S)-2-({8-[(3.beta.)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z-
,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA
(2S)). In addition to these, an ionizable amino lipid can also be a
lipid including a cyclic amine group.
[1050] Ionizable lipids can also be the compounds disclosed in
International Publication No. WO 2015/199952 A1, hereby
incorporated by reference in its entirety. For example, the
ionizable amino lipids include, but not limited to:
##STR00049## ##STR00050## ##STR00051##
[1051] and any combination thereof.
[1052] (vi) Other Lipid Composition Components
[1053] The lipid composition of a pharmaceutical composition
disclosed herein can include one or more components in addition to
those described above. For example, the lipid composition can
include one or more permeability enhancer molecules, carbohydrates,
polymers, surface altering agents (e.g., surfactants), or other
components. For example, a permeability enhancer molecule can be a
molecule described by U.S. Patent Application Publication No.
2005/0222064. Carbohydrates can include simple sugars (e.g.,
glucose) and polysaccharides (e.g., glycogen and derivatives and
analogs thereof). The lipid composition can include a buffer such
as, but not limited to, citrate or phosphate at a pH of 7, salt
and/or sugar. Salt and/or sugar can be included in the formulations
described herein for isotonicity.
[1054] A polymer can be included in and/or used to encapsulate or
partially encapsulate a pharmaceutical composition disclosed herein
(e.g., a pharmaceutical composition in lipid nanoparticle form). A
polymer can be biodegradable and/or biocompatible. A polymer can be
selected from, but is not limited to, polyamines, polyethers,
polyamides, polyesters, polycarbamates, polyureas, polycarbonates,
polystyrenes, polyimides, polysulfones, polyurethanes,
polyacetylenes, polyethylenes, polyethyleneimines, polyisocyanates,
polyacrylates, polymethacrylates, polyacrylonitriles, and
polyarylates.
[1055] The ratio between the lipid composition and the
polynucleotide range can be from about 10:1 to about 60:1
(wt/wt).
[1056] In some embodiments, the ratio between the lipid composition
and the polynucleotide can be about 10:1, 11:1, 12:1, 13:1, 14:1,
15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1,
26:1, 27:1, 28:1, 29:1, 30:1, 31:1, 32:1, 33:1, 34:1, 35:1, 36:1,
37:1, 38:1, 39:1, 40:1, 41:1, 42:1, 43:1, 44:1, 45:1, 46:1, 47:1,
48:1, 49:1, 50:1, 51:1, 52:1, 53:1, 54:1, 55:1, 56:1, 57:1, 58:1,
59:1 or 60:1 (wt/wt). In some embodiments, the wt/wt ratio of the
lipid composition to the polynucleotide encoding a therapeutic
agent is about 20:1 or about 15:1.
[1057] In some embodiments, the pharmaceutical composition
disclosed herein can contain more than one polypeptides. For
example, a pharmaceutical composition disclosed herein can contain
two or more polynucleotides (e.g., RNA, e.g., mRNA).
[1058] In one embodiment, the lipid nanoparticles described herein
can comprise polynucleotides (e.g., mRNA) in a lipid:polynucleotide
weight ratio of 5:1, 10:1, 15:1, 20:1, 25:1, 30:1, 35:1, 40:1,
45:1, 50:1, 55:1, 60:1 or 70:1, or a range or any of these ratios
such as, but not limited to, 5:1 to about 10:1, from about 5:1 to
about 15:1, from about 5:1 to about 20:1, from about 5:1 to about
25:1, from about 5:1 to about 30:1, from about 5:1 to about 35:1,
from about 5:1 to about 40:1, from about 5:1 to about 45:1, from
about 5:1 to about 50:1, from about 5:1 to about 55:1, from about
5:1 to about 60:1, from about 5:1 to about 70:1, from about 10:1 to
about 15:1, from about 10:1 to about 20:1, from about 10:1 to about
25:1, from about 10:1 to about 30:1, from about 10:1 to about 35:1,
from about 10:1 to about 40:1, from about 10:1 to about 45:1, from
about 10:1 to about 50:1, from about 10:1 to about 55:1, from about
10:1 to about 60:1, from about 10:1 to about 70:1, from about 15:1
to about 20:1, from about 15:1 to about 25:1,from about 15:1 to
about 30:1, from about 15:1 to about 35:1, from about 15:1 to about
40:1, from about 15:1 to about 45:1, from about 15:1 to about 50:1,
from about 15:1 to about 55:1, from about 15:1 to about 60:1 or
from about 15:1 to about 70:1.
[1059] In one embodiment, the lipid nanoparticles described herein
can comprise the polynucleotide in a concentration from
approximately 0.1 mg/ml to 2 mg/ml such as, but not limited to, 0.1
mg/ml, 0.2 mg/ml, 0.3 mg/ml, 0.4 mg/ml, 0.5 mg/ml, 0.6 mg/ml, 0.7
mg/ml, 0.8 mg/ml, 0.9 mg/ml, 1.0 mg/ml, 1.1 mg/ml, 1.2 mg/ml, 1.3
mg/ml, 1.4 mg/ml, 1.5 mg/ml, 1.6 mg/ml, 1.7 mg/ml, 1.8 mg/ml, 1.9
mg/ml, 2.0 mg/ml or greater than 2.0 mg/ml.
[1060] In one embodiment, formulations comprising the
polynucleotides and lipid nanoparticles described herein can
comprise 0.15 mg/ml to 2 mg/ml of the polynucleotide described
herein (e.g., mRNA). In some embodiments, the formulation can
further comprise 10 mM of citrate buffer and the formulation can
additionally comprise up to 10% w/w of sucrose (e.g., at least 1%
w/w, at least 2% w/w/, at least 3% w/w, at least 4% w/w, at least
5% w/w, at least 6% w/w, at least 7% w/w, at least 8% w/w, at least
9% w/w or 10% w/w).
[1061] (vii) Nanoparticle Compositions
[1062] In some embodiments, the pharmaceutical compositions
disclosed herein are formulated as lipid nanoparticles (LNP).
Accordingly, the present disclosure also provides nanoparticle
compositions comprising (i) a lipid composition comprising a
compound of formula (I) as described herein, and (ii) a
polynucleotide encoding an MCM polypeptide. In such nanoparticle
composition, the lipid composition disclosed herein can encapsulate
the polynucleotide encoding an MCM polypeptide.
[1063] Nanoparticle compositions are typically sized on the order
of micrometers or smaller and can include a lipid bilayer.
Nanoparticle compositions encompass lipid nanoparticles (LNPs),
liposomes (e.g., lipid vesicles), and lipoplexes. For example, a
nanoparticle composition can be a liposome having a lipid bilayer
with a diameter of 500 nm or less.
[1064] Nanoparticle compositions include, for example, lipid
nanoparticles (LNPs), liposomes, and lipoplexes. In some
embodiments, nanoparticle compositions are vesicles including one
or more lipid bilayers. In certain embodiments, a nanoparticle
composition includes two or more concentric bilayers separated by
aqueous compartments. Lipid bilayers can be functionalized and/or
crosslinked to one another. Lipid bilayers can include one or more
ligands, proteins, or channels.
[1065] Nanoparticle compositions of the present disclosure comprise
at least one compound according to formula (I). For example, the
nanoparticle composition can include one or more of Compounds
1-147. Nanoparticle compositions can also include a variety of
other components. For example, the nanoparticle composition can
include one or more other lipids in addition to a lipid according
to formula (I) or (II), for example (i) at least one phospholipid,
(ii) at least one quaternary amine compound, (iii) at least one
structural lipid, (iv) at least one PEG-lipid, or (v) any
combination thereof.
[1066] In some embodiments, the nanoparticle composition comprises
a compound of formula (I), (e.g., Compounds 18, 25, 26 or 48). In
some embodiments, the nanoparticle composition comprises a compound
of formula (I) (e.g., Compounds 18, 25, 26 or 48) and a
phospholipid (e.g., DSPC or MSPC). In some embodiments, the
nanoparticle composition comprises a compound of formula (I) (e.g.,
Compounds 18, 25, 26 or 48), a phospholipid (e.g., DSPC or MSPC),
and a quaternary amine compound (e.g., DOTAP). In some embodiments,
the nanoparticle composition comprises a compound of formula (I)
(e.g., Compounds 18, 25, 26 or 48), and a quaternary amine compound
(e.g., DOTAP).
[1067] In some embodiments, the nanoparticle composition comprises
a lipid composition consisting or consisting essentially of
compound of formula (I) (e.g., Compounds 18, 25, 26 or 48). In some
embodiments, the nanoparticle composition comprises a lipid
composition consisting or consisting essentially of a compound of
formula (I) (e.g., Compounds 18, 25, 26 or 48) and a phospholipid
(e.g., DSPC or MSPC). In some embodiments, the nanoparticle
composition comprises a lipid composition consisting or consisting
essentially of a compound of formula (I) (e.g., Compounds 18, 25,
26 or 48), a phospholipid (e.g., DSPC or MSPC), and a quaternary
amine compound (e.g., DOTAP). In some embodiments, the nanoparticle
composition comprises a lipid composition consisting or consisting
essentially of a compound of formula (I) (e.g., Compounds 18, 25,
26 or 48), and a quaternary amine compound (e.g., DOTAP).
[1068] Nanoparticle compositions can be characterized by a variety
of methods. For example, microscopy (e.g., transmission electron
microscopy or scanning electron microscopy) can be used to examine
the morphology and size distribution of a nanoparticle composition.
Dynamic light scattering or potentiometry (e.g., potentiometric
titrations) can be used to measure zeta potentials. Dynamic light
scattering can also be utilized to determine particle sizes.
Instruments such as the Zetasizer Nano ZS (Malvern Instruments Ltd,
Malvern, Worcestershire, UK) can also be used to measure multiple
characteristics of a nanoparticle composition, such as particle
size, polydispersity index, and zeta potential.
[1069] The size of the nanoparticles can help counter biological
reactions such as, but not limited to, inflammation, or can
increase the biological effect of the polynucleotide.
[1070] As used herein, "size" or "mean size" in the context of
nanoparticle compositions refers to the mean diameter of a
nanoparticle composition.
[1071] In one embodiment, the polynucleotide encoding an MCM
polypeptide are formulated in lipid nanoparticles having a diameter
from about 10 to about 100 nm such as, but not limited to, about 10
to about 20 nm, about 10 to about 30 nm, about 10 to about 40 nm,
about 10 to about 50 nm, about 10 to about 60 nm, about 10 to about
70 nm, about 10 to about 80 nm, about 10 to about 90 nm, about 20
to about 30 nm, about 20 to about 40 nm, about 20 to about 50 nm,
about 20 to about 60 nm, about 20 to about 70 nm, about 20 to about
80 nm, about 20 to about 90 nm, about 20 to about 100 nm, about 30
to about 40 nm, about 30 to about 50 nm, about 30 to about 60 nm,
about 30 to about 70 nm, about 30 to about 80 nm, about 30 to about
90 nm, about 30 to about 100 nm, about 40 to about 50 nm, about 40
to about 60 nm, about 40 to about 70 nm, about 40 to about 80 nm,
about 40 to about 90 nm, about 40 to about 100 nm, about 50 to
about 60 nm, about 50 to about 70 nm, about 50 to about 80 nm,
about 50 to about 90 nm, about 50 to about 100 nm, about 60 to
about 70 nm, about 60 to about 80 nm, about 60 to about 90 nm,
about 60 to about 100 nm, about 70 to about 80 nm, about 70 to
about 90 nm, about 70 to about 100 nm, about 80 to about 90 nm,
about 80 to about 100 nm and/or about 90 to about 100 nm.
[1072] In one embodiment, the nanoparticles have a diameter from
about 10 to 500 nm. In one embodiment, the nanoparticle has a
diameter greater than 100 nm, greater than 150 nm, greater than 200
nm, greater than 250 nm, greater than 300 nm, greater than 350 nm,
greater than 400 nm, greater than 450 nm, greater than 500 nm,
greater than 550 nm, greater than 600 nm, greater than 650 nm,
greater than 700 nm, greater than 750 nm, greater than 800 nm,
greater than 850 nm, greater than 900 nm, greater than 950 nm or
greater than 1000 nm.
[1073] In some embodiments, the largest dimension of a nanoparticle
composition is 1.mu.m or shorter (e.g., 1.mu.m, 900 nm, 800 nm, 700
nm, 600 nm, 500 nm, 400 nm, 300 nm, 200 nm, 175 nm, 150 nm, 125 nm,
100 nm, 75 nm, 50 nm, or shorter).
[1074] A nanoparticle composition can be relatively homogenous. A
polydispersity index can be used to indicate the homogeneity of a
nanoparticle composition, e.g., the particle size distribution of
the nanoparticle composition. A small (e.g., less than 0.3)
polydispersity index generally indicates a narrow particle size
distribution. A nanoparticle composition can have a polydispersity
index from about 0 to about 0.25, such as 0.01, 0.02, 0.03, 0.04,
0.05, 0.06, 0.07, 0.08, 0.09, 0.10, 0.11, 0.12, 0.13, 0.14, 0.15,
0.16, 0.17, 0.18, 0.19, 0.20, 0.21, 0.22, 0.23, 0.24, or 0.25. In
some embodiments, the polydispersity index of a nanoparticle
composition disclosed herein can be from about 0.10 to about
0.20.
[1075] The zeta potential of a nanoparticle composition can be used
to indicate the electrokinetic potential of the composition. For
example, the zeta potential can describe the surface charge of a
nanoparticle composition. Nanoparticle compositions with relatively
low charges, positive or negative, are generally desirable, as more
highly charged species can interact undesirably with cells,
tissues, and other elements in the body. In some embodiments, the
zeta potential of a nanoparticle composition disclosed herein can
be from about -10 mV to about +20 mV, from about -10 mV to about
+15 mV, from about 10 mV to about +10 mV, from about -10 mV to
about +5 mV, from about -10 mV to about 0 mV, from about -10 mV to
about -5 mV, from about -5 mV to about +20 mV, from about -5 mV to
about +15 mV, from about -5 mV to about +10 mV, from about -5 mV to
about +5 mV, from about -5 mV to about 0 mV, from about 0 mV to
about +20 mV, from about 0 mV to about +15 mV, from about 0 mV to
about +10 mV, from about 0 mV to about +5 mV, from about +5 mV to
about +20 mV, from about +5 mV to about +15 mV, or from about +5 mV
to about +10 mV.
[1076] In some embodiments, the zeta potential of the lipid
nanoparticles can be from about 0 mV to about 100 mV, from about 0
mV to about 90 mV, from about 0 mV to about 80 mV, from about 0 mV
to about 70 mV, from about 0 mV to about 60 mV, from about 0 mV to
about 50 mV, from about 0 mV to about 40 mV, from about 0 mV to
about 30 mV, from about 0 mV to about 20 mV, from about 0 mV to
about 10 mV, from about 10 mV to about 100 mV, from about 10 mV to
about 90 mV, from about 10 mV to about 80 mV, from about 10 mV to
about 70 mV, from about 10 mV to about 60 mV, from about 10 mV to
about 50 mV, from about 10 mV to about 40 mV, from about 10 mV to
about 30 mV, from about 10 mV to about 20 mV, from about 20 mV to
about 100 mV, from about 20 mV to about 90 mV, from about 20 mV to
about 80 mV, from about 20 mV to about 70 mV, from about 20 mV to
about 60 mV, from about 20 mV to about 50 mV, from about 20 mV to
about 40 mV, from about 20 mV to about 30 mV, from about 30 mV to
about 100 mV, from about 30 mV to about 90 mV, from about 30 mV to
about 80 mV, from about 30 mV to about 70 mV, from about 30 mV to
about 60 mV, from about 30 mV to about 50 mV, from about 30 mV to
about 40 mV, from about 40 mV to about 100 mV, from about 40 mV to
about 90 mV, from about 40 mV to about 80 mV, from about 40 mV to
about 70 mV, from about 40 mV to about 60 mV, and from about 40 mV
to about 50 mV. In some embodiments, the zeta potential of the
lipid nanoparticles can be from about 10 mV to about 50 mV, from
about 15 mV to about 45 mV, from about 20 mV to about 40 mV, and
from about 25 mV to about 35 mV. In some embodiments, the zeta
potential of the lipid nanoparticles can be about 10 mV, about 20
mV, about 30 mV, about 40 mV, about 50 mV, about 60 mV, about 70
mV, about 80 mV, about 90 mV, and about 100 mV.
[1077] The term "encapsulation efficiency" of a polynucleotide
describes the amount of the polynucleotide that is encapsulated by
or otherwise associated with a nanoparticle composition after
preparation, relative to the initial amount provided. As used
herein, "encapsulation" can refer to complete, substantial, or
partial enclosure, confinement, surrounding, or encasement.
[1078] Encapsulation efficiency is desirably high (e.g., close to
100%). The encapsulation efficiency can be measured, for example,
by comparing the amount of the polynucleotide in a solution
containing the nanoparticle composition before and after breaking
up the nanoparticle composition with one or more organic solvents
or detergents.
[1079] Fluorescence can be used to measure the amount of free
polynucleotide in a solution. For the nanoparticle compositions
described herein, the encapsulation efficiency of a polynucleotide
can be at least 50%, for example 50%, 55%, 60%, 65%, 70%, 75%, 80%,
85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%. In
some embodiments, the encapsulation efficiency can be at least 80%.
In certain embodiments, the encapsulation efficiency can be at
least 90%.
[1080] The amount of a polynucleotide present in a pharmaceutical
composition disclosed herein can depend on multiple factors such as
the size of the polynucleotide, desired target and/or application,
or other properties of the nanoparticle composition as well as on
the properties of the polynucleotide.
[1081] For example, the amount of an mRNA useful in a nanoparticle
composition can depend on the size (expressed as length, or
molecular mass), sequence, and other characteristics of the mRNA.
The relative amounts of a polynucleotide in a nanoparticle
composition can also vary.
[1082] The relative amounts of the lipid composition and the
polynucleotide present in a lipid nanoparticle composition of the
present disclosure can be optimized according to considerations of
efficacy and tolerability. For compositions including an mRNA as a
polynucleotide, the N:P ratio can serve as a useful metric.
[1083] As the N:P ratio of a nanoparticle composition controls both
expression and tolerability, nanoparticle compositions with low N:P
ratios and strong expression are desirable. N:P ratios vary
according to the ratio of lipids to RNA in a nanoparticle
composition.
[1084] In general, a lower N:P ratio is preferred. The one or more
RNA, lipids, and amounts thereof can be selected to provide an N:P
ratio from about 2:1 to about 30:1, such as 2:1, 3:1, 4:1, 5:1,
6:1, 7:1, 8:1, 9:1, 10:1, 12:1, 14:1, 16:1, 18:1, 20:1, 22:1, 24:1,
26:1, 28:1, or 30:1. In certain embodiments, the N:P ratio can be
from about 2:1 to about 8:1. In other embodiments, the N:P ratio is
from about 5:1 to about 8:1. In certain embodiments, the N:P ratio
is between 5:1 and 6:1. In one specific aspect, the N:P ratio is
about is about 5.67:1.
[1085] In addition to providing nanoparticle compositions, the
present disclosure also provides methods of producing lipid
nanoparticles comprising encapsulating a polynucleotide. Such
method comprises using any of the pharmaceutical compositions
disclosed herein and producing lipid nanoparticles in accordance
with methods of production of lipid nanoparticles known in the art.
See, e.g., Wang et al. (2015) "Delivery of oligonucleotides with
lipid nanoparticles" Adv. Drug Deliv. Rev. 87:68-80; Silva et al.
(2015) "Delivery Systems for Biopharmaceuticals. Part I:
Nanoparticles and Microparticles" Curr. Pharm. Technol. 16:
940-954; Naseri et al. (2015) "Solid Lipid Nanoparticles and
Nanostructured Lipid Carriers: Structure, Preparation and
Application" Adv. Pharm. Bull. 5:305-13; Silva et al. (2015) "Lipid
nanoparticles for the delivery of biopharmaceuticals" Curr. Pharm.
Biotechnol. 16:291-302, and references cited therein.
Excipients
[1086] The disclosure also includes pharmaceutical compositions
that comprise a formulation of a polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with excipients. The polynucleotides of the disclosure
can be formulated using one or more excipients to: (1) increase
stability; (2) increase cell transfection; (3) permit the sustained
or delayed release (e.g., from a depot formulation of the
polynucleotide); (4) alter the biodistribution (e.g., target the
polynucleotide to specific tissues or cell types); (5) increase the
translation of encoded protein in vivo; and/or (6) alter the
release profile of encoded protein in vivo. In addition to
traditional excipients such as any and all solvents, dispersion
media, diluents, or other liquid vehicles, dispersion or suspension
aids, surface active agents, isotonic agents, thickening or
emulsifying agents, preservatives, excipients of the present
disclosure can include, without limitation, lipidoids, liposomes,
lipid nanoparticles, polymers, lipoplexes, core-shell
nanoparticles, peptides, proteins, cells transfected with
polynucleotides (e.g., for transplantation into a subject),
hyaluronidase, nanoparticle mimics and combinations thereof.
Accordingly, the formulations of the disclosure can include one or
more excipients, each in an amount that together increases the
stability of the polynucleotide, increases cell transfection by the
polynucleotide, increases the expression of polynucleotides encoded
protein, and/or alters the release profile of polynucleotide
encoded proteins. Further, the polynucleotides of the present
disclosure can be formulated using self-assembled nucleic acid
nanoparticles.
[1087] A pharmaceutically acceptable excipient, as used herein,
includes, but are not limited to, any and all solvents, dispersion
media, diluents, or other liquid vehicles, dispersion or suspension
aids, surface active agents, isotonic agents, thickening or
emulsifying agents, preservatives, solid binders, lubricants,
flavoring agents, stabilizers, antioxidants, osmolality adjusting
agents, pH adjusting agents and the like, as suited to the
particular dosage form desired. Various excipients for formulating
pharmaceutical compositions and techniques for preparing the
composition are known in the art (see Remington: The Science and
Practice of Pharmacy, 21.sup.st Edition, A. R. Gennaro (Lippincott,
Williams & Wilkins, Baltimore, Md., 2006; incorporated herein
by reference in its entirety). The use of a conventional excipient
medium can be contemplated within the scope of the present
disclosure, except insofar as any conventional excipient medium is
incompatible with a substance or its derivatives, such as by
producing any undesirable biological effect or otherwise
interacting in a deleterious manner with any other component(s) of
the pharmaceutical composition, its use is contemplated to be
within the scope of this disclosure.
[1088] In some embodiments, a pharmaceutically acceptable excipient
can be at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% pure. In some embodiments, an excipient is
approved for use for humans and for veterinary use. In some
embodiments, an excipient can be approved by United States Food and
Drug Administration. In some embodiments, an excipient can be of
pharmaceutical grade. In some embodiments, an excipient can meet
the standards of the United States Pharmacopoeia (USP), the
European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the
International Pharmacopoeia.
[1089] Pharmaceutically acceptable excipients used in the
manufacture of pharmaceutical compositions include, but are not
limited to, inert diluents, dispersing and/or granulating agents,
surface active agents and/or emulsifiers, disintegrating agents,
binding agents, preservatives, buffering agents, lubricating
agents, and/or oils. Such excipients can optionally be included in
pharmaceutical compositions. The composition can also include
excipients such as cocoa butter and suppository waxes, coloring
agents, coating agents, sweetening, flavoring, and/or perfuming
agents.
[1090] Exemplary diluents include, but are not limited to, calcium
carbonate, sodium carbonate, calcium phosphate, dicalcium
phosphate, calcium sulfate, calcium hydrogen phosphate, sodium
phosphate lactose, sucrose, cellulose, microcrystalline cellulose,
kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch,
cornstarch, powdered sugar, etc., and/or combinations thereof.
[1091] Exemplary granulating and/or dispersing agents include, but
are not limited to, potato starch, corn starch, tapioca starch,
sodium starch glycolate, clays, alginic acid, guar gum, citrus
pulp, agar, bentonite, cellulose and wood products, natural sponge,
cation-exchange resins, calcium carbonate, silicates, sodium
carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone),
sodium carboxymethyl starch (sodium starch glycolate),
carboxymethyl cellulose, cross-linked sodium carboxymethyl
cellulose (croscarmellose), methylcellulose, pregelatinized starch
(starch 1500), microcrystalline starch, water insoluble starch,
calcium carboxymethyl cellulose, magnesium aluminum silicate
(VEEGUM.RTM.), sodium lauryl sulfate, quaternary ammonium
compounds, etc., and/or combinations thereof.
[1092] Exemplary surface active agents and/or emulsifiers include,
but are not limited to, natural emulsifiers (e.g. acacia, agar,
alginic acid, sodium alginate, tragacanth, chondrux, cholesterol,
xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol,
wax, and lecithin), colloidal clays (e.g., bentonite [aluminum
silicate] and VEEGUM.RTM. [magnesium aluminum silicate]), long
chain amino acid derivatives, high molecular weight alcohols (e.g.,
stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin
monostearate, ethylene glycol distearate, glyceryl monostearate,
and propylene glycol monostearate, polyvinyl alcohol), carbomers
(e.g., carboxy polymethylene, polyacrylic acid, acrylic acid
polymer, and carboxyvinyl polymer), carrageenan, cellulosic
derivatives (e.g., carboxymethylcellulose sodium, powdered
cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty
acid esters (e.g., polyoxyethylene sorbitan monolaurate
[TWEEN.RTM.20], polyoxyethylene sorbitan [TWEEN.RTM.60],
polyoxyethylene sorbitan monooleate [TWEEN.RTM.80], sorbitan
monopalmitate [SPAN.RTM.40], sorbitan monostearate [SPAN.RTM.60],
sorbitan tristearate [SPAN.RTM.65], glyceryl monooleate, sorbitan
monooleate [SPAN.RTM.80]), polyoxyethylene esters (e.g.,
polyoxyethylene monostearate [MYRJ.RTM.45], polyoxyethylene
hydrogenated castor oil, polyethoxylated castor oil,
polyoxymethylene stearate, and SOLUTOL.RTM.), sucrose fatty acid
esters, polyethylene glycol fatty acid esters (e.g.,
CREMOPHOR.RTM.), polyoxyethylene ethers, (e.g., polyoxyethylene
lauryl ether [BRIJ.RTM.30]), poly(vinyl-pyrrolidone), diethylene
glycol monolaurate, triethanolamine oleate, sodium oleate,
potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium
lauryl sulfate, PLUORINC.RTM.F 68, POLOXAMER.RTM.188, cetrimonium
bromide, cetylpyridinium chloride, benzalkonium chloride, docusate
sodium, etc. and/or combinations thereof.
[1093] Exemplary binding agents include, but are not limited to,
starch (e.g., cornstarch and starch paste); gelatin; sugars (e.g.,
sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol,
mannitol); amino acids (e.g., glycine); natural and synthetic gums
(e.g., acacia, sodium alginate, extract of Irish moss, panwar gum,
ghatti gum, mucilage of isapol husks, carboxymethylcellulose,
methylcellulose, ethylcellulose, hydroxyethylcellulose,
hydroxypropyl cellulose, hydroxypropyl methylcellulose,
microcrystalline cellulose, cellulose acetate,
poly(vinyl-pyrrolidone), magnesium aluminum silicate (VEEGUM.RTM.),
and larch arabogalactan); alginates; polyethylene oxide;
polyethylene glycol; inorganic calcium salts; silicic acid;
polymethacrylates; waxes; water; alcohol; etc.; and combinations
thereof.
[1094] Exemplary preservatives can include, but are not limited to,
antioxidants, chelating agents, antimicrobial preservatives,
antifungal preservatives, alcohol preservatives, acidic
preservatives, and/or other preservatives. Oxidation is a potential
degradation pathway for mRNA, especially for liquid mRNA
formulations. In order to prevent oxidation, antioxidants can be
added to the formulation. Exemplary antioxidants include, but are
not limited to, alpha tocopherol, ascorbic acid, acorbyl palmitate,
benzyl alcohol, butylated hydroxyanisole, EDTA, m-cresol,
methionine, butylated hydroxytoluene, monothioglycerol, potassium
metabisulfite, propionic acid, propyl gallate, sodium ascorbate,
sodium bisulfite, sodium metabisulfite, thioglycerol and/or sodium
sulfite. Exemplary chelating agents include
ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate,
disodium edetate, dipotassium edetate, edetic acid, fumaric acid,
malic acid, phosphoric acid, sodium edetate, tartaric acid, and/or
trisodium edetate. Exemplary antimicrobial preservatives include,
but are not limited to, benzalkonium chloride, benzethonium
chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium
chloride, chlorhexidine, chlorobutanol, chlorocresol,
chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine,
imidurea, phenol, phenoxyethanol, phenylethyl alcohol,
phenylmercuric nitrate, propylene glycol, and/or thimerosal.
Exemplary antifungal preservatives include, but are not limited to,
butyl paraben, methyl paraben, ethyl paraben, propyl paraben,
benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium
sorbate, sodium benzoate, sodium propionate, and/or sorbic acid.
Exemplary alcohol preservatives include, but are not limited to,
ethanol, polyethylene glycol, phenol, phenolic compounds,
bisphenol, chlorobutanol, hydroxybenzoate, and/or phenylethyl
alcohol. Exemplary acidic preservatives include, but are not
limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric
acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid,
and/or phytic acid. Other preservatives include, but are not
limited to, tocopherol, tocopherol acetate, deteroxime mesylate,
cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened
(BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl
ether sulfate (SLES), sodium bisulfite, sodium metabisulfite,
potassium sulfite, potassium metabisulfite, GLYDANT PLUS.RTM.,
PHENONIP.RTM., methylparaben, GERMALL.RTM.115, GERMABEN.RTM.II,
NEOLONE.TM., KATHON.TM., and/or EUXYL.RTM..
[1095] In some embodiments, the pH of polynucleotide solutions are
maintained between pH 5 and pH 8 to improve stability. Exemplary
buffers to control pH can include, but are not limited to sodium
phosphate, sodium citrate, sodium succinate, histidine (or
histidine-HCl), sodium carbonate, and/or sodium malate. In another
embodiment, the exemplary buffers listed above can be used with
additional monovalent counterions (including, but not limited to
potassium). Divalent cations can also be used as buffer
counterions; however, these are subject to complex formation and/or
mRNA degradation.
[1096] Exemplary buffering agents can also include, but are not
limited to, citrate buffer solutions, acetate buffer solutions,
phosphate buffer solutions, ammonium chloride, calcium carbonate,
calcium chloride, calcium citrate, calcium glubionate, calcium
gluceptate, calcium gluconate, D-gluconic acid, calcium
glycerophosphate, calcium lactate, propanoic acid, calcium
levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric
acid, tribasic calcium phosphate, calcium hydroxide phosphate,
potassium acetate, potassium chloride, potassium gluconate,
potassium mixtures, dibasic potassium phosphate, monobasic
potassium phosphate, potassium phosphate mixtures, sodium acetate,
sodium bicarbonate, sodium chloride, sodium citrate, sodium
lactate, dibasic sodium phosphate, monobasic sodium phosphate,
sodium phosphate mixtures, tromethamine, magnesium hydroxide,
aluminum hydroxide, alginic acid, pyrogen-free water, isotonic
saline, Ringer's solution, ethyl alcohol, etc., and/or combinations
thereof.
[1097] Exemplary lubricating agents include, but are not limited
to, magnesium stearate, calcium stearate, stearic acid, silica,
talc, malt, glyceryl behanate, hydrogenated vegetable oils,
polyethylene glycol, sodium benzoate, sodium acetate, sodium
chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate,
etc., and combinations thereof.
[1098] Exemplary oils include, but are not limited to, almond,
apricot kernel, avocado, babassu, bergamot, black current seed,
borage, cade, camomile, canola, caraway, carnauba, castor,
cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton
seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol,
gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba,
kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut,
mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange,
orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed,
pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood,
sasquana, savoury, sea buckthorn, sesame, shea butter, silicone,
soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut,
and wheat germ oils. Exemplary oils include, but are not limited
to, butyl stearate, caprylic triglyceride, capric triglyceride,
cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl
myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone
oil, and/or combinations thereof.
[1099] Excipients such as cocoa butter and suppository waxes,
coloring agents, coating agents, sweetening, flavoring, and/or
perfuming agents can be present in the composition, according to
the judgment of the formulator.
[1100] Exemplary additives include physiologically biocompatible
buffers (e.g., trimethylamine hydrochloride), addition of chelants
(such as, for example, DTPA or DTPA-bisamide) or calcium chelate
complexes (as for example calcium DTPA, CaNaDTPA-bisamide), or,
optionally, additions of calcium or sodium salts (for example,
calcium chloride, calcium ascorbate, calcium gluconate or calcium
lactate). In addition, antioxidants and suspending agents can be
used.
Lipidoids
[1101] The disclosure includes pharmaceutical compositions that
comprise a lipidoid formulation of the polynucleotide described
herein, i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide.
[1102] The synthesis of lipidoids has been extensively described
and formulations containing these compounds are particularly suited
for delivery of polynucleotides (see Mahon et al., Bioconjug. Chem.
2010 21:1448-1454; Schroeder et al., J Intern Med. 2010 267:9-21;
Akinc et al., Nat Biotechnol. 2008 26:561-569; Love et al., Proc
Natl Acad Sci U S A. 2010 107:1864-1869; Siegwart et al., Proc Natl
Acad Sci U S A. 2011 108:12996-3001; all of which are incorporated
herein in their entireties).
[1103] Lipidoids have been used to effectively deliver double
stranded small interfering RNA molecules in rodents and non-human
primates (see Akinc et al., Nat Biotechnol. 2008 26:561-569;
Frank-Kamenetsky et al., Proc Natl Acad Sci U S A. 2008
105:11915-11920; Akinc et al., Mol Ther. 2009 17:872-879; Love et
al., Proc Natl Acad Sci U S A. 2010 107:1864-1869; Leuschner et
al., Nat Biotechnol. 2011 29:1005-1010; all of which is
incorporated herein in their entirety), and the present disclosure
describes their formulation and use in delivering
polynucleotides.
[1104] Complexes, micelles, liposomes or particles can be prepared
containing these lipidoids and therefore, can result in an
effective delivery of the polynucleotide, as judged by the
production of an encoded protein, following the injection of a
lipidoid formulation via localized and/or systemic routes of
administration. Lipidoid complexes of polynucleotides can be
administered by various means including, but not limited to,
intravenous, intramuscular, or subcutaneous routes.
[1105] In vivo delivery of nucleic acids can be affected by many
parameters, including, but not limited to, the formulation
composition, nature of particle PEGylation, degree of loading,
polynucleotide to lipid ratio, and biophysical parameters such as,
but not limited to, particle size (Akinc et al., Mol Ther. 2009
17:872-879; herein incorporated by reference in its entirety). As
an example, small changes in the anchor chain length of
poly(ethylene glycol) (PEG) lipids can result in significant
effects on in vivo efficacy. Formulations with the different
lipidoids, including, but not limited to
penta[3-(1-laurylaminopropionyl)]-triethylenetetramine
hydrochloride (TETA-5LAP; aka 98N12-5, see Murugaiah et al.,
Analytical Biochemistry, 401:61 (2010); herein incorporated by
reference in its entirety), C12-200 (including derivatives and
variants), and MD1, can be tested for in vivo activity.
[1106] The lipidoid referred to herein as "98N12-5" is disclosed by
Akinc et al., Mol Ther. 2009 17:872-879 and is incorporated by
reference in its entirety.
[1107] The lipidoid referred to herein as "C12-200" is disclosed by
Love et al., Proc Natl Acad Sci U S A. 2010 107:1864-1869 and Liu
and Huang, Molecular Therapy. 2010 669-670; both of which are
herein incorporated by reference in their entirety. The lipidoid
formulations can include particles comprising either 3 or 4 or more
components in addition to polynucleotides.
[1108] Lipidoids and polynucleotide formulations comprising
lipidoids are described in International Patent Application No.
PCT/US2014/097077, the contents of which are herein incorporated by
reference in its entirety.
Liposomes, Lipoplexes, and Lipid Nanoparticles
[1109] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, using one or more liposomes, lipoplexes, or lipid
nanoparticles. In one embodiment, pharmaceutical compositions of
the polynucleotides include liposomes. Liposomes are
artificially-prepared vesicles that can primarily be composed of a
lipid bilayer and can be used as a delivery vehicle for the
administration of nutrients and pharmaceutical formulations.
Liposomes can be of different sizes such as, but not limited to, a
multilamellar vesicle (MLV) that can be hundreds of nanometers in
diameter and can contain a series of concentric bilayers separated
by narrow aqueous compartments, a small unicellular vesicle (SUV)
that can be smaller than 50 nm in diameter, and a large unilamellar
vesicle (LUV) that can be between 50 and 500 nm in diameter.
Liposome design can include, but is not limited to, opsonins or
ligands in order to improve the attachment of liposomes to
unhealthy tissue or to activate events such as, but not limited to,
endocytosis. Liposomes can contain a low or a high pH in order to
improve the delivery of the pharmaceutical formulations.
[1110] The formation of liposomes can depend on the physicochemical
characteristics such as, but not limited to, the pharmaceutical
formulation entrapped and the liposomal ingredients, the nature of
the medium in which the lipid vesicles are dispersed, the effective
concentration of the entrapped substance and its potential
toxicity, any additional processes involved during the application
and/or delivery of the vesicles, the optimization size,
polydispersity and the shelf-life of the vesicles for the intended
application, and the batch-to-batch reproducibility and possibility
of large-scale production of safe and efficient liposomal
products.
[1111] As a non-limiting example, liposomes such as synthetic
membrane vesicles can be prepared by the methods, apparatus and
devices described in US Patent Publication No. US20130177638,
US20130177637, US20130177636, US20130177635, US20130177634,
US20130177633, US20130183375, US20130183373 and US20130183372, the
contents of each of which are herein incorporated by reference in
its entirety.
[1112] In one embodiment, pharmaceutical compositions described
herein can include, without limitation, liposomes such as those
formed from 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA)
liposomes, DiLa2 liposomes from Marina Biotech (Bothell, Wash.),
1,2-dilinoleyloxy-3-dimethylaminopropane (DLin-DMA),
2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLin-KC2-DMA), and MC3 (US20100324120; herein incorporated by
reference in its entirety) and liposomes that can deliver small
molecule drugs such as, but not limited to, DOXIL.RTM. from Janssen
Biotech, Inc. (Horsham, Pa.).
[1113] In one embodiment, pharmaceutical compositions described
herein can include, without limitation, liposomes such as those
formed from the synthesis of stabilized plasmid-lipid particles
(SPLP) or stabilized nucleic acid lipid particle (SNALP) that have
been previously described and shown to be suitable for
oligonucleotide delivery in vitro and in vivo (see Wheeler et al.
Gene Therapy. 1999 6:271-281; Zhang et al. Gene Therapy. 1999
6:1438-1447; Jeffs et al. Pharm Res. 2005 22:362-372; Morrissey et
al., Nat Biotechnol. 2005 2:1002-1007; Zimmermann et al., Nature.
2006 441:111-114; Heyes et al. J Contr Rel. 2005 107:276-287;
Semple et al. Nature Biotech. 2010 28:172-176; Judge et al. J Clin
Invest. 2009 119:661-673; deFougerolles Hum Gene Ther. 2008
19:125-132; U.S. Patent Publication No US20130122104; all of which
are incorporated herein in their entireties). The original
manufacture method by Wheeler et al. was a detergent dialysis
method, which was later improved by Jeffs et al. and is referred to
as the spontaneous vesicle formation method. The liposome
formulations are composed of 3 to 4 lipid components in addition to
the polynucleotide. As an example a liposome can contain, but is
not limited to, 55% cholesterol, 20% disteroylphosphatidyl choline
(DSPC), 10% PEG-S-DSG, and 15%
1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), as described by
Jeffs et al. As another example, certain liposome formulations can
contain, but are not limited to, 48% cholesterol, 20% DSPC, 2%
PEG-c-DMA, and 30% cationic lipid, where the cationic lipid can be
1,2-distearloxy-N,N-dimethylaminopropane (DSDMA), DODMA, DLin-DMA,
or 1,2-dilinolenyloxy-3-dimethylaminopropane (DLenDMA), as
described by Heyes et al.
[1114] In some embodiments, liposome formulations can comprise from
about 25.0% cholesterol to about 40.0% cholesterol, from about
30.0% cholesterol to about 45.0% cholesterol, from about 35.0%
cholesterol to about 50.0% cholesterol and/or from about 48.5%
cholesterol to about 60% cholesterol. For example, formulations can
comprise a percentage of cholesterol selected from the group
consisting of 28.5%, 31.5%, 33.5%, 36.5%, 37.0%, 38.5%, 39.0% and
43.5%. In some embodiments, formulations can comprise from about
5.0% to about 10.0% DSPC and/or from about 7.0% to about 15.0%
DSPC.
[1115] In one embodiment, pharmaceutical compositions can include
liposomes that can be formed to deliver polynucleotides that can
encode at least one polypeptide of interest. The polynucleotides
can be encapsulated by the liposome and/or it can be contained in
an aqueous core that can then be encapsulated by the liposome (see
International Pub. Nos. WO2012031046, WO2012031043, WO2012030901
and WO2012006378 and US Patent Publication No. US20130189351,
US20130195969 and US20130202684; the contents of each of which are
herein incorporated by reference in their entirety).
[1116] In another embodiment, liposomes can be formulated for
targeted delivery. As a non-limiting example, the liposome can be
formulated for targeted delivery to the liver. The liposome used
for targeted delivery can include, but is not limited to, the
liposomes described in and methods of making liposomes described in
US Patent Publication No. US20130195967, the contents of which are
herein incorporated by reference in its entirety.
[1117] In another embodiment, the polynucleotide can be formulated
in a cationic oil-in-water emulsion where the emulsion particle
comprises an oil core and a cationic lipid that can interact with
the polynucleotide anchoring the molecule to the emulsion particle
(see International Pub. No. WO2012006380; herein incorporated by
reference in its entirety).
[1118] In one embodiment, the polynucleotides can be formulated in
a water-in-oil emulsion comprising a continuous hydrophobic phase
in which the hydrophilic phase is dispersed. As a non-limiting
example, the emulsion can be made by the methods described in
International Publication No. WO201087791, the contents of which
are herein incorporated by reference in its entirety.
[1119] In another embodiment, the lipid formulation can include at
least cationic lipid, a lipid that can enhance transfection and a
least one lipid that contains a hydrophilic head group linked to a
lipid moiety (International Pub. No. WO2011076807 and U.S. Pub. No.
20110200582; the contents of each of which is herein incorporated
by reference in their entirety). In another embodiment, the
polynucleotides can be formulated in a lipid vesicle that can have
crosslinks between functionalized lipid bilayers (see U.S. Pub. No.
20120177724, the contents of which is herein incorporated by
reference in its entirety).
[1120] In one embodiment, the polynucleotides can be formulated in
a liposome as described in International Patent Publication No.
WO2013086526, the contents of which is herein incorporated by
reference in its entirety. The polynucleotides can be encapsulated
in a liposome using reverse pH gradients and/or optimized internal
buffer compositions as described in International Patent
Publication No. WO2013086526, the contents of which is herein
incorporated by reference in its entirety.
[1121] In one embodiment, the polynucleotides pharmaceutical
compositions can be formulated in liposomes such as, but not
limited to, DiLa2 liposomes (Marina Biotech, Bothell, Wash.),
SMARTICLES.RTM. (Marina Biotech, Bothell, Wash.), neutral DOPC
(1,2-dioleoyl-sn-glycero-3-phosphocholine) based liposomes (e.g.,
siRNA delivery for ovarian cancer (Landen et al. Cancer Biology
& Therapy 2006 5(12)1708-1713); herein incorporated by
reference in its entirety) and hyaluronan-coated liposomes (Quiet
Therapeutics, Israel).
[1122] In one embodiment, the cationic lipid can be a low molecular
weight cationic lipid such as those described in US Patent
Application No. 20130090372, the contents of which are herein
incorporated by reference in its entirety.
[1123] In one embodiment, the polynucleotides can be formulated in
a lipid vesicle that can have crosslinks between functionalized
lipid bilayers.
[1124] In one embodiment, the polynucleotides can be formulated in
a liposome comprising a cationic lipid. The liposome can have a
molar ratio of nitrogen atoms in the cationic lipid to the
phosphates in the RNA (N:P ratio) of between 1:1 and 20:1 as
described in International Publication No. WO2013006825, herein
incorporated by reference in its entirety. In another embodiment,
the liposome can have a N:P ratio of greater than 20:1 or less than
1:1.
[1125] In one embodiment, the polynucleotides can be formulated in
a lipid-polycation complex. The formation of the lipid-polycation
complex can be accomplished by methods known in the art and/or as
described in U.S. Pub. No. 20120178702, herein incorporated by
reference in its entirety. As a non-limiting example, the
polycation can include a cationic peptide or a polypeptide such as,
but not limited to, polylysine, polyornithine and/or polyarginine
and the cationic peptides described in International Pub. No.
WO2012013326 or US Patent Pub. No. US20130142818; each of which is
herein incorporated by reference in its entirety. In another
embodiment, the polynucleotides can be formulated in a
lipid-polycation complex that can further include a non-cationic
lipid such as, but not limited to, cholesterol or dioleoyl
phosphatidylethanolamine (DOPE).
[1126] In one embodiment, the polynucleotides can be formulated in
an aminoalcohol lipidoid. Aminoalcohol lipidoids that can be used
in the present disclosure can be prepared by the methods described
in U.S. Pat. No. 8,450,298, herein incorporated by reference in its
entirety.
[1127] The liposome formulation can be influenced by, but not
limited to, the selection of the cationic lipid component, the
degree of cationic lipid saturation, the nature of the PEGylation,
ratio of all components and biophysical parameters such as size. In
one example by Semple et al. (Semple et al. Nature Biotech. 2010
28:172-176; herein incorporated by reference in its entirety), the
liposome formulation was composed of 57.1% cationic lipid, 7.1%
dipalmitoylphosphatidylcholine, 34.3% cholesterol, and 1.4%
PEG-c-DMA. As another example, changing the composition of the
cationic lipid could more effectively deliver siRNA to various
antigen presenting cells (Basha et al. Mol Ther. 2011 19:2186-2200;
herein incorporated by reference in its entirety). In some
embodiments, liposome formulations can comprise from about 35 to
about 45% cationic lipid, from about 40% to about 50% cationic
lipid, from about 50% to about 60% cationic lipid and/or from about
55% to about 65% cationic lipid. In some embodiments, the ratio of
lipid to mRNA in liposomes can be from about 5:1 to about 20:1,
from about 10:1 to about 25:1, from about 15:1 to about 30:1 and/or
at least 30:1.
[1128] In some embodiments, the ratio of PEG in the lipid
nanoparticle (LNP) formulations can be increased or decreased
and/or the carbon chain length of the PEG lipid can be modified
from C14 to C18 to alter the pharmacokinetics and/or
biodistribution of the LNP formulations. As a non-limiting example,
LNP formulations can contain from about 0.5% to about 3.0%, from
about 1.0% to about 3.5%, from about 1.5% to about 4.0%, from about
2.0% to about 4.5%, from about 2.5% to about 5.0% and/or from about
3.0% to about 6.0% of the lipid molar ratio of PEG-c-DOMG
(R-3-[(.omega.-methoxy-poly(ethyleneglycol)2000)carbamoyl)]-1,2-dimyristy-
loxypropyl-3-amine) (also referred to herein as PEG-DOMG) as
compared to the cationic lipid, DSPC and cholesterol. In another
embodiment the PEG-c-DOMG can be replaced with a PEG lipid such as,
but not limited to, PEG-DSG (1,2-Distearoyl-sn-glycerol,
methoxypolyethylene glycol), PEG-DMG (1,2-Dimyristoyl-sn-glycerol)
and/or PEG-DPG (1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene
glycol). The cationic lipid can be selected from any lipid known in
the art such as, but not limited to, DLin-MC3-DMA, DLin-DMA,
C12-200 and DLin-KC2-DMA.
[1129] In one embodiment, the polynucleotides can be formulated in
a lipid nanoparticle such as those described in International
Publication No. WO2012170930, the contents of which is herein
incorporated by reference in its entirety.
[1130] In one embodiment, the formulation comprising the
polynucleotide is a nanoparticle that can comprise at least one
lipid. The lipid can be selected from, but is not limited to,
DLin-DMA, DLin-K-DMA, 98N12-5, C12-200, DLin-MC3-DMA, DLin-KC2-DMA,
DODMA, PLGA, PEG, PEG-DMG, PEGylated lipids and amino alcohol
lipids. In another aspect, the lipid can be a cationic lipid such
as, but not limited to, DLin-DMA, DLin-D-DMA, DLin-MC3-DMA,
DLin-KC2-DMA, DODMA and amino alcohol lipids. The amino alcohol
cationic lipid can be the lipids described in and/or made by the
methods described in US Patent Publication No. US20130150625,
herein incorporated by reference in its entirety. As a non-limiting
example, the cationic lipid can be
2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-{[(9Z,2Z)-octadeca-9,12-
-dien-1-yloxy]methyl}propan-1-ol (Compound 1 in US20130150625);
2-amino-3-[(9Z)-octadec-9-en-1-yloxy]-2{-[(9Z)-octadec-9-en-1-yloxy]methy-
l}propan-1-ol (Compound 2 in US20130150625);
2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-[(octyloxy)methyl]propa-
n-1-ol (Compound 3 in US20130150625); and
2-(dimethylamino)-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-{[(9Z,12Z)-oc-
tadeca-9,12-dien-1-yloxy]methyl}propan-1-ol (Compound 4 in
US20130150625); or any pharmaceutically acceptable salt or
stereoisomer thereof.
[1131] Lipid nanoparticle formulations typically comprise a lipid,
in particular, an ionizable cationic lipid, for example,
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), or
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), and
further comprise a neutral lipid, a sterol and a molecule capable
of reducing particle aggregation, for example a PEG or PEG-modified
lipid.
[1132] In one embodiment, the lipid nanoparticle formulation
consists essentially of (i) at least one lipid selected from the
group consisting of
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319); (ii) a
neutral lipid selected from DSPC, DPPC, POPC, DOPE and SM; (iii) a
sterol, e.g., cholesterol; and (iv) a PEG-lipid, e.g., PEG-DMG or
PEG-cDMA, in a molar ratio of about 20-60% cationic lipid: 5-25%
neutral lipid: 25-55% sterol; 0.5-15% PEG-lipid.
[1133] In one embodiment, the formulation includes from about 25%
to about 75% on a molar basis of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), e.g.,
from about 35 to about 65%, from about 45 to about 65%, about 60%,
about 57.5%, about 50% or about 40% on a molar basis.
[1134] In one embodiment, the formulation includes from about 0.5%
to about 15% on a molar basis of the neutral lipid e.g., from about
3 to about 12%, from about 5 to about 10% or about 15%, about 10%,
or about 7.5% on a molar basis. Exemplary neutral lipids include,
but are not limited to, DSPC, POPC, DPPC, DOPE and SM. In one
embodiment, the formulation includes from about 5% to about 50% on
a molar basis of the sterol (e.g., about 15 to about 45%, about 20
to about 40%, about 40%, about 38.5%, about 35%, or about 31% on a
molar basis. An exemplary sterol is cholesterol. In one embodiment,
the formulation includes from about 0.5% to about 20% on a molar
basis of the PEG or PEG-modified lipid (e.g., about 0.5 to about
10%, about 0.5 to about 5%, about 1.5%, about 0.5%, about 1.5%,
about 3.5%, or about 5% on a molar basis. In one embodiment, the
PEG or PEG modified lipid comprises a PEG molecule of an average
molecular weight of 2,000 Da. In other embodiments, the PEG or PEG
modified lipid comprises a PEG molecule of an average molecular
weight of less than 2,000, for example around 1,500 Da, around
1,000 Da, or around 500 Da. Exemplary PEG-modified lipids include,
but are not limited to, PEG-distearoyl glycerol (PEG-DMG) (also
referred herein as PEG-C14 or C14-PEG), PEG-cDMA (further discussed
in Reyes et al. J. Controlled Release, 107, 276-287 (2005) the
contents of which are herein incorporated by reference in its
entirety)
[1135] In one embodiment, the formulations of the disclosure
include 25-75% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 0.5-15%
of the neutral lipid, 5-50% of the sterol, and 0.5-20% of the PEG
or PEG-modified lipid on a molar basis.
[1136] In one embodiment, the formulations of the disclosure
include 35-65% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 3-12%
of the neutral lipid, 15-45% of the sterol, and 0.5-10% of the PEG
or PEG-modified lipid on a molar basis.
[1137] In one embodiment, the formulations of the disclosure
include 45-65% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 5-10%
of the neutral lipid, 25-40% of the sterol, and 0.5-10% of the PEG
or PEG-modified lipid on a molar basis.
[1138] In one embodiment, the formulations of the disclosure
include about 60% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
7.5% of the neutral lipid, about 31% of the sterol, and about 1.5%
of the PEG or PEG-modified lipid on a molar basis.
[1139] In one embodiment, the formulations of the disclosure
include about 50% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
10% of the neutral lipid, about 38.5% of the sterol, and about 1.5%
of the PEG or PEG-modified lipid on a molar basis.
[1140] In one embodiment, the formulations of the disclosure
include about 50% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
10% of the neutral lipid, about 35% of the sterol, about 4.5% or
about 5% of the PEG or PEG-modified lipid, and about 0.5% of the
targeting lipid on a molar basis.
[1141] In one embodiment, the formulations of the disclosure
include about 40% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
15% of the neutral lipid, about 40% of the sterol, and about 5% of
the PEG or PEG-modified lipid on a molar basis.
[1142] In one embodiment, the formulations of the disclosure
include about 57.2% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
7.1% of the neutral lipid, about 34.3% of the sterol, and about
1.4% of the PEG or PEG-modified lipid on a molar basis.
[1143] In one embodiment, the formulations of the disclosure
include about 57.5% of a cationic lipid selected from the PEG lipid
is PEG-cDMA (PEG-cDMA is further discussed in Reyes et al. (J.
Controlled Release, 107, 276-287 (2005), the contents of which are
herein incorporated by reference in its entirety), about 7.5% of
the neutral lipid, about 31.5% of the sterol, and about 3.5% of the
PEG or PEG-modified lipid on a molar basis.
[1144] In some embodiments, lipid nanoparticle formulation consists
essentially of a lipid mixture in molar ratios of about 20-70%
cationic lipid: 5-45% neutral lipid: 20-55% cholesterol: 0.5-15%
PEG-modified lipid. In some embodiments, lipid nanoparticle
formulation consists essentially of a lipid mixture in molar ratios
of about 20-60% cationic lipid: 5-25% neutral lipid: 25-55%
cholesterol: 0.5-15% PEG-modified lipid.
[1145] In particular embodiments, the molar lipid ratio is
approximately 50/10/38.5/1.5 (mol % cationic lipid/neutral lipid,
e.g., DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG, PEG-DSG or
PEG-DPG), 57.2/7.1134.3/1.4 (mol % cationic lipid/neutral lipid,
e.g., DPPC/Chol/PEG-modified lipid, e.g., PEG-cDMA), 40/15/40/5
(mol % cationic lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified
lipid, e.g., PEG-DMG), 50/10/35/4.5/0.5 (mol % cationic
lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g.,
PEG-DSG), 50/10/35/5 (cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG), 40/10/40/10 (mol %
cationic lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid,
e.g., PEG-DMG or PEG-cDMA), 35/15/40/10 (mol % cationic
lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g.,
PEG-DMG or PEG-cDMA) or 52/13/30/5 (mol % cationic lipid/neutral
lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG or
PEG-cDMA).
[1146] Exemplary lipid nanoparticle compositions and methods of
making same are described, for example, in Semple et al. (2010)
Nat. Biotechnol. 28:172-176; Jayarama et al. (2012), Angew. Chem.
Int. Ed., 51: 8529-8533; and Maier et al. (2013) Molecular Therapy
21, 1570-1578 (the contents of each of which are incorporated
herein by reference in their entirety).
[1147] In one embodiment, the lipid nanoparticle formulations
described herein can comprise a cationic lipid, a PEG lipid and a
structural lipid and optionally comprise a non-cationic lipid. As a
non-limiting example, the lipid nanoparticle can comprise about
40-60% of cationic lipid, about 5-15% of a non-cationic lipid,
about 1-2% of a PEG lipid and about 30-50% of a structural lipid.
As another non-limiting example, the lipid nanoparticle can
comprise about 50% cationic lipid, about 10% non-cationic lipid,
about 1.5% PEG lipid and about 38.5% structural lipid. As yet
another non-limiting example, the lipid nanoparticle can comprise
about 55% cationic lipid, about 10% non-cationic lipid, about 2.5%
PEG lipid and about 32.5% structural lipid. In one embodiment, the
cationic lipid can be any cationic lipid described herein such as,
but not limited to, DLin-KC2-DMA, DLin-MC3-DMA and L319.
[1148] In one embodiment, the lipid nanoparticle formulations
described herein can be 4 component lipid nanoparticles. The lipid
nanoparticle can comprise a cationic lipid, a non-cationic lipid, a
PEG lipid and a structural lipid. As a non-limiting example, the
lipid nanoparticle can comprise about 40-60% of cationic lipid,
about 5-15% of a non-cationic lipid, about 1-2% of a PEG lipid and
about 30-50% of a structural lipid. As another non-limiting
example, the lipid nanoparticle can comprise about 50% cationic
lipid, about 10% non-cationic lipid, about 1.5% PEG lipid and about
38.5% structural lipid. As yet another non-limiting example, the
lipid nanoparticle can comprise about 55% cationic lipid, about 10%
non-cationic lipid, about 2.5% PEG lipid and about 32.5% structural
lipid. In one embodiment, the cationic lipid can be any cationic
lipid described herein such as, but not limited to, DLin-KC2-DMA,
DLin-MC3-DMA and L319.
[1149] In one embodiment, the lipid nanoparticle formulations
described herein can comprise a cationic lipid, a non-cationic
lipid, a PEG lipid and a structural lipid. As a non-limiting
example, the lipid nanoparticle comprise about 50% of the cationic
lipid DLin-KC2-DMA, about 10% of the non-cationic lipid DSPC, about
1.5% of the PEG lipid PEG-DOMG and about 38.5% of the structural
lipid cholesterol. As a non-limiting example, the lipid
nanoparticle comprise about 50% of the cationic lipid DLin-MC3-DMA,
about 10% of the non-cationic lipid DSPC, about 1.5% of the PEG
lipid PEG-DOMG and about 38.5% of the structural lipid cholesterol.
As a non-limiting example, the lipid nanoparticle comprise about
50% of the cationic lipid DLin-MC3-DMA, about 10% of the
non-cationic lipid DSPC, about 1.5% of the PEG lipid PEG-DMG and
about 38.5% of the structural lipid cholesterol. As yet another
non-limiting example, the lipid nanoparticle comprise about 55% of
the cationic lipid L319, about 10% of the non-cationic lipid DSPC,
about 2.5% of the PEG lipid PEG-DMG and about 32.5% of the
structural lipid cholesterol.
[1150] In one embodiment, the cationic lipid can be selected from,
but not limited to, a cationic lipid described in International
Publication Nos. WO2012040184, WO2011153120, WO2011149733,
WO2011090965, WO2011043913, WO2011022460, WO2012061259,
WO2012054365, WO2012044638, WO2010080724, WO201021865,
WO2008103276, WO2013086373 and WO2013086354, U.S. Pat. Nos.
7,893,302, 7,404,969, 8,283,333, and 8,466,122 and US Patent
Publication No. US20100036115, US20120202871, US20130064894,
US20130129785, US20130150625, US20130178541 and US20130225836; the
contents of each of which are herein incorporated by reference in
their entirety. In another embodiment, the cationic lipid can be
selected from, but not limited to, formula A described in
International Publication Nos. WO2012040184, WO2011153120,
WO2011149733, WO2011090965, WO2011043913, WO2011022460,
WO2012061259, WO2012054365, WO2012044638 and WO2013116126 or US
Patent Publication No. US20130178541 and US20130225836; the
contents of each of which is herein incorporated by reference in
their entirety. In yet another embodiment, the cationic lipid can
be selected from, but not limited to, formula CLI-CLXXIX of
International Publication No. WO2008103276, formula CLI-CLXXIX of
U.S. Pat. No. 7,893,302, formula CLI-CLXXXXII of U.S. Pat. No.
7,404,969 and formula I-VI of US Patent Publication No.
US20100036115, formula I of US Patent Publication No US20130123338;
each of which is herein incorporated by reference in their
entirety. As a non-limiting example, the cationic lipid can be
selected from (20Z,23Z)-N,N-dimethylnonacosa-20,23-dien-10-amine,
(17Z,20Z)-N,N-dimemylhexacosa-17,20-dien-9-amine,
(1Z,19Z)-N5N-dimethylpentacosa-1 6, 19-dien-8-amine,
(13Z,16Z)-N,N-dimethyldocosa-13,16-dien-5-amine,
(12Z,15Z)-N,N-dimethylhenicosa-12,15-dien-4-amine,
(14Z,17Z)-N,N-dimethyltricosa-14,17-dien-6-amine,
(15Z,18Z)-N,N-dimethyltetracosa-15,18-dien-7-amine,
(18Z,21Z)-N,N-dimethylheptacosa-18,21-dien-10-amine,
(15Z,18Z)-N,N-dimethyltetracosa-15,18-dien-5-amine,
(14Z,17Z)-N,N-dimethyltricosa-14,17-dien-4-amine,
(19Z,22Z)-N,N-dimeihyloctacosa-19,22-dien-9-amine,
(18Z,21Z)-N,N-dimethylheptacosa-18,21-dien-8-amine,
(17Z,20Z)-N,N-dimethylhexacosa-17,20-dien-7-amine,
(16Z,19Z)-N,N-dimethylpentacosa-16,19-dien-6-amine,
(22Z,25Z)-N,N-dimethylhentriaconta-22,25-dien-10-amine,
(21Z,24Z)-N,N-dimethyltriaconta-21,24-dien-9-amine,
(18Z)-N,N-dimetylheptacos-18-en-10-amine,
(17Z)-N,N-dimethylhexacos-17-en-9-amine,
(19Z,22Z)-N,N-dimethyloctacosa-19,22-dien-7-amine,
N,N-dimethylheptacosan-10-amine,
(20Z,23Z)-N-ethyl-N-methylnonacosa-20,23-dien-10-amine,
1-[(11Z,14Z)-1-nonylicosa-11,14-dien-1-yl] pyrrolidine,
(20Z)-N,N-dimethylheptacos-20-en-10-amine, (15Z)-N,N-dimethyl
eptacos-15-en-1 0-amine, (14Z)-N,N-dimethylnonacos-14-en-10-amine,
(17Z)-N,N-dimethylnonacos-17-en-10-amine,
(24Z)-N,N-dimethyltritriacont-24-en-10-amine,
(20Z)-N,N-dimethylnonacos-20-en-10-amine,
(22Z)-N,N-dimethylhentriacont-22-en-10-amine,
(16Z)-N,N-dimethylpentacos-16-en-8-amine,
(12Z,15Z)-N,N-dimethyl-2-nonylhenicosa-12,15-dien-1-amine,
(13Z,16Z)-N,N-dimethyl-3-nonyldocosa-13,16-dien-1-amine,
N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl] eptadecan-8-amine,
1-[(1S,2R)-2-hexylcyclopropyl]-N,N-dimethylnonadecan-10-amine,
N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]nonadecan-10-amine,
N,N-dimethyl-21-[(1S,2R)-2-octylcyclopropyl]henicosan-10-amine,N,N-dimeth-
yl-1-[(1S,2S)-2-{[(1R,2R)-2-pentylcycIopropyl]methyl}cyclopropyl]nonadecan-
-10-amine,N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]hexadecan-8-amine,
N,N-dimethyl-[(1R,2S)-2-undecyIcyclopropyl]tetradecan-5-amine,
N,N-dimethyl-3-{7-[(1S,2R)-2-octylcyclopropyl]heptyl}
dodecan-1-amine,
1-[(1R,2S)-2-heptylcyclopropyl]-N,N-dimethyloctadecan-9-amine,
1-[(1S,2R)-2-decylcyclopropyl]-N,N-dimethylpentadecan-6-amine,
N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]pentadecan-8-amine,
R--N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-(octyloxy)propa-
n-2-amine,
S--N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-(octy-
loxy)propan-2-amine,
1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}pyrr-
olidine,
(2S)--N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-[(5Z-
)-oct-5-en-1-yloxy]propan-2-amine,
1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}azet-
idine,
(2S)-1-(hexyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-ylo-
xy]propan-2-amine,
(2S)-1-(heptyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]pr-
opan-2-amine,
N,N-dimethyl-1-(nonyloxy)-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-
-amine,
N,N-dimethyl-1-[(9Z)-octadec-9-en-1-yloxy]-3-(octyloxy)propan-2-am-
ine;
(2S)--N,N-dimethyl-1-[(6Z,9Z,12Z)-octadeca-6,9,12-trien-1-yloxy]-3-(o-
ctyloxy)propan-2-amine,
(2S)-1-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethyl-3-(pentyloxy)pro-
pan-2-amine,
(2S)-1-(hexyloxy)-3-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethylprop-
an-2-amine,
1-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2--
amine,
1-[(13Z,16Z)-docosa-13,16-dien-1-yloxy]-N,N-dimethyl-3-(octyloxy)pr-
opan-2-amine,
(2S)-1-[(13Z,16Z)-docosa-13,16-dien-1-yloxy]-3-(hexyloxy)-N,N-dimethylpro-
pan-2-amine,
(2S)-1-[(13Z)-docos-13-en-1-yloxy]-3-(hexyloxy)-N,N-dimethylpropan-2-amin-
e,
1-[(13Z)-docos-13-en-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine,
1-[(9Z)-hexadec-9-en-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine,
(2R)--N,N-dimethyl-H(1-metoylo
ctyl)oxy]-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-amine,
(2R)-1-[(3,7-dimethyloctyl)oxy]-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-di-
en-1-yloxy]propan-2-amine,
N,N-dimethyl-1-(octyloxy)-3-({8-[(1S,2S)-2-{[(1R,2R)-2-pentylcyclopropyl]-
methyl}cyclopropyl]octyl}oxy)propan-2-amine,
N,N-dimethyl-1-{[8-(2-octylcyclopropyl)octyl]oxy}-3-(octyloxy)propan-2-am-
ine and (11E,20Z,23Z)-N,N-dimethylnonacosa-11,20,2-trien-10-amine
or a pharmaceutically acceptable salt or stereoisomer thereof.
[1151] In one embodiment, the lipid can be a cleavable lipid such
as those described in International Publication No. WO2012170889,
herein incorporated by reference in its entirety.
[1152] In another embodiment, the lipid can be a cationic lipid
such as, but not limited to, Formula (I) of U.S. Patent Application
No. US20130064894, the contents of which are herein incorporated by
reference in its entirety.
[1153] In one embodiment, the cationic lipid can be synthesized by
methods known in the art and/or as described in International
Publication Nos. WO2012040184, WO2011153120, WO2011149733,
WO2011090965, WO2011043913, WO2011022460, WO2012061259,
WO2012054365, WO2012044638, WO2010080724, WO201021865, WO2013086373
and WO2013086354; the contents of each of which are herein
incorporated by reference in their entirety.
[1154] In another embodiment, the cationic lipid can be a trialkyl
cationic lipid. Non-limiting examples of trialkyl cationic lipids
and methods of making and using the trialkyl cationic lipids are
described in International Patent Publication No. WO2013126803, the
contents of which are herein incorporated by reference in its
entirety.
[1155] In one embodiment, the LNP formulations of the
polynucleotides can contain PEG-c-DOMG at 3% lipid molar ratio. In
another embodiment, the LNP formulations of polynucleotides can
contain PEG-c-DOMG at 1.5% lipid molar ratio.
[1156] In one embodiment, the pharmaceutical compositions of the
polynucleotides can include at least one of the PEGylated lipids
described in International Publication No. WO2012099755, the
contents of which is herein incorporated by reference in its
entirety.
[1157] In one embodiment, the LNP formulation can contain PEG-DMG
2000
(1,2-dimyristoyl-sn-glycero-3-phophoethanolamine-N-[methoxy(polyethylene
glycol)-2000). In one embodiment, the LNP formulation can contain
PEG-DMG 2000, a cationic lipid known in the art and at least one
other component. In another embodiment, the LNP formulation can
contain PEG-DMG 2000, a cationic lipid known in the art, DSPC and
cholesterol. As a non-limiting example, the LNP formulation can
contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol. As another
non-limiting example the LNP formulation can contain PEG-DMG 2000,
DLin-DMA, DSPC and cholesterol in a molar ratio of 2:40:10:48 (see,
e.g., Geall et al., Nonviral delivery of self-amplifying RNA
vaccines, PNAS 2012; PMID: 22908294; herein incorporated by
reference in its entirety).
[1158] In one embodiment, the LNP formulation can be formulated by
the methods described in International Publication Nos.
WO2011127255 or WO2008103276, the contents of each of which is
herein incorporated by reference in their entirety. As a
non-limiting example, the polynucleotides described herein can be
encapsulated in LNP formulations as described in WO2011127255
and/or WO2008103276; each of which is herein incorporated by
reference in their entirety.
[1159] In one embodiment, the polynucleotides described herein can
be formulated in a nanoparticle to be delivered by a parenteral
route as described in U.S. Pub. No. US20120207845; the contents of
which are herein incorporated by reference in its entirety.
[1160] In one embodiment, the Polynucleotides can be formulated in
a lipid nanoparticle made by the methods described in US Patent
Publication No US20130156845 or International Publication No
WO2013093648 or WO2012024526, each of which is herein incorporated
by reference in its entirety.
[1161] The lipid nanoparticles described herein can be made in a
sterile environment by the system and/or methods described in US
Patent Publication No. US20130164400, herein incorporated by
reference in its entirety.
[1162] In one embodiment, the LNP formulation can be formulated in
a nanoparticle such as a nucleic acid-lipid particle described in
U.S. Pat. No. 8,492,359, the contents of which are herein
incorporated by reference in its entirety. As a non-limiting
example, the lipid particle can comprise one or more active agents
or therapeutic agents; one or more cationic lipids comprising from
about 50 mol % to about 85 mol % of the total lipid present in the
particle; one or more non-cationic lipids comprising from about 13
mol % to about 49.5 mol % of the total lipid present in the
particle; and one or more conjugated lipids that inhibit
aggregation of particles comprising from about 0.5 mol % to about 2
mol % of the total lipid present in the particle. The nucleic acid
in the nanoparticle can be the polynucleotides described herein
and/or are known in the art.
[1163] In one embodiment, the LNP formulation can be formulated by
the methods described in International Publication Nos.
WO2011127255 or WO2008103276, the contents of each of which are
herein incorporated by reference in their entirety. As a
non-limiting example, modified RNA described herein can be
encapsulated in LNP formulations as described in WO2011127255
and/or WO2008103276; the contents of each of which are herein
incorporated by reference in their entirety.
[1164] In one embodiment, LNP formulations described herein can
comprise a polycationic composition. As a non-limiting example, the
polycationic composition can be selected from formula 1-60 of US
Patent Publication No. US20050222064; the content of which is
herein incorporated by reference in its entirety. In another
embodiment, the LNP formulations comprising a polycationic
composition can be used for the delivery of the modified RNA
described herein in vivo and/or in vitro.
[1165] In one embodiment, the LNP formulations described herein can
additionally comprise a permeability enhancer molecule.
Non-limiting permeability enhancer molecules are described in US
Patent Publication No. US20050222064; the content of which is
herein incorporated by reference in its entirety.
[1166] In one embodiment, the polynucleotide pharmaceutical
compositions can be formulated in liposomes such as, but not
limited to, DiLa2 liposomes (Marina Biotech, Bothell, Wash.),
SMARTICLES.RTM. (Marina Biotech, Bothell, Wash.), neutral DOPC
(1,2-dioleoyl-sn-glycero-3-phosphocholine) based liposomes (e.g.,
siRNA delivery for ovarian cancer (Landen et al. Cancer Biology
& Therapy 2006 5(12)1708-1713); herein incorporated by
reference in its entirety) and hyaluronan-coated liposomes (Quiet
Therapeutics, Israel).
[1167] In one embodiment, the Polynucleotides can be formulated in
a lyophilized gel-phase liposomal composition as described in US
Publication No. US2012060293, herein incorporated by reference in
its entirety.
[1168] The nanoparticle formulations can comprise a phosphate
conjugate. The phosphate conjugate can increase in vivo circulation
times and/or increase the targeted delivery of the nanoparticle.
Phosphate conjugates for use with the present disclosure can be
made by the methods described in International Application No.
WO2013033438 or US Patent Publication No. US20130196948, the
contents of each of which are herein incorporated by reference in
its entirety. As a non-limiting example, the phosphate conjugates
can include a compound of any one of the formulas described in
International Application No. WO2013033438, herein incorporated by
reference in its entirety.
[1169] The nanoparticle formulation can comprise a polymer
conjugate. The polymer conjugate can be a water soluble conjugate.
The polymer conjugate can have a structure as described in U.S.
Patent Application No. 20130059360, the contents of which are
herein incorporated by reference in its entirety. In one aspect,
polymer conjugates with the polynucleotides of the present
disclosure can be made using the methods and/or segmented polymeric
reagents described in U.S. Patent Application No. 20130072709,
herein incorporated by reference in its entirety. In another
aspect, the polymer conjugate can have pendant side groups
comprising ring moieties such as, but not limited to, the polymer
conjugates described in US Patent Publication No. US20130196948,
the contents of which is herein incorporated by reference in its
entirety.
[1170] The nanoparticle formulations can comprise a conjugate to
enhance the delivery of nanoparticles of the present disclosure in
a subject. Further, the conjugate can inhibit phagocytic clearance
of the nanoparticles in a subject. In one aspect, the conjugate can
be a "self" peptide designed from the human membrane protein CD47
(e.g., the "self" particles described by Rodriguez et al (Science
2013 339, 971-975), herein incorporated by reference in its
entirety). As shown by Rodriguez et al. the self peptides delayed
macrophage-mediated clearance of nanoparticles which enhanced
delivery of the nanoparticles. In another aspect, the conjugate can
be the membrane protein CD47 (e.g., see Rodriguez et al. Science
2013 339, 971-975, herein incorporated by reference in its
entirety). Rodriguez et al. showed that, similarly to "self"
peptides, CD47 can increase the circulating particle ratio in a
subject as compared to scrambled peptides and PEG coated
nanoparticles.
[1171] In one embodiment, the Polynucleotides of the present
disclosure are formulated in nanoparticles that comprise a
conjugate to enhance the delivery of the nanoparticles of the
present disclosure in a subject. The conjugate can be the CD47
membrane or the conjugate can be derived from the CD47 membrane
protein, such as the "self" peptide described previously. In
another aspect the nanoparticle can comprise PEG and a conjugate of
CD47 or a derivative thereof. In yet another aspect, the
nanoparticle can comprise both the "self" peptide described above
and the membrane protein CD47.
[1172] In another aspect, a "self" peptide and/or CD47 protein can
be conjugated to a virus-like particle or pseudovirion, as
described herein for delivery of the Polynucleotides of the present
disclosure.
[1173] In another embodiment, pharmaceutical compositions comprise
the polynucleotides of the present disclosure and a conjugate that
can have a degradable linkage. Non-limiting examples of conjugates
include an aromatic moiety comprising an ionizable hydrogen atom, a
spacer moiety, and a water-soluble polymer. As a non-limiting
example, pharmaceutical compositions comprising a conjugate with a
degradable linkage and methods for delivering such pharmaceutical
compositions are described in US Patent Publication No.
US20130184443, the contents of which are herein incorporated by
reference in its entirety.
[1174] The nanoparticle formulations can be a carbohydrate
nanoparticle comprising a carbohydrate carrier and a
polynucleotide. As a non-limiting example, the carbohydrate carrier
can include, but is not limited to, an anhydride-modified
phytoglycogen or glycogen-type material, phytoglycogen octenyl
succinate, phytoglycogen beta-dextrin, anhydride-modified
phytoglycogen beta-dextrin. (See, e.g., International Publication
No. WO2012109121; the contents of which are herein incorporated by
reference in its entirety).
[1175] Nanoparticle formulations of the present disclosure can be
coated with a surfactant or polymer in order to improve the
delivery of the particle. In one embodiment, the nanoparticle can
be coated with a hydrophilic coating such as, but not limited to,
PEG coatings and/or coatings that have a neutral surface charge.
The hydrophilic coatings can help to deliver nanoparticles with
larger payloads such as, but not limited to, Polynucleotides within
the central nervous system. As a non-limiting example nanoparticles
comprising a hydrophilic coating and methods of making such
nanoparticles are described in US Patent Publication No.
US20130183244, the contents of which are herein incorporated by
reference in its entirety.
[1176] In one embodiment, the lipid nanoparticles of the present
disclosure can be hydrophilic polymer particles. Non-limiting
examples of hydrophilic polymer particles and methods of making
hydrophilic polymer particles are described in US Patent
Publication No. US20130210991, the contents of which are herein
incorporated by reference in its entirety.
[1177] In another embodiment, the lipid nanoparticles of the
present disclosure can be hydrophobic polymer particles.
[1178] Lipid nanoparticle formulations can be improved by replacing
the cationic lipid with a biodegradable cationic lipid that is
known as a rapidly eliminated lipid nanoparticle (reLNP). Ionizable
cationic lipids, such as, but not limited to, DLinDMA,
DLin-KC2-DMA, and DLin-MC3-DMA, have been shown to accumulate in
plasma and tissues over time and can be a potential source of
toxicity. The rapid metabolism of the rapidly eliminated lipids can
improve the tolerability and therapeutic index of the lipid
nanoparticles by an order of magnitude from a 1 mg/kg dose to a 10
mg/kg dose in rat. Inclusion of an enzymatically degraded ester
linkage can improve the degradation and metabolism profile of the
cationic component, while still maintaining the activity of the
reLNP formulation. The ester linkage can be internally located
within the lipid chain or it can be terminally located at the
terminal end of the lipid chain. The internal ester linkage can
replace any carbon in the lipid chain.
[1179] In one embodiment, the internal ester linkage can be located
on either side of the saturated carbon.
[1180] Lipid nanoparticles can be engineered to alter the surface
properties of particles so the lipid nanoparticles can penetrate
the mucosal barrier. Mucus is located on mucosal tissue such as,
but not limited to, oral (e.g., the buccal and esophageal membranes
and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach,
small intestine, large intestine, colon, rectum), nasal,
respiratory (e.g., nasal, pharyngeal, tracheal and bronchial
membranes), genital (e.g., vaginal, cervical and urethral
membranes). Nanoparticles larger than 10-200 nm can be used for
higher drug encapsulation efficiency and the ability to provide the
sustained delivery of a wide array of drugs have been thought to be
too large to rapidly diffuse through mucosal barriers. Mucus is
continuously secreted, shed, discarded or digested and recycled so
most of the trapped particles can be removed from the mucosal
tissue within seconds or within a few hours. Large polymeric
nanoparticles (200 nm-500 nm in diameter) that have been coated
densely with a low molecular weight polyethylene glycol (PEG)
diffused through mucus only 4 to 6-fold lower than the same
particles diffusing in water (Lai et al. PNAS 2007 104(5):1482-487;
Lai et al. Adv Drug Deliv Rev. 2009 61(2): 158-171; each of which
is herein incorporated by reference in their entirety). The
transport of nanoparticles can be determined using rates of
permeation and/or fluorescent microscopy techniques including, but
not limited to, fluorescence recovery after photobleaching (FRAP)
and high resolution multiple particle tracking (MPT). As a
non-limiting example, compositions that can penetrate a mucosal
barrier can be made as described in U.S. Pat. No. 8,241,670 or
International Patent Publication No. WO2013110028, the contents of
each of which are herein incorporated by reference in its
entirety.
[1181] The lipid nanoparticle engineered to penetrate mucus can
comprise a polymeric material (i.e., a polymeric core) and/or a
polymer-vitamin conjugate and/or a tri-block co-polymer. The
polymeric material can include, but is not limited to, polyamines,
polyethers, polyamides, polyesters, polycarbamates, polyureas,
polycarbonates, poly(styrenes), polyimides, polysulfones,
polyurethanes, polyacetylenes, polyethylenes, polyethyeneimines,
polyisocyanates, polyacrylates, polymethacrylates,
polyacrylonitriles, and polyarylates. The polymeric material can be
biodegradable and/or biocompatible. Non-limiting examples of
biocompatible polymers are described in International Patent
Publication No. WO2013116804, the contents of which are herein
incorporated by reference in its entirety. The polymeric material
can additionally be irradiated. As a non-limiting example, the
polymeric material can be gamma irradiated (See e.g., International
App. No. WO201282165, herein incorporated by reference in its
entirety). Non-limiting examples of specific polymers include
poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA),
poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(glycolic
acid) (PGA), poly(lactic acid-co-glycolic acid) (PLGA),
poly(L-lactic acid-co-glycolic acid) (PLLGA), poly(D,L-lactide)
(PDLA), poly(L-lactide) (PLLA), poly(D,L-lactide-co-caprolactone),
poly(D,L-lactide-co-caprolactone-co-glycolide),
poly(D,L-lactide-co-PEO-co-D,L-lactide),
poly(D,L-lactide-co-PPO-co-D,L-lactide), polyalkyl cyanoacralate,
polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate
(HPMA), polyethyleneglycol, poly-L-glutamic acid, poly(hydroxy
acids), polyanhydrides, polyorthoesters, poly(ester amides),
polyamides, poly(ester ethers), polycarbonates, polyalkylenes such
as polyethylene and polypropylene, polyalkylene glycols such as
poly(ethylene glycol) (PEG), polyalkylene oxides (PEO),
polyalkylene terephthalates such as poly(ethylene terephthalate),
polyvinyl alcohols (PVA), polyvinyl ethers, polyvinyl esters such
as poly(vinyl acetate), polyvinyl halides such as poly(vinyl
chloride) (PVC), polyvinylpyrrolidone, polysiloxanes, polystyrene
(PS), polyurethanes, derivatized celluloses such as alkyl
celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose
esters, nitro celluloses, hydroxypropylcellulose,
carboxymethylcellulose, polymers of acrylic acids, such as
poly(methyl(meth)acrylate) (PMMA), poly(ethyl(meth)acrylate),
poly(butyl(meth)acrylate), poly(isobutyl(meth)acrylate),
poly(hexyl(meth)acrylate), poly(isodecyl(meth)acrylate),
poly(lauryl(meth)acrylate), poly(phenyl(meth)acrylate), poly(methyl
acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate),
poly(octadecyl acrylate) and copolymers and mixtures thereof,
polydioxanone and its copolymers, polyhydroxyalkanoates,
polypropylene fumarate, polyoxymethylene, poloxamers,
poly(ortho)esters, poly(butyric acid), poly(valeric acid),
poly(lactide-co-caprolactone), PEG-PLGA-PEG and trimethylene
carbonate, polyvinylpyrrolidone. The lipid nanoparticle can be
coated or associated with a co-polymer such as, but not limited to,
a block co-polymer (such as a branched polyether-polyamide block
copolymer described in International Publication No. WO2013012476,
herein incorporated by reference in its entirety), and
(poly(ethylene glycol))-(poly(propylene oxide))-(poly(ethylene
glycol)) triblock copolymer (see, e.g., US Publication 20120121718
and US Publication 20100003337 and U.S. Pat. No. 8,263,665; each of
which is herein incorporated by reference in their entirety). The
co-polymer can be a polymer that is generally regarded as safe
(GRAS) and the formation of the lipid nanoparticle can be in such a
way that no new chemical entities are created. For example, the
lipid nanoparticle can comprise poloxamers coating PLGA
nanoparticles without forming new chemical entities that are still
able to rapidly penetrate human mucus (Yang et al. Angew. Chem.
Int. Ed. 2011 50:2597-2600; the contents of which are herein
incorporated by reference in its entirety). A non-limiting scalable
method to produce nanoparticles that can penetrate human mucus is
described by Xu et al. (See, e.g., J Control Release 2013,
170(2):279-86; the contents of which are herein incorporated by
reference in its entirety).
[1182] The vitamin of the polymer-vitamin conjugate can be vitamin
E. The vitamin portion of the conjugate can be substituted with
other suitable components such as, but not limited to, vitamin A,
vitamin E, other vitamins, cholesterol, a hydrophobic moiety, or a
hydrophobic component of other surfactants (e.g., sterol chains,
fatty acids, hydrocarbon chains and alkylene oxide chains).
[1183] The lipid nanoparticle engineered to penetrate mucus can
include surface altering agents such as, but not limited to,
polynucleotides, anionic proteins (e.g., bovine serum albumin),
surfactants (e.g., cationic surfactants such as for example
dimethyldioctadecyl-ammonium bromide), sugars or sugar derivatives
(e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin,
polyethylene glycol and poloxamer), mucolytic agents (e.g.,
N-acetylcysteine, mugwort, bromelain, papain, clerodendrum,
acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna,
ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin,
gelsolin, thymosin .beta.4 dornase alfa, neltenexine, erdosteine)
and various DNases including rhDNase. The surface altering agent
can be embedded or enmeshed in the particle's surface or disposed
(e.g., by coating, adsorption, covalent linkage, or other process)
on the surface of the lipid nanoparticle. (see e.g., US Publication
20100215580 and US Publication 20080166414 and US20130164343; the
contents of each of which is herein incorporated by reference in
their entirety).
[1184] In one embodiment, the mucus penetrating lipid nanoparticles
can comprise at least one polynucleotide described herein. The
polynucleotide can be encapsulated in the lipid nanoparticle and/or
disposed on the surface of the particle. The polynucleotide can be
covalently coupled to the lipid nanoparticle. Formulations of mucus
penetrating lipid nanoparticles can comprise a plurality of
nanoparticles. Further, the formulations can contain particles that
can interact with the mucus and alter the structural and/or
adhesive properties of the surrounding mucus to decrease
mucoadhesion that can increase the delivery of the mucus
penetrating lipid nanoparticles to the mucosal tissue.
[1185] In another embodiment, the mucus penetrating lipid
nanoparticles can be a hypotonic formulation comprising a mucosal
penetration enhancing coating. The formulation can be hypotonic for
the epithelium to which it is being delivered. Non-limiting
examples of hypotonic formulations can be found in International
Patent Publication No. WO2013110028, the contents of which are
herein incorporated by reference in its entirety.
[1186] In one embodiment, in order to enhance the delivery through
the mucosal barrier the polynucleotide formulation can comprise or
be a hypotonic solution. Hypotonic solutions were found to increase
the rate at which mucoinert particles such as, but not limited to,
mucus-penetrating particles, were able to reach the vaginal
epithelial surface (see, e.g., Ensign et al. Biomaterials 2013
34(28):6922-9; the contents of which is herein incorporated by
reference in its entirety).
[1187] In one embodiment, the polynucleotide is formulated as a
lipoplex, such as, without limitation, the ATUPLEX.TM. system, the
DACC system, the DBTC system and other siRNA-lipoplex technology
from Silence Therapeutics (London, United Kingdom), STEMFECT.TM.
from STEMGENT.RTM. (Cambridge, Mass.), and polyethylenimine (PEI)
or protamine-based targeted and non-targeted delivery of nucleic
acids (Aleku et al. Cancer Res. 2008 68:9788-9798; Strumberg et al.
Int J Clin Pharmacol Ther 2012 50:76-78; Santel et al., Gene Ther
2006 13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370;
Gutbier et al., Pulm Pharmacol. Ther. 2010 23:334-344; Kaufmann et
al. Microvasc Res 2010 80:286-293Weide et al. J Immunother. 2009
32:498-507; Weide et al. J Immunother. 2008 31:180-188; Pascolo
Expert Opin. Biol. Ther. 4:1285-1294; Fotin-Mleczek et al., 2011 J.
Immunother. 34:1-15; Song et al., Nature Biotechnol. 2005,
23:709-717; Peer et al., Proc Natl Acad Sci U S A. 2007 6;
104:4095-4100; deFougerolles Hum Gene Ther. 2008 19:125-132; all of
which are incorporated herein by reference in its entirety).
[1188] In one embodiment such formulations can also be constructed
or compositions altered such that they passively or actively are
directed to different cell types in vivo, including but not limited
to hepatocytes, immune cells, tumor cells, endothelial cells,
antigen presenting cells, and leukocytes (Akinc et al. Mol Ther.
2010 18:1357-1364; Song et al., Nat Biotechnol. 2005 23:709-717;
Judge et al., J Clin Invest. 2009 119:661-673; Kaufmann et al.,
Microvasc Res 2010 80:286-293; Santel et al., Gene Ther 2006
13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370; Gutbier
et al., Pulm Pharmacol. Ther. 2010 23:334-344; Basha et al., Mol.
Ther. 2011 19:2186-2200; Fenske and Cullis, Expert Opin Drug Deliv.
2008 5:25-44; Peer et al., Science. 2008 319:627-630; Peer and
Lieberman, Gene Ther. 2011 18:1127-1133; all of which are
incorporated herein by reference in its entirety). One example of
passive targeting of formulations to liver cells includes the
DLin-DMA, DLin-KC2-DMA and DLin-MC3-DMA-based lipid nanoparticle
formulations that have been shown to bind to apolipoprotein E and
promote binding and uptake of these formulations into hepatocytes
in vivo (Akinc et al. Mol Ther. 2010 18:1357-1364; herein
incorporated by reference in its entirety). Formulations can also
be selectively targeted through expression of different ligands on
their surface as exemplified by, but not limited by, folate,
transferrin, N-acetylgalactosamine (GalNAc), and antibody targeted
approaches (Kolhatkar et al., Curr Drug Discov Technol. 2011
8:197-206; Musacchio and Torchilin, Front Biosci. 2011
16:1388-1412; Yu et al., Mol Membr Biol. 2010 27:286-298; Patil et
al., Crit Rev Ther Drug Carrier Syst. 2008 25:1-61; Benoit et al.,
Biomacromolecules. 2011 12:2708-2714; Zhao et al., Expert Opin Drug
Deliv. 2008 5:309-319; Akinc et al., Mol Ther. 2010 18:1357-1364;
Srinivasan et al., Methods Mol Biol. 2012 820:105-116; Ben-Arie et
al., Methods Mol Biol. 2012 757:497-507; Peer 2010 J Control
Release. 20:63-68; Peer et al., Proc Natl Acad Sci U S A. 2007
104:4095-4100; Kim et al., Methods Mol Biol. 2011 721:339-353;
Subramanya et al., Mol Ther. 2010 18:2028-2037; Song et al., Nat
Biotechnol. 2005 23:709-717; Peer et al., Science. 2008
319:627-630; Peer and Lieberman, Gene Ther. 2011 18:1127-1133; all
of which are incorporated herein by reference in its entirety).
[1189] In one embodiment, the polynucleotide is formulated as a
solid lipid nanoparticle. A solid lipid nanoparticle (SLN) can be
spherical with an average diameter between 10 to 1000 nm. SLN
possess a solid lipid core matrix that can solubilize lipophilic
molecules and can be stabilized with surfactants and/or
emulsifiers. In a further embodiment, the lipid nanoparticle can be
a self-assembly lipid-polymer nanoparticle (see Zhang et al., ACS
Nano, 2008, 2 (8), pp 1696-1702; the contents of which are herein
incorporated by reference in its entirety). As a non-limiting
example, the SLN can be the SLN described in International Patent
Publication No. WO2013105101, the contents of which are herein
incorporated by reference in its entirety. As another non-limiting
example, the SLN can be made by the methods or processes described
in International Patent Publication No. WO2013105101, the contents
of which are herein incorporated by reference in its entirety.
[1190] Liposomes, lipoplexes, or lipid nanoparticles can be used to
improve the efficacy of polynucleotides directed protein production
as these formulations can be able to increase cell transfection by
the polynucleotide; and/or increase the translation of encoded
protein. One such example involves the use of lipid encapsulation
to enable the effective systemic delivery of polyplex plasmid DNA
(Heyes et al., Mol Ther. 2007 15:713-720; herein incorporated by
reference in its entirety). The liposomes, lipoplexes, or lipid
nanoparticles can also be used to increase the stability of the
polynucleotide.
[1191] In one embodiment, the Polynucleotides of the present
disclosure can be formulated for controlled release and/or targeted
delivery. As used herein, "controlled release" refers to a
pharmaceutical composition or compound release profile that
conforms to a particular pattern of release to effect a therapeutic
outcome. In one embodiment, the polynucleotides can be encapsulated
into a delivery agent described herein and/or known in the art for
controlled release and/or targeted delivery. As used herein, the
term "encapsulate" means to enclose, surround or encase. As it
relates to the formulation of the compounds of the disclosure,
encapsulation can be substantial, complete or partial. The term
"substantially encapsulated" means that at least greater than 50,
60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or greater than
99.999% of the pharmaceutical composition or compound of the
disclosure can be enclosed, surrounded or encased within the
delivery agent. "Partially encapsulation" means that less than 10,
10, 20, 30, 40 50 or less of the pharmaceutical composition or
compound of the disclosure can be enclosed, surrounded or encased
within the delivery agent. Advantageously, encapsulation can be
determined by measuring the escape or the activity of the
pharmaceutical composition or compound of the disclosure using
fluorescence and/or electron micrograph. For example, at least 1,
5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99,
99.9, 99.99 or greater than 99.99% of the pharmaceutical
composition or compound of the disclosure are encapsulated in the
delivery agent.
[1192] In one embodiment, the controlled release formulation can
include, but is not limited to, tri-block co-polymers. As a
non-limiting example, the formulation can include two different
types of tri-block co-polymers (International Pub. No. WO2012131104
and WO2012131106; the contents of each of which is herein
incorporated by reference in its entirety).
[1193] In another embodiment, the Polynucleotides can be
encapsulated into a lipid nanoparticle or a rapidly eliminated
lipid nanoparticle and the lipid nanoparticles or a rapidly
eliminated lipid nanoparticle can then be encapsulated into a
polymer, hydrogel and/or surgical sealant described herein and/or
known in the art. As a non-limiting example, the polymer, hydrogel
or surgical sealant can be PLGA, ethylene vinyl acetate (EVAc),
poloxamer, GELSITE.RTM. (Nanotherapeutics, Inc. Alachua, Fla.),
HYLENEX.RTM. (Halozyme Therapeutics, San Diego Calif.), surgical
sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, Ga.),
TISSELL.RTM. (Baxter International, Inc. Deerfield, Ill.),
PEG-based sealants, and COSEAL.RTM. (Baxter International, Inc.
Deerfield, Ill.).
[1194] In another embodiment, the lipid nanoparticle can be
encapsulated into any polymer known in the art that can form a gel
when injected into a subject. As another non-limiting example, the
lipid nanoparticle can be encapsulated into a polymer matrix that
can be biodegradable.
[1195] In one embodiment, the polynucleotide formulation for
controlled release and/or targeted delivery can also include at
least one controlled release coating. Controlled release coatings
include, but are not limited to, OPADRY.RTM.,
polyvinylpyrrolidone/vinyl acetate copolymer, polyvinylpyrrolidone,
hydroxypropyl methylcellulose, hydroxypropyl cellulose,
hydroxyethyl cellulose, EUDRAGIT RL.RTM., EUDRAGIT RS.RTM. and
cellulose derivatives such as ethylcellulose aqueous dispersions
(AQUACOAT.RTM. and SURELEASE.RTM.).
[1196] In one embodiment, the polynucleotide controlled release
and/or targeted delivery formulation can comprise at least one
degradable polyester that can contain polycationic side chains.
Degradable polyesters include, but are not limited to, poly(serine
ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline
ester), and combinations thereof. In another embodiment, the
degradable polyesters can include a PEG conjugation to form a
PEGylated polymer.
[1197] In one embodiment, the polynucleotide controlled release
and/or targeted delivery formulation comprising at least one
polynucleotide can comprise at least one PEG and/or PEG related
polymer derivatives as described in U.S. Pat. No. 8,404,222, herein
incorporated by reference in its entirety.
[1198] In another embodiment, the polynucleotide controlled release
delivery formulation comprising at least one polynucleotide can be
the controlled release polymer system described in US20130130348,
herein incorporated by reference in its entirety.
[1199] In one embodiment, the Polynucleotides of the present
disclosure can be encapsulated in a therapeutic nanoparticle,
referred to herein as "therapeutic nanoparticle polynucleotides."
Therapeutic nanoparticles can be formulated by methods described
herein and known in the art such as, but not limited to,
International Pub Nos. WO2010005740, WO2010030763, WO2010005721,
WO2010005723, WO2012054923, US Pub. Nos. US20110262491,
US20100104645, US20100087337, US20100068285, US20110274759,
US20100068286, US20120288541, US20130123351 and US20130230567 and
U.S. Pat. No. 8,206,747, 8,293,276, 8,318,208 and 8,318,211; the
contents of each of which are herein incorporated by reference in
their entirety. In another embodiment, therapeutic polymer
nanoparticles can be identified by the methods described in US Pub
No. US20120140790, the contents of which is herein incorporated by
reference in its entirety.
[1200] In one embodiment, the therapeutic nanoparticle
polynucleotide can be formulated for sustained release. As used
herein, "sustained release" refers to a pharmaceutical composition
or compound that conforms to a release rate over a specific period
of time. The period of time can include, but is not limited to,
hours, days, weeks, months and years. As a non-limiting example,
the sustained release nanoparticle can comprise a polymer and a
therapeutic agent such as, but not limited to, the polynucleotides
of the present disclosure (see International Pub No. 2010075072 and
US Pub No. US20100216804, US20110217377 and US20120201859, each of
which is herein incorporated by reference in their entirety). In
another non-limiting example, the sustained release formulation can
comprise agents that permit persistent bioavailability such as, but
not limited to, crystals, macromolecular gels and/or particulate
suspensions (see US Patent Publication No US20130150295, the
contents of which is herein incorporated by reference in its
entirety).
[1201] In one embodiment, the therapeutic nanoparticle
Polynucleotides can be formulated to be target specific. As a
non-limiting example, the therapeutic nanoparticles can include a
corticosteroid (see International Pub. No. WO2011084518; herein
incorporated by reference in its entirety). As a non-limiting
example, the therapeutic nanoparticles can be formulated in
nanoparticles described in International Pub No. WO2008121949,
WO2010005726, WO2010005725, WO2011084521 and US Pub No.
US20100069426, US20120004293 and US20100104655, each of which is
herein incorporated by reference in their entirety.
[1202] In one embodiment, the nanoparticles of the present
disclosure can comprise a polymeric matrix. As a non-limiting
example, the nanoparticle can comprise two or more polymers such
as, but not limited to, polyethylenes, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates,
polycaprolactones, polyamides, polyacetals, polyethers, polyesters,
poly(orthoesters), polycyanoacrylates, polyvinyl alcohols,
polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or
combinations thereof.
[1203] In one embodiment, the therapeutic nanoparticle comprises a
diblock copolymer. In one embodiment, the diblock copolymer can
include PEG in combination with a polymer such as, but not limited
to, polyethylenes, polycarbonates, polyanhydrides,
polyhydroxyacids, polypropylfumerates, polycaprolactones,
polyamides, polyacetals, polyethers, polyesters, poly(orthoesters),
polycyanoacrylates, polyvinyl alcohols, polyurethanes,
polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or
combinations thereof. In another embodiment, the diblock copolymer
can comprise the diblock copolymers described in European Patent
Publication No. the contents of which are herein incorporated by
reference in its entirety. In yet another embodiment, the diblock
copolymer can be a high-X diblock copolymer such as those described
in International Patent Publication No. WO2013120052, the contents
of which are herein incorporated by reference in its entirety.
[1204] As a non-limiting example the therapeutic nanoparticle
comprises a PLGA-PEG block copolymer (see US Pub. No. US20120004293
and U.S. Pat. No. 8,236,330, each of which is herein incorporated
by reference in their entirety). In another non-limiting example,
the therapeutic nanoparticle is a stealth nanoparticle comprising a
diblock copolymer of PEG and PLA or PEG and PLGA (see U.S. Pat. No
8,246,968 and International Publication No. WO2012166923, the
contents of each of which are herein incorporated by reference in
its entirety). In yet another non-limiting example, the therapeutic
nanoparticle is a stealth nanoparticle or a target-specific stealth
nanoparticle as described in US Patent Publication No.
US20130172406, the contents of which are herein incorporated by
reference in its entirety.
[1205] In one embodiment, the therapeutic nanoparticle can comprise
a multiblock copolymer (see, e.g., U.S. Pat. Nos. 8,263,665 and
8,287,910 and US Patent Pub. No. US20130195987; the contents of
each of which are herein incorporated by reference in its
entirety).
[1206] In yet another non-limiting example, the lipid nanoparticle
comprises the block copolymer PEG-PLGA-PEG (see, e.g., the
thermosensitive hydrogel (PEG-PLGA-PEG) was used as a TGF-beta1
gene delivery vehicle in Lee et al. Thermosensitive Hydrogel as a
Tgf-.beta.1 Gene Delivery Vehicle Enhances Diabetic Wound Healing.
Pharmaceutical Research, 2003 20(12): 1995-2000; as a controlled
gene delivery system in Li et al. Controlled Gene Delivery System
Based on Thermosensitive Biodegradable Hydrogel. Pharmaceutical
Research 2003 20(6):884-888; and Chang et al., Non-ionic
amphiphilic biodegradable PEG-PLGA-PEG copolymer enhances gene
delivery efficiency in rat skeletal muscle. J Controlled Release.
2007 118:245-253; each of which is herein incorporated by reference
in its entirety). The Polynucleotides of the present disclosure can
be formulated in lipid nanoparticles comprising the PEG-PLGA-PEG
block copolymer.
[1207] In one embodiment, the therapeutic nanoparticle can comprise
a multiblock copolymer (\see, e.g., U.S. Pat. Nos. 8,263,665 and
8,287,910 and US Patent Pub. No. US20130195987; the contents of
each of which are herein incorporated by reference in its
entirety).
[1208] In one embodiment, the block copolymers described herein can
be included in a polyion complex comprising a non-polymeric micelle
and the block copolymer (see, e.g., U.S. Pub. No. 20120076836;
herein incorporated by reference in its entirety).
[1209] In one embodiment, the therapeutic nanoparticle can comprise
at least one acrylic polymer. Acrylic polymers include but are not
limited to, acrylic acid, methacrylic acid, acrylic acid and
methacrylic acid copolymers, methyl methacrylate copolymers,
ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl
methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid),
polycyanoacrylates and combinations thereof.
[1210] In one embodiment, the therapeutic nanoparticles can
comprise at least one poly(vinyl ester) polymer. The poly(vinyl
ester) polymer can be a copolymer such as a random copolymer. As a
non-limiting example, the random copolymer can have a structure
such as those described in International Application No.
WO2013032829 or US Patent Publication No US20130121954, the
contents of which are herein incorporated by reference in its
entirety. In one aspect, the poly(vinyl ester) polymers can be
conjugated to the polynucleotides described herein. In another
aspect, the poly(vinyl ester) polymer that can be used in the
present disclosure can be those described in, herein incorporated
by reference in its entirety.
[1211] In one embodiment, the therapeutic nanoparticle can comprise
at least one diblock copolymer. The diblock copolymer can be, but
it not limited to, a poly(lactic) acid-poly(ethylene)glycol
copolymer (see, e.g., International Patent Publication No.
WO2013044219; herein incorporated by reference in its
entirety).
[1212] In one embodiment, the therapeutic nanoparticles can
comprise at least one cationic polymer described herein and/or
known in the art.
[1213] In one embodiment, the therapeutic nanoparticles can
comprise at least one amine-containing polymer such as, but not
limited to polylysine, polyethylene imine, poly(amidoamine)
dendrimers, poly(beta-amino esters) (see, e.g., U.S. Pat. No.
8,287,849; herein incorporated by reference in its entirety) and
combinations thereof.
[1214] In another embodiment, the nanoparticles described herein
can comprise an amine cationic lipid such as those described in
International Patent Application No. WO2013059496, the contents of
which are herein incorporated by reference in its entirety. In one
aspect the cationic lipids can have an amino-amine or an
amino-amide moiety.
[1215] In one embodiment, the therapeutic nanoparticles can
comprise at least one degradable polyester that can contain
polycationic side chains. Degradable polyesters include, but are
not limited to, poly(serine ester), poly(L-lactide-co-L-lysine),
poly(4-hydroxy-L-proline ester), and combinations thereof. In
another embodiment, the degradable polyesters can include a PEG
conjugation to form a PEGylated polymer.
[1216] In another embodiment, the therapeutic nanoparticle can
include a conjugation of at least one targeting ligand. The
targeting ligand can be any ligand known in the art such as, but
not limited to, a monoclonal antibody. (Kirpotin et al, Cancer Res.
2006 66:6732-6740; herein incorporated by reference in its
entirety).
[1217] In one embodiment, the therapeutic nanoparticle
Polynucleotides, e.g., therapeutic nanoparticles comprising at
least one polynucleotide can be formulated using the methods
described by Podobinski et al in U.S. Pat. No. 8,404,799, the
contents of which are herein incorporated by reference in its
entirety.
[1218] In one embodiment, the Polynucleotides can be encapsulated
in, linked to and/or associated with synthetic nanocarriers.
Synthetic nanocarriers include, but are not limited to, those
described in International Pub. Nos. WO2010005740, WO2010030763,
WO201213501, WO2012149252, WO2012149255, WO2012149259,
WO2012149265, WO2012149268, WO2012149282, WO2012149301,
WO2012149393, WO2012149405, WO2012149411, WO2012149454 and
WO2013019669, and US Pub. Nos. US20110262491, US20100104645,
US20100087337 and US20120244222, each of which is herein
incorporated by reference in their entirety. The synthetic
nanocarriers can be formulated using methods known in the art
and/or described herein. As a non-limiting example, the synthetic
nanocarriers can be formulated by the methods described in
International Pub Nos. WO2010005740, WO2010030763 and
WO201213501and US Pub. Nos. US20110262491, US20100104645,
US20100087337 and US2012024422, each of which is herein
incorporated by reference in their entirety. In another embodiment,
the synthetic nanocarrier formulations can be lyophilized by
methods described in International Pub. No. WO2011072218 and U.S.
Pat. No. 8,211,473; the content of each of which is herein
incorporated by reference in their entirety. In yet another
embodiment, formulations of the present disclosure, including, but
not limited to, synthetic nanocarriers, can be lyophilized or
reconstituted by the methods described in US Patent Publication No.
US20130230568, the contents of which are herein incorporated by
reference in its entirety.
[1219] In one embodiment, the synthetic nanocarriers can contain
reactive groups to release the polynucleotides described herein
(see International Pub. No. WO20120952552 and US Pub No.
US20120171229, each of which is herein incorporated by reference in
their entirety).
[1220] In one embodiment, the synthetic nanocarriers can be
formulated for targeted release. In one embodiment, the synthetic
nanocarrier is formulated to release the polynucleotides at a
specified pH and/or after a desired time interval. As a
non-limiting example, the synthetic nanoparticle can be formulated
to release the polynucleotides after 24 hours and/or at a pH of 4.5
(see International Pub. Nos. WO2010138193 and WO2010138194 and US
Pub Nos. US20110020388 and US20110027217, each of which is herein
incorporated by reference in their entireties).
[1221] In one embodiment, the synthetic nanocarriers can be
formulated for controlled and/or sustained release of the
polynucleotides described herein. As a non-limiting example, the
synthetic nanocarriers for sustained release can be formulated by
methods known in the art, described herein and/or as described in
International Pub No. WO2010138192 and US Pub No. 20100303850, each
of which is herein incorporated by reference in their entirety.
[1222] In one embodiment, the polynucleotide can be formulated for
controlled and/or sustained release wherein the formulation
comprises at least one polymer that is a crystalline side chain
(CYSC) polymer. CYSC polymers are described in U.S. Pat. No.
8,399,007, herein incorporated by reference in its entirety.
[1223] In one embodiment, the synthetic nanocarrier can comprise at
least one polynucleotide that encodes at least one adjuvant. As
non-limiting example, the adjuvant can comprise
dimethyldioctadecylammonium-bromide,
dimethyldioctadecylammonium-chloride,
dimethyldioctadecylammonium-phosphate or
dimethyldioctadecylammonium-acetate (DDA) and an apolar fraction or
part of said apolar fraction of a total lipid extract of a
mycobacterium (See, e.g., U.S. Pat. No. 8,241,610; herein
incorporated by reference in its entirety). In another embodiment,
the synthetic nanocarrier can comprise at least one polynucleotide
and an adjuvant. As a non-limiting example, the synthetic
nanocarrier comprising and adjuvant can be formulated by the
methods described in International Pub No. WO2011150240 and US Pub
No. US20110293700, each of which is herein incorporated by
reference in its entirety.
[1224] In one embodiment, the synthetic nanocarrier can encapsulate
at least one polynucleotide that encodes a peptide, fragment or
region from a virus. As a non-limiting example, the synthetic
nanocarrier can include, but is not limited to, the nanocarriers
described in International Pub No. WO2012024621, WO201202629,
WO2012024632 and US Pub No. US20120064110, US20120058153 and
US20120058154, each of which is herein incorporated by reference in
their entirety.
[1225] In one embodiment, the synthetic nanocarrier can be coupled
to a polynucleotide that can be able to trigger a humoral and/or
cytotoxic T lymphocyte (CTL) response (see, e.g., International
Publication No. WO2013019669, herein incorporated by reference in
its entirety).
[1226] In one embodiment, the polynucleotide can be encapsulated
in, linked to and/or associated with zwitterionic lipids.
Non-limiting examples of zwitterionic lipids and methods of using
zwitterionic lipids are described in US Patent Publication No.
US20130216607, the contents of which are herein incorporated by
reference in its entirety. In one aspect, the zwitterionic lipids
can be used in the liposomes and lipid nanoparticles described
herein.
[1227] In one embodiment, the polynucleotide can be formulated in
colloid nanocarriers as described in US Patent Publication No.
US20130197100, the contents of which are herein incorporated by
reference in its entirety.
[1228] In one embodiment, the nanoparticle can be optimized for
oral administration. The nanoparticle can comprise at least one
cationic biopolymer such as, but not limited to, chitosan or a
derivative thereof. As a non-limiting example, the nanoparticle can
be formulated by the methods described in U.S. Pub. No.
20120282343; herein incorporated by reference in its entirety.
[1229] In some embodiments, LNPs comprise the lipid KL52 (an
amino-lipid disclosed in U.S. Application Publication No.
2012/0295832 expressly incorporated herein by reference in its
entirety). Activity and/or safety (as measured by examining one or
more of ALT/AST, white blood cell count and cytokine induction) of
LNP administration can be improved by incorporation of such lipids.
LNPs comprising KL52 can be administered intravenously and/or in
one or more doses. In some embodiments, administration of LNPs
comprising KL52 results in equal or improved mRNA and/or protein
expression as compared to LNPs comprising MC3.
[1230] In some embodiments, polynucleotide can be delivered using
smaller LNPs. Such particles can comprise a diameter from below 0.1
um up to 100 nm such as, but not limited to, less than 0.1 um, less
than 1.0 um, less than 5 um, less than 10 um, less than 15 um, less
than 20 um, less than 25 um, less than 30 um, less than 35 um, less
than 40 um, less than 50 um, less than 55 um, less than 60 um, less
than 65 um, less than 70 um, less than 75 um, less than 80 um, less
than 85 um, less than 90 um, less than 95 um, less than 100 um,
less than 125 um, less than 150 um, less than 175 um, less than 200
um, less than 225 um, less than 250 um, less than 275 um, less than
300 urn, less than 325 urn, less than 350 urn, less than 375 urn,
less than 400 urn, less than 425 um, less than 450 um, less than
475 um, less than 500 um, less than 525 um, less than 550 um, less
than 575 um, less than 600 um, less than 625 um, less than 650 um,
less than 675 um, less than 700 um, less than 725 um, less than 750
um, less than 775 um, less than 800 um, less than 825 urn, less
than 850 urn, less than 875 urn, less than 900 urn, less than 925
urn, less than 950 um, or less than 975 um.
[1231] In another embodiment, polynucleotides can be delivered
using smaller LNPs that can comprise a diameter from about 1 nm to
about 100 nm, from about 1 nm to about 10 nm, about 1 nm to about
20 nm, from about 1 nm to about 30 nm, from about 1 nm to about 40
nm, from about 1 nm to about 50 nm, from about 1 nm to about 60 nm,
from about 1 nm to about 70 nm, from about 1 nm to about 80 nm,
from about 1 nm to about 90 nm, from about 5 nm to about from 100
nm, from about 5 nm to about 10 nm, about 5 nm to about 20 nm, from
about 5 nm to about 30 nm, from about 5 nm to about 40 nm, from
about 5 nm to about 50 nm, from about 5 nm to about 60 nm, from
about 5 nm to about 70 nm, from about 5 nm to about 80 nm, from
about 5 nm to about 90 nm, about 10 to about 50 nM, from about 20
to about 50 nm, from about 30 to about 50 nm, from about 40 to
about 50 nm, from about 20 to about 60 nm, from about 30 to about
60 nm, from about 40 to about 60 nm, from about 20 to about 70 nm,
from about 30 to about 70 nm, from about 40 to about 70 nm, from
about 50 to about 70 nm, from about 60 to about 70 nm, from about
20 to about 80 nm, from about 30 to about 80 nm, from about 40 to
about 80 nm, from about 50 to about 80 nm, from about 60 to about
80 nm, from about 20 to about 90 nm, from about 30 to about 90 nm,
from about 40 to about 90 nm, from about 50 to about 90 nm, from
about 60 to about 90 nm and/or from about 70 to about 90 nm.
[1232] In some embodiments, such LNPs are synthesized using methods
comprising microfluidic mixers. Exemplary microfluidic mixers can
include, but are not limited to a slit interdigitial micromixer
including, but not limited to those manufactured by Microinnova
(Allerheiligen bei Wildon, Austria) and/or a staggered herringbone
micromixer (SHM) (Zhigaltsev, I. V. et al., Bottom-up design and
synthesis of limit size lipid nanoparticle systems with aqueous and
triglyceride cores using millisecond microfluidic mixing have been
published (Langmuir. 2012. 28:3633-40; Belliveau, N. M. et al.,
Microfluidic synthesis of highly potent limit-size lipid
nanoparticles for in vivo delivery of siRNA. Molecular
Therapy-Nucleic Acids. 2012. 1:e37; Chen, D. et al., Rapid
discovery of potent siRNA-containing lipid nanoparticles enabled by
controlled microfluidic formulation. J Am Chem Soc. 2012.
134(16):6948-51; each of which is herein incorporated by reference
in its entirety). In some embodiments, methods of LNP generation
comprising SHM, further comprise the mixing of at least two input
streams wherein mixing occurs by microstructure-induced chaotic
advection (MICA). According to this method, fluid streams flow
through channels present in a herringbone pattern causing
rotational flow and folding the fluids around each other. This
method can also comprise a surface for fluid mixing wherein the
surface changes orientations during fluid cycling. Methods of
generating LNPs using SHM include those disclosed in U.S.
Application Publication Nos. 2004/0262223 and 2012/0276209, each of
which is expressly incorporated herein by reference in their
entirety.
[1233] In one embodiment, the polynucleotide of the present
disclosure can be formulated in lipid nanoparticles created using a
micromixer such as, but not limited to, a Slit Interdigital
Microstructured Mixer (SIMM-V2) or a Standard Slit Interdigital
Micro Mixer (SSIMM) or Caterpillar (CPMM) or Impinging-jet
(IJMM)from the Institut fur Mikrotechnik Mainz GmbH, Mainz
Germany).
[1234] In one embodiment, the polynucleotides of the present
disclosure can be formulated in lipid nanoparticles created using
microfluidic technology (see Whitesides, George M. The Origins and
the Future of Microfluidics. Nature, 2006 442: 368-373; and Abraham
et al. Chaotic Mixer for Microchannels. Science, 2002 295: 647-651;
each of which is herein incorporated by reference in its entirety).
As a non-limiting example, controlled microfluidic formulation
includes a passive method for mixing streams of steady
pressure-driven flows in micro channels at a low Reynolds number
(see, e.g., Abraham et al. Chaotic Mixer for Microchannels.
Science, 2002 295: 647-651; which is herein incorporated by
reference in its entirety).
[1235] In one embodiment, the polynucleotides of the present
disclosure can be formulated in lipid nanoparticles created using a
micromixer chip such as, but not limited to, those from Harvard
Apparatus (Holliston, Mass.) or Dolomite Microfluidics (Royston,
UK). A micromixer chip can be used for rapid mixing of two or more
fluid streams with a split and recombine mechanism.
[1236] In one embodiment, the polynucleotides of the disclosure can
be formulated for delivery using the drug encapsulating
microspheres described in International Patent Publication No.
WO2013063468 or U.S. Pat. No. 8,440,614, each of which is herein
incorporated by reference in its entirety. The microspheres can
comprise a compound of the formula (I), (II), (III), (IV), (V) or
(VI) as described in International Patent Publication No.
WO2013063468, the contents of which are herein incorporated by
reference in its entirety. In another aspect, the amino acid,
peptide, polypeptide, lipids (APPL) are useful in delivering the
polynucleotides of the disclosure to cells (see International
Patent Publication No. WO2013063468, the contents of which is
herein incorporated by reference in its entirety).
[1237] In one embodiment, the polynucleotides of the disclosure can
be formulated in lipid nanoparticles having a diameter from about
10 to about 100 nm such as, but not limited to, about 10 to about
20 nm, about 10 to about 30 nm, about 10 to about 40 nm, about 10
to about 50 nm, about 10 to about 60 nm, about 10 to about 70 nm,
about 10 to about 80 nm, about 10 to about 90 nm, about 20 to about
30 nm, about 20 to about 40 nm, about 20 to about 50 nm, about 20
to about 60 nm, about 20 to about 70 nm, about 20 to about 80 nm,
about 20 to about 90 nm, about 20 to about 100 nm, about 30 to
about 40 nm, about 30 to about 50 nm, about 30 to about 60 nm,
about 30 to about 70 nm, about 30 to about 80 nm, about 30 to about
90 nm, about 30 to about 100 nm, about 40 to about 50 nm, about 40
to about 60 nm, about 40 to about 70 nm, about 40 to about 80 nm,
about 40 to about 90 nm, about 40 to about 100 nm, about 50 to
about 60 nm, about 50 to about 70 nm about 50 to about 80 nm, about
50 to about 90 nm, about 50 to about 100 nm, about 60 to about 70
nm, about 60 to about 80 nm, about 60 to about 90 nm, about 60 to
about 100 nm, about 70 to about 80 nm, about 70 to about 90 nm,
about 70 to about 100 nm, about 80 to about 90 nm, about 80 to
about 100 nm and/or about 90 to about 100 nm.
[1238] In one embodiment, the lipid nanoparticles can have a
diameter from about 10 to 500 nm.
[1239] In one embodiment, the lipid nanoparticle can have a
diameter greater than 100 nm, greater than 150 nm, greater than 200
nm, greater than 250 nm, greater than 300 nm, greater than 350 nm,
greater than 400 nm, greater than 450 nm, greater than 500 nm,
greater than 550 nm, greater than 600 nm, greater than 650 nm,
greater than 700 nm, greater than 750 nm, greater than 800 nm,
greater than 850 nm, greater than 900 nm, greater than 950 nm or
greater than 1000 nm.
[1240] In one aspect, the lipid nanoparticle can be a limit size
lipid nanoparticle described in International Patent Publication
No. WO2013059922, the contents of which are herein incorporated by
reference in its entirety. The limit size lipid nanoparticle can
comprise a lipid bilayer surrounding an aqueous core or a
hydrophobic core; where the lipid bilayer can comprise a
phospholipid such as, but not limited to,
diacylphosphatidylcholine, a diacylphosphatidylethanolamine, a
ceramide, a sphingomyelin, a dihydrosphingomyelin, a cephalin, a
cerebroside, a C8-C20 fatty acid diacylphophatidylcholine, and
1-palmitoyl-2-oleoyl phosphatidylcholine (POPC). In another aspect
the limit size lipid nanoparticle can comprise a polyethylene
glycol-lipid such as, but not limited to, DLPE-PEG, DMPE-PEG,
DPPC-PEG and D SPE-PEG.
[1241] In one embodiment, the polynucleotides can be delivered,
localized and/or concentrated in a specific location using the
delivery methods described in International Patent Publication No.
WO2013063530, the contents of which are herein incorporated by
reference in its entirety. As a non-limiting example, a subject can
be administered an empty polymeric particle prior to,
simultaneously with or after delivering the polynucleotides to the
subject. The empty polymeric particle undergoes a change in volume
once in contact with the subject and becomes lodged, embedded,
immobilized or entrapped at a specific location in the subject.
[1242] In one embodiment, the polynucleotides can be formulated in
an active substance release system (see, e.g., US Patent
Publication No. US20130102545, the contents of which is herein
incorporated by reference in its entirety). The active substance
release system can comprise 1) at least one nanoparticle bonded to
an oligonucleotide inhibitor strand that is hybridized with a
catalytically active nucleic acid and 2) a compound bonded to at
least one substrate molecule bonded to a therapeutically active
substance (e.g., polynucleotides described herein), where the
therapeutically active substance is released by the cleavage of the
substrate molecule by the catalytically active nucleic acid.
[1243] In one embodiment, the polynucleotides can be formulated in
a nanoparticle comprising an inner core comprising a non-cellular
material and an outer surface comprising a cellular membrane. The
cellular membrane can be derived from a cell or a membrane derived
from a virus. As a non-limiting example, the nanoparticle can be
made by the methods described in International Patent Publication
No. WO2013052167, herein incorporated by reference in its entirety.
As another non-limiting example, the nanoparticle described in
International Patent Publication No. WO2013052167, herein
incorporated by reference in its entirety, can be used to deliver
the polynucleotides described herein.
[1244] In one embodiment, the polynucleotides can be formulated in
porous nanoparticle-supported lipid bilayers (protocells).
Protocells are described in International Patent Publication No.
WO2013056132, the contents of which are herein incorporated by
reference in its entirety.
[1245] In one embodiment, the polynucleotides described herein can
be formulated in polymeric nanoparticles as described in or made by
the methods described in U.S. Pat. Nos. 8,420,123 and 8,518,963 and
European Patent No. EP2073848B1, the contents of each of which are
herein incorporated by reference in their entirety. As a
non-limiting example, the polymeric nanoparticle can have a high
glass transition temperature such as the nanoparticles described in
or nanoparticles made by the methods described in U.S. Pat. No.
8,518,963, the contents of which are herein incorporated by
reference in its entirety. As another non-limiting example, the
polymer nanoparticle for oral and parenteral formulations can be
made by the methods described in European Patent No. EP2073848B1,
the contents of which are herein incorporated by reference in its
entirety.
[1246] In another embodiment, the polynucleotides described herein
can be formulated in nanoparticles used in imaging. The
nanoparticles can be liposome nanoparticles such as those described
in US Patent Publication No US20130129636, herein incorporated by
reference in its entirety. As a non-limiting example, the liposome
can comprise
gadolinium(III)2-{4,7-bis-carboxymethyl-10-[(N,N-distearylamidomethyl-N'--
amido-methyl]-1,4,7,10-tetra-azacyclododec-1-yl}-acetic acid and a
neutral, fully saturated phospholipid component (see, e.g., US
Patent Publication No US20130129636, the contents of which is
herein incorporated by reference in its entirety).
[1247] In one embodiment, the nanoparticles that can be used in the
present disclosure are formed by the methods described in U.S.
Patent Application No. US20130130348, the contents of which is
herein incorporated by reference in its entirety.
[1248] The nanoparticles of the present disclosure can further
include nutrients such as, but not limited to, those which
deficiencies can lead to health hazards from anemia to neural tube
defects (see e.g., the nanoparticles described in International
Patent Publication No WO2013072929, the contents of which is herein
incorporated by reference in its entirety). As a non-limiting
example, the nutrient can be iron in the form of ferrous, ferric
salts or elemental iron, iodine, folic acid, vitamins or
micronutrients.
[1249] In one embodiment, the polynucleotides of the present
disclosure can be formulated in a swellable nanoparticle. The
swellable nanoparticle can be, but is not limited to, those
described in U.S. Patent No. 8,440,231, the contents of which is
herein incorporated by reference in its entirety. As a non-limiting
embodiment, the swellable nanoparticle can be used for delivery of
the polynucleotides of the present disclosure to the pulmonary
system (see, e.g., U.S. Pat. No. 8,440,231, the contents of which
is herein incorporated by reference in its entirety).
[1250] The polynucleotides of the present disclosure can be
formulated in polyanhydride nanoparticles such as, but not limited
to, those described in U.S. Pat. No. 8,449,916, the contents of
which is herein incorporated by reference in its entirety.
[1251] The nanoparticles and microparticles of the present
disclosure can be geometrically engineered to modulate macrophage
and/or the immune response. In one aspect, the geometrically
engineered particles can have varied shapes, sizes and/or surface
charges in order to incorporated the polynucleotides of the present
disclosure for targeted delivery such as, but not limited to,
pulmonary delivery (see, e.g., International Publication No
WO2013082111, the contents of which is herein incorporated by
reference in its entirety). Other physical features the
geometrically engineering particles can have include, but are not
limited to, fenestrations, angled arms, asymmetry and surface
roughness, charge that can alter the interactions with cells and
tissues. As a non-limiting example, nanoparticles of the present
disclosure can be made by the methods described in International
Publication No WO2013082111, the contents of which is herein
incorporated by reference in its entirety.
[1252] In one embodiment, the nanoparticles of the present
disclosure can be water soluble nanoparticles such as, but not
limited to, those described in International Publication No.
WO2013090601, the contents of which is herein incorporated by
reference in its entirety. The nanoparticles can be inorganic
nanoparticles that have a compact and zwitterionic ligand in order
to exhibit good water solubility. The nanoparticles can also have
small hydrodynamic diameters (HD), stability with respect to time,
pH, and salinity and a low level of non-specific protein
binding.
[1253] In one embodiment the nanoparticles of the present
disclosure can be developed by the methods described in US Patent
Publication No. US20130172406, the contents of which are herein
incorporated by reference in its entirety.
[1254] In one embodiment, the nanoparticles of the present
disclosure are stealth nanoparticles or target-specific stealth
nanoparticles such as, but not limited to, those described in US
Patent Publication No. US20130172406; the contents of which is
herein incorporated by reference in its entirety. The nanoparticles
of the present disclosure can be made by the methods described in
US Patent Publication No. US20130172406, the contents of which are
herein incorporated by reference in its entirety.
[1255] In another embodiment, the stealth or target-specific
stealth nanoparticles can comprise a polymeric matrix. The
polymeric matrix can comprise two or more polymers such as, but not
limited to, polyethylenes, polycarbonates, polyanhydrides,
polyhydroxyacids, polypropylfumerates, polycaprolactones,
polyamides, polyacetals, polyethers, polyesters, poly(orthoesters),
polycyanoacrylates, polyvinyl alcohols, polyurethanes,
polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polyesters, polyanhydrides, polyethers, polyurethanes,
polymethacrylates, polyacrylates, polycyanoacrylates or
combinations thereof.
[1256] In one embodiment, the nanoparticle can be a
nanoparticle-nucleic acid hybrid structure having a high density
nucleic acid layer. As a non-limiting example, the
nanoparticle-nucleic acid hybrid structure can made by the methods
described in US Patent Publication No. US20130171646, the contents
of which are herein incorporated by reference in its entirety. The
nanoparticle can comprise a nucleic acid such as, but not limited
to, polynucleotides described herein and/or known in the art.
[1257] At least one of the nanoparticles of the present disclosure
can be embedded in in the core a nanostructure or coated with a low
density porous 3-D structure or coating that is capable of carrying
or associating with at least one payload within or on the surface
of the nanostructure. Non-limiting examples of the nanostructures
comprising at least one nanoparticle are described in International
Patent Publication No. WO2013123523, the contents of which are
herein incorporated by reference in its entirety.
Amino Acid Lipids
[1258] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with amino acid lipids. Amino acid lipids are
lipophilic compounds comprising an amino acid residue and one or
more lipophilic tails. Non-limiting examples of amino acid lipids
and methods of making amino acid lipids are described in U.S. Pat.
No. 8,501,824, the contents of which are herein incorporated by
reference in its entirety.
[1259] In some embodiments, the amino acid lipids have a
hydrophilic portion and a lipophilic portion. The hydrophilic
portion can be an amino acid residue and a lipophilic portion can
comprise at least one lipophilic tail.
[1260] In some embodiments, the amino acid lipid formulations can
be used to deliver the polynucleotides to a subject.
[1261] In another embodiment, the amino acid lipid formulations can
deliver a polynucleotide in releasable form that comprises an amino
acid lipid that binds and releases the polynucleotides. As a
non-limiting example, the release of the polynucleotides can be
provided by an acid-labile linker such as, but not limited to,
those described in U.S. Pat. Nos. 7,098,032, 6,897,196, 6,426,086,
7,138,382, 5,563,250, and 5,505,931, the contents of each of which
are herein incorporated by reference in its entirety.
Polymers, Biodegradable Nanoparticles, and Core-Shell
Nanoparticles
[1262] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, using natural and/or synthetic polymers. Non-limiting
examples of polymers that can be used for delivery include, but are
not limited to, DYNAMIC POLYCONJUGATE.RTM. (Arrowhead Research
Corp., Pasadena, Calif.) formulations from MIRUS.RTM. Bio (Madison,
Wis.) and Roche Madison (Madison, Wis.), PHASERX.TM. polymer
formulations such as, without limitation, SMARTT POLYMER
TECHNOLOGY.TM. (PHASERX.RTM., Seattle, Wash.), DMRI/DOPE,
poloxamer, VAXFECTIN.RTM. adjuvant from Vical (San Diego, Calif.),
chitosan, cyclodextrin from Calando Pharmaceuticals (Pasadena,
Calif.), dendrimers and poly(lactic-co-glycolic acid) (PLGA)
polymers. RONDEL.TM. (RNAi/Oligonucleotide Nanoparticle Delivery)
polymers (Arrowhead Research Corporation, Pasadena, Calif.) and pH
responsive co-block polymers such as, but not limited to,
PHASERX.RTM. (Seattle, Wash.).
[1263] A non-limiting example of chitosan formulation includes a
core of positively charged chitosan and an outer portion of
negatively charged substrate (U.S. Pub. No. 20120258176; herein
incorporated by reference in its entirety). Chitosan includes, but
is not limited to N-trimethyl chitosan, mono-N-carboxymethyl
chitosan (MCC), N-palmitoyl chitosan (NPCS), EDTA-chitosan, low
molecular weight chitosan, chitosan derivatives, or combinations
thereof.
[1264] In some embodiments, the polymers used in the present
disclosure have undergone processing to reduce and/or inhibit the
attachment of unwanted substances such as, but not limited to,
bacteria, to the surface of the polymer. The polymer can be
processed by methods known and/or described in the art and/or
described in International Pub. No. WO2012150467, herein
incorporated by reference in its entirety.
[1265] A non-limiting example of PLGA formulations include, but are
not limited to, PLGA injectable depots (e.g., ELIGARD.RTM. which is
formed by dissolving PLGA in 66% N-methyl-2-pyrrolidone (NMP) and
the remainder being aqueous solvent and leuprolide. Once injected,
the PLGA and leuprolide peptide precipitates into the subcutaneous
space).
[1266] Many of these polymer approaches have demonstrated efficacy
in delivering oligonucleotides in vivo into the cell cytoplasm
(reviewed in deFougerolles Hum Gene Ther. 2008 19:125-132; herein
incorporated by reference in its entirety). Two polymer approaches
that have yielded robust in vivo delivery of nucleic acids, in this
case with small interfering RNA (siRNA), are dynamic polyconjugates
and cyclodextrin-based nanoparticles (see, e.g., US Patent
Publication No. US20130156721, herein incorporated by reference in
its entirety). The first of these delivery approaches uses dynamic
polyconjugates and has been shown in vivo in mice to effectively
deliver siRNA and silence endogenous target mRNA in hepatocytes
(Rozema et al., Proc Natl Acad Sci U S A. 2007 104:12982-12887;
herein incorporated by reference in its entirety). This particular
approach is a multicomponent polymer system whose key features
include a membrane-active polymer to which nucleic acid, in this
case siRNA, is covalently coupled via a disulfide bond and where
both PEG (for charge masking) and N-acetylgalactosamine (for
hepatocyte targeting) groups are linked via pH-sensitive bonds
(Rozema et al., Proc Natl Acad Sci U S A. 2007 104:12982-12887;
herein incorporated by reference in its entirety). On binding to
the hepatocyte and entry into the endosome, the polymer complex
disassembles in the low-pH environment, with the polymer exposing
its positive charge, leading to endosomal escape and cytoplasmic
release of the siRNA from the polymer. Through replacement of the
N-acetylgalactosamine group with a mannose group, it was shown one
could alter targeting from asialoglycoprotein receptor-expressing
hepatocytes to sinusoidal endothelium and Kupffer cells. Another
polymer approach involves using transferrin-targeted
cyclodextrin-containing polycation nanoparticles. These
nanoparticles have demonstrated targeted silencing of the EWS-FLI1
gene product in transferrin receptor-expressing Ewing's sarcoma
tumor cells (Hu-Lieskovan et al., Cancer Res. 2005 65: 8984-8982;
herein incorporated by reference in its entirety) and siRNA
formulated in these nanoparticles was well tolerated in non-human
primates (Heidel et al., Proc Natl Acad Sci USA 2007 104:5715-21;
herein incorporated by reference in its entirety). Both of these
delivery strategies incorporate rational approaches using both
targeted delivery and endosomal escape mechanisms.
[1267] The polymer formulation can permit the sustained or delayed
release of polynucleotides (e.g., following intramuscular or
subcutaneous injection). The altered release profile for the
polynucleotide can result in, for example, translation of an
encoded protein over an extended period of time. The polymer
formulation can also be used to increase the stability of the
polynucleotide. Biodegradable polymers have been previously used to
protect nucleic acids other than polynucleotide from degradation
and been shown to result in sustained release of payloads in vivo
(Rozema et al., Proc Natl Acad Sci U S A. 2007 104:12982-12887;
Sullivan et al., Expert Opin Drug Deliv. 2010 7:1433-1446;
Convertine et al., Biomacromolecules. 2010 Oct. 1; Chu et al., Acc
Chem Res. 2012 Jan 13; Manganiello et al., Biomaterials. 2012
33:2301-2309; Benoit et al., Biomacromolecules. 2011 12:2708-2714;
Singha et al., Nucleic Acid Ther. 2011 2:133-147; deFougerolles Hum
Gene Ther. 2008 19:125-132; Schaffert and Wagner, Gene Ther. 2008
16:1131-1138; Chaturvedi et al., Expert Opin Drug Deliv. 2011
8:1455-1468; Davis, Mol Pharm. 2009 6:659-668; Davis, Nature 2010
464:1067-1070; each of which is herein incorporated by reference in
its entirety).
[1268] In some embodiments, the pharmaceutical compositions can be
sustained release formulations. In a further embodiment, the
sustained release formulations can be for subcutaneous delivery.
Sustained release formulations can include, but are not limited to,
PLGA microspheres, ethylene vinyl acetate (EVAc), poloxamer,
GELSITE.RTM. (Nanotherapeutics, Inc. Alachua, Fla.), HYLENEX.RTM.
(Halozyme Therapeutics, San Diego Calif.), surgical sealants such
as fibrinogen polymers (Ethicon Inc. Cornelia, Ga.), TISSELL.RTM.
(Baxter International, Inc. Deerfield, Ill.), PEG-based sealants,
and COSEAL.RTM. (Baxter International, Inc. Deerfield, Ill.).
[1269] As a non-limiting example modified mRNA can be formulated in
PLGA microspheres by preparing the PLGA microspheres with tunable
release rates (e.g., days and weeks) and encapsulating the modified
mRNA in the PLGA microspheres while maintaining the integrity of
the modified mRNA during the encapsulation process. EVAc are
non-biodegradable, biocompatible polymers that are used extensively
in pre-clinical sustained release implant applications (e.g.,
extended release products Ocusert a pilocarpine ophthalmic insert
for glaucoma or progestasert a sustained release progesterone
intrauterine device; transdermal delivery systems Testoderm,
Duragesic and Selegiline; catheters). Poloxamer F-407 NF is a
hydrophilic, non-ionic surfactant triblock copolymer of
polyoxyethylene-polyoxypropylene-polyoxyethylene having a low
viscosity at temperatures less than 5.degree. C. and forms a solid
gel at temperatures greater than 15.degree. C. PEG-based surgical
sealants comprise two synthetic PEG components mixed in a delivery
device that can be prepared in one minute, seals in 3 minutes and
is reabsorbed within 30 days. GELSITE.RTM. and natural polymers are
capable of in-situ gelation at the site of administration. They
have been shown to interact with protein and peptide therapeutic
candidates through ionic interaction to provide a stabilizing
effect.
[1270] Polymer formulations can also be selectively targeted
through expression of different ligands as exemplified by, but not
limited by, folate, transferrin, and N-acetylgalactosamine (GalNAc)
(Benoit et al., Biomacromolecules. 2011 12:2708-2714; Rozema et
al., Proc Natl Acad Sci U S A. 2007 104:12982-12887; Davis, Mol
Pharm. 2009 6:659-668; Davis, Nature 2010 464:1067-1070; each of
which is herein incorporated by reference in its entirety).
[1271] The polynucleotides of the disclosure can be formulated with
or in a polymeric compound. The polymer can include at least one
polymer such as, but not limited to, polyethenes, polyethylene
glycol (PEG), poly(1-lysine)(PLL), PEG grafted to PLL, cationic
lipopolymer, biodegradable cationic lipopolymer, polyethyleneimine
(PEI), cross-linked branched poly(alkylene imines), a polyamine
derivative, a modified poloxamer, a biodegradable polymer, elastic
biodegradable polymer, biodegradable block copolymer, biodegradable
random copolymer, biodegradable polyester copolymer, biodegradable
polyester block copolymer, biodegradable polyester block random
copolymer, multiblock copolymers, linear biodegradable copolymer,
poly[.alpha.-(4-aminobutyl)-L-glycolic acid) (PAGA), biodegradable
cross-linked cationic multi-block copolymers, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates,
polycaprolactones, polyamides, polyacetals, polyethers, polyesters,
poly(orthoesters), polycyanoacrylates, polyvinyl alcohols,
polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester),
acrylic polymers, amine-containing polymers, dextran polymers,
dextran polymer derivatives or combinations thereof.
[1272] As a non-limiting example, the polynucleotides of the
disclosure can be formulated with the polymeric compound of PEG
grafted with PLL as described in U.S. Pat. No. 6,177,274; herein
incorporated by reference in its entirety. The formulation can be
used for transfecting cells in vitro or for in vivo delivery of
polynucleotide. In another example, the polynucleotide can be
suspended in a solution or medium with a cationic polymer, in a dry
pharmaceutical composition or in a solution that is capable of
being dried as described in U.S. Pub. Nos. 20090042829 and
20090042825; each of which are herein incorporated by reference in
their entireties.
[1273] As another non-limiting example the polynucleotides of the
disclosure can be formulated with a PLGA-PEG block copolymer (see
US Pub. No. US20120004293 and U.S. Pat. No. 8,236,330, herein
incorporated by reference in their entireties) or PLGA-PEG-PLGA
block copolymers (See U.S. Pat. No. 6,004,573, herein incorporated
by reference in its entirety). As a non-limiting example, the
polynucleotides of the disclosure can be formulated with a diblock
copolymer of PEG and PLA or PEG and PLGA (see U.S. Pat. No.
8,246,968, herein incorporated by reference in its entirety).
[1274] A polyamine derivative can be used to deliver nucleic acids
or to treat and/or prevent a disease or to be included in an
implantable or injectable device (U.S. Pub. No. 20100260817 (now
U.S. Pat. No. 8,460,696) the contents of each of which is herein
incorporated by reference in its entirety). As a non-limiting
example, a pharmaceutical composition can include the
polynucleotide and the polyamine derivative described in U.S. Pub.
No. 20100260817 (now U.S. Pat. No. 8,460,696; the contents of which
are incorporated herein by reference in its entirety. As a
non-limiting example the polynucleotides of the present disclosure
can be delivered using a polyamine polymer such as, but not limited
to, a polymer comprising a 1,3-dipolar addition polymer prepared by
combining a carbohydrate diazide monomer with a dialkyne unite
comprising oligoamines (U.S. Pat. No. 8,236,280; herein
incorporated by reference in its entirety).
[1275] The polynucleotides of the disclosure can be formulated with
at least one acrylic polymer. Acrylic polymers include but are not
limited to, acrylic acid, methacrylic acid, acrylic acid and
methacrylic acid copolymers, methyl methacrylate copolymers,
ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl
methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid),
polycyanoacrylates and combinations thereof.
[1276] In some embodiments, the polynucleotides of the present
disclosure can be formulated with at least one polymer and/or
derivatives thereof described in International Publication Nos.
WO2011115862, WO2012082574 and WO2012068187 and U.S. Pub. No.
20120283427, each of which are herein incorporated by reference in
their entireties. In another embodiment, the polynucleotides of the
present disclosure can be formulated with a polymer of formula Z as
described in WO2011115862, herein incorporated by reference in its
entirety. In yet another embodiment, the polynucleotides can be
formulated with a polymer of formula Z, Z' or Z'' as described in
International Pub. Nos. WO2012082574 or WO2012068187 and U.S. Pub.
No. 2012028342, each of which are herein incorporated by reference
in their entireties. The polymers formulated with the modified RNA
of the present disclosure can be synthesized by the methods
described in International Pub. Nos. WO2012082574 or WO2012068187,
each of which are herein incorporated by reference in their
entireties.
[1277] The polynucleotides of the disclosure can be formulated with
at least one acrylic polymer. Acrylic polymers include but are not
limited to, acrylic acid, methacrylic acid, acrylic acid and
methacrylic acid copolymers, methyl methacrylate copolymers,
ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl
methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid),
polycyanoacrylates and combinations thereof.
[1278] Formulations of polynucleotides of the disclosure can
include at least one amine-containing polymer such as, but not
limited to polylysine, polyethylene imine, poly(amidoamine)
dendrimers, poly(amine-co-esters) or combinations thereof. As a
non-limiting example, the poly(amine-co-esters) can be the polymers
described in and/or made by the methods described in International
Publication No WO2013082529, the contents of which are herein
incorporated by reference in its entirety.
[1279] For example, the polynucleotides of the disclosure can be
formulated in a pharmaceutical compound including a poly(alkylene
imine), a biodegradable cationic lipopolymer, a biodegradable block
copolymer, a biodegradable polymer, or a biodegradable random
copolymer, a biodegradable polyester block copolymer, a
biodegradable polyester polymer, a biodegradable polyester random
copolymer, a linear biodegradable copolymer, PAGA, a biodegradable
cross-linked cationic multi-block copolymer or combinations
thereof. The biodegradable cationic lipopolymer can be made by
methods known in the art and/or described in U.S. Pat. No.
6,696,038, U.S. App. Nos. 20030073619 and 20040142474 each of which
is herein incorporated by reference in their entireties. The
poly(alkylene imine) can be made using methods known in the art
and/or as described in U.S. Pub. No. 20100004315, herein
incorporated by reference in its entirety. The biodegradable
polymer, biodegradable block copolymer, the biodegradable random
copolymer, biodegradable polyester block copolymer, biodegradable
polyester polymer, or biodegradable polyester random copolymer can
be made using methods known in the art and/or as described in U.S.
Pat. Nos. 6,517,869 and 6,267,987, the contents of which are each
incorporated herein by reference in their entirety. The linear
biodegradable copolymer can be made using methods known in the art
and/or as described in U.S. Pat. No. 6,652,886. The PAGA polymer
can be made using methods known in the art and/or as described in
U.S. Pat. No. 6,217,912 herein incorporated by reference in its
entirety. The PAGA polymer can be copolymerized to form a copolymer
or block copolymer with polymers such as but not limited to,
poly-L-lysine, polyarginine, polyornithine, histones, avidin,
protamines, polylactides and poly(lactide-co-glycolides). The
biodegradable cross-linked cationic multi-block copolymers can be
made my methods known in the art and/or as described in U.S. Pat.
Nos. 8,057,821, 8,444,992 or U.S. Pub. No. 2012009145 each of which
are herein incorporated by reference in their entireties. For
example, the multi-block copolymers can be synthesized using linear
polyethyleneimine (LPEI) blocks that have distinct patterns as
compared to branched polyethyleneimines. Further, the composition
or pharmaceutical composition can be made by the methods known in
the art, described herein, or as described in U.S. Pub. No.
20100004315 or U.S. Pat. Nos. 6,267,987 and 6,217,912 each of which
are herein incorporated by reference in their entireties.
[1280] The polynucleotides of the disclosure can be formulated with
at least one degradable polyester that can contain polycationic
side chains. Degradable polyesters include, but are not limited to,
poly(serine ester), poly(L-lactide-co-L-lysine),
poly(4-hydroxy-L-proline ester), and combinations thereof. In
another embodiment, the degradable polyesters can include a PEG
conjugation to form a PEGylated polymer.
[1281] The polynucleotides of the disclosure can be formulated with
at least one crosslinkable polyester. Crosslinkable polyesters
include those known in the art and described in US Pub. No.
20120269761, the contents of which is herein incorporated by
reference in its entirety.
[1282] The polynucleotides of the disclosure can be formulated in
or with at least one cyclodextrin polymer. Cyclodextrin polymers
and methods of making cyclodextrin polymers include those known in
the art and described in US Pub. No. 20130184453, the contents of
which are herein incorporated by reference in its entirety.
[1283] In some embodiments, the polynucleotides of the disclosure
can be formulated in or with at least one crosslinked
cation-binding polymers. Crosslinked cation-binding polymers and
methods of making crosslinked cation-binding polymers include those
known in the art and described in International Patent Publication
No. WO2013106072, WO2013106073 and WO2013106086, the contents of
each of which are herein incorporated by reference in its
entirety.
[1284] In some embodiments, the polynucleotides of the disclosure
can be formulated in or with at least one branched polymer.
Branched polymers and methods of making branched polymers include
those known in the art and described in International Patent
Publication No. WO2013113071, the contents of each of which are
herein incorporated by reference in its entirety.
[1285] In some embodiments, the polynucleotides of the disclosure
can be formulated in or with at least PEGylated albumin polymer.
PEGylated albumin polymer and methods of making PEGylated albumin
polymer include those known in the art and described in US Patent
Publication No. US20130231287, the contents of each of which are
herein incorporated by reference in its entirety.
[1286] In some embodiments, the polymers described herein can be
conjugated to a lipid-terminating PEG. As a non-limiting example,
PLGA can be conjugated to a lipid-terminating PEG forming
PLGA-DSPE-PEG. As another non-limiting example, PEG conjugates for
use with the present disclosure are described in International
Publication No. WO2008103276, herein incorporated by reference in
its entirety. The polymers can be conjugated using a ligand
conjugate such as, but not limited to, the conjugates described in
U.S. Pat. No. 8,273,363, herein incorporated by reference in its
entirety.
[1287] In some embodiments, the polynucleotides disclosed herein
can be mixed with the PEGs or the sodium phosphate/sodium carbonate
solution prior to administration. In another embodiment, a
polynucleotides encoding a protein of interest can be mixed with
the PEGs and also mixed with the sodium phosphate/sodium carbonate
solution. In yet another embodiment, polynucleotides encoding a
protein of interest can be mixed with the PEGs and a
polynucleotides encoding a second protein of interest can be mixed
with the sodium phosphate/sodium carbonate solution.
[1288] In some embodiments, the polynucleotides described herein
can be conjugated with another compound. Non-limiting examples of
conjugates are described in U.S. Pat. Nos. 7,964,578 and 7,833,992,
each of which are herein incorporated by reference in their
entireties. In another embodiment, modified RNA of the present
disclosure can be conjugated with conjugates of formula 1-122 as
described in U.S. Pat. Nos. 7,964,578 and 7,833,992, each of which
are herein incorporated by reference in their entireties. The
polynucleotides described herein can be conjugated with a metal
such as, but not limited to, gold. (See, e.g., Giljohann et al.
Journ. Amer. Chem. Soc. 2009 131(6): 2072-2073; herein incorporated
by reference in its entirety). In another embodiment, the
polynucleotides described herein can be conjugated and/or
encapsulated in gold-nanoparticles. (International Pub. No.
WO201216269 and U.S. Pub. No. 20120302940 and US20130177523; the
contents of each of which is herein incorporated by reference in
its entirety).
[1289] As described in U.S. Pub. No. 20100004313, herein
incorporated by reference in its entirety, a gene delivery
composition can include a nucleotide sequence and a poloxamer. For
example, the polynucleotides of the present disclosure can be used
in a gene delivery composition with the poloxamer described in U.S.
Pub. No. 20100004313.
[1290] In some embodiments, the polymer formulation of the present
disclosure can be stabilized by contacting the polymer formulation,
which can include a cationic carrier, with a cationic lipopolymer
that can be covalently linked to cholesterol and polyethylene
glycol groups. The polymer formulation can be contacted with a
cationic lipopolymer using the methods described in U.S. Pub. No.
20090042829 herein incorporated by reference in its entirety. The
cationic carrier can include, but is not limited to,
polyethylenimine, poly(trimethylenimine), poly(tetramethylenimine),
polypropylenimine, aminoglycoside-polyamine,
dideoxy-diamino-b-cyclodextrin, spermine, spermidine,
poly(2-dimethylamino)ethyl methacrylate, poly(lysine),
poly(histidine), poly(arginine), cationized gelatin, dendrimers,
chitosan, 1,2-Dioleoyl-3-Trimethylammonium-Propane(DOTAP),
N-[1-(2,3-dioleoyloxy)propyl]-N,N,N-trimethylammonium chloride
(DOTMA),
1-[2-(oleoyloxy)ethyl]-2-oleyl-3-(2-hydroxyethyl)imidazolinium
chloride (DOTIM),
2,3-dioleyloxy-N-[2(sperminecarboxamido)ethyl]-N,N-dimethyl-1-pr-
opanaminium trifluoroacetate (DOSPA),
3B--[N-(N',N'-Dimethylaminoethane)-carbamoyl]Cholesterol
Hydrochloride (DC-Cholesterol HCl) diheptadecylamidoglycyl
spermidine (DOGS), N,N-distearyl-N,N-dimethylammonium bromide
(DDAB), N-(1,2-dimyristyloxyprop-3-yl)-N,N-dimethyl-N-hydroxyethyl
ammonium bromide (DMRIE), N,N-dioleyl-N,N-dimethylammonium chloride
DODAC) and combinations thereof. As a non-limiting example, the
polynucleotides can be formulated with a cationic lipopolymer such
as those described in U.S. Patent Application No. 20130065942,
herein incorporated by reference in its entirety.
[1291] The polynucleotides of the disclosure can be formulated in a
polyplex of one or more polymers (See, e.g., U.S. Pat. No.
8,501,478, U.S. Pub. No. 20120237565 and 20120270927 and
20130149783 and International Patent Pub. No. WO2013090861; the
contents of each of which is herein incorporated by reference in
its entirety). As a non-limiting example, the polyplex can be
formed using the novel alpha-aminoamidine polymers described in
International Publication No. WO2013090861, the contents of which
are herein incorporated by reference in its entirety. As another
non-limiting example, the polyplex can be formed using the click
polymers described in U.S. Pat. No. 8,501,478, the contents of
which is herein incorporated by reference in its entirety.
[1292] In some embodiments, the polyplex comprises two or more
cationic polymers. The cationic polymer can comprise a
poly(ethylene imine) (PEI) such as linear PEI. In another
embodiment, the polyplex comprises p(TETA/CBA) its PEGylated analog
p(TETA/CBA)-g-PEG2k and mixtures thereof (see, e.g., US Patent
Publication No. US20130149783, the contents of which are herein
incorporated by reference in its entirety.
[1293] The polynucleotides of the disclosure can also be formulated
as a nanoparticle using a combination of polymers, lipids, and/or
other biodegradable agents, such as, but not limited to, calcium
phosphate. Components can be combined in a core-shell, hybrid,
and/or layer-by-layer architecture, to allow for fine-tuning of the
nanoparticle so to delivery of the polynucleotide, polynucleotides
can be enhanced (Wang et al., Nat Mater. 2006 5:791-796; Fuller et
al., Biomaterials. 2008 29:1526-1532; DeKoker et al., Adv Drug
Deliv Rev. 2011 63:748-761; Endres et al., Biomaterials. 2011
32:7721-7731; Su et al., Mol Pharm. 2011 Jun. 6; 8(3):774-87;
herein incorporated by reference in its entirety). As a
non-limiting example, the nanoparticle can comprise a plurality of
polymers such as, but not limited to hydrophilic-hydrophobic
polymers (e.g., PEG-PLGA), hydrophobic polymers (e.g., PEG) and/or
hydrophilic polymers (International Pub. No. WO20120225129; the
contents of which is herein incorporated by reference in its
entirety).
[1294] As another non-limiting example the nanoparticle comprising
hydrophilic polymers for the polynucleotides can be those described
in or made by the methods described in International Patent
Publication No. WO2013119936, the contents of which are herein
incorporated by reference in its entirety.
[1295] In some embodiments, the biodegradable polymers that can be
used in the present disclosure are poly(ether-anhydride) block
copolymers. As a non-limiting example, the biodegradable polymers
used herein can be a block copolymer as described in International
Patent Publication No WO2006063249, herein incorporated by
reference in its entirety, or made by the methods described in
International Patent Publication No WO2006063249, herein
incorporated by reference in its entirety.
[1296] In another embodiment, the biodegradable polymers that can
be used in the present disclosure are alkyl and cycloalkyl
terminated biodegradable lipids. As a non-limiting example, the
alkyl and cycloalkyl terminated biodegradable lipids can be those
described in International Publication No. WO2013086322 and/or made
by the methods described in International Publication No.
WO2013086322; the contents of which are herein incorporated by
reference in its entirety.
[1297] In yet another embodiment, the biodegradable polymers that
can be used in the present disclosure are cationic lipids having
one or more biodegradable group located in a lipid moiety. As a
non-limiting example, the biodegradable lipids can be those
described in US Patent Publication No. US20130195920, the contents
of which are herein incorporated by reference in its entirety.
[1298] Biodegradable calcium phosphate nanoparticles in combination
with lipids and/or polymers have been shown to deliver
polynucleotides in vivo. In some embodiments, a lipid coated
calcium phosphate nanoparticle, which can also contain a targeting
ligand such as anisamide, can be used to deliver the
polynucleotide, polynucleotides of the present disclosure. For
example, to effectively deliver siRNA in a mouse metastatic lung
model a lipid coated calcium phosphate nanoparticle was used (Li et
al., J Contr Rel. 2010 142: 416-421; Li et al., J Contr Rel. 2012
158:108-114; Yang et al., Mol Ther. 2012 20:609-615; herein
incorporated by reference in its entirety). This delivery system
combines both a targeted nanoparticle and a component to enhance
the endosomal escape, calcium phosphate, in order to improve
delivery of the siRNA.
[1299] In some embodiments, calcium phosphate with a PEG-polyanion
block copolymer can be used to delivery polynucleotides (Kazikawa
et al., J Contr Rel. 2004 97:345-356; Kazikawa et al., J Contr Rel.
2006 111:368-370; the contents of each of which are herein
incorporated by reference in its entirety).
[1300] In some embodiments, a PEG-charge-conversional polymer
(Pitella et al., Biomaterials. 2011 32:3106-3114; the contents of
which are herein incorporated by reference in its entirety) can be
used to form a nanoparticle to deliver the polynucleotides of the
present disclosure. The PEG-charge-conversional polymer can improve
upon the PEG-polyanion block copolymers by being cleaved into a
polycation at acidic pH, thus enhancing endosomal escape.
[1301] In some embodiments, a polymer used in the present
disclosure can be a pentablock polymer such as, but not limited to,
the pentablock polymers described in International Patent
Publication No. WO2013055331, herein incorporated by reference in
its entirety. As a non-limiting example, the pentablock polymer
comprises PGA-PCL-PEG-PCL-PGA, wherein PEG is polyethylene glycol,
PCL is poly(E-caprolactone), PGA is poly(glycolic acid), and PLA is
poly(lactic acid). As another non-limiting example, the pentablock
polymer comprises PEG-PCL-PLA-PCL-PEG, wherein PEG is polyethylene
glycol, PCL is poly(E-caprolactone), PGA is poly(glycolic acid),
and PLA is poly(lactic acid).
[1302] In some embodiments, a polymer that can be used in the
present disclosure comprises at least one diepoxide and at least
one aminoglycoside (See, e.g., International Patent Publication No.
WO2013055971, the contents of which are herein incorporated by
reference in its entirety). The diepoxide can be selected from, but
is not limited to, 1,4 butanediol diglycidyl ether (1,4 B),
1,4-cyclohexanedimethanol diglycidyl ether (1,4 C),
4-vinylcyclohexene diepoxide (4VCD), ethyleneglycol diglycidyl
ether (EDGE), glycerol diglycidyl ether (GDE), neopentylglycol
diglycidyl ether (NPDGE), poly(ethyleneglycol) diglycidyl ether
(PEGDE), poly(propyleneglycol) diglycidyl ether (PPGDE) and
resorcinol diglycidyl ether (RDE). The aminoglycoside can be
selected from, but is not limited to, streptomycin, neomycin,
framycetin, paromomycin, ribostamycin, kanamycin, amikacin,
arbekacin, bekanamycin, dibekacin, tobramycin, spectinomycin,
hygromycin, gentamicin, netilmicin, sisomicin, isepamicin,
verdamicin, astromicin, and apramycin. As a non-limiting example,
the polymers can be made by the methods described in International
Patent Publication No. WO2013055971, the contents of which are
herein incorporated by reference in its entirety. As another
non-limiting example, compositions comprising any of the polymers
comprising at least one least one diepoxide and at least one
aminoglycoside can be made by the methods described in
International Patent Publication No. WO2013055971, the contents of
which are herein incorporated by reference in its entirety.
[1303] In some embodiments, a polymer that can be used in the
present disclosure can be a cross-linked polymer. As a non-limiting
example, the cross-linked polymers can be used to form a particle
as described in U.S. Pat. No. 8,414,927, the contents of which are
herein incorporated by reference in its entirety. As another
non-limiting example, the cross-linked polymer can be obtained by
the methods described in US Patent Publication No. US20130172600,
the contents of which are herein incorporated by reference in its
entirety.
[1304] In another embodiment, a polymer that can be used in the
present disclosure can be a cross-linked polymer such as those
described in U.S. Pat. No. 8,461,132, the contents of which are
herein incorporated by reference in its entirety. As a non-limiting
example, the cross-linked polymer can be used in a therapeutic
composition for the treatment of a body tissue. The therapeutic
composition can be administered to damaged tissue using various
methods known in the art and/or described herein such as injection
or catheterization.
[1305] In some embodiments, a polymer that can be used in the
present disclosure can be a di-alphatic substituted pegylated lipid
such as, but not limited to, those described in International
Patent Publication No. WO2013049328, the contents of which are
herein incorporated by reference in its entirety.
[1306] In some embodiments, a block copolymer is PEG-PLGA-PEG (see,
e.g., the thermosensitive hydrogel (PEG-PLGA-PEG) was used as a
TGF-beta1 gene delivery vehicle in Lee et al. Thermosensitive
Hydrogel as a Tgf-.beta.1 Gene Delivery Vehicle Enhances Diabetic
Wound Healing. Pharmaceutical Research, 2003 20(12): 1995-2000; as
a controlled gene delivery system in Li et al. Controlled Gene
Delivery System Based on Thermosensitive Biodegradable Hydrogel.
Pharmaceutical Research 2003 20(6):884-888; and Chang et al.,
Non-ionic amphiphilic biodegradable PEG-PLGA-PEG copolymer enhances
gene delivery efficiency in rat skeletal muscle. J Controlled
Release. 2007 118:245-253; each of which is herein incorporated by
reference in its entirety) can be used in the present disclosure.
The present disclosure can be formulated with PEG-PLGA-PEG for
administration such as, but not limited to, intramuscular and
subcutaneous administration.
[1307] In another embodiment, the PEG-PLGA-PEG block copolymer is
used in the present disclosure to develop a biodegradable sustained
release system. In one aspect, the polynucleotides of the present
disclosure are mixed with the block copolymer prior to
administration. In another aspect, the polynucleotides acids of the
present disclosure are co-administered with the block
copolymer.
[1308] In some embodiments, the polymer used in the present
disclosure can be a multi-functional polymer derivative such as,
but not limited to, a multi-functional N-maleimidyl polymer
derivatives as described in U.S. Pat. No. 8,454,946, the contents
of which are herein incorporated by reference in its entirety.
[1309] The use of core-shell nanoparticles has additionally focused
on a high-throughput approach to synthesize cationic cross-linked
nanogel cores and various shells (Siegwart et al., Proc Natl Acad
Sci U S A. 2011 108:12996-13001; the contents of which are herein
incorporated by reference in its entirety). The complexation,
delivery, and internalization of the polymeric nanoparticles can be
precisely controlled by altering the chemical composition in both
the core and shell components of the nanoparticle. For example, the
core-shell nanoparticles can efficiently deliver siRNA to mouse
hepatocytes after they covalently attach cholesterol to the
nanoparticle.
[1310] In some embodiments, a hollow lipid core comprising a middle
PLGA layer and an outer neutral lipid layer containing PEG can be
used to delivery of the polynucleotide, polynucleotides of the
present disclosure. As a non-limiting example, in mice bearing a
luciferease-expressing tumor, it was determined that the
lipid-polymer-lipid hybrid nanoparticle significantly suppressed
luciferase expression, as compared to a conventional lipoplex (Shi
et al, Angew Chem Int Ed. 2011 50:7027-7031; herein incorporated by
reference in its entirety).
[1311] In some embodiments, the lipid nanoparticles can comprise a
core of the polynucleotides disclosed herein and a polymer shell.
The polymer shell can be any of the polymers described herein and
are known in the art. In an additional embodiment, the polymer
shell can be used to protect the polynucleotides in the core.
[1312] Core-shell nanoparticles for use with the polynucleotides of
the present disclosure are described and can be formed by the
methods described in U.S. Pat. No. 8,313,777 or International
Patent Publication No. WO2013124867, the contents of each of which
are herein incorporated by reference in their entirety.
[1313] In some embodiments, the core-shell nanoparticles can
comprise a core of the polynucleotides disclosed herein and a
polymer shell. The polymer shell can be any of the polymers
described herein and are known in the art. In an additional
embodiment, the polymer shell can be used to protect the
polynucleotides in the core.
[1314] In some embodiments, the polymer used with the formulations
described herein can be a modified polymer (such as, but not
limited to, a modified polyacetal) as described in International
Publication No. WO2011120053, the contents of which are herein
incorporated by reference in its entirety.
[1315] In some embodiments, the formulation can be a polymeric
carrier cargo complex comprising a polymeric carrier and at least
one nucleic acid molecule. Non-limiting examples of polymeric
carrier cargo complexes are described in International Patent
Publications Nos. WO2013113326, WO2013113501, WO2013113325,
WO2013113502 and WO2013113736 and European Patent Publication No.
EP2623121, the contents of each of which are herein incorporated by
reference in their entireties. In one aspect the polymeric carrier
cargo complexes can comprise a negatively charged nucleic acid
molecule such as, but not limited to, those described in
International Patent Publication Nos. WO2013113325 and
WO2013113502, the contents of each of which are herein incorporated
by reference in its entirety.
[1316] In some embodiments, a pharmaceutical composition can
comprise polynucleotides of the disclosure and a polymeric carrier
cargo complex (See, e.g., the antigens described in International
Patent Publications Nos. WO2013113326, WO2013113501, WO2013113325,
WO2013113502 and WO2013113736 and European Patent Publication No.
EP2623121, the contents of each of which are herein incorporated by
reference in their entireties).
[1317] In some embodiments, the polymer used with the formulations
described herein can be a modified polymer (such as, but not
limited to, a modified polyacetal) as described in International
Publication No. WO2011120053, the contents of which are herein
incorporated by reference in its entirety
Peptides and Proteins
[1318] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, using one or more peptides and/or proteins. The
polynucleotides of the disclosure can be formulated with peptides
and/or proteins in order to increase transfection of cells by the
polynucleotide. In some embodiments, peptides such as, but not
limited to, proteins and peptides that enable intracellular or
mitochondrial delivery can be used to deliver pharmaceutical
formulations.
[1319] Formulations of the disclosure including peptides or
proteins can be used to increase cell transfection by the
polynucleotide, alter the biodistribution of the polynucleotide
(e.g., by targeting specific tissues or cell types), and/or
increase the translation of encoded protein. (See e.g.,
International Pub. No. WO2012110636 and WO2013123298; the contents
of which are herein incorporated by reference in its entirety).
[1320] In some embodiments, the cell penetrating peptide can be,
but is not limited to, those described in US Patent Publication No
US20130129726, US20130137644 and US20130164219, each of which is
herein incorporated by reference in its entirety.
Self-Assembled Macromolecules
[1321] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with amphiphilic macromolecules (AMs) for delivery.
AMs comprise biocompatible amphiphilic polymers that have an
alkylated sugar backbone covalently linked to poly(ethylene
glycol). In aqueous solution, the AMs self-assemble to form
micelles. Non-limiting examples of methods of forming AMs and AMs
are described in US Patent Publication No. US20130217753, the
contents of which are herein incorporated by reference in its
entirety.
Cations and Anions
[1322] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with cations or anions. In some embodiments, the
formulations include metal cations such as, but not limited to,
Zn2+, Ca2+, Cu2+, Mg+ and combinations thereof. As a non-limiting
example, formulations can include polymers and a polynucleotides
complexed with a metal cation (see, e.g., U.S. Pat. Nos. 6,265,389
and 6,555,525, each of which is herein incorporated by reference in
its entirety).
[1323] In some embodiments, cationic nanoparticles comprising
combinations of divalent and monovalent cations can be formulated
with polynucleotides. Such nanoparticles can form spontaneously in
solution over a given period (e.g., hours, days, etc.). Such
nanoparticles do not form in the presence of divalent cations alone
or in the presence of monovalent cations alone. The delivery of
polynucleotides in cationic nanoparticles or in one or more depot
comprising cationic nanoparticles can improve polynucleotide
bioavailability by acting as a long-acting depot and/or reducing
the rate of degradation by nucleases.
Suspension Formulations
[1324] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in suspensions. In some embodiments, suspension
formulations are provided comprising polynucleotides, water
immiscible oil depots, surfactants and/or co-surfactants and/or
co-solvents. Combinations of oils and surfactants can enable
suspension formulation with polynucleotides. Delivery of
polynucleotides in a water immiscible depot can be used to improve
bioavailability through sustained release of mRNA from the depot to
the surrounding physiologic environment and prevent polynucleotides
degradation by nucleases.
[1325] In some embodiments, suspension formulations of mRNA can be
prepared using combinations of polynucleotides, oil-based solutions
and surfactants. Such formulations can be prepared as a two-part
system comprising an aqueous phase comprising polynucleotides and
an oil-based phase comprising oil and surfactants. Exemplary oils
for suspension formulations can include, but are not limited to
sesame oil and Miglyol (comprising esters of saturated coconut and
palmkernel oil-derived caprylic and capric fatty acids and glycerin
or propylene glycol), corn oil, soybean oil, peanut oil, beeswax
and/or palm seed oil. Exemplary surfactants can include, but are
not limited to Cremophor, polysorbate 20, polysorbate 80,
polyethylene glycol, transcutol, Capmul.RTM., labrasol, isopropyl
myristate, and/or Span 80. In some embodiments, suspensions can
comprise co-solvents including, but not limited to ethanol,
glycerol and/or propylene glycol.
[1326] Suspensions can be formed by first preparing polynucleotides
formulation comprising an aqueous solution of polynucleotide and an
oil-based phase comprising one or more surfactants. Suspension
formation occurs as a result of mixing the two phases (aqueous and
oil-based). In some embodiments, such a suspension can be delivered
to an aqueous phase to form an oil-in-water emulsion. In some
embodiments, delivery of a suspension to an aqueous phase results
in the formation of an oil-in-water emulsion in which the oil-based
phase comprising polynucleotides forms droplets that can range in
size from nanometer-sized droplets to micrometer-sized droplets. In
some embodiments, specific combinations of oils, surfactants,
cosurfactants and/or co-solvents can be utilized to suspend
polynucleotides in the oil phase and/or to form oil-in-water
emulsions upon delivery into an aqueous environment.
[1327] In some embodiments, suspensions can provide modulation of
the release of polynucleotides into the surrounding environment. In
such embodiments, polynucleotides release can be modulated by
diffusion from a water immiscible depot followed by
resolubilization into a surrounding environment (e.g., an aqueous
environment).
[1328] In some embodiments, polynucleotides within a water
immiscible depot (e.g., suspended within an oil phase) can result
in altered polynucleotides stability (e.g., altered degradation by
nucleases).
[1329] In some embodiments, polynucleotides can be formulated such
that upon injection, an emulsion forms spontaneously (e.g., when
delivered to an aqueous phase). Such particle formation can provide
a high surface area to volume ratio for release of polynucleotides
from an oil phase to an aqueous phase.
[1330] In some embodiments, the polynucleotides can be formulated
in a nanoemulsion such as, but not limited to, the nanoemulsions
described in U.S. Pat. No. 8,496,945, the contents of which are
herein incorporated by reference in its entirety. The nanoemulsions
can comprise nanoparticles described herein. As a non-limiting
example, the nanoparticles can comprise a liquid hydrophobic core
that can be surrounded or coated with a lipid or surfactant layer.
The lipid or surfactant layer can comprise at least one
membrane-integrating peptide and can also comprise a targeting
ligand (see, e.g., U.S. Pat. No. 8,496,945, the contents of which
are herein incorporated by reference in its entirety).
Semi-Solid Compositions
[1331] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in semi-solid compositions. In some embodiments, the
polynucleotides can be formulated with a hydrophobic matrix to form
a semi-solid composition. As a non-limiting example, the semi-solid
composition or paste-like composition can be made by the methods
described in International Patent Publication No WO201307604,
herein incorporated by reference in its entirety. The semi-solid
composition can be a sustained release formulation as described in
International Patent Publication No WO201307604, herein
incorporated by reference in its entirety.
[1332] In another embodiment, the semi-solid composition can
further have a micro-porous membrane or a biodegradable polymer
formed around the composition (see, e.g., International Patent
Publication No WO201307604, herein incorporated by reference in its
entirety).
[1333] The semi-solid composition using the polynucleotides of the
present disclosure can have the characteristics of the semi-solid
mixture as described in International Patent Publication No
WO201307604, herein incorporated by reference in its entirety
(e.g., a modulus of elasticity of at least 10.sup.-4 N mm.sup.-2,
and/or a viscosity of at least 100 mPas).
Surgical Sealants: Gels and Hydrogels
[1334] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with surgical sealants. In some embodiments, the
polynucleotides disclosed herein can be encapsulated into any
hydrogel known in the art that can form a gel when injected into a
subject. Surgical sealants such as gels and hydrogels are described
in International Patent Application No. PCT/US2014/027077, the
contents of which are herein incorporated by reference in its
entirety.
Conjugates
[1335] The disclosure includes pharmaceutical compositions that
comprise conjugates of the polynucleotide described herein, i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide. The
polynucleotides of the disclosure include conjugates, such as a
polynucleotide covalently linked to a carrier or targeting group,
or including two encoding regions that together produce a fusion
protein (e.g., bearing a targeting group and therapeutic protein or
peptide).
[1336] The conjugates of the disclosure include a naturally
occurring substance, such as a protein (e.g., human serum albumin
(HSA), low-density lipoprotein (LDL), high-density lipoprotein
(HDL), or globulin); an carbohydrate (e.g., a dextran, pullulan,
chitin, chitosan, inulin, cyclodextrin or hyaluronic acid); or a
lipid. The ligand can also be a recombinant or synthetic molecule,
such as a synthetic polymer, e.g., a synthetic polyamino acid, an
oligonucleotide (e.g., an aptamer). Examples of polyamino acids
include polyamino acid is a polylysine (PLL), poly L-aspartic acid,
poly L-glutamic acid, styrene-maleic acid anhydride copolymer,
poly(L-lactide-co-glycolied) copolymer, divinyl ether-maleic
anhydride copolymer, N-(2-hydroxypropyl)methacrylamide copolymer
(HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA),
polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide
polymers, or polyphosphazine. Example of polyamines include:
polyethylenimine, polylysine (PLL), spermine, spermidine,
polyamine, pseudopeptide-polyamine, peptidomimetic polyamine,
dendrimer polyamine, arginine, amidine, protamine, cationic lipid,
cationic porphyrin, quaternary salt of a polyamine, or an alpha
helical peptide.
[1337] In some embodiments, the conjugate of the present disclosure
can function as a carrier for the polynucleotides of the present
disclosure. The conjugate can comprise a cationic polymer such as,
but not limited to, polyamine, polylysine, polyalkylenimine, and
polyethylenimine that can be grafted to with poly(ethylene glycol).
As a non-limiting example, the conjugate can be similar to the
polymeric conjugate and the method of synthesizing the polymeric
conjugate described in U.S. Pat. No. 6,586,524 herein incorporated
by reference in its entirety.
[1338] A non-limiting example of a method for conjugation to a
substrate is described in US Patent Publication No. US20130211249,
the contents of which are herein incorporated by reference in its
entirety. The method can be used to make a conjugated polymeric
particle comprising a polynucleotide.
[1339] The conjugates can also include targeting groups, e.g., a
cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid
or protein, e.g., an antibody, that binds to a specified cell type
such as a kidney cell. A targeting group can be a thyrotropin,
melanotropin, lectin, glycoprotein, surfactant protein A, Mucin
carbohydrate, multivalent lactose, multivalent galactose,
N-acetyl-galactosamine, N-acetyl-glucosamine multivalent mannose,
multivalent fucose, glycosylated polyaminoacids, multivalent
galactose, transferrin, bisphosphonate, polyglutamate,
polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate,
vitamin B12, biotin, an RGD peptide, an RGD peptide mimetic or an
aptamer.
[1340] Targeting groups can be proteins, e.g., glycoproteins, or
peptides, e.g., molecules having a specific affinity for a
co-ligand, or antibodies e.g., an antibody, that binds to a
specified cell type such as a cancer cell, endothelial cell, or
bone cell. Targeting groups can also include hormones and hormone
receptors. They can also include non-peptidic species, such as
lipids, lectins, carbohydrates, vitamins, cofactors, multivalent
lactose, multivalent galactose, N-acetyl-galactosamine,
N-acetyl-glucosamine multivalent mannose, multivalent frucose, or
aptamers. The ligand can be, for example, a lipopolysaccharide, or
an activator of p38 MAP kinase.
[1341] The targeting group can be any ligand that is capable of
targeting a specific receptor. Examples include, without
limitation, folate, GalNAc, galactose, mannose, mannose-6P,
apatamers, integrin receptor ligands, chemokine receptor ligands,
transferrin, biotin, serotonin receptor ligands, PSMA, endothelin,
GCPII, somatostatin, LDL, and HDL ligands. In particular
embodiments, the targeting group is an aptamer. The aptamer can be
unmodified or have any combination of modifications disclosed
herein.
[1342] As a non-limiting example, the targeting group can be a
glutathione receptor (GR)-binding conjugate for targeted delivery
across the blood-central nervous system barrier (See, e.g., US
Patent Publication No. US2013021661012, the contents of which are
herein incorporated by reference in its entirety.
[1343] In some embodiments, the conjugate of the present disclosure
can be a synergistic biomolecule-polymer conjugate. The synergistic
biomolecule-polymer conjugate can be long-acting continuous-release
system to provide a greater therapeutic efficacy. The synergistic
biomolecule-polymer conjugate can be those described in US Patent
Publication No. US20130195799, the contents of which are herein
incorporated by reference in its entirety.
[1344] In another embodiment, the conjugate that can be used in the
present disclosure can be an aptamer conjugate. Non-limiting
examples of apatamer conjugates are described in International
Patent Publication No. WO2012040524, the contents of which are
herein incorporated by reference in its entirety. The aptamer
conjugates can be used to provide targeted delivery of formulations
comprising polynucleotides.
[1345] In some embodiments, the conjugate that can be used in the
present disclosure can be an amine containing polymer conjugate.
Non-limiting examples of amine containing polymer conjugate are
described in U.S. Pat. No. 8,507,653, the contents of which are
herein incorporated by reference in its entirety.
[1346] In some embodiments, pharmaceutical compositions of the
present disclosure can include chemical modifications such as, but
not limited to, modifications similar to locked nucleic acids.
[1347] Representative U.S. Patents that teach the preparation of
locked nucleic acid (LNA) such as those from Santaris, include, but
are not limited to, the following: U.S. Pat. Nos. 6,268,490;
6,670,461; 6,794,499; 6,998,484; 7,053,207; 7,084,125; and
7,399,845, each of which is herein incorporated by reference in its
entirety.
[1348] Representative U.S. patents that teach the preparation of
PNA compounds include, but are not limited to, U.S. Pat. Nos.
5,539,082; 5,714,331; and 5,719,262, each of which is herein
incorporated by reference. Further teaching of PNA compounds can be
found, for example, in Nielsen et al., Science, 1991, 254,
1497-1500.
[1349] Some embodiments featured in the disclosure include
polynucleotides with phosphorothioate backbones and
oligonucleosides with other modified backbones, and in particular
--CH.sub.2--NH--CH.sub.2--, --CH.sub.2--N(CH.sub.3)--O--CH.sub.2--
[known as a methylene (methylimino) or MMI backbone],
--CH.sub.2--O--N(CH.sub.3)--CH.sub.2--,
--CH.sub.2--N(CH.sub.3)--N(CH.sub.3)--CH.sub.2-- and
--N(CH.sub.3)--CH.sub.2--CH.sub.2-- [wherein the native
phosphodiester backbone is represented as
--O--P(O).sub.2--O--CH.sub.2--] of the above-referenced U.S. Pat.
No. 5,489,677, and the amide backbones of the above-referenced U.S.
Pat. No. 5,602,240. In some embodiments, the polynucleotides
featured herein have morpholino backbone structures of the
above-referenced U.S. Pat. No. 5,034,506.
[1350] Modifications at the 2' position can also aid in delivery.
For example, modifications at the 2' position are not located in a
polypeptide-coding sequence, i.e., not in a translatable region.
Modifications at the 2' position can be located in a 5'UTR, a 3'UTR
and/or a tailing region. Modifications at the 2' position can
include one of the following at the 2' position: H (i.e.,
2'-deoxy); F; O--, S--, or N-alkyl; O--, S--, or N-alkenyl; O--,
S-- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl
and alkynyl can be substituted or unsubstituted C.sub.1 to C.sub.10
alkyl or C.sub.2 to C.sub.10 alkenyl and alkynyl. Exemplary
suitable modifications include O[(CH.sub.2).sub.nO].sub.mCH.sub.3,
O(CH.sub.2)..sub.nOCH.sub.3, O(CH.sub.2).sub.nNH.sub.2,
O(CH.sub.2).sub.nCH.sub.3, O(CH.sub.2).sub.nONH.sub.2, and
O(CH.sub.2).sub.nON[(CH.sub.2).sub.nCH.sub.3)].sub.2, where n and m
are from 1 to about 10. In other embodiments, the polynucleotides
include one of the following at the 2' position: C.sub.1 to
C.sub.10 lower alkyl, substituted lower alkyl, alkaryl, aralkyl,
O-alkaryl or O-aralkyl, SH, SCH.sub.3, OCN, Cl, Br, CN, CF.sub.3,
OCF.sub.3, SOCH.sub.3, SO.sub.2CH.sub.3, ONO.sub.2, NO.sub.2,
N.sub.3, NH.sub.2, heterocycloalkyl, heterocycloalkaryl,
aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving
group, a reporter group, an intercalator, a group for improving the
pharmacokinetic properties, or a group for improving the
pharmacodynamic properties, and other substituents having similar
properties. In some embodiments, the modification includes a
2'-methoxyethoxy (2'-O--CH.sub.2CH.sub.2OCH.sub.3, also known as
2'-O-(2-methoxyethyl) or 2'-MOE) (Martin et al., Helv. Chim. Acta,
1995, 78:486-504) i.e., an alkoxy-alkoxy group. Another exemplary
modification is 2'-dimethylaminooxyethoxy, i.e., a
O(CH.sub.2).sub.2ON(CH.sub.3).sub.2 group, also known as 2'-DMAOE,
as described in examples herein below, and
2'-dimethylaminoethoxyethoxy (also known in the art as
2'-O-dimethylaminoethoxyethyl or 2'-DMAEOE), i.e.,
2'-O--CH.sub.2--O--CH.sub.2--N(CH.sub.2).sub.2, also described in
examples herein below. Other modifications include 2'-methoxy
(2'-OCH.sub.3), 2'-aminopropoxy
(2'-OCH.sub.2CH.sub.2CH.sub.2NH.sub.2) and 2'-fluoro (2'-F).
Similar modifications can also be made at other positions,
particularly the 3' position of the sugar on the 3' terminal
nucleotide or in 2'-5' linked dsRNAs and the 5' position of 5'
terminal nucleotide. Polynucleotides of the disclosure can also
have sugar mimetics such as cyclobutyl moieties in place of the
pentofuranosyl sugar. Representative U.S. patents that teach the
preparation of such modified sugar structures include, but are not
limited to, U.S. Pat. Nos. 4,981,957; 5,118,800; 5,319,080;
5,359,044; 5,393,878; 5,446,137; 5,466,786; 5,514,785; 5,519,134;
5,567,811; 5,576,427; 5,591,722; 5,597,909; 5,610,300; 5,627,053;
5,639,873; 5,646,265; 5,658,873; 5,670,633; and 5,700,920; the
contents of each of which is herein incorporated by reference in
their entirety.
[1351] In still other embodiments, the polynucleotide is covalently
conjugated to a cell penetrating polypeptide. The cell-penetrating
peptide can also include a signal sequence or a targeting sequence.
The conjugates of the disclosure can be designed to have increased
stability; increased cell transfection; and/or altered the
biodistribution (e.g., targeted to specific tissues or cell
types).
[1352] In some embodiments, the polynucleotides can be conjugated
to an agent to enhance delivery. As a non-limiting example, the
agent can be a monomer or polymer such as a targeting monomer or a
polymer having targeting blocks as described in International
Publication No. WO2011062965, herein incorporated by reference in
its entirety. In another non-limiting example, the agent can be a
transport agent covalently coupled to the polynucleotides of the
present disclosure (See, e.g., U.S. Pat. Nos. 6,835.393 and
7,374,778, each of which is herein incorporated by reference in its
entirety). In yet another non-limiting example, the agent can be a
membrane barrier transport enhancing agent such as those described
in U.S. Pat. Nos. 7,737,108 and 8,003,129, each of which is herein
incorporated by reference in its entirety.
[1353] In another embodiment, polynucleotides can be conjugated to
SMARTT POLYMER TECHNOLOGY.RTM. (PHASERX.RTM., Inc. Seattle,
Wash.).
[1354] In another aspect, the conjugate can be a peptide that
selectively directs the nanoparticle to neurons in a tissue or
organism. As a non-limiting example, the peptide used can be, but
is not limited to, the peptides described in US Patent Publication
No US20130129627, herein incorporated by reference in its
entirety.
[1355] In yet another aspect, the conjugate can be a peptide that
can assist in crossing the blood-brain barrier.
Nanoparticle Formulations
[1356] Self-Assembled Nanoparticles
[1357] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with self-assembled nanoparticles. Nucleic acid
self-assembled nanoparticles are described in International Patent
Application No. PCT/US2014/027077, the contents of which are herein
incorporated by reference in its entirety, such as in paragraphs
[000740]-[000743]. Polymer-based self-assembled nanoparticles are
described in International Patent Application No.
PCT/US2014/027077, the contents of which are herein incorporated by
reference in its entirety.
[1358] Nanoparticle Mimics
[1359] The disclosure includes pharmaceutical compositions that
comprise a nanoparticle mimic formulation of the polynucleotide
described herein, i.e., a polynucleotide comprising an ORF encoding
an MCM polypeptide. In some embodiments, the polynucleotides of the
disclosure is be encapsulated within and/or absorbed to a
nanoparticle mimic. A nanoparticle mimic can mimic the delivery
function organisms or particles such as, but not limited to,
pathogens, viruses, bacteria, fungus, parasites, prions and cells.
As a non-limiting example the polynucleotides of the disclosure can
be encapsulated in a non-viron particle that can mimic the delivery
function of a virus (see International Pub. No. WO2012006376 and US
Patent Publication No. US20130171241 and US20130195968, the
contents of each of which are herein incorporated by reference in
its entirety).
[1360] Nanotubes
[1361] The disclosure includes pharmaceutical compositions that
comprise a nanotube formulation of the polynucleotide described
herein, i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide. The polynucleotides of the disclosure can be attached
or otherwise bound to at least one nanotube such as, but not
limited to, rosette nanotubes, rosette nanotubes having twin bases
with a linker, carbon nanotubes and/or single-walled carbon
nanotubes, The polynucleotides can be bound to the nanotubes
through forces such as, but not limited to, steric, ionic, covalent
and/or other forces. Nanotubes and nanotube formulations comprising
polynucleotides are described in International Patent Application
No. PCT/US2014/027077, the contents of which are herein
incorporated by reference in its entirety.
[1362] Inorganic Nanoparticles
[1363] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in inorganic nanoparticles. Example methods are
provided in U.S. Pat. No. 8,257,745, herein incorporated by
reference in its entirety. The inorganic nanoparticles can include,
but are not limited to, clay substances that are water swellable.
As a non-limiting example, the inorganic nanoparticle can include
synthetic smectite clays that are made from simple silicates (See,
e.g., U.S. Pat. Nos. 5,585,108 and 8,257,745 each of which are
herein incorporated by reference in their entirety).
[1364] In some embodiments, the inorganic nanoparticles can
comprise a core of the polynucleotides disclosed herein and a
polymer shell. The polymer shell can be any of the polymers
described herein and are known in the art. In an additional
embodiment, the polymer shell can be used to protect the
polynucleotides in the core.
[1365] Semi-Conductive and Metallic Nanoparticles
[1366] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with water-dispersible nanoparticles comprising a
semiconductive or metallic material (U.S. Pub. No. 20120228565;
herein incorporated by reference in its entirety) or formed in a
magnetic nanoparticle (U.S. Pub. No. 20120265001 and 20120283503;
each of which is herein incorporated by reference in its entirety).
The water-dispersible nanoparticles can be hydrophobic
nanoparticles or hydrophilic nanoparticles.
[1367] In some embodiments, the semi-conductive and/or metallic
nanoparticles can comprise a core of the polynucleotides disclosed
herein and a polymer shell. The polymer shell can be any of the
polymers described herein and are known in the art. In an
additional embodiment, the polymer shell can be used to protect the
polynucleotides in the core.
[1368] Molded Nanoparticles and Microparticles
[1369] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in nanoparticles and/or microparticles. These
nanoparticles and/or microparticles can be molded into any size
shape and chemistry. As an example, the nanoparticles and/or
microparticles can be made using the PRINT.RTM. technology by
LIQUIDA TECHNOLOGIES.RTM. (Morrisville, N.C.) (See, e.g.,
International Pub. No. WO2007024323; the contents of which are
herein incorporated by reference in its entirety).
[1370] In some embodiments, the molded nanoparticles can comprise a
core of the polynucleotides disclosed herein and a polymer shell.
The polymer shell can be any of the polymers described herein and
are known in the art. In an additional embodiment, the polymer
shell can be used to protect the polynucleotides in the core.
[1371] In some embodiments, the polynucleotides of the present
disclosure can be formulated in microparticles. The microparticles
can contain a core of the polynucleotides and a cortex of a
biocompatible and/or biodegradable polymer. As a non-limiting
example, the microparticles that can be used with the present
disclosure can be those described in U.S. Pat. No. 8,460,709, U.S.
Patent Publication No. US20130129830 and International Patent
Publication No WO2013075068, each of which is herein incorporated
by reference in its entirety. As another non-limiting example, the
microparticles can be designed to extend the release of the
polynucleotides of the present disclosure over a desired period of
time (see, e.g., extended release of a therapeutic protein in U.S.
Patent Publication No. US20130129830, herein incorporated by
reference in its entirety).
[1372] The microparticle for use with the present disclosure can
have a diameter of at least 1 micron to at least 100 microns (e.g.,
at least 1 micron, at least 5 micron, at least 10 micron, at least
15 micron, at least 20 micron, at least 25 micron, at least 30
micron, at least 35 micron, at least 40 micron, at least 45 micron,
at least 50 micron, at least 55 micron, at least 60 micron, at
least 65 micron, at least 70 micron, at least 75 micron, at least
80 micron, at least 85 micron, at least 90 micron, at least 95
micron, at least 97 micron, at least 99 micron, and at least 100
micron).
[1373] NanoJackets and NanoLiposomes
[1374] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with NanoJackets and NanoLiposomes by Keystone Nano
(State College, Pa.). NanoJackets are made of compounds that are
naturally found in the body including calcium, phosphate and can
also include a small amount of silicates. Nanojackets can range in
size from 5 to 50 nm and can be used to deliver hydrophilic and
hydrophobic compounds such as, but not limited to,
polynucleotides.
[1375] NanoLiposomes are made of lipids such as, but not limited
to, lipids that naturally occur in the body. NanoLiposomes can
range in size from 60-80 nm and can be used to deliver hydrophilic
and hydrophobic compounds such as, but not limited to,
polynucleotides. In one aspect, the polynucleotides disclosed
herein are formulated in a NanoLiposome such as, but not limited
to, Ceramide NanoLiposomes.Cells
[1376] The disclosure also includes cells that comprise a
polynucleotide described herein, i.e., a polynucleotide comprising
an ORF encoding an MCM polypeptide. The polynucleotides of the
disclosure can be transfected ex vivo into cells, which are
subsequently transplanted into a subject. As non-limiting examples,
the pharmaceutical compositions can include red blood cells to
deliver modified RNA to liver and myeloid cells, virosomes to
deliver modified RNA in virus-like particles (VLPs), and
electroporated cells such as, but not limited to, from MAXCYTE.RTM.
(Gaithersburg, Md.) and from ERYTECH.RTM. (Lyon, France) to deliver
modified RNA. Examples of use of red blood cells, viral particles
and electroporated cells to deliver payloads other than
polynucleotides have been documented (Godfrin et al., Expert Opin
Biol Ther. 2012 12:127-133; Fang et al., Expert Opin Biol Ther.
2012 12:385-389; Hu et al., Proc Natl Acad Sci U S A. 2011
108:10980-10985; Lund et al., Pharm Res. 2010 27:400-420; Huckriede
et al., J Liposome Res. 2007; 17:39-47; Cusi, Hum Vaccin. 2006
2:1-7; de Jonge et al., Gene Ther. 2006 13:400-411; all of which
are herein incorporated by reference in its entirety).
[1377] The polynucleotides can be delivered in synthetic VLPs
synthesized by the methods described in International Pub No.
WO2011085231 and WO2013116656 and US Pub No. 20110171248, the
contents of each of which are herein incorporated by reference in
their entireties.
[1378] Cell-based formulations of the polynucleotides of the
disclosure can be used to ensure cell transfection (e.g., in the
cellular carrier), alter the biodistribution of the polynucleotide
(e.g., by targeting the cell carrier to specific tissues or cell
types), and/or increase the translation of encoded protein.
[1379] A variety of methods are known in the art and suitable for
introduction of nucleic acid into a cell, including viral and
non-viral mediated techniques. Examples of typical non-viral
mediated techniques include, but are not limited to,
electroporation, calcium phosphate mediated transfer,
nucleofection, sonoporation, heat shock, magnetofection, liposome
mediated transfer, microinjection, microprojectile mediated
transfer (nanoparticles), cationic polymer mediated transfer
(DEAE-dextran, polyethylenimine, polyethylene glycol (PEG) and the
like) or cell fusion.
[1380] The technique of sonoporation, or cellular sonication, is
the use of sound (e.g., ultrasonic frequencies) for modifying the
permeability of the cell plasma membrane. Sonoporation methods are
known to those in the art and are used to deliver nucleic acids in
vivo (Yoon and Park, Expert Opin Drug Deliv. 2010 7:321-330;
Postema and Gilja, Curr Pharm Biotechnol. 2007 8:355-361; Newman
and Bettinger, Gene Ther. 2007 14:465-475; all herein incorporated
by reference in their entirety). Sonoporation methods are known in
the art and are also taught for example as it relates to bacteria
in US Patent Publication 20100196983 and as it relates to other
cell types in, for example, US Patent Publication 20100009424, each
of which are incorporated herein by reference in their
entirety.
[1381] Electroporation techniques are also well known in the art
and are used to deliver nucleic acids in vivo and clinically (Andre
et al., Curr Gene Ther. 2010 10:267-280; Chiarella et al., Curr
Gene Ther. 2010 10:281-286; Hojman, Curr Gene Ther. 2010
10:128-138; all herein incorporated by reference in their
entirety). Electroporation devices are sold by many companies
worldwide including, but not limited to BTX.RTM. Instruments
(Holliston, Mass.) (e.g., the AgilePulse In Vivo System) and Inovio
(Blue Bell, Pa.) (e.g., Inovio SP-5P intramuscular delivery device
or the CELLECTRA.RTM. 3000 intradermal delivery device). In some
embodiments, polynucleotides can be delivered by
electroporation.
[1382] In some embodiments, the cells are selected from the group
consisting of mammalian cells, bacterial cells, plant, microbial,
algal and fungal cells. In some embodiments, the cells are
mammalian cells, such as, but not limited to, human, mouse, rat,
goat, horse, rabbit, hamster or cow cells. In a further embodiment,
the cells can be from an established cell line, including, but not
limited to, HeLa, NS0, SP2/0, KEK 293T, Vero, Caco, Caco-2, MDCK,
COS-1, COS-7, K562, Jurkat, CHO-K1, DG44, CHOK1SV, CHO-S, Huvec,
CV-1, Huh-7, NIH3T3, HEK293, 293, A549, HepG2, IMR-90, MCF-7,
U-20S, Per.C6, SF9, SF21 or Chinese Hamster Ovary (CHO) cells.
[1383] In certain embodiments, the cells are fungal cells, such as,
but not limited to, Chrysosporium cells, Aspergillus cells,
Trichoderma cells, Dictyostelium cells, Candida cells,
Saccharomyces cells, Schizosaccharomyces cells, and Penicillium
cells.
[1384] In certain embodiments, the cells are bacterial cells such
as, but not limited to, E. coli, B. subtilis, or BL21 cells.
Primary and secondary cells to be transfected by the methods of the
disclosure can be obtained from a variety of tissues and include,
but are not limited to, all cell types that can be maintained in
culture. For examples, primary and secondary cells that can be
transfected by the methods of the disclosure include, but are not
limited to, fibroblasts, keratinocytes, epithelial cells (e.g.,
mammary epithelial cells, intestinal epithelial cells), endothelial
cells, glial cells, neural cells, formed elements of the blood
(e.g., lymphocytes, bone marrow cells), muscle cells and precursors
of these somatic cell types. Primary cells can also be obtained
from a donor of the same species or from another species (e.g.,
mouse, rat, rabbit, cat, dog, pig, cow, bird, sheep, goat,
horse).
[1385] Minicells
[1386] The disclosure also includes minicells that comprise a
polynucleotide described herein, i.e., a polynucleotide comprising
an ORF encoding an MCM polypeptide. In one aspect, the
polynucleotides can be formulated in bacterial minicells. As a
non-limiting example, bacterial minicells can be those described in
International Publication No. WO2013088250 or US Patent Publication
No. US20130177499, the contents of each of which are herein
incorporated by reference in its entirety.
Micro-Organs
[1387] The disclosure also includes micro-organs containing a
polynucleotide described herein, i.e., a polynucleotide comprising
an ORF encoding an MCM polypeptide. The polynucleotides can be
contained in a micro-organ that can then express an encoded
polypeptide of interest in a long-lasting therapeutic formulation.
Micro-organs and formulations thereof are described in
International Patent Application No. PCT/US2014/027077, the
contents of which are herein incorporated by reference in its
entirety.
Exosomes
[1388] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in exosomes. The exosomes can be loaded with at least
one polynucleotide and delivered to cells, tissues and/or
organisms. As a non-limiting example, the polynucleotides can be
loaded in the exosomes described in International Publication No.
WO2013084000, herein incorporated by reference in its entirety.
Pseudovirions
[1389] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in in Pseudovirions (e.g., pseudo-virions). As a
non-limiting example, the pseudovirions can be those developed
and/or are described by Aura Biosciences (Cambridge, Mass.). In one
aspect, the pseudovirion can be developed to deliver drugs to
keratinocytes and basal membranes (See e.g., US Patent Publication
Nos. US20130012450, US20130012566, US21030012426 and US20120207840
and International Publication No. WO2013009717, each of which is
herein incorporated by reference in its entirety).
[1390] In some embodiments, the pseudovirion used for delivering
the polynucleotides of the present disclosure can be derived from
viruses such as, but not limited to, herpes and papillomaviruses
(See, e.g., US Patent Publication Nos. US Patent Publication Nos.
US20130012450, US20130012566, US21030012426 and US20120207840 and
International Publication No. WO2013009717, each of which is herein
incorporated by reference in its entirety; and Ma et al. HPV
pseudovirions as DNA delivery vehicles. Ther Deliv. 2011: 2(4):
427-430; Kines et al. The initial steps leading to papillomavirus
infection occur on the basement membrane prior to cell surface
binding. PNAS 2009:106(48), 20458-20463; Roberts et al. Genital
transmission of HPV in a mouse model is potentiated by nonoxynol-9
and inhibited by carrageenan. Nature Medicine. 2007:13(7) 857-861;
Gordon et al., Targeting the Vaginal Mucosa with Human
Papillomavirus Pseudovirion Vaccines delivering SIV DNA. J Immunol.
2012 188(2) 714-723; Cuburu et al., Intravaginal immunization with
HPV vectors induces tissue-resident CD8+ T cell responses. The
Journal of Clinical Investigation. 2012: 122(12) 4606-4620; Hung et
al., Ovarian Cancer Gene Therapy Using HPV-16 Pseudovirion Carrying
the HSV-tk Gene. PLoS ONE. 2012: 7(7) e40983; Johnson et al., Role
of Heparan Sulfate in Attachment to and Infection of the Murine
Female Genital Tract by Human Papillomavirus. J Virology. 2009:
83(5) 2067-2074; each of which is herein incorporated by reference
in its entirety).
[1391] The pseudovirion can be a virus-like particle (VLP) prepared
by the methods described in US Patent Publication No. US20120015899
and US20130177587 and International Patent Publication No.
WO2010047839 WO2013116656, WO2013106525 and WO2013122262, the
contents of each of which is herein incorporated by reference in
its entirety. In one aspect, the VLP can be, but is not limited to,
bacteriophages MS, Q.beta., R17, fr, GA, Sp, MI, I, MXI, NL95,
AP205, f2, PP7, and the plant viruses Turnip crinkle virus (TCV),
Tomato bushy stunt virus (TBSV), Southern bean mosaic virus (SBMV)
and members of the genus Bromovirus including Broad bean mottle
virus, Brome mosaic virus, Cassia yellow blotch virus, Cowpea
chlorotic mottle virus (CCMV), Melandrium yellow fleck virus, and
Spring beauty latent virus. In another aspect, the VLP can be
derived from the influenza virus as described in US Patent
Publication No. US20130177587 or U.S. Pat. No. 8,506,967, the
contents of each of which are herein incorporated by reference in
its entirety. In yet another aspect, the VLP can comprise a B7-1
and/or B7-2 molecule anchored to a lipid membrane or the exterior
of the particle such as described in International Patent
Publication No. WO2013116656, the contents of which are herein
incorporated by reference in its entirety. In one aspect, the VLP
can be derived from norovirus, rotavirus recombinant VP6 protein or
double layered VP2/VP6 such as the VLP described in International
Patent Publication No. WO2012049366, the contents of which are
herein incorporated by reference in its entirety.
[1392] The pseudovirion can be a human papilloma virus-like
particle such as, but not limited to, those described in
International Publication No. WO2010120266 and US Patent
Publication No. US20120171290, each of which is herein incorporated
by reference in its entirety and Ma et al. HPV pseudovirions as DNA
delivery vehicles. Ther Deliv. 2011: 2(4): 427-430; Kines et al.
The initial steps leading to papillomavirus infection occur on the
basement membrane prior to cell surface binding. PNAS 2009:106(48),
20458-20463; Roberts et al. Genital transmission of HPV in a mouse
model is potentiated by nonoxynol-9 and inhibited by carrageenan.
Nature Medicine. 2007:13(7) 857-861; Gordon et al., Targeting the
Vaginal Mucosa with Human Papillomavirus Pseudovirion Vaccines
delivering SIV DNA. J Immunol. 2012 188(2) 714-723; Cuburu et al.,
Intravaginal immunization with HPV vectors induces tissue-resident
CD8+ T cell responses. The Journal of Clinical Investigation. 2012:
122(12) 4606-4620; Hung et al., Ovarian Cancer Gene Therapy Using
HPV-16 Pseudovirion Carrying the HSV-tk Gene. PLoS ONE. 2012: 7(7)
e40983; Johnson et al., Role of Heparan Sulfate in Attachment to
and Infection of the Murine Female Genital Tract by Human
Papillomavirus. J Virology. 2009: 83(5) 2067-2074; each of which is
herein incorporated by reference in its entirety.
[1393] In one aspect, the pseudovirions can be virion derived
nanoparticles such as, but not limited to, those described in US
Patent Publication No. US20130116408 and US20130115247, each of
which is herein incorporated by reference in their entirety. The
virion derived nanoparticles can be made by the methods described
in US Patent Publication No. US20130116408 and US20130115247 or
International Patent Publication No. WO2013119877, each of which is
herein incorporated by reference in their entirety.
[1394] In some embodiments, the virus-like particle (VLP) can be a
self-assembled particle. Non-limiting examples of self-assembled
VLPs and methods of making the self-assembled VLPs are described in
International Patent Publication No. WO2013122262, the contents of
which are herein incorporated by reference in its entirety.
Silk-Based Delivery
[1395] The disclosure also includes pharmaceutical compositions
that are formulated for silk-based delivery of the polynucleotides
described herein, i.e., a polynucleotide comprising an ORF encoding
an MCM polypeptide. In some embodiments, the polynucleotides can be
formulated in a sustained release silk-based delivery system. The
silk-based delivery system can be formed by contacting a silk
fibroin solution with a therapeutic agent such as, but not limited
to, the polynucleotides described herein and/or known in the art.
As a non-limiting example, the sustained release silk-based
delivery system that can be used in the present disclosure and
methods of making such system are described in US Patent
Publication No. US20130177611, the contents of which are herein
incorporated by reference in its entirety.
Microparticles
[1396] The disclosure includes pharmaceutical compositions that
comprise a microparticle formulation of the polynucleotide
described herein, i.e., a polynucleotide comprising an ORF encoding
an MCM polypeptide. In some embodiments, formulations comprising
polynucleotides can comprise microparticles. The microparticles can
comprise a polymer described herein and/or known in the art such
as, but not limited to, poly(a-hydroxy acid), a polyhydroxy butyric
acid, a polycaprolactone, a polyorthoester and a polyanhydride. The
microparticle can have adsorbent surfaces to adsorb biologically
active molecules such as polynucleotides. As a non-limiting example
microparticles for use with the present disclosure and methods of
making microparticles are described in US Patent Publication No.
US2013195923 and US20130195898 and U.S. Pat. Nos. 8,309,139 and
8,206,749, the contents of each of which are herein incorporated by
reference in its entirety.
[1397] In another embodiment, the formulation can be a
microemulsion comprising microparticles and polynucleotides. As a
non-limiting example, microemulsions comprising microparticles are
described in US Patent Publication No. US2013195923 and
US20130195898 and U.S. Pat. Nos. 8,309,139 and 8,206,749, the
contents of each of which are herein incorporated by reference in
its entirety.
Microvesicles
[1398] The disclosure includes pharmaceutical compositions that
comprise a microvesicle-based formulation of the polynucleotide
described herein, i.e., a polynucleotide comprising an ORF encoding
an MCM polypeptide. In some embodiments, polynucleotides can be
formulated in microvesicles. Non-limiting examples of microvesicles
include those described in US Patent Publication No. US20130209544,
the contents of which are herein incorporated by reference in its
entirety.
[1399] In some embodiments, the microvesicle is an ARRDC1-mediated
microvesicles (ARMMs). Non-limiting examples of ARMMs and methods
of making ARMMs are described in International Patent Publication
No. WO2013119602, the contents of which are herein incorporated by
reference in its entirety.
Interpolyelectrolyte Complexes
[1400] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in an interpolyelectrolyte complex.
Interpolyelectrolyte complexes are formed when charge-dynamic
polymers are complexed with one or more anionic molecules.
Non-limiting examples of charge-dynamic polymers and
interpolyelectrolyte complexes and methods of making
interpolyelectrolyte complexes are described in U.S. Pat. No.
8,524,368, the contents of which is herein incorporated by
reference in its entirety.
Crystalline Polymeric Systems
[1401] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, in crystalline polymeric systems. Crystalline
polymeric systems are polymers with crystalline moieties and/or
terminal units comprising crystalline moieties. Non-limiting
examples of polymers with crystalline moieties and/or terminal
units comprising crystalline moieties termed "CYC polymers,"
crystalline polymer systems and methods of making such polymers and
systems are described in U.S. Pat. No. 8,524,259, the contents of
which are herein incorporated by reference in its entirety.
Cryoprotectants for mRNA
[1402] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with cyroprotectants. As used herein, there term
"cryoprotectant" refers to one or more agent that when combined
with a given substance, helps to reduce or eliminate damage to that
substance that occurs upon freezing. In some embodiments,
cryoprotectants are combined with polynucleotides in order to
stabilize them during freezing. Frozen storage of mRNA between
-20.degree. C. and -80.degree. C. can be advantageous for long term
(e.g., 36 months) stability of polynucleotide. In some embodiments,
cryoprotectants are included in polynucleotide formulations to
stabilize polynucleotide through freeze/thaw cycles and under
frozen storage conditions. Cryoprotectants of the present
disclosure can include, but are not limited to sucrose, trehalose,
lactose, glycerol, dextrose, raffinose and/or mannitol. Trehalose
is listed by the Food and Drug Administration as being generally
regarded as safe (GRAS) and is commonly used in commercial
pharmaceutical formulations.
Bulking Agents
[1403] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with bulking agents. As used herein, the term "bulking
agent" refers to one or more agents included in formulations to
impart a desired consistency to the formulation and/or
stabilization of formulation components. In some embodiments,
bulking agents are included in lyophilized polynucleotide
formulations to yield a "pharmaceutically elegant" cake,
stabilizing the lyophilized polynucleotides during long term (e.g.,
36 month) storage. Bulking agents of the present disclosure can
include, but are not limited to sucrose, trehalose, mannitol,
glycine, lactose and/or raffinose. In some embodiments,
combinations of cryoprotectants and bulking agents (for example,
sucrose/glycine or trehalose/mannitol) can be included to both
stabilize polynucleotides during freezing and provide a bulking
agent for lyophilization.
[1404] Non-limiting examples of formulations and methods for
formulating the polynucleotides of the present disclosure are also
provided in International Publication No WO2013090648 filed Dec.
14, 2012, the contents of which are incorporated herein by
reference in their entirety.
Inactive Ingredients
[1405] The disclosure also includes pharmaceutical compositions
that comprise a formulation of the polynucleotide described herein,
i.e., a polynucleotide comprising an ORF encoding an MCM
polypeptide, with at least one excipient that is an inactive
ingredient. As used herein, the term "inactive ingredient" refers
to one or more inactive agents included in formulations. In some
embodiments, all, none or some of the inactive ingredients that can
be used in the formulations of the present disclosure can be
approved by the US Food and Drug Administration (FDA). A
non-exhaustive list of inactive ingredients and the routes of
administration the inactive ingredients can be formulated in are
described in International Application No. PCT/US2014/027077.
VII. Method of Use of Polynucleotides
[1406] The polynucleotides of the present disclosure (i.e., a
polynucleotide comprising an ORF encoding an MCM polypeptide) can
be administered by any route that results in a therapeutically
effective outcome. These include, but are not limited to enteral
(into the intestine), gastroenteral, epidural (into the dura
matter), oral (by way of the mouth), transdermal, peridural,
intracerebral (into the cerebrum), intracerebroventricular (into
the cerebral ventricles), epicutaneous (application onto the skin),
intradermal, (into the skin itself), subcutaneous (under the skin),
nasal administration (through the nose), intravenous (into a vein),
intravenous bolus, intravenous drip, intraarterial (into an
artery), intramuscular (into a muscle), intracardiac (into the
heart), intraosseous infusion (into the bone marrow), intrathecal
(into the spinal canal), intraperitoneal, (infusion or injection
into the peritoneum), intravesical infusion, intravitreal, (through
the eye), intracavernous injection (into a pathologic cavity)
intracavitary (into the base of the penis), intravaginal
administration, intrauterine, extra-amniotic administration,
transdermal (diffusion through the intact skin for systemic
distribution), transmucosal (diffusion through a mucous membrane),
transvaginal, insufflation (snorting), sublingual, sublabial,
enema, eye drops (onto the conjunctiva), in ear drops, auricular
(in or by way of the ear), buccal (directed toward the cheek),
conjunctival, cutaneous, dental (to a tooth or teeth),
electro-osmosis, endocervical, endosinusial, endotracheal,
extracorporeal, hemodialysis, infiltration, interstitial,
intra-abdominal, intra-amniotic, intra-articular, intrabiliary,
intrabronchial, intrabursal, intracartilaginous (within a
cartilage), intracaudal (within the cauda equine), intracisternal
(within the cisterna magna cerebellomedularis), intracorneal
(within the cornea), dental intracornal, intracoronary (within the
coronary arteries), intracorporus cavernosum (within the dilatable
spaces of the corporus cavernosa of the penis), intradiscal (within
a disc), intraductal (within a duct of a gland), intraduodenal
(within the duodenum), intradural (within or beneath the dura),
intraepidermal (to the epidermis), intraesophageal (to the
esophagus), intragastric (within the stomach), intragingival
(within the gingivae), intraileal (within the distal portion of the
small intestine), intralesional (within or introduced directly to a
localized lesion), intraluminal (within a lumen of a tube),
intralymphatic (within the lymph), intramedullary (within the
marrow cavity of a bone), intrameningeal (within the meninges),
intraocular (within the eye), intraovarian (within the ovary),
intrapericardial (within the pericardium), intrapleural (within the
pleura), intraprostatic (within the prostate gland), intrapulmonary
(within the lungs or its bronchi), intrasinal (within the nasal or
periorbital sinuses), intraspinal (within the vertebral column),
intrasynovial (within the synovial cavity of a joint),
intratendinous (within a tendon), intratesticular (within the
testicle), intrathecal (within the cerebrospinal fluid at any level
of the cerebrospinal axis), intrathoracic (within the thorax),
intratubular (within the tubules of an organ), intratumor (within a
tumor), intratympanic (within the aurus media), intravascular
(within a vessel or vessels), intraventricular (within a
ventricle), iontophoresis (by means of electric current where ions
of soluble salts migrate into the tissues of the body), irrigation
(to bathe or flush open wounds or body cavities), laryngeal
(directly upon the larynx), nasogastric (through the nose and into
the stomach), occlusive dressing technique (topical route
administration that is then covered by a dressing that occludes the
area), ophthalmic (to the external eye), oropharyngeal (directly to
the mouth and pharynx), parenteral, percutaneous, periarticular,
peridural, perineural, periodontal, rectal, respiratory (within the
respiratory tract by inhaling orally or nasally for local or
systemic effect), retrobulbar (behind the pons or behind the
eyeball), intramyocardial (entering the myocardium), soft tissue,
subarachnoid, subconjunctival, submucosal, topical, transplacental
(through or across the placenta), transtracheal (through the wall
of the trachea), transtympanic (across or through the tympanic
cavity), ureteral (to the ureter), urethral (to the urethra),
vaginal, caudal block, diagnostic, nerve block, biliary perfusion,
cardiac perfusion, photopheresis or spinal. In specific
embodiments, compositions can be administered in a way that allows
them cross the blood-brain barrier, vascular barrier, or other
epithelial barrier. In some embodiments, a formulation for a route
of administration can include at least one inactive ingredient.
[1407] The polynucleotides of the present disclosure can be
delivered to a cell naked. As used herein in, "naked" refers to
delivering polynucleotides free from agents that promote
transfection. For example, the polynucleotides delivered to the
cell can contain no modifications. The naked polynucleotides can be
delivered to the cell using routes of administration known in the
art and described herein.
[1408] The polynucleotides of the present disclosure can be
formulated, using the methods described herein. The formulations
can contain polynucleotides that can be modified and/or unmodified.
The formulations can further include, but are not limited to, cell
penetration agents, a pharmaceutically acceptable carrier, a
delivery agent, a bioerodible or biocompatible polymer, a solvent,
and a sustained-release delivery depot. The formulated
polynucleotides can be delivered to the cell using routes of
administration known in the art and described herein.
[1409] The compositions can also be formulated for direct delivery
to an organ or tissue in any of several ways in the art including,
but not limited to, direct soaking or bathing, via a catheter, by
gels, powder, ointments, creams, gels, lotions, and/or drops, by
using substrates such as fabric or biodegradable materials coated
or impregnated with the compositions, and the like.
Parenteral and Injectable Administration
[1410] The present disclosure encompasses the delivery of
polynucleotides of the disclosure (i.e., a polynucleotide
comprising an ORF encoding an MCM polypeptide) in forms suitable
for parenteral and injectable administration. Liquid dosage forms
for parenteral administration include, but are not limited to,
pharmaceutically acceptable emulsions, microemulsions, solutions,
suspensions, syrups, and/or elixirs. In addition to active
ingredients, liquid dosage forms can comprise inert diluents
commonly used in the art such as, for example, water or other
solvents, solubilizing agents and emulsifiers such as ethyl
alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl
alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol,
dimethylformamide, oils (in particular, cottonseed, groundnut,
corn, germ, olive, castor, and sesame oils), glycerol,
tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid
esters of sorbitan, and mixtures thereof. Besides inert diluents,
oral compositions can include adjuvants such as wetting agents,
emulsifying and suspending agents, sweetening, flavoring, and/or
perfuming agents. In certain embodiments for parenteral
administration, compositions are mixed with solubilizing agents
such as CREMOPHOR.RTM., alcohols, oils, modified oils, glycols,
polysorbates, cyclodextrins, polymers, and/or combinations
thereof.
[1411] A pharmaceutical composition for parenteral administration
can comprise at least one inactive ingredient. Any or none of the
inactive ingredients used can have been approved by the US Food and
Drug Administration (FDA). A non-exhaustive list of inactive
ingredients for use in pharmaceutical compositions for parenteral
administration includes hydrochloric acid, mannitol, nitrogen,
sodium acetate, sodium chloride and sodium hydroxide.
[1412] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions can be formulated according to
the known art using suitable dispersing agents, wetting agents,
and/or suspending agents. Sterile injectable preparations can be
sterile injectable solutions, suspensions, and/or emulsions in
nontoxic parenterally acceptable diluents and/or solvents, for
example, as a solution in 1,3-butanediol. Among the acceptable
vehicles and solvents that can be employed are water, Ringer's
solution, U.S.P., and isotonic sodium chloride solution. Sterile,
fixed oils are conventionally employed as a solvent or suspending
medium. For this purpose any bland fixed oil can be employed
including synthetic mono- or diglycerides. Fatty acids such as
oleic acid can be used in the preparation of injectables. The
sterile formulation can also comprise adjuvants such as local
anesthetics, preservatives and buffering agents.
[1413] Injectable formulations can be sterilized, for example, by
filtration through a bacterial-retaining filter, and/or by
incorporating sterilizing agents in the form of sterile solid
compositions that can be dissolved or dispersed in sterile water or
other sterile injectable medium prior to use.
[1414] Injectable formulations can be for direct injection into a
region of a tissue, organ and/or subject. As a non-limiting
example, a tissue, organ and/or subject can be directly injected a
formulation by intramyocardial injection into the ischemic region.
(See, e.g., Zangi et al. Nature Biotechnology 2013; the contents of
which are herein incorporated by reference in its entirety).
[1415] In order to prolong the effect of an active ingredient, it
is often desirable to slow the absorption of the active ingredient
from subcutaneous or intramuscular injection. This can be
accomplished by the use of a liquid suspension of crystalline or
amorphous material with poor water solubility. The rate of
absorption of the drug then depends upon its rate of dissolution
which, in turn, can depend upon crystal size and crystalline form.
Alternatively, delayed absorption of a parenterally administered
drug form is accomplished by dissolving or suspending the drug in
an oil vehicle. Injectable depot forms are made by forming
microencapsule matrices of the drug in biodegradable polymers such
as polylactide-polyglycolide. Depending upon the ratio of drug to
polymer and the nature of the particular polymer employed, the rate
of drug release can be controlled. Examples of other biodegradable
polymers include poly(orthoesters) and poly(anhydrides). Depot
injectable formulations are prepared by entrapping the drug in
liposomes or microemulsions that are compatible with body
tissues.
Therapeutic Use
[1416] The polynucleotides of the present disclosure are used in
the preparation, manufacture and therapeutic use of polynucleotide
molecules comprising an mRNA encoding a methylmalonyl-CoA mutase
(MCM) polypeptide. In some embodiments, the polynucleotides of the
present disclosure can be used to treat and/or prevent MCM-related
diseases, disorders or conditions. Typically, but not exclusively,
the polynucleotides of the present disclosure can be used to treat
and/or prevent methylmalonic acidemia. In some embodiments, the
nucleotides are used in methods for reducing the levels of
methylmalonic acid in a subject in need thereof. For instance, one
aspect of the disclosure provides a method of alleviating the
symptoms of methylmalonic acidemia in a subject via the
administration of a composition comprising a polynucleotide
encoding MCM to that subject.
[1417] In some embodiments, the polynucleotides of the present
disclosure are used to reduce the level of a metabolite associated
with methylmalonic acidemia, the method comprising administering to
the subject an effective amount of a polynucleotide encoding an MCM
polypeptide. In some embodiments, the administration of an
effective amount of a polynucleotide reduces the levels of a
biomarker of methylmalonic acidemia such as methylmalonic acid,
propionyl-carnitine, acetyl-carnitine, propionyl-CoA,
D-methylmalonyl-CoA, L-methylmalonyl-CoA, or a combination thereof
in a subject. In some embodiments, the administration of the
polynucleotide results in reduction in the level of one or more
biomarkers of methylmalonic acidemia within a short period of time
after administration of the polynucleotide.
[1418] In some embodiments, the administration of the
polynucleotide results in expression of methylmalonyl-CoA mutase in
cells of the subject. In some embodiments, administering the
polynucleotide results in an increase of MCM enzymatic activity in
the subject. For example, in some embodiments, the polynucleotides
of the present disclosure are used in methods of administering a
composition comprising an mRNA encoding MCM to a subject, wherein
the method results in an increase of MCM enzymatic activity in at
least some cells of a subject. In some embodiments, the
administration of a composition comprising an mRNA encoding MCM to
a subject results in an increase of MCM enzymatic activity in cells
of subject by at least 10%, at least 25%, at least 50%, at least
75%, at least 100%, or by more than 100%. In some embodiments, the
administration of a composition comprising an mRNA encoding MCM to
a subject results in an increase of MCM enzymatic activity in cells
subject to a level at least 10%, at least 20%, at least 30%, at
least 40%, at least 50%, at least 60%, at least 70%, at least 80%,
at least 90%, or to 100% or more of the activity level expected in
a normal subject, e.g., a normal human not suffering from MMA. In
some embodiments, the administration of the polynucleotide results
in expression of methylmalonyl-CoA mutase in at least some of the
cells of a subject that persists for a period of time sufficient to
allow significant methylmalonyl-CoA metabolism to occur.
[1419] In some embodiments, the expression of the encoded
polypeptide is increased. In some embodiments, the IVT
polynucleotide increases MCM expression levels in cells when
introduced into those cells, e.g., by 20-50%, at least 20%, at
least 25%, at least 30%, at least 35%, at least 40%, at least 45%,
or at least 50%.
[1420] In some embodiments, the method or use comprises
administering a polynucleotide, e.g., mRNA, comprising an ORF
having significant sequence similarity to a polynucleotide selected
from the group of SEQ ID NOs: 1-207, 732-765, and 772, wherein the
ORF encodes an MCM polypeptide. Other aspects of the present
disclosure relate to transplantation of cells containing
polynucleotides to a mammalian subject. Administration of cells to
mammalian subjects is known to those of ordinary skill in the art,
and includes, but is not limited to, local implantation (e.g.,
topical or subcutaneous administration), organ delivery or systemic
injection (e.g., intravenous injection or inhalation), and the
formulation of cells in pharmaceutically acceptable carriers. Such
compositions containing polynucleotides can be formulated for
administration intramuscularly, transarterially, intraperitoneally,
intravenously, intranasally, subcutaneously, endoscopically,
transdermally, or intrathecally.
[1421] In some embodiments, the composition can be formulated for
extended release.
[1422] In some embodiments, the present methods are able to
catalyze the conversion of at least 0.1%, 0.5%, 1%, 2%, 2.5%, 5%,
10%, 20%, 25%, 30%, 35% 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85% or more of L-methylmalonyl-CoA to succinyl-CoA. In some
embodiments, a the methods are able to catalyze the conversion of a
range of from 0.1% to 5%, 5% to 25%, 10% to 25%, 10% to 30%, 20% to
40%, 10% to 50%, 20% to 50%, 10% to 75%, 20% to 75%, 30% to 75%,
30% to 85%, or 25% to 100% of L-methylmalonyl-CoA to
succinyl-CoA.
[1423] In some embodiments, the methods achieve at least 0.1%,
0.5%, 1%, 2%, 2.5%, 5%, 10%, 20%, 25%, 30%, 35% 40%, 45%, 50%, 55%,
60%, 65%, 70%, 75%, 80%, 85% or more of the enzymatic activity
sufficient for the synthesis of AdoCbl. In some embodiments, the
methods achieve a range of from 0.1% to 5%, 5% to 25%, 10% to 25%,
10% to 30%, 20% to 40%, 10% to 50%, 20% to 50%, 10% to 75%, 20% to
75%, 30% to 75%, 30% to 85%, or 25% to 100% of the enzymatic
activity sufficient for the synthesis of Adenosylcobalamin
(AdoCbl).
[1424] In some embodiments, the methods achieve sufficient
enzymatic activity to synthesize at least 0.1%, 0.5%, 1%, 2%, 2.5%,
5%, 10%, 20%, 25%, 30%, 35% 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85% or more of the active form of Adenosylcobalamin (AdoCbl),
found in healthy individuals. In some embodiments, the methods
achieve sufficient enzymatic activity to synthesize a range of from
0.1% to 5%, 5% to 25%, 10% to 25%, 10% to 30%, 20% to 40%, 10% to
50%, 20% to 50%, 10% to 75%, 20% to 75%, 30% to 75%, 30% to 85%, or
25% to 100% of the active form of AdoCbl found in healthy
individuals.
[1425] In some embodiments, the methods involve the administration
of a polynucleotide in combination with another therapy to a
patient in need thereof. Such methods can involve administering a
polynucleotide prior to, concurrent with, or subsequent to
administration of the additional therapy. In some embodiments, such
methods have an additive or synergistic effect. In some
embodiments, presented herein is a method for treating MMA,
comprising administering to a patient in need thereof an effective
amount of a polynucleotide (e.g., mRNA) encoding an MCM polypeptide
and an effective amount of another therapy. Examples of such other
therapies include, but are not limited to, cobalamin supplements,
camitine supplements and antibiotics. In another specific
embodiment, presented herein is a method for treating MMA,
comprising administering to a patient in need thereof an effective
amount of a polynucleotide (e.g., mRNA) encoding an MCM polypeptide
and maintaining a low-protein diet.
[1426] In some embodiments, the concentration of methylmalonic acid
in biological specimens (e.g., blood, plasma, serum, cerebral
spinal fluid, urine, or any other biofluids) of a patient is
monitored before, during and/or after a course of treatment
involving the administration of a polynucleotide (e.g., mRNA)
encoding an MCM polypeptide or a pharmaceutical composition thereof
to the patient. In some embodiments, the concentration of
methylcitrate in biological specimens (e.g., urine, blood, plasma,
serum, cerebral spinal fluid, or any other biofluids) of a patient
is monitored before, during and/or after a course of treatment
involving the administration of a polynucleotide (e.g., mRNA)
encoding an MCM polypeptide or a pharmaceutical composition thereof
to the patient. In some embodiments, the concentration of
propionylcarnitine in biological specimens (e.g., blood, plasma,
serum, cerebral spinal fluid, urine, or any other biofluids) of a
patient is monitored before, during and/or after a course of
treatment involving the administration of a polynucleotide (e.g.,
mRNA) encoding an MCM polypeptide or a pharmaceutical composition
thereof to the patient. In some embodiments, erythrocyte odd
long-chain fatty acids (OLCFAs) levels are monitored before, during
and/or after a course of treatment involving the administration of
a polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof to a patient. In some
embodiments, the urinary urea:methylmalonic acid ratio is monitored
before, during and/or after a course of treatment involving the
administration of a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof to a patient.
The dosage, frequency and/or length of administration of a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof to a patient may be modified as
a result of the concentration of methylmalonic acid, methylcitrate,
or propionylcarnitine, erythrocyte odd long-chain fatty acids
(OLCFAs) levels, or the urinary urea:methylmalonic acid ratio.
Alternatively, changes in one or more of these monitoring
parameters (e.g., concentration of methylmalonic acid,
methylcitrate, or propionylcarnitine, erythrocyte odd long-chain
fatty acids (OLCFAs) levels, or the urinary urea:methylmalonic acid
ratio) might indicate that the course of treatment involving the
administration of the polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or pharmaceutical composition thereof is effective in
treating MMA.
[1427] In a specific embodiment, presented herein is a method for
treating MMA, comprising: (a) administering to a patient in need
thereof one or more doses of a polynucleotide (e.g., mRNA) encoding
an MCM polypeptide or a pharmaceutical composition thereof; and (b)
monitoring the concentration of methylmalonic acid, methylcitrate,
or propionylcarnitine (e.g., detected in biological specimens such
as plasma, serum, cerebral spinal fluid, urine, or other
biofluids), erythrocyte odd long-chain fatty acids (OLCFAs) levels,
or the urinary urea:methylmalonic acid ratio before and/or after
step (a). In some embodiments, step (b) comprises monitoring the
concentration of methylmalonic acid. In some embodiments, step (b)
comprises monitoring the concentration of methylmalonic acid,
methylcitrate and/or propionylcarnitine. In some embodiments, the
monitoring step (b) is carried out before and/or after a certain
number of doses (e.g., 1, 2, 4, 6, 8, 10, 12, 14, 15, or 20 doses,
or more doses; or 2 to 4, 2 to 8, 2 to 20 or 2 to 30 doses) or
after a certain time period (e.g., 1, 2, 3, 4, 5, 6, or 7 days; or
1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 45, 48, or 50 weeks) of
administering the polynucleotide (e.g., mRNA) encoding an MCM
polypeptide. In some embodiments, one or more of these monitoring
parameters are detected prior to administration of the
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or
pharmaceutical composition thereof. In some embodiments, a decrease
in the concentration of methylmalonic acid, methylcitrate, or
propionylcamitine, or a decrease in erythrocyte odd long-chain
fatty acids (OLCFAs) levels following administration of the
polynucleotide or pharmaceutical composition thereof indicates that
the course of treatment is effective for treating MMA. In some
embodiments, an increase in the urinary urea:methylmalonic acid
ratio following administration of the polynucleotide (e.g., mRNA)
encoding an MCM polypeptide or pharmaceutical composition thereof
indicates that the course of treatment is effective for treating
MMA.
[1428] The concentration of methylmalonic acid, methylcitrate, or
propionylcamitine, erythrocyte odd long-chain fatty acids (OLCFAs)
levels, or the urinary urea:methylmalonic acid ratio of a patient
may be detected by any technique known to one of skill in the art.
In some embodiments, the method for detecting the concentration of
methylmalonic acid, methylcitrate, or propionylcarnitine in a
patient involves obtaining a tissue or fluid sample from the
patient and detecting the concentration of methylmalonic acid,
methylcitrate, propionylcarnitine or urea in the biological sample
(e.g., from plasma serum sample, cerebral spinal fluid, urine, or
other biofluids) that has been subjected to certain types of
treatment (e.g., centrifugation) and detection by use of, e.g.,
standard gas chromatography/mass spectroscopy (GC/MS)
stable-isotope dilution methods, positive chemical ionization gas
chromatography mass spectrometry (CI GC-MS) spectroscopic
techniques (e.g., UV spectroscopy) or high pressure liquid
chromatography (HPLC).
[1429] In some embodiments, the methods for treating MMA provided
herein alleviate or manage one, two or more symptoms associated
with MMA. Alleviating or managing one, two or more symptoms of MMA
may be used as a clinical endpoint for efficacy of a polynucleotide
for treating MMA. In some embodiments, the methods for treating MMA
provided herein reduce the duration and/or severity of one or more
symptoms associated with MMA. In some embodiments, the methods for
treating MMA provided herein inhibit the onset, progression and/or
recurrence of one or more symptoms associated with MMA. In some
embodiments, the methods for treating MMA provided herein reduce
the number of symptoms associated with MMA. In some embodiments,
the methods for treating MMA provided herein inhibit or reduce the
progression of one or more symptoms associated therewith.
[1430] Symptoms associated with MMA include, but are not limited
to: apnea, hyperammonemia, metabolic acidosis, lethargy, vomiting,
dehydration, hypotonia, hypoglycemia, repeated yeast infections,
renal impairment, mental retardation, developmental delays,
seizures, movement disorders, progressive encephalopathy, facial
dysmorphism (e.g., high forehead, broad nasal bridge, epicanthal
folds, long smooth philtrum, or triangular mouth), stroke, skin
lesions (e.g., moniliasis), occasional hepatomegaly, acute onset of
choreoathetosis, dystonia, dysphagia, dysarthria, growth problems
(e.g., growth failure), kidney disease or failure, tissue damage,
feeding problems, cognitive disabilities, metabolic attacks
triggered by common infections and reduced glomerular filtration
rate (GFR).
[1431] In some embodiments, the methods for treating MMA provided
herein reduce or eliminate one, two, or more of the following:
metabolic acidosis, developmental delays, movement disorders,
metabolic decompensation episodes (e.g., frequency and/or numbers
of episodes), skin lesions, hypotonia, seizures, and renal
impairment, associated with MMA. In some embodiments, the methods
for treating MMA provided herein improve renal function,
development, cognitive ability and movement in a patient diagnosed
with MMA.
[1432] In some embodiments, the methods for treating MMA provided
herein reduce hospitalization (e.g., the frequency or duration of
hospitalization) of a patient diagnosed with MMA. In some
embodiments, the methods for treating MMA provided herein reduce
hospitalization length of a patient diagnosed with MMA. In some
embodiments, the methods for treating MMA provided herein decrease
the hospitalization rate.
[1433] In some embodiments, the methods provided herein increase
the survival of a patient diagnosed with MMA. In some embodiments,
the methods for treating MMA provided herein reduce the mortality
of subjects diagnosed with MMA. In some embodiments, the methods
for treating MMA provided herein increase symptom-free survival of
MMA patients. In some embodiments, the methods for treating MMA
provided herein do not cure MMA in patients, but prevent the
progression or worsening of the disease. In some embodiments, the
methods for treating MMA provided herein enhance or improve the
therapeutic effect of another therapy.
[1434] In some embodiments, the methods for treating MMA provided
herein reduce the concentration of plasma methylmalonic acid in a
subject by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%,
45%, 50%, 55%, 60%, 65%, 80%, 85%, 90%, 95%, or 100%, or in a range
of from 5% to 50%, 10% to 50%, 20% to 50%, 20% to 75%, 25% to 75%,
25% to 90% or 10% to 99% relative to the respective concentration
prior to administration of a polynucleotide (e.g., mRNA) encoding
an MCM polypeptide, as assessed by methods well known in the art or
described herein. In some embodiments, the methods for treating MMA
provided herein reduce the concentration of urinary methylmalonic
acid in a subject by at least about 5%, 10%, 15%, 20%, 25%, 30%,
35%, 40%, 45%, 50%, 55%, 60%, 65%, 80%, 85%, 90%, 95%, or 100%, or
in a range of from 5% to 50%, 10% to 50%, 20% to 50%, 20% to 75%,
25% to 75%, 25% to 90% or 10% to 99% relative to the respective
concentration prior to administration of a polynucleotide (e.g.,
mRNA) encoding an MCM polypeptide, as assessed by methods well
known in the art or described herein.
[1435] In some embodiments, the methods for treating MMA provided
herein reduce the concentration of a metabolite of methylmalonic
acid in a subject by at least about 5%, 10%, 15%, 20%, 25%, 30%,
35%, 40%, 45%, 50%, 55%, 60%, 65%, 80%, 85%, 90%, 95%, or 100%, or
in a range of from 5% to 50%, 10% to 50%, 20% to 50%, 20% to 75%,
25% to 75%, 25% to 90% or 10% to 99% relative to the respective
concentration prior to administration of a polynucleotide (e.g.,
mRNA) encoding an MCM polypeptide, as assessed by methods well
known in the art or described herein. In some embodiments, the
methods for treating MMA provided herein reduce the concentration
of plasma propionylcamitine in a subject by at least about 5%, 10%,
15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 80%, 85%,
90%, 95%, or 100%, or in a range of from 5% to 50%, 10% to 50%, 20%
to 50%, 20% to 75%, 25% to 75%, 25% to 90% or 10% to 99% relative
to the respective concentration prior to administration of a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide, as
assessed by methods well known in the art or described herein. In
some embodiments, the methods for treating MMA provided herein
reduce the concentration of urinary methylcitrate in a subject by
at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
55%, 60%, 65%, 80%, 85%, 90%, 95%, or 100%, or in a range of from
10% to 50%, 20% to 50%, 20% to 75%, 25% to 75%, 25% to 90% or 10%
to 99% relative to the respective concentration prior to
administration of a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide, as assessed by methods well known in the art or
described herein.
[1436] In some embodiments, the methods for treating MMA provided
herein reduce the erythrocyte odd-numbered long-chain fatty acids
levels in a subject by at least about 5%, 10%, 15%, 20%, 25%, 30%,
35%, 40%, 45%, 50%, 55%, 60%, 65%, 80%, 85%, 90%, 95%, or 100%, or
in a range of from 10% to 50%, 20% to 50%, 20% to 75%, 25% to 75%,
25% to 90% or 10% to 99% relative to the respective concentration
prior to administration of a polynucleotide (e.g., mRNA) encoding
an MCM polypeptide, as assessed by methods well known in the art or
described herein. In some embodiments, the methods for treating MMA
provided herein increase the urinary urea:methylmalonic acid ratio
in a subject by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%,
40%, 45%, 50%, 55%, 60%, 65%, 80%, 85%, 90%, 95%, or 100%, or in a
range of from 10% to 50%, 20% to 50%, 20% to 75%, 25% to 75%, 25%
to 90% or 10% to 99% relative to the respective concentration prior
to administration of a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide, as assessed by methods well known in the art or
described herein.
[1437] In some embodiments, the methods for treating MMA provided
herein increase the cellular enzyme activity in a subject by at
least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%,
60%, 65%, 80%, 85%, 90%, 95%, or 100%, or in a range of from 10% to
50%, 20% to 50%, 20% to 75%, 25% to 75%, 25% to 90% or 10% to 99%
relative to the respective concentration prior to administration of
a polynucleotide (e.g., mRNA) encoding an MCM polypeptide, as
assessed by methods well known in the art or described herein. In
certain embodiment, the increase in cellular enzyme activity is
determined by obtaining cells (e.g., fibroblasts or lymphocytes)
from the subject, culturing the cells in the presence or absence of
a polynucleotide, and comparing the cellular enzyme activity in the
presence of the polynucleotide (e.g., mRNA) encoding an MCM
polypeptide to the cellular enzyme activity in the absence of the
polynucleotide. Techniques for measuring cellular enzyme activity
are known in the art and described herein (see, e.g., Section 6,
infra).
[1438] In some aspects, the methods for treating MMA provided
herein improve or developmental or cognitive function in a subject.
In some aspects, the methods for treating MMA provided herein
improve control of muscle contractions by a subject as assessed by
methods well known in the art. In some embodiments, the methods for
treating MMA provided herein improve renal function In some
embodiments, the methods for treating MMA provided herein decrease
the need for kidney transplant, liver transplant or both. In some
embodiments, the methods for treating MMA provided herein decrease
the requirement for hospitalization. In some embodiments, the
methods for treating MMA provided herein decrease the length and/or
frequency of hospitalization.
[1439] In some embodiments, the subject is a male human. In some
embodiments, the subject is a female human. In some embodiments, a
subject treated for MMA in accordance with the methods provided
herein is a fetus. In accordance with this embodiment, a pregnant
female may be administered a polynucleotide in a manner that
permits the polynucleotide to pass through the placenta to the
fetus. Alternatively, the polynucleotide may be administered
directly to the fetus by, e.g., injection. In some embodiments, a
subject treated for MMA in accordance with the methods provided
herein is a human infant. In one embodiment, a subject treated for
MMA in accordance with the methods provided herein is an elderly
human. In another embodiment, a subject treated for MMA in
accordance with the methods provided herein is a human adult. In
another embodiment, a subject treated for MMA in accordance with
the methods provided herein is a human child. In another
embodiment, a subject treated for MMA in accordance with the
methods provided herein is a human toddler.
[1440] In a specific embodiment, a subject treated for MMA in
accordance with the methods provided herein is a human that is less
than 5 years old. In another specific embodiment, a subject treated
for MMA in accordance with the methods provided herein is a human
that is older than 5 years old. In a specific embodiment, a subject
treated for MMA in accordance with the methods provided herein is a
human that is less than 5 years old, is older than 5 years old, is
18 years old or is older than 18 years old.
[1441] In some embodiments, a subject treated for MMA in accordance
with the methods provided herein is administered a polynucleotide
(e.g., mRNA) encoding an MCM polypeptide or a pharmaceutical
composition thereof, or a combination therapy before any adverse
effects or intolerance to therapies other than the polynucleotide
develops. In some embodiments, a subject treated for MMA in
accordance with the methods provided herein is a refractory
patient. In a certain embodiment, a refractory patient is an MMA
patient that is refractory to a standard therapy (e.g., carnitine
or cobalamin supplements).
[1442] In some embodiments, a subject treated for MMA in accordance
with the methods provided herein is a human that has proven
refractory to therapies other than treatment with a polynucleotide,
but is no longer on these therapies. In some embodiments, a subject
treated for MMA in accordance with the methods provided herein is a
human already receiving one or more conventional MMA therapies,
such as camitine supplements, cobalamin supplements, antibiotics,
kidney transplant, and/or liver transplant. In some embodiments, a
subject treated for MMA in accordance with the methods provided
herein is a human on a low-protein diet. In some embodiments, a
subject treated for MMA in accordance with the methods provided
herein is a human on a diet that avoids substances containing
isoleucine, threonine, methionine, and valine.
[1443] In some embodiments, a subject treated for MMA in accordance
with the methods provided herein is a human susceptible to adverse
reactions to conventional therapies. In some embodiments, a subject
treated for MMA in accordance with the methods provided herein is a
human that has not received a therapy, e.g., a carnitine
supplement, a cobalamin supplement, an antibiotic, a kidney
transplant, and/or a liver transplant, prior to the administration
of a polynucleotide or a pharmaceutical composition thereof. In
some embodiments, a subject treated for MMA in accordance with the
methods provided herein is a human that has received a therapy
prior to administration of a polynucleotide or a pharmaceutical
composition thereof. In some embodiments, a subject treated for MMA
in accordance with the methods provided herein is a human that has
experienced adverse side effects to the prior therapy or the prior
therapy was discontinued due to unacceptable levels of toxicity to
the human.
[1444] In some embodiments, a subject treated for MMA in accordance
with the methods provided herein is a human diagnosed with a
complete (mut.sup.0) or partial (mut.sup.-) defect in
methylmalonyl-CoA mutase (MCM). The gene encoding MCM is referred
to as the MUT gene and is located on chromosome 6p21.1.
Dosage and Administration
[1445] In accordance with the methods for treating MMA provided
herein, a polynucleotide (e.g., mRNA) encoding an MCM polypeptide
or a pharmaceutical composition thereof can be administered to a
subject in need thereof by a variety of routes in amounts which
result in a beneficial or therapeutic effect. A polynucleotide
(e.g., mRNA) encoding an MCM polypeptide or pharmaceutical
composition thereof may be intravenously administered to a subject
in need thereof in accordance with the methods for treating MMA
provided herein.
[1446] In accordance with the methods for treating MMA provided
herein that involve administration of a polynucleotide (e.g., mRNA)
encoding an MCM polypeptide in combination with one or more
additional therapies, the polynucleotide (e.g., mRNA) encoding an
MCM polypeptide and one or more additional therapies may be
administered by the same route or a different route of
administration.
[1447] The dosage and frequency of administration of a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof is administered to a subject in
need thereof in accordance with the methods for treating MMA
provided herein will be efficacious while minimizing any side
effects. The exact dosage and frequency of administration of a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof can be determined by a
practitioner, in light of factors related to the subject that
requires treatment. Factors which may be taken into account include
the severity of the disease state, general health of the subject,
age, weight, and gender of the subject, diet, time and frequency of
administration, drug combination(s), reaction sensitivities, and
tolerance/response to therapy. The dosage and frequency of
administration of a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof may be adjusted
over time to provide sufficient levels of the polynucleotide or to
maintain the desired effect.
[1448] In some embodiments, a polynucleotide (e.g., mRNA) encoding
an MCM polypeptide or a pharmaceutical composition thereof is
administered to a subject in need thereof in accordance with the
methods for treating MMA provided herein at a dosage and a
frequency of administration that achieves one or more of the
following: (i) the reduction or amelioration of the severity of one
or more MMA symptoms; (ii) the reduction in the duration of one or
more symptoms associated with MMA; (iii) the prevention in the
recurrence of a symptom associated with MMA; (iv) the reduction in
hospitalization of a subject; (v) a reduction in hospitalization
length; (vi) the increase in the survival of a subject; (vii) the
enhancement or improvement of the therapeutic effect of another
therapy; (viii) an improvement in developmental or cognitive
ability; (ix) a decrease in the frequency and/or number of
metabolic decompensation episodes; (x) an improvement in control of
muscle contraction; (xi) a reduction in mortality; (xii) an
increase in the survival rate of patients; (xiii) a decrease in
hospitalization rate; (xiv) the prevention of the development or
onset of one or more symptoms associated with MMA; (xv) the
reduction in the number of symptoms associated with MMA; (xvi) an
decrease in the concentration of methylmalonic acid in biological
fluids (e.g., plasma or urine); (xvii) a decrease in the
concentration of metabolites of methylmalonic acid , such as
propionylcarnitine or methylcitrate, in biological fluids (e.g.,
plasma or urine); (xviii) a decrease in erythrocyte odd-numbered
long-chain fatty acid levels; (xix) an increase in the urinary
urea:methylmalonic acid ratio; (xx) an increase in symptom-free
survival of MMA patients; (xxi) an improvement in renal function;
and (xxii) improvement in quality of life as assessed by methods
well known in the art.
[1449] In some embodiments, a polynucleotide (e.g., mRNA) encoding
an MCM polypeptide or a pharmaceutical composition thereof is
administered to a subject in need thereof in accordance with the
methods for treating MMA provided herein once in a day. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
to a subject in need thereof in accordance with the methods for
treating MMA provided herein once every two days. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
to a subject in need thereof in accordance with the methods for
treating MMA provided herein once every three days. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
to a subject in need thereof in accordance with the methods for
treating MMA provided herein once every four days. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
to a subject in need thereof in accordance with the methods for
treating MMA provided herein once every five days. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
to a subject in need thereof in accordance with the methods for
treating MMA provided herein once every six days. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
to a subject in need thereof in accordance with the methods for
treating MMA provided herein once every week. In some embodiments,
a polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof is administered to a subject in
need thereof in accordance with the methods for treating MMA
provided herein once every two weeks. In some embodiments, a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof is administered to a subject in
need thereof in accordance with the methods for treating MMA
provided herein once every three weeks. In some embodiments, a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof is administered to a subject in
need thereof in accordance with the methods for treating MMA
provided herein once every month. In some embodiments, a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof is administered to a subject in
need thereof in accordance with the methods for treating MMA
provided herein on a monthly schedule sufficient to maintain
decreased symptoms in a MMA patient suffering therefrom. In some
embodiments, provide herein are methods for continuous therapy
wherein a polynucleotide (e.g., mRNA) encoding an MCM polypeptide
or a pharmaceutical composition thereof is administered to a
subject in need thereof in accordance with the methods for treating
MMA provided herein daily for a certain period of time. In some
embodiments, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide or a pharmaceutical composition thereof is administered
continuously in subsequent 24 hour periods daily, weekly, monthly
or yearly.
[1450] Treatment periods for a course of therapy can span one week,
two weeks, three weeks, four weeks, five weeks, six weeks, seven
weeks, eight weeks, nine weeks, ten weeks, eleven weeks, twelve
weeks, thirteen weeks, fourteen weeks, four months, five months,
six months, seven months, eight months, nine months, ten months,
eleven months, one year, two years, three years, four years, five
years or longer. The treatment periods can be interrupted by
periods of rest which can span a day, one week, two weeks, three
weeks, four weeks, five weeks, six weeks, seven weeks, eight weeks,
nine weeks, ten weeks, eleven weeks, twelve weeks, thirteen weeks,
fourteen weeks, four months, five months, six months, seven months,
eight months, nine months, ten months, eleven months, one year, two
years, three years, four years, five years or longer. Such
determinations can be made by one skilled in the art (e.g., a
physician). In some embodiments, treatment is intermittent, with
periods of treatment being followed by periods of no treatment.
Continuous treatment can be interrupted by one or more days,
months, weeks or years. Continuous treatment can also be followed
by a rest period lasting one or more days, months, weeks or years,
with continuous treatment then resuming after the rest period.
[1451] In a particular embodiment, a polynucleotide or a
pharmaceutical composition thereof is administered in a dose of
about 0.01-10 mg/kg. In a particular embodiment, a polynucleotide
or a pharmaceutical composition thereof is administered in a dose
of about 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05
mg/kg, 0.06 mg/kg , 0.07 mg/kg, 0.08, mg/kg , 0.09 mg/kg, 0.1
mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5
mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, 0.9
mg/kg, 1.0 mg/kg, about 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, about 1.4
mg/kg, 1.5 mg/kg, 1.6 mg/kg, about 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg,
about 2.0 mg/kg, 2.1 mg/kg, 2.2 mg/kg, about 2.3 mg/kg, 2.4 mg/kg,
2.5 mg/kg, 3.0 mg/kg, 3.5 mg/kg, 4.0 mg/kg or about 5.0 mg/kg. In a
particular embodiment, a polynucleotide or a pharmaceutical
composition thereof is administered in a dose of about 0.01-2
mg/kg. In a particular embodiment, a polynucleotide or a
pharmaceutical composition thereof is administered in a dose of
about 0.02-1 mg/kg. In a particular embodiment, a polynucleotide or
a pharmaceutical composition thereof is administered in a dose of
about 0.02-1 mg/kg. In a particular embodiment, a polynucleotide or
a pharmaceutical composition thereof is administered in a dose of
about 0.02-0.5 mg/kg. In a particular embodiment, a polynucleotide
or a pharmaceutical composition thereof is administered in a dose
of about 0.03-0.5 mg/kg. In a particular embodiment, a
polynucleotide or a pharmaceutical composition thereof is
administered in a dose of about 0.04-0.5 mg/kg. In a particular
embodiment, a polynucleotide or a pharmaceutical composition
thereof is administered in a dose of about 0.05-0.5 mg/kg.
[1452] In a particular embodiment, a polynucleotide or a
pharmaceutical composition thereof is administered in a dose of
about 0.02-0.5 mg/kg. In a particular embodiment, a polynucleotide
or a pharmaceutical composition thereof is administered in a dose
of about 0.02-0.1 or 0.2 mg/kg. In a particular embodiment, a
polynucleotide or a pharmaceutical composition thereof is
administered in a dose of about 0.02-0.1 or 0.2 mg/kg. In a
particular embodiment, a polynucleotide or a pharmaceutical
composition thereof is administered in a dose of about 0.03-0.1 or
0.2 mg/kg. In a particular embodiment, a polynucleotide or a
pharmaceutical composition thereof is administered in a dose of
about 0.04-0.1 or 0.2 mg/kg. In a particular embodiment, a
polynucleotide or a pharmaceutical composition thereof is
administered in a dose of about 0.05-0.1 or 0.2 mg/kg.
[1453] In other embodiments, an effective dose for the
polynucleotide of the disclosure is 0.1 mg/kg to 1.0 mg/kg, 0.1
mg/kg to 10 mg/kg, 0.1 mg/kg to 2 mg/kg, 0.1 mg/kg to 5 mg/kg, 1
mg/kg to 5 mg/kg, or 1 mg/kg to 3 mg/kg. In some embodiments, the
effective dose is sufficient to reduce the plasma MMA level after
the administration at least 70%, at least 75%, at least 80%, at
least 85%, at least 90%, or at least 95% compared to the plasma MMA
level prior to the administration. In other embodiments, the plasma
MMA level is reduced about 75% to 85% compared to the plasma MMA
level prior to the administration.
[1454] In other embodiments, the effective dose is siffucient to
maintain the plasma MMA level after the administration lower than
about 5 .mu.mol/L, about 4.5 .mu.mol/L, about 4 .mu.mol/L, about
3.5 .mu.mol/L, about 3 .mu.mol/L, about 2.5 .mu.mol/L, about 2
.mu.mol/L, about 1.5 .mu.mol/L, about 1 .mu.mol/L, about 0.9
.mu.mol/L, about 0.8 .mu.mol/L, about 0.7 .mu.mol/L, about 0.6
.mu.mol/L, about 0.5 .mu.mol/L, about 0.4 .mu.mol/L, about 0.3
.mu.mol/L, or 0.27 .mu.mol/L.
[1455] In certain embodiments, the effective dose is sufficient to
maintain the urinary MMA level less than 2000 mmol/mol creatinine,
less than 1900 mmol/mol creatinine, less than 1800 mmol/mol
creatinine, less than 1700 mmol/mol creatinine, less than 1600
mmol/mol creatinine, less than 1500 mmol/mol creatinine, less than
1400 mmol/mol creatinine, less than 1300 mmol/mol creatinine, less
than 1200 mmol/mol creatinine, less than 1100 mmol/mol creatinine,
less than 1000 mmol/mol creatinine, 900 mmol/mol creatinine, 800
mmol/mol creatinine, 700 mmol/mol creatinine, 600 mmol/mol
creatinine, 500 mmol/mol creatinine, 400 mmol/mol creatinine, 300
mmol/mol creatinine, 200 mmol/mol creatinine, 100 mmol/mol
creatinine, 90 mmol/mol creatinine, 80 mmol/mol creatinine, 70
mmol/mol creatinine, 60 mmol/mol creatinine, 50 mmol/mol
creatinine, 40 mmol/mol creatinine, 30 mmol/mol creatinine, 20
mmol/mol creatinine, 10 mmol/mol creatinine, 9 mmol/mol creatinine,
8 mmol/mol creatinine, 7 mmol/mol creatinine, 6 mmol/mol
creatinine,5 mmol/mol creatinine, 4 mmol/mol creatinine, 3 mmol/mol
creatinine, 2 mmol/mol creatinine, or 1 mmol/mol creatinine.
[1456] In some embodiments, a method for treating MMA presented
herein involves the administration to a subject in need thereof of
one or more doses of an effective amount of a polynucleotide (e.g.,
mRNA) encoding an MCM polypeptide or a pharmaceutical composition,
wherein the effective amount may or may not be the same for each
dose. In some embodiments, a first dose of a polynucleotide or
pharmaceutical composition thereof is administered to a subject in
need thereof for a first period of time, and subsequently, a second
dose of a polynucleotide is administered to the subject for a
second period of time. The first dose may be more than the second
dose, or the first dose may be less than the second dose. A third
dose of a polynucleotide also may be administered to a subject in
need thereof for a third period of time.
[1457] The length of time that a subject in need thereof is
administered a polynucleotide or a pharmaceutical composition
thereof in accordance with the methods for treating MMA presented
herein will be the time period that is determined to be
efficacious. In some embodiments, a method for treating MMA
presented herein involves the administration of a polynucleotide or
a pharmaceutical composition thereof for a period of time until the
severity and/or number of symptoms associated with MMA
decrease.
[1458] It will be understood that the amounts of a polynucleotide
or a pharmaceutical composition thereof administered to a patient
in need thereof are or can be calculated based upon the actual
weight of the patient in question or the average weight of the
patient population in question.
Combination Therapy
[1459] Presented herein are combination therapies for the treatment
of MMA which involve the administration of a polynucleotide (e.g.,
mRNA) encoding an MCM polypeptide in combination with one or more
additional therapies to a subject in need thereof. In a specific
embodiment, presented herein are combination therapies for the
treatment of MMA which involve the administration of an effective
amount of a polynucleotide (e.g., mRNA) encoding an MCM polypeptide
in combination with an effective amount of another therapy to a
subject in need thereof. Specific examples of such other therapies
include, but are not limited to, carnitine supplements (such as
L-carnitine), cobalamin supplements and antibiotics (such as
metronidazole).
[1460] The combination therapies provided herein involve
administrating to a subject to in need thereof a polynucleotide or
a pharmaceutical composition thereof in combination with
conventional, or known, therapies for MMA. Current therapies for
MMA, include camitine supplements, cobalamin supplements and
antibiotics. Other therapies for MMA or a condition associated
therewith are aimed at controlling or relieving symptoms, e.g.,
anti-seizure medication. Accordingly, in some embodiments, the
combination therapies provided herein involve administrating to a
subject to in need thereof a pain reliever, a medication for
epileptic seizures, or other therapy aimed at alleviating or
controlling symptoms associated with MMA or a condition associated
therewith.
[1461] In some embodiments, the methods for treating MMA provided
herein comprise administering a polynucleotide (e.g., mRNA)
encoding an MCM polypeptide as a single agent for a period of time
prior to administering the polynucleotide in combination with an
additional therapy. In some embodiments, the methods for treating
MMA provided herein comprise administering an additional therapy
alone for a period of time prior to administering a polynucleotide
(e.g., mRNA) encoding an MCM polypeptide in combination with the
additional therapy.
[1462] In some embodiments, the administration of a polynucleotide
(e.g., mRNA) encoding an MCM polypeptide and one or more additional
therapies in accordance with the methods presented herein have an
additive effect relative the administration of the polynucleotide
or said one or more additional therapies alone. In some
embodiments, the administration of a polynucleotide (e.g., mRNA)
encoding an MCM polypeptide and one or more additional therapies in
accordance with the methods presented herein have a synergistic
effect relative to the administration of the polynucleotide or said
one or more additional therapies alone.
[1463] The combination of a polynucleotide (e.g., mRNA) encoding an
MCM polypeptide and one or more additional therapies can be
administered to a subject in the same pharmaceutical composition.
Alternatively, a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide and one or more additional therapies can be
administered concurrently to a subject in separate pharmaceutical
compositions. A polynucleotide (e.g., mRNA) encoding an MCM
polypeptide and one or more additional therapies can be
administered sequentially to a subject in separate pharmaceutical
compositions. A polynucleotide (e.g., mRNA) encoding an MCM
polypeptide and one or more additional therapies may also be
administered to a subject by the same or different routes of
administration.
[1464] In some embodiments, the combination therapies provided
herein involve administering to a subject in need thereof a
polynucleotide (e.g., mRNA) encoding an MCM polypeptide or a
pharmaceutical composition thereof in combination with one or more
of the following: a camitine supplement (e.g., L-camitine), a
cobalamin supplement and an antibiotic. In some embodiments, the
combination therapies provided herein involve administering to a
subject in need thereof a polynucleotide (e.g., mRNA) encoding an
MCM polypeptide or a pharmaceutical composition thereof in
combination with an organ transplant (e.g., a kidney, liver or
kidney and liver transplant).
Clinical Objectives
[1465] Efficacy of a polynucleotide for treating MMA may be
assessed by determining the effects of the polynucleotide on
reduction of plasma methylmalonic acid. The efficacy of a
polynucleotide for treating MMA may also be assessed by: (i)
determining the effect on urinary levels of methylcitrate; (ii)
determining the effect on plasma levels of propionlycarnitine;
(iii) evaluating effects on erythrocyte odd long-chain fatty acid
levels; (iv) determining effects on the urinary urea:methylmalonic
acid ratio; (v) determining the effects on enzyme activity in
cultured fibroblasts and lymphocytes from subjects with MMA, (vi)
evaluating the effects on the developmental and cognitive ability
of subjects; (vii) evaluating the effects on the dystonia rating
scale; (viii) evaluating the effects on the occurrence of any
metabolic decompensation episodes; (ix) evaluating the safety
profile of the polynucleotide; (x) evaluating compliance with
treatment with the polynucleotide; and (xi) determining the
polynucleotide's plasma exposure over time.
Clinical Endpoints
[1466] A primary clinical endpoint for efficacy of a polynucleotide
for treating MMA includes a reduction in plasma methylmalonic acid
levels. Other clinical endpoints for the efficacy of a
polynucleotide for treating MMA may include: a reduction in urinary
methylmalonic acid levels;
[1467] a reduction in urinary methylcitrate; a reduction in plasma
propionylcarnitine; a reduction in erythrocyte odd long-chain fatty
acid levels; an increase in the urea:methylmalonic acid ratio;
[1468] and pharmacokinetic parameters, e.g., time to maximum plasma
concentration (T.sub.max), C.sub.max, AUC, terminal elimination
half-life (t.sub.1/2) based on a polynucleotide's plasma
concentrations as assessed by a validated bioanalytical method.
[1469] Plasma Methylmalonic Acid Levels
[1470] Plasma methylmalonic acid levels may be used to indicate the
effectiveness of a polynucleotide to increase the activity of the
relevant enzyme or factor (e.g., MCM). Normal plasma methylmalonic
acid level is about <0.27 .mu.mol/L (Fowler et al., 2008, J.
Inherit. Metab. Dis. 31: 350-360). Plasma methylmalonic acid levels
are elevated in patients with MMA, generally in the range of about
100 to about 1.000 .mu.mol/L in cobalamin-non responsive patients
and about 5 to about 100 .mu.mol/L in cobalamin-responsive patients
(Venditti, 2007, Gene Reviews). Methylmalonic acid is considered to
be nephrotoxic, and central nervous system trapping of
methylmalonic acid, propionyl-CoA, and 2 methylcitrate is
considered to be the basis for chronic neurologic complications of
MMA (Morath et al., 2008, J. Inherit. Metab. Dis. 31: 35-43). A
decrease by >30% in plasma or urine methylmalonic acid levels
has been considered by some to be a clinically relevant difference
(Zwickler et al., 2008, J. Inherit. Metab. Dis. 31: 361-367).
[1471] Blood may be collected and plasma methylmalonic acid
concentrations may be determined using a standard gas
chromatography/mass spectroscopy (GC/MS) stable-isotope dilution
method.
[1472] Urinary Methylmalonic Acid Levels
[1473] Urinary methylmalonic acid levels may be used to indicate
the effectiveness of a polynucleotide to increase the activity of
the relevant enzyme or factor (e.g., MCM). The normal urinary
methylmalonic acid level is <4 mmol/mol creatinine (Venditti,
2007, Gene Reviews), and the level is significantly elevated in
MMA. In general, the more severe types of MMA, mut.sup.0 and cblB,
have higher urinary methylmalonic acid levels (about 5,000 to
>10.000 mmol/mol creatinine) compared to the less severe types,
mut.sup.- and cblA (<1,000 to >5,000 mol/mol creatinine)
(Horster et al., 2007, Pediatr. Res. 62: 225-230; Fowler et al.,
2008, J. Inherit. Metab. Dis. 31: 350-360). It has been observed
that chronic renal failure does not occur in patients with urinary
methylmalonic acid levels below -2.000 mmol/mol creatinine (Horster
et al., 2007, Pediatr. Res. 62: 225-230).
[1474] Urine may be collected and urinary methylmalonic acid
concentrations may be determined using a standard gas
chromatography/mass spectroscopy (GC/MS) stable-isotope dilution
method.
[1475] Plasma Propionylcarnitine, Urinary Methylcitrate,
Erythrocyte OLCFAs, Urinary Urea: Methylmalonic Acid Ratio
[1476] Plasma propionylcamitine and urinary methylcitrate are
methylmalonic acid metabolites and may be used to indicate the
effectiveness of a polynucleotide (e.g., mRNA) encoding an MCM
polypeptide to increase the activity of the relevant enzyme or
factor (e.g., MCM). It has been suggested that plasma
propionylcamitine may be a more useful measurement than urinary
methylmalonic acid in the presence of renal insufficiency (Horster
et al., 2007, Pediatr. Res. 62: 225-230). Urinary methylcitrate has
been found to be elevated in the setting of elevated methylmalonic
acid levels (Fowler et al., 2008, J. Inherit. Metab. Dis. 31:
350-360). Blood and urine may be collected and standard techniques
may be used to determine plasma propionylcamitine levels and
urinary methylcitrate levels, respectively.
[1477] OLCFAs are measured in erythrocyte membrane lipids and may
be used to indicate the effectiveness of a polynucleotide (e.g.,
mRNA) encoding an MCM polypeptide to increase the activity of the
relevant enzyme or factor (e.g., MCM). Erythrocyte OLCFAs values
reflect both the severity of the disease and the quality of the
dietary control in MMA (Merinero et al., 2008, J. Inherit. Metab.
Dis. 31: 55-66). This parameter is indicative of the propionyl-CoA
load of the cells and of long-term metabolic control in organic
acidemias (Merinero et al., 2008, J. Inherit. Metab. Dis. 31:
55-66; Sperl et al., 2000, Eur. J. Pediatr. 159: 54-88). A standard
method for determination of erythrocyte OLCFAs concentrations is
available.
[1478] An increase in urinary urea:methylmalonic acid ratio
following administration of a polynucleotide (e.g., mRNA) encoding
an MCM polypeptide compared to baseline may indicate an increase in
activity of the deficient enzyme or factor (MCM, cblA, or cblB).
Protein catabolism leads to production of both urea and
methylmalonic acid. The values of these catabolic products may
fluctuate with dietary protein intake. If the source of
methylmalonic acid is predominantly natural protein, in patients
with no enzyme activity (e.g., mut.sup.0 patients) the ratio of
urinary urea:methylmalonic acid is approximately 3.5. If there is
residual enzyme activity (e.g., administration of vitamin B12 to
cobalamin-sensitive patients) the ratio is generally >5.
Patients receiving amino acid supplements will produce more urea
than methylmalonic acid and will have a urea:MMA ratio>5.
However, even in this category of patients the urea:MMA ratio will
increase if the activity of the deficient enzyme or factor
increases, (Valayannopoulos et al., Annual Symposium of the Society
for the Study of Inborn Errors of Metabolism, Amsterdam, The
Netherlands, September 2004).
VIII. Kits and Devices
Kits
[1479] The disclosure provides a variety of kits for conveniently
and/or effectively using the claimed nucleotides of the present
disclosure. Typically kits will comprise sufficient amounts and/or
numbers of components to allow a user to perform multiple
treatments of a subject(s) and/or to perform multiple
experiments.
[1480] In one aspect, the present disclosure provides kits
comprising the molecules (polynucleotides) of the disclosure.
[1481] Said kits can be for protein production, comprising a first
polynucleotides comprising a translatable region. The kit can
further comprise packaging and instructions and/or a delivery agent
to form a formulation composition. The delivery agent can comprise
a saline, a buffered solution, a lipidoid or any delivery agent
disclosed herein.
[1482] In some embodiments, the buffer solution can include sodium
chloride, calcium chloride, phosphate and/or EDTA. In another
embodiment, the buffer solution can include, but is not limited to,
saline, saline with 2 mM calcium, 5% sucrose, 5% sucrose with 2 mM
calcium, 5% Mannitol, 5% Mannitol with 2 mM calcium, Ringer's
lactate, sodium chloride, sodium chloride with 2 mM calcium and
mannose (See, e.g., U.S. Pub. No. 20120258046; herein incorporated
by reference in its entirety). In a further embodiment, the buffer
solutions can be precipitated or it can be lyophilized. The amount
of each component can be varied to enable consistent, reproducible
higher concentration saline or simple buffer formulations. The
components can also be varied in order to increase the stability of
modified RNA in the buffer solution over a period of time and/or
under a variety of conditions. In one aspect, the present
disclosure provides kits for protein production, comprising: a
polynucleotide comprising a translatable region, provided in an
amount effective to produce a desired amount of a protein encoded
by the translatable region when introduced into a target cell; a
second polynucleotide comprising an inhibitory nucleic acid,
provided in an amount effective to substantially inhibit the innate
immune response of the cell; and packaging and instructions.
[1483] In one aspect, the present disclosure provides kits for
protein production, comprising a polynucleotide comprising a
translatable region, wherein the polynucleotide exhibits reduced
degradation by a cellular nuclease, and packaging and
instructions.
[1484] In one aspect, the present disclosure provides kits for
protein production, comprising a polynucleotide comprising a
translatable region, wherein the polynucleotide exhibits reduced
degradation by a cellular nuclease, and a mammalian cell suitable
for translation of the translatable region of the first nucleic
acid.
Devices
[1485] The present disclosure provides for devices that can
incorporate polynucleotides that encode polypeptides of interest.
These devices contain in a stable formulation the reagents to
synthesize a polynucleotide in a formulation available to be
immediately delivered to a subject in need thereof, such as a human
patient
[1486] Devices for administration can be employed to deliver the
polynucleotides of the present disclosure according to single,
multi- or split-dosing regimens taught herein. Such devices are
taught in, for example, International Application PCT/US2013/30062
filed Mar. 9, 2013, the contents of which are incorporated herein
by reference in their entirety.
[1487] Method and devices known in the art for multi-administration
to cells, organs and tissues are contemplated for use in
conjunction with the methods and compositions disclosed herein as
embodiments of the present disclosure. These include, for example,
those methods and devices having multiple needles, hybrid devices
employing for example lumens or catheters as well as devices
utilizing heat, electric current or radiation driven
mechanisms.
[1488] According to the present disclosure, these
multi-administration devices can be utilized to deliver the single,
multi- or split doses contemplated herein. Such devices are taught
for example in, International Application PCT/US2013/30062 filed
Mar. 9, 2013, the contents of which are incorporated herein by
reference in their entirety.
[1489] In some embodiments, the polynucleotide is administered
subcutaneously or intramuscularly via at least 3 needles to three
different, optionally adjacent, sites simultaneously, or within a
60 minutes period (e.g., administration to 4, 5, 6, 7, 8, 9, or 10
sites simultaneously or within a 60 minute period).
Methods and Devices Utilizing Catheters and/or Lumens
[1490] Methods and devices using catheters and lumens can be
employed to administer the polynucleotides of the present
disclosure on a single, multi- or split dosing schedule. Such
methods and devices are described in International Application
PCT/US2013/30062 filed Mar. 9, 2013 (Attorney Docket Number M300),
the contents of which are incorporated herein by reference in their
entirety.
Methods and Devices Utilizing Electrical Current
[1491] Methods and devices utilizing electric current can be
employed to deliver the polynucleotides of the present disclosure
according to the single, multi- or split dosing regimens taught
herein. Such methods and devices are described in International
Application PCT/US2013/30062 filed Mar. 9, 2013 (Attorney Docket
Number M300), the contents of which are incorporated herein by
reference in their entirety.
IX. Definitions
[1492] In order that the present disclosure can be more readily
understood, certain terms are first defined. As used in this
application, except as otherwise expressly provided herein, each of
the following terms shall have the meaning set forth below.
Additional definitions are set forth throughout the
application.
[1493] The disclosure includes embodiments in which exactly one
member of the group is present in, employed in, or otherwise
relevant to a given product or process. The disclosure includes
embodiments in which more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process.
[1494] In this specification and the appended claims, the singular
forms "a," "an" and "the" include plural referents unless the
context clearly dictates otherwise. The terms "a" (or "an"), as
well as the terms "one or more," and "at least one" can be used
interchangeably herein. In certain aspects, the term "a" or "an"
means "single." In other aspects, the term "a" or "an" includes
"two or more" or "multiple."
[1495] Furthermore, "and/or" where used herein is to be taken as
specific disclosure of each of the two specified features or
components with or without the other. Thus, the term "and/or" as
used in a phrase such as "A and/or B" herein is intended to include
"A and B," "A or B," "A" (alone), and "B" (alone). Likewise, the
term "and/or" as used in a phrase such as "A, B, and/or C" is
intended to encompass each of the following aspects: A, B, and C;
A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A
(alone); B (alone); and C (alone).
[1496] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this disclosure is related. For
example, the Concise Dictionary of Biomedicine and Molecular
Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of
Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the
Oxford Dictionary Of Biochemistry And Molecular Biology, Revised,
2000, Oxford University Press, provide one of skill with a general
dictionary of many of the terms used in this disclosure.
[1497] Wherever aspects are described herein with the language
"comprising," otherwise analogous aspects described in terms of
"consisting of" and/or "consisting essentially of" are also
provided.
[1498] Units, prefixes, and symbols are denoted in their Systeme
International de Unites (SI) accepted form. Numeric ranges are
inclusive of the numbers defining the range. Where a range of
values is recited, it is to be understood that each intervening
integer value, and each fraction thereof, between the recited upper
and lower limits of that range is also specifically disclosed,
along with each subrange between such values. The upper and lower
limits of any range can independently be included in or excluded
from the range, and each range where either, neither or both limits
are included is also encompassed within the disclosure. Where a
value is explicitly recited, it is to be understood that values
that are about the same quantity or amount as the recited value are
also within the scope of the disclosure. Where a combination is
disclosed, each subcombination of the elements of that combination
is also specifically disclosed and is within the scope of the
disclosure. Conversely, where different elements or groups of
elements are individually disclosed, combinations thereof are also
disclosed. Where any element of an disclosure is disclosed as
having a plurality of alternatives, examples of that disclosure in
which each alternative is excluded singly or in any combination
with the other alternatives are also hereby disclosed; more than
one element of an disclosure can have such exclusions, and all
combinations of elements having such exclusions are hereby
disclosed.
[1499] Nucleotides are referred to by their commonly accepted
single-letter codes. Unless otherwise indicated, nucleic acids are
written left to right in 5' to 3' orientation. Nucleotides are
referred to herein by their commonly known one-letter symbols
recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
Accordingly, A represents adenine, C represents cytosine, G
represents guanine, T represents thymine, U represents uracil.
[1500] Amino acids are referred to herein by either their commonly
known three letter symbols or by the one-letter symbols recommended
by the IUPAC-IUB Biochemical Nomenclature Commission. Unless
otherwise indicated, amino acid sequences are written left to right
in amino to carboxy orientation.
[1501] At various places in the present specification, substituents
of compounds of the present disclosure are disclosed in groups or
in ranges. It is specifically intended that the present disclosure
include each and every individual subcombination of the members of
such groups and ranges
[1502] About: As used herein, the term "about" means +/-10% of the
recited value.
[1503] Administered in combination: As used herein, the term
"administered in combination" or "combined administration" means
that two or more agents are administered to a subject at the same
time or within an interval such that there can be an overlap of an
effect of each agent on the patient. In some embodiments, they are
administered within about 60, 30, 15, 10, 5, or 1 minute of one
another. In some embodiments, the administrations of the agents are
spaced sufficiently closely together such that a combinatorial
(e.g., a synergistic) effect is achieved.
[1504] Amino acid substitution: The term "amino acid substitution"
refers to replacing an amino acid residue present in a parent
sequence (e.g., a consensus sequence) with another amino acid
residue. An amino acid can be substituted in a parent sequence, for
example, via chemical peptide synthesis or through recombinant
methods known in the art. Accordingly, a reference to a
"substitution at position X" refers to the substitution of an amino
acid present at position X with an alternative amino acid residue.
In some aspects, substitution patterns can be described according
to the schema AnY, wherein A is the single letter code
corresponding to the amino acid naturally present at position n,
and Y is the substituting amino acid residue. In other aspects,
substitution patterns can be described according to the schema
An(YZ), wherein A is the single letter code corresponding to the
amino acid residue substituting the amino acid naturally present at
position X, and Y and Z are alternative substituting amino acid
residue, i.e., In the context of the present disclosure,
substitutions (even when they referred to as amino acid
substitution) are conducted at the nucleic acid level, i.e.,
substituting an amino acid residue with an alternative amino acid
residue is conducted by substituting the codon encoding the first
amino acid with a codon encoding the second amino acid.
[1505] Animal: As used herein, the term "animal" refers to any
member of the animal kingdom. In some embodiments, "animal" refers
to humans at any stage of development. In some embodiments,
"animal" refers to non-human animals at any stage of development.
In certain embodiments, the non-human animal is a mammal (e.g., a
rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep,
cattle, a primate, or a pig). In some embodiments, animals include,
but are not limited to, mammals, birds, reptiles, amphibians, fish,
and worms. In some embodiments, the animal is a transgenic animal,
genetically-engineered animal, or a clone.
[1506] Approximately: As used herein, the term "approximately," as
applied to one or more values of interest, refers to a value that
is similar to a stated reference value. In certain embodiments, the
term "approximately" refers to a range of values that fall within
25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%,
7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater
than or less than) of the stated reference value unless otherwise
stated or otherwise evident from the context (except where such
number would exceed 100% of a possible value).
[1507] Associated with: As used herein with respect to a disease,
the term "associated with" means that the symptom, measurement,
characteristic, or status in question is linked to the diagnosis,
development, presence, or progression of that disease. As
association may, but need not, be causatively linked to the
disease.
[1508] When used with respect to two or more moieties, the terms
"associated with," "conjugated," "linked," "attached," and
"tethered," when used with respect to two or more moieties, means
that the moieties are physically associated or connected with one
another, either directly or via one or more additional moieties
that serves as a linking agent, to form a structure that is
sufficiently stable so that the moieties remain physically
associated under the conditions in which the structure is used,
e.g., physiological conditions. An "association" need not be
strictly through direct covalent chemical bonding. It can also
suggest ionic or hydrogen bonding or a hybridization based
connectivity sufficiently stable such that the "associated"
entities remain physically associated.
[1509] Bifunctional: As used herein, the term "bifunctional" refers
to any substance, molecule or moiety that is capable of or
maintains at least two functions. The functions can affect the same
outcome or a different outcome. The structure that produces the
function can be the same or different. For example, bifunctional
modified RNAs of the present disclosure can encode a cytotoxic
peptide (a first function) while those nucleosides that comprise
the encoding RNA are, in and of themselves, cytotoxic (second
function). In this example, delivery of the bifunctional modified
RNA to a cancer cell would produce not only a peptide or protein
molecule that can ameliorate or treat the cancer but would also
deliver a cytotoxic payload of nucleosides to the cell should
degradation, instead of translation of the modified RNA, occur.
[1510] Biocompatible: As used herein, the term "biocompatible"
means compatible with living cells, tissues, organs or systems
posing little to no risk of injury, toxicity or rejection by the
immune system.
[1511] Biodegradable: As used herein, the term "biodegradable"
means capable of being broken down into innocuous products by the
action of living things.
[1512] Biologically active: As used herein, the phrase
"biologically active" refers to a characteristic of any substance
that has activity in a biological system and/or organism. For
instance, a substance that, when administered to an organism, has a
biological effect on that organism, is considered to be
biologically active. In particular embodiments, a polynucleotide of
the present disclosure can be considered biologically active if
even a portion of the polynucleotide is biologically active or
mimics an activity considered biologically relevant.
[1513] Chimera: As used herein, "chimera" is an entity having two
or more incongruous or heterogeneous parts or regions.
[1514] Conservative amino acid substitution: A "conservative amino
acid substitution" is one in which the amino acid residue is
replaced with an amino acid residue having a similar side chain.
Families of amino acid residues having similar side chains have
been defined in the art, including basic side chains (e.g., lysine,
arginine, or histidine), acidic side chains (e.g., aspartic acid or
glutamic acid), uncharged polar side chains (e.g., glycine,
asparagine, glutamine, serine, threonine, tyrosine, or cysteine),
nonpolar side chains (e.g., alanine, valine, leucine, isoleucine,
proline, phenylalanine, methionine, or tryptophan), beta-branched
side chains (e.g., threonine, valine, isoleucine) and aromatic side
chains (e.g., tyrosine, phenylalanine, tryptophan, or histidine).
Thus, if an amino acid in a polypeptide is replaced with another
amino acid from the same side chain family, the amino acid
substitution is considered to be conservative. In another aspect, a
string of amino acids can be conservatively replaced with a
structurally similar string that differs in order and/or
composition of side chain family members.
[1515] Non-conservative amino acid substitutions include those in
which (i) a residue having an electropositive side chain (e.g.,
Arg, His or Lys) is substituted for, or by, an electronegative
residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser
or Thr) is substituted for, or by, a hydrophobic residue (e.g.,
Ala, Leu, Ile, Phe or Val), (iii) a cysteine or proline is
substituted for, or by, any other residue, or (iv) a residue having
a bulky hydrophobic or aromatic side chain (e.g., Val, His, Ile or
Trp) is substituted for, or by, one having a smaller side chain
(e.g., Ala or Ser) or no side chain (e.g., Gly).
[1516] Other amino acid substitutions can be readily identified by
workers of ordinary skill. For example, for the amino acid alanine,
a substitution can be taken from any one of D-alanine, glycine,
beta-alanine, L-cysteine and D-cysteine. For lysine, a replacement
can be any one of D-lysine, arginine, D-arginine, homo-arginine,
methionine, D-methionine, ornithine, or D-ornithine. Generally,
substitutions in functionally important regions that can be
expected to induce changes in the properties of isolated
polypeptides are those in which (i) a polar residue, e.g., serine
or threonine, is substituted for (or by) a hydrophobic residue,
e.g., leucine, isoleucine, phenylalanine, or alanine; (ii) a
cysteine residue is substituted for (or by) any other residue;
(iii) a residue having an electropositive side chain, e.g., lysine,
arginine or histidine, is substituted for (or by) a residue having
an electronegative side chain, e.g., glutamic acid or aspartic
acid; or (iv) a residue having a bulky side chain, e.g.,
phenylalanine, is substituted for (or by) one not having such a
side chain, e.g., glycine. The likelihood that one of the foregoing
non-conservative substitutions can alter functional properties of
the protein is also correlated to the position of the substitution
with respect to functionally important regions of the protein: some
non-conservative substitutions can accordingly have little or no
effect on biological properties.
[1517] Conserved: As used herein, the term "conserved" refers to
nucleotides or amino acid residues of a polynucleotide sequence or
polypeptide sequence, respectively, that are those that occur
unaltered in the same position of two or more sequences being
compared. Nucleotides or amino acids that are relatively conserved
are those that are conserved amongst more related sequences than
nucleotides or amino acids appearing elsewhere in the
sequences.
[1518] In some embodiments, two or more sequences are said to be
"completely conserved" if they are 100% identical to one another.
In some embodiments, two or more sequences are said to be "highly
conserved" if they are at least 70% identical, at least 80%
identical, at least 90% identical, or at least 95% identical to one
another. In some embodiments, two or more sequences are said to be
"highly conserved" if they are about 70% identical, about 80%
identical, about 90% identical, about 95%, about 98%, or about 99%
identical to one another. In some embodiments, two or more
sequences are said to be "conserved" if they are at least 30%
identical, at least 40% identical, at least 50% identical, at least
60% identical, at least 70% identical, at least 80% identical, at
least 90% identical, or at least 95% identical to one another. In
some embodiments, two or more sequences are said to be "conserved"
if they are about 30% identical, about 40% identical, about 50%
identical, about 60% identical, about 70% identical, about 80%
identical, about 90% identical, about 95% identical, about 98%
identical, or about 99% identical to one another. Conservation of
sequence can apply to the entire length of an polynucleotide or
polypeptide or can apply to a portion, region or feature
thereof.
[1519] Controlled Release: As used herein, the term "controlled
release" refers to a pharmaceutical composition or compound release
profile that conforms to a particular pattern of release to effect
a therapeutic outcome.
[1520] Cyclic or Cyclized: As used herein, the term "cyclic" refers
to the presence of a continuous loop. Cyclic molecules need not be
circular, only joined to form an unbroken chain of subunits. Cyclic
molecules such as the engineered RNA or mRNA of the present
disclosure can be single units or multimers or comprise one or more
components of a complex or higher order structure.
[1521] Cytotoxic: As used herein, "cytotoxic" refers to killing or
causing injurious, toxic, or deadly effect on a cell (e.g., a
mammalian cell (e.g., a human cell)), bacterium, virus, fungus,
protozoan, parasite, prion, or a combination thereof.
[1522] Delivery: As used herein, "delivery" refers to the act or
manner of delivering a compound, substance, entity, moiety, cargo
or payload.
[1523] Delivery Agent: As used herein, "delivery agent" refers to
any substance that facilitates, at least in part, the in vivo
delivery of a polynucleotide to targeted cells.
[1524] Destabilized: As used herein, the term "destable,"
"destabilize," or "destabilizing region" means a region or molecule
that is less stable than a starting, wild-type or native form of
the same region or molecule.
[1525] Detectable label: As used herein, "detectable label" refers
to one or more markers, signals, or moieties that are attached,
incorporated or associated with another entity that is readily
detected by methods known in the art including radiography,
fluorescence, chemiluminescence, enzymatic activity, absorbance and
the like. Detectable labels include radioisotopes, fluorophores,
chromophores, enzymes, dyes, metal ions, ligands such as biotin,
avidin, streptavidin and haptens, quantum dots, and the like.
Detectable labels can be located at any position in the peptides or
proteins disclosed herein. They can be within the amino acids, the
peptides, or proteins, or located at the N- or C-termini.
[1526] Diastereomer: As used herein, the term "diastereomer," means
stereoisomers that are not mirror images of one another and are
non-superimposable on one another.
[1527] Digest: As used herein, the term "digest" means to break
apart into smaller pieces or components. When referring to
polypeptides or proteins, digestion results in the production of
peptides.
[1528] Distal: As used herein, the term "distal" means situated
away from the center or away from a point or region of
interest.
[1529] Dosing regimen: As used herein, a "dosing regimen" is a
schedule of administration or physician determined regimen of
treatment, prophylaxis, or palliative care.
[1530] Effective Amount: As used herein, the term "effective
amount" of an agent is that amount sufficient to effect beneficial
or desired results, for example, clinical results, and, as such, an
"effective amount" depends upon the context in which it is being
applied. The term "effective amount" can be used interchangeably
with "effective dose," "therapeutically effective amount," or
"therapeutically effective dose."
[1531] Enantiomer: As used herein, the term "enantiomer" means each
individual optically active form of a compound of the disclosure,
having an optical purity or enantiomeric excess (as determined by
methods standard in the art) of at least 80% (i.e., at least 90% of
one enantiomer and at most 10% of the other enantiomer), at least
90%, or at least 98%.
[1532] Encapsulate: As used herein, the term "encapsulate" means to
enclose, surround or encase.
[1533] Encoded protein cleavage signal: As used herein, "encoded
protein cleavage signal" refers to the nucleotide sequence that
encodes a protein cleavage signal.
[1534] Engineered: As used herein, embodiments of the disclosure
are "engineered" when they are designed to have a feature or
property, whether structural or chemical, that varies from a
starting point, wild type or native molecule.
[1535] Effective Amount: As used herein, the term "effective
amount" of an agent is that amount sufficient to effect beneficial
or desired results, for example, clinical results, and, as such, an
"effective amount" depends upon the context in which it is being
applied. For example, in the context of administering an agent that
treats high cholesterol, an effective amount of an agent is, for
example, an amount sufficient to achieve treatment, as defined
herein, of high cholesterol, as compared to the response obtained
without administration of the agent.
[1536] Exosome: As used herein, "exosome" is a vesicle secreted by
mammalian cells or a complex involved in RNA degradation.
[1537] Expression: As used herein, "expression" of a nucleic acid
sequence refers to one or more of the following events: (1)
production of an RNA template from a DNA sequence (e.g., by
transcription); (2) processing of an RNA transcript (e.g., by
splicing, editing, 5' cap formation, and/or 3' end processing); (3)
translation of an RNA into a polypeptide or protein; and (4)
post-translational modification of a polypeptide or protein.
[1538] Feature: As used herein, a "feature" refers to a
characteristic, a property, or a distinctive element.
[1539] Formulation: As used herein, a "formulation" includes at
least a polynucleotide and a delivery agent.
[1540] Fragment: A "fragment," as used herein, refers to a portion.
For example, fragments of proteins can comprise polypeptides
obtained by digesting full-length protein isolated from cultured
cells.
[1541] Functional: As used herein, a "functional" biological
molecule is a biological molecule in a form in which it exhibits a
property and/or activity by which it is characterized.
[1542] Homology: As used herein, the term "homology" refers to the
overall relatedness between polymeric molecules, e.g., between
nucleic acid molecules (e.g., DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. In some embodiments,
polymeric molecules are considered to be "homologous" to one
another if their sequences are at least 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical
or similar. The term "homologous" necessarily refers to a
comparison between at least two sequences (polynucleotide or
polypeptide sequences). In accordance with the disclosure, two
polynucleotide sequences are considered to be homologous if the
polypeptides they encode are at least about 50%, 60%, 70%, 80%,
90%, 95%, or even 99% for at least one stretch of at least about 20
amino acids. In some embodiments, homologous polynucleotide
sequences are characterized by the ability to encode a stretch of
at least 4-5 uniquely specified amino acids. For polynucleotide
sequences less than 60 nucleotides in length, homology is
determined by the ability to encode a stretch of at least 4-5
uniquely specified amino acids. In accordance with the disclosure,
two protein sequences are considered to be homologous if the
proteins are at least about 50%, 60%, 70%, 80%, or 90% identical
for at least one stretch of at least about 20 amino acids.
[1543] Identity: As used herein, the term "identity" refers to the
overall relatedness between polymeric molecules, e.g., between
polynucleotide molecules (e.g., DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. Percent identity can be
calculated between two DNA molecules, between two RNA molecules,
and between a DNA molecule and an RNA molecule. When DNA and RNA
are compared, T is considered to be U (or vice versa).
[1544] Calculation of the percent identity of two polynucleotide
sequences, for example, can be performed by aligning the two
sequences for optimal comparison purposes (e.g., gaps can be
introduced in one or both of a first and a second nucleic acid
sequences for optimal alignment and non-identical sequences can be
disregarded for comparison purposes). In certain embodiments, the
length of a sequence aligned for comparison purposes is at least
30%, at least 40%, at least 50%, at least 60%, at least 70%, at
least 80%, at least 90%, at least 95%, or 100% of the length of the
reference sequence. The nucleotides at corresponding nucleotide
positions are then compared. When a position in the first sequence
is occupied by the same nucleotide as the corresponding position in
the second sequence, then the molecules are identical at that
position. The percent identity between the two sequences is a
function of the number of identical positions shared by the
sequences, taking into account the number of gaps, and the length
of each gap, which needs to be introduced for optimal alignment of
the two sequences. The comparison of sequences and determination of
percent identity between two sequences can be accomplished using a
mathematical algorithm. For example, the percent identity between
two nucleotide sequences can be determined using methods such as
those described in Computational Molecular Biology, Lesk, A. M.,
ed., Oxford University Press, New York, 1988; Biocomputing:
Informatics and Genome Projects, Smith, D. W., ed., Academic Press,
New York, 1993; Sequence Analysis in Molecular Biology, von Heinje,
G., Academic Press, 1987; Computer Analysis of Sequence Data, Part
I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New
Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and
Devereux, J., eds., M Stockton Press, New York, 1991; each of which
is incorporated herein by reference. For example, the percent
identity between two nucleotide sequences can be determined using
the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which
has been incorporated into the ALIGN program (version 2.0) using a
PAM120 weight residue table, a gap length penalty of 12 and a gap
penalty of 4. The percent identity between two nucleotide sequences
can, alternatively, be determined using the GAP program in the GCG
software package using an NWSgapdna.CMP matrix. Methods commonly
employed to determine percent identity between sequences include,
but are not limited to those disclosed in Carillo, H., and Lipman,
D., SIAM J Applied Math., 48:1073 (1988); incorporated herein by
reference. Techniques for determining identity are codified in
publicly available computer programs. Exemplary computer software
to determine homology between two sequences include, but are not
limited to, GCG program package, Devereux, J., et al., Nucleic
Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA
Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).
[1545] Intact: As used herein, in the context of a polypeptide, the
term "intact" means retaining an amino acid corresponding to the
wild-type protein, e.g., not mutating or substituting the wild-type
amino acid.
[1546] Isomer: As used herein, the term "isomer" means any
tautomer, stereoisomer, enantiomer, or diastereomer of any compound
of the disclosure. It is recognized that the compounds of the
disclosure can have one or more chiral centers and/or double bonds
and, therefore, exist as stereoisomers, such as double-bond isomers
(i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers
(i.e., (+) or (-)) or cis/trans isomers). According to the
disclosure, the chemical structures depicted herein, and therefore
the compounds of the disclosure, encompass all of the corresponding
stereoisomers, that is, both the stereomerically pure form (e.g.,
geometrically pure, enantiomerically pure, or diastereomerically
pure) and enantiomeric and stereoisomeric mixtures, e.g.,
racemates. Enantiomeric and stereoisomeric mixtures of compounds of
the disclosure can typically be resolved into their component
enantiomers or stereoisomers by well-known methods, such as
chiral-phase gas chromatography, chiral-phase high performance
liquid chromatography, crystallizing the compound as a chiral salt
complex, or crystallizing the compound in a chiral solvent.
Enantiomers and stereoisomers can also be obtained from
stereomerically or enantiomerically pure intermediates, reagents,
and catalysts by well-known asymmetric synthetic methods.
[1547] In vitro: As used herein, the term "in vitro" refers to
events that occur in an artificial environment, e.g., in a test
tube or reaction vessel, in cell culture, in a Petri dish, etc.,
rather than within an organism (e.g., animal, plant, or
microbe).
[1548] In vivo: As used herein, the term "in vivo" refers to events
that occur within an organism (e.g., animal, plant, or microbe or
cell or tissue thereof).
[1549] Isolated: As used herein, the term "isolated" refers to a
substance or entity that has been separated from at least some of
the components with which it was associated (whether in nature or
in an experimental setting). Isolated substances can have varying
levels of purity in reference to the substances from which they
have been associated. Isolated substances and/or entities can be
separated from at least about 10%, about 20%, about 30%, about 40%,
about 50%, about 60%, about 70%, about 80%, about 90%, or more of
the other components with which they were initially associated. In
some embodiments, isolated agents are more than about 80%, about
85%, about 90%, about 91%, about 92%, about 93%, about 94%, about
95%, about 96%, about 97%, about 98%, about 99%, or more than about
99% pure. As used herein, a substance is "pure" if it is
substantially free of other components. Substantially isolated: By
"substantially isolated" is meant that the compound is
substantially separated from the environment in which it was formed
or detected. Partial separation can include, for example, a
composition enriched in the compound of the present disclosure.
Substantial separation can include compositions containing at least
about 50%, at least about 60%, at least about 70%, at least about
80%, at least about 90%, at least about 95%, at least about 97%, or
at least about 99% by weight of the compound of the present
disclosure, or salt thereof.
[1550] A polynucleotide, vector, polypeptide, cell, or any
composition disclosed herein that is "isolated" is a
polynucleotide, vector, polypeptide, cell, or composition that is
in a form not found in nature. Isolated polynucleotides, vectors,
polypeptides, or compositions include those that have been purified
to a degree that they are no longer in a form in which they are
found in nature. In some aspects, a polynucleotide, vector,
polypeptide, or composition that is isolated is substantially
pure.
[1551] Linker: As used herein, a "linker" refers to a group of
atoms, e.g., 10-1,000 atoms, and can be comprised of the atoms or
groups such as, but not limited to, carbon, amino, alkylamino,
oxygen, sulfur, sulfoxide, sulfonyl, carbonyl, and imine. The
linker can be attached to a modified nucleoside or nucleotide on
the nucleobase or sugar moiety at a first end, and to a payload,
e.g., a detectable or therapeutic agent, at a second end. The
linker can be of sufficient length as to not interfere with
incorporation into a nucleic acid sequence. The linker can be used
for any useful purpose, such as to form polynucleotide multimers
(e.g., through linkage of two or more chimeric polynucleotides
molecules or IVT polynucleotides) or polynucleotides conjugates, as
well as to administer a payload, as described herein. Examples of
chemical groups that can be incorporated into the linker include,
but are not limited to, alkyl, alkenyl, alkynyl, amido, amino,
ether, thioether, ester, alkylene, heteroalkylene, aryl, or
heterocyclyl, each of which can be optionally substituted, as
described herein. Examples of linkers include, but are not limited
to, unsaturated alkanes, polyethylene glycols (e.g., ethylene or
propylene glycol monomeric units, e.g., diethylene glycol,
dipropylene glycol, triethylene glycol, tripropylene glycol,
tetraethylene glycol, or tetraethylene glycol), and dextran
polymers and derivatives thereof., Other examples include, but are
not limited to, cleavable moieties within the linker, such as, for
example, a disulfide bond (--S--S--) or an azo bond (--N.dbd.N--),
which can be cleaved using a reducing agent or photolysis.
Non-limiting examples of a selectively cleavable bond include an
amido bond can be cleaved for example by the use of
tris(2-carboxyethyl)phosphine (TCEP), or other reducing agents,
and/or photolysis, as well as an ester bond can be cleaved for
example by acidic or basic hydrolysis.
[1552] MCM Associated Disease: As used herein, an "MCM-associated
disease" or "MCM-associated disorder" refers to diseases or
disorders, respectively, which results from aberrant MCM activity
(e.g., decreased activity or increased activity). As a non-limiting
example, methylmalonic acidemia an MCM-associated disease.
[1553] Mitochondrial transit peptide: As used herein, the terms
"mitochondrial transit peptide," "mitochondrial targeting peptide,"
and "mitochondrial targeting sequence" refer to an amino acid
sequence (or a polynucleotide encoding such an amino acid sequence)
that is a part of a larger polypeptide, where that sequence directs
the transport or localization of the larger polypeptide to
mitochondria.
[1554] Modified: As used herein "modified" refers to a changed
state or structure of a molecule of the disclosure. Molecules can
be modified in many ways including chemically, structurally, and
functionally. In some embodiments, the mRNA molecules of the
present disclosure are modified by the introduction of non-natural
nucleosides and/or nucleotides, e.g., as it relates to the natural
ribonucleotides A, U, G, and C. Noncanonical nucleotides such as
the cap structures are not considered "modified" although they
differ from the chemical structure of the A, C, G, U
ribonucleotides.
[1555] Mucus: As used herein, "mucus" refers to the natural
substance that is viscous and comprises mucin glycoproteins.
[1556] Naturally occurring: As used herein, "naturally occurring"
means existing in nature without artificial aid.
[1557] Non-human vertebrate: As used herein, a "non-human
vertebrate" includes all vertebrates except Homo sapiens, including
wild and domesticated species. Examples of non-human vertebrates
include, but are not limited to, mammals, such as alpaca, banteng,
bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea
pig, horse, llama, mule, pig, rabbit, reindeer, sheep water
buffalo, and yak.
[1558] Nucleic acid sequence: The terms "nucleic acid sequence" and
"nucleotide sequence" are used interchangeably and refer to a
contiguous nucleic acid sequence. The sequence can be either single
stranded or double stranded DNA or RNA, e.g., an mRNA.
[1559] The term "nucleic acid," in its broadest sense, includes any
compound and/or substance that comprises a polymer of nucleotides.
These polymers are often referred to as polynucleotides. Exemplary
nucleic acids or polynucleotides of the disclosure include, but are
not limited to, ribonucleic acids (RNAs), deoxyribonucleic acids
(DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs),
peptide nucleic acids (PNAs), locked nucleic acids (LNAs, including
LNA having a .beta.-D-ribo configuration, .alpha.-LNA having an
.alpha.-L-ribo configuration (a diastereomer of LNA), 2'-amino-LNA
having a 2'-amino functionalization, and 2'-amino-.alpha.-LNA
having a 2'-amino functionalization), ethylene nucleic acids (ENA),
cyclohexenyl nucleic acids (CeNA) or hybrids or combinations
thereof.
[1560] The phrase "nucleotide sequence encoding" and variants
thereof refers to the nucleic acid (e.g., an mRNA or DNA molecule)
coding sequence that comprises a nucleotide sequence that encodes a
polypeptide or functional fragment thereof as set forth herein. The
coding sequence can further include initiation and termination
signals operably linked to regulatory elements including a promoter
and polyadenylation signal capable of directing expression in the
cells of an individual or mammal to which the nucleic acid is
administered. The coding sequence can further include sequences
that encode signal peptides or targeting peptides, e.g.,
mitochondrial transit peptides.
[1561] Off-target: As used herein, "off target" refers to any
unintended effect on any one or more target, gene, or cellular
transcript.
[1562] Open reading frame: As used herein, "open reading frame" or
"ORF" refers to a sequence that does not contain a stop codon in a
given reading frame.
[1563] Operably linked: As used herein, the phrase "operably
linked" refers to a functional connection between two or more
molecules, constructs, transcripts, entities, moieties or the
like.
[1564] Optionally substituted: Herein a phrase of the form
"optionally substituted X" (e.g., optionally substituted alkyl) is
intended to be equivalent to "X, wherein X is optionally
substituted" (e.g., "alkyl, wherein said alkyl is optionally
substituted"). It is not intended to mean that the feature "X"
(e.g., alkyl) per se is optional.
[1565] Part: As used herein, a "part" or "region" of a
polynucleotide is defined as any portion of the polynucleotide that
is less than the entire length of the polynucleotide.
[1566] Peptide: As used herein, "peptide" is less than or equal to
50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45,
or 50 amino acids long.
[1567] Patient: As used herein, "patient" refers to a subject who
can seek or be in need of treatment, requires treatment, is
receiving treatment, will receive treatment, or a subject who is
under care by a trained professional for a particular disease or
condition.
[1568] Pharmaceutically acceptable: The phrase "pharmaceutically
acceptable" is employed herein to refer to those compounds,
materials, compositions, and/or dosage forms that are, within the
scope of sound medical judgment, suitable for use in contact with
the tissues of human beings and animals without excessive toxicity,
irritation, allergic response, or other problem or complication,
commensurate with a reasonable benefit/risk ratio.
[1569] Pharmaceutically acceptable excipients: The phrase
"pharmaceutically acceptable excipient," as used herein, refers any
ingredient other than the compounds described herein (for example,
a vehicle capable of suspending or dissolving the active compound)
and having the properties of being substantially nontoxic and
non-inflammatory in a patient. Excipients can include, for example:
antiadherents, antioxidants, binders, coatings, compression aids,
disintegrants, dyes (colors), emollients, emulsifiers, fillers
(diluents), film formers or coatings, flavors, fragrances, glidants
(flow enhancers), lubricants, preservatives, printing inks,
sorbents, suspensing or dispersing agents, sweeteners, and waters
of hydration. Exemplary excipients include, but are not limited to:
butylated hydroxytoluene (BHT), calcium carbonate, calcium
phosphate (dibasic), calcium stearate, croscarmellose, crosslinked
polyvinyl pyrrolidone, citric acid, crospovidone, cysteine,
ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl
methylcellulose, lactose, magnesium stearate, maltitol, mannitol,
methionine, methylcellulose, methyl paraben, microcrystalline
cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone,
pregelatinized starch, propyl paraben, retinyl palmitate, shellac,
silicon dioxide, sodium carboxymethyl cellulose, sodium citrate,
sodium starch glycolate, sorbitol, starch (corn), stearic acid,
sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C,
and xylitol.
[1570] Pharmaceutically acceptable salts: The present disclosure
also includes pharmaceutically acceptable salts of the compounds
described herein. As used herein, "pharmaceutically acceptable
salts" refers to derivatives of the disclosed compounds wherein the
parent compound is modified by converting an existing acid or base
moiety to its salt form (e.g., by reacting the free base group with
a suitable organic acid). Examples of pharmaceutically acceptable
salts include, but are not limited to, mineral or organic acid
salts of basic residues such as amines; alkali or organic salts of
acidic residues such as carboxylic acids; and the like.
Representative acid addition salts include acetate, acetic acid,
adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzene
sulfonic acid, benzoate, bisulfate, borate, butyrate, camphorate,
camphorsulfonate, citrate, cyclopentanepropionate, digluconate,
dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate,
glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide,
hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate,
lactobionate, lactate, laurate, lauryl sulfate, malate, maleate,
malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate,
nitrate, oleate, oxalate, palmitate, pamoate, pectinate,
persulfate, 3-phenylpropionate, phosphate, picrate, pivalate,
propionate, stearate, succinate, sulfate, tartrate, thiocyanate,
toluenesulfonate, undecanoate, valerate salts, and the like.
Representative alkali or alkaline earth metal salts include sodium,
lithium, potassium, calcium, magnesium, and the like, as well as
nontoxic ammonium, quaternary ammonium, and amine cations,
including, but not limited to ammonium, tetramethylammonium,
tetraethylammonium, methylamine, dimethylamine, trimethylamine,
triethylamine, ethylamine, and the like. The pharmaceutically
acceptable salts of the present disclosure include the conventional
non-toxic salts of the parent compound formed, for example, from
non-toxic inorganic or organic acids. The pharmaceutically
acceptable salts of the present disclosure can be synthesized from
the parent compound that contains a basic or acidic moiety by
conventional chemical methods. Generally, such salts can be
prepared by reacting the free acid or base forms of these compounds
with a stoichiometric amount of the appropriate base or acid in
water or in an organic solvent, or in a mixture of the two;
generally, nonaqueous media like ether, ethyl acetate, ethanol,
isopropanol, or acetonitrile are used. Lists of suitable salts are
found in Remington's Pharmaceutical Sciences, 17.sup.th ed., Mack
Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical
Salts: Properties, Selection, and Use, P. H. Stahl and C. G.
Wermuth (eds.), Wiley-VCH, 2008, and Berge et al., Journal of
Pharmaceutical Science, 66, 1-19 (1977), each of which is
incorporated herein by reference in its entirety.
[1571] Pharmaceutically acceptable solvate: The term
"pharmaceutically acceptable solvate," as used herein, means a
compound of the disclosure wherein molecules of a suitable solvent
are incorporated in the crystal lattice. A suitable solvent is
physiologically tolerable at the dosage administered. For example,
solvates can be prepared by crystallization, recrystallization, or
precipitation from a solution that includes organic solvents,
water, or a mixture thereof. Examples of suitable solvents are
ethanol, water (for example, mono-, di-, and tri-hydrates),
N-methylpyrrolidinone (NMP), dimethyl sulfoxide (DMSO),
N,N'-dimethylformamide (DMF), N,N'-dimethylacetamide (DMAC),
1,3-dimethyl-2-imidazolidinone (DMEU),
1,3-dimethyl-3,4,5,6-tetrahydro-2-(1H)-pyrimidinone (DMPU),
acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl
alcohol, 2-pyrrolidone, benzyl benzoate, and the like. When water
is the solvent, the solvate is referred to as a "hydrate."
[1572] Pharmacokinetic: As used herein, "pharmacokinetic" refers to
any one or more properties of a molecule or compound as it relates
to the determination of the fate of substances administered to a
living organism. Pharmacokinetics is divided into several areas
including the extent and rate of absorption, distribution,
metabolism and excretion. This is commonly referred to as ADME
where: (A) Absorption is the process of a substance entering the
blood circulation; (D) Distribution is the dispersion or
dissemination of substances throughout the fluids and tissues of
the body; (M) Metabolism (or Biotransformation) is the irreversible
transformation of parent compounds into daughter metabolites; and
(E) Excretion (or Elimination) refers to the elimination of the
substances from the body. In rare cases, some drugs irreversibly
accumulate in body tissue.
[1573] Physicochemical: As used herein, "physicochemical" means of
or relating to a physical and/or chemical property.
[1574] Polynucleotide: The term "polynucleotide" as used herein
refers to polymers of nucleotides of any length, including
ribonucleotides, deoxyribonucleotides, analogs thereof, or mixtures
thereof. This term refers to the primary structure of the molecule.
Thus, the term includes triple-, double- and single-stranded
deoxyribonucleic acid ("DNA"), as well as triple-, double- and
single-stranded ribonucleic acid ("RNA"). It also includes
modified, for example by alkylation, and/or by capping, and
unmodified forms of the polynucleotide. More particularly, the term
"polynucleotide" includes polydeoxyribonucleotides (containing
2-deoxy-D-ribose), polyribonucleotides (containing D-ribose),
including tRNA, rRNA, hRNA, siRNA and mRNA, whether spliced or
unspliced, any other type of polynucleotide that is an N- or
C-glycoside of a purine or pyrimidine base, and other polymers
containing normucleotidic backbones, for example, polyamide (e.g.,
peptide nucleic acids "PNAs") and polymorpholino polymers, and
other synthetic sequence-specific nucleic acid polymers providing
that the polymers contain nucleobases in a configuration that
allows for base pairing and base stacking, such as is found in DNA
and RNA. In particular aspects, the polynucleotide comprises an
mRNA. In other aspect, the mRNA is a synthetic mRNA. In some
aspects, the synthetic mRNA comprises at least one unnatural
nucleobase. In some aspects, all nucleobases of a certain class
have been replaced with unnatural nucleobases (e.g., all uridines
in a polynucleotide disclosed herein can be replaced with an
unnatural nucleobase, e.g., 5-methoxyuridine). In some aspects, the
polynucleotide (e.g., a synthetic RNA or a synthetic DNA) comprises
only natural nucleobases, i.e., A, C, T and U in the case of a
synthetic DNA, or A, C, T, and U in the case of a synthetic
RNA.
[1575] The skilled artisan will appreciate that the T bases in the
codon maps disclosed herein are present in DNA, whereas the T bases
would be replaced by U bases in corresponding RNAs. For example, a
codon-nucleotide sequence disclosed herein in DNA form, e.g., a
vector or an in-vitro translation (IVT) template, would have its T
bases transcribed as U based in its corresponding transcribed mRNA.
In this respect, both sequence-optimized DNA sequences (comprising
T) and their corresponding RNA sequences (comprising U) are
considered sequence-optimized nucleotide sequence of the present
disclosure. A skilled artisan would also understand that equivalent
codon-maps can be generated by replaced one or more bases with
non-natural bases. Thus, e.g., a TTC codon (DNA map) would
correspond to a UUC codon (RNA map), which in turn would correspond
to a .PSI..PSI.C codon (RNA map in which U has been replaced with
pseudouridine).
[1576] Standard A-T and G-C base pairs form under conditions that
allow the formation of hydrogen bonds between the N3-H and C4-oxy
of thymidine and the N1 and C6-NH2, respectively, of adenosine and
between the C2-oxy, N3 and C4-NH2, of cytidine and the C2-NH2,
N'--H and C6-oxy, respectively, of guanosine. Thus, for example,
guanosine (2-amino-6-oxy-9-.beta.-D-ribofuranosyl-purine) can be
modified to form isoguanosine
(2-oxy-6-amino-9-.beta.-D-ribofuranosyl-purine). Such modification
results in a nucleoside base that will no longer effectively form a
standard base pair with cytosine. However, modification of cytosine
(1-.beta.-D-ribofuranosyl-2-oxy-4-amino-pyrimidine) to form
isocytosine (1-.beta.-D-ribofuranosyl-2-amino-4-oxy-pyrimidine-)
results in a modified nucleotide that will not effectively base
pair with guanosine but will form a base pair with isoguanosine
(U.S. Pat. No. 5,681,702 to Collins et al., hereby incorporated by
reference in its entirety). Isocytosine is available from Sigma
Chemical Co. (St. Louis, Mo.); isocytidine can be prepared by the
method described by Switzer et al. (1993) Biochemistry
32:10489-10496 and references cited therein;
2'-deoxy-5-methyl-isocytidine can be prepared by the method of Tor
et al., 1993, J. Am. Chem. Soc. 115:4461-4467 and references cited
therein; and isoguanine nucleotides can be prepared using the
method described by Switzer et al., 1993, supra, and Mantsch et
al., 1993, Biochem. 14:5593-5601, or by the method described in
U.S. Pat. No. 5,780,610 to Collins et al., each of which is hereby
incorporated by reference in its entirety. Other nonnatural base
pairs can be synthesized by the method described in Piccirilli et
al., 1990, Nature 343:33-37, hereby incorporated by reference in
its entirety, for the synthesis of 2,6-diaminopyrimidine and its
complement (1-methylpyrazolo-[4,3]pyrimidine-5,7-(4H,6H)-dione.
Other such modified nucleotide units that form unique base pairs
are known, such as those described in Leach et al. (1992) J. Am.
Chem. Soc. 114:3675-3683 and Switzer et al., supra.
[1577] Polypeptide: As used herein, "polypeptide" means a polymer
of amino acid residues (natural or unnatural) linked together most
often by peptide bonds. The term, as used herein, refers to
proteins, polypeptides, and peptides of any size, structure, or
function. Thus, polypeptides include gene products, naturally
occurring polypeptides, synthetic polypeptides, homologs,
orthologs, paralogs, fragments and other equivalents, variants, and
analogs of the foregoing. A polypeptide can be a single molecule or
can be a multi-molecular complex such as a dimer, trimer or
tetramer. They can also comprise single chain or multichain
polypeptides and can be associated or linked. Most commonly
disulfide linkages are found in multichain polypeptides. The term
polypeptide can also apply to amino acid polymers in which one or
more amino acid residues are an artificial chemical analogue of a
corresponding naturally occurring amino acid.
[1578] The term polypeptide encompasses an amino acid polymer that
has been modified naturally or by intervention; for example,
disulfide bond formation, glycosylation, lipidation, acetylation,
phosphorylation, or any other manipulation or modification, such as
conjugation with a labeling component. Also included within the
definition are, for example, polypeptides containing one or more
analogs of an amino acid (including, for example, unnatural amino
acids such as homocysteine, ornithine, p-acetylphenylalanine,
D-amino acids, and creatine), as well as other modifications known
in the art.
[1579] Polypeptide variant: As used herein, the term "polypeptide
variant" refers to molecules that differ in their amino acid
sequence from a native or reference sequence. The amino acid
sequence variants can possess substitutions, deletions, and/or
insertions at certain positions within the amino acid sequence, as
compared to a native or reference sequence. Ordinarily, variants
will possess at least about 50% identity (homology), at least about
60% identity, at least about 70% identity, at least about 80%
identity, at least about 90% identity, at least about 95% identity,
at least about 99% identity to a native or reference sequence. In
some embodiments, they will be at least about 80%, or at least
about 90% identical (homologous) to a native or reference
sequence.
[1580] Polypeptide per unit drug (PUD): As used herein, a PUD or
product per unit drug, is defined as a subdivided portion of total
daily dose, usually 1 mg, pg, kg, etc., of a product (such as a
polypeptide) as measured in body fluid or tissue, usually defined
in concentration such as pmol/mL, mmol/mL, etc. divided by the
measure in the body fluid.
[1581] Preventing: As used herein, the term "preventing" refers to
partially or completely delaying onset of an infection, disease,
disorder and/or condition; partially or completely delaying onset
of one or more symptoms, features, or clinical manifestations of a
particular infection, disease, disorder, and/or condition;
partially or completely delaying onset of one or more symptoms,
features, or manifestations of a particular infection, disease,
disorder, and/or condition; partially or completely delaying
progression from an infection, a particular disease, disorder
and/or condition; and/or decreasing the risk of developing
pathology associated with the infection, the disease, disorder,
and/or condition.
[1582] Prodrug: The present disclosure also includes prodrugs of
the compounds described herein. As used herein, "prodrugs" refer to
any substance, molecule or entity that is in a form predicate for
that substance, molecule or entity to act as a therapeutic upon
chemical or physical alteration. Prodrugs can by covalently bonded
or sequestered in some way and that release or are converted into
the active drug moiety prior to, upon or after administered to a
mammalian subject. Prodrugs can be prepared by modifying functional
groups present in the compounds in such a way that the
modifications are cleaved, either in routine manipulation or in
vivo, to the parent compounds. Prodrugs include compounds wherein
hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any
group that, when administered to a mammalian subject, cleaves to
form a free hydroxyl, amino, sulfhydryl, or carboxyl group
respectively. Preparation and use of prodrugs is discussed in T.
Higuchi and V. Stella, "Pro-drugs as Novel Delivery Systems," Vol.
14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in
Drug Design, ed. Edward B. Roche, American Pharmaceutical
Association and Pergamon Press, 1987, both of which are hereby
incorporated by reference in their entirety.
[1583] Proliferate: As used herein, the term "proliferate" means to
grow, expand or increase or cause to grow, expand or increase
rapidly. "Proliferative" means having the ability to proliferate.
"Anti-proliferative" means having properties counter to or
inapposite to proliferative properties.
[1584] Prophylactic: As used herein, "prophylactic" refers to a
therapeutic or course of action used to prevent the spread of
disease.
[1585] Prophylaxis: As used herein, a "prophylaxis" refers to a
measure taken to maintain health and prevent the spread of disease.
An "immune phrophylaxis" refers to a measure to produce active or
passive immunity to prevent the spread of disease.
[1586] Protein cleavage site: As used herein, "protein cleavage
site" refers to a site where controlled cleavage of the amino acid
chain can be accomplished by chemical, enzymatic or photochemical
means.
[1587] Protein cleavage signal: As used herein "protein cleavage
signal" refers to at least one amino acid that flags or marks a
polypeptide for cleavage.
[1588] Protein of interest: As used herein, the terms "proteins of
interest" or "desired proteins" include those provided herein and
fragments, mutants, variants, and alterations thereof.
[1589] Proximal: As used herein, the term "proximal" means situated
nearer to the center or to a point or region of interest.
[1590] Pseudouridine: As used herein, pseudouridine refers to the
C-glycoside isomer of the nucleoside uridine. A "pseudouridine
analog" is any modification, variant, isoform or derivative of
pseudouridine. For example, pseudouridine analogs include but are
not limited to 1-carboxymethyl-pseudouridine,
1-propynyl-pseudouridine, 1-taurinomethyl-pseudouridine,
1-taurinomethyl-4-thio-pseudouridine, 1-methylpseudouridine
(m.sup.1.psi.), 1-methyl-4-thio-pseudouridine
(m.sup.1s.sup.4.psi.), 4-thio-1-methyl-pseudouridine,
3-methyl-pseudouridine (m.sup.3.psi.),
2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-1-deaza-pseudouridine, dihydropseudouridine,
2-thio-dihydropseudouridine, 2-methoxyuridine,
2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine,
4-methoxy-2-thio-pseudouridine, N1-methyl-pseudouridine,
1-methyl-3-(3-amino-3-carboxypropyl)pseudouridine (acp.sup.3.psi.),
and 2'-O-methyl-pseudouridine (.psi.m).
[1591] Purified: As used herein, "purify," "purified,"
"purification" means to make substantially pure or clear from
unwanted components, material defilement, admixture or
imperfection.
[1592] Repeated transfection: As used herein, the term "repeated
transfection" refers to transfection of the same cell culture with
a polynucleotide a plurality of times. The cell culture can be
transfected at least twice, at least 3 times, at least 4 times, at
least 5 times, at least 6 times, at least 7 times, at least 8
times, at least 9 times, at least 10 times, at least 11 times, at
least 12 times, at least 13 times, at least 14 times, at least 15
times, at least 16 times, at least 17 times at least 18 times, at
least 19 times, at least 20 times, at least 25 times, at least 30
times, at least 35 times, at least 40 times, at least 45 times, at
least 50 times or more.
[1593] Sample: As used herein, the term "sample" or "biological
sample" refers to a subset of its tissues, cells or component parts
(e.g., body fluids, including but not limited to blood, mucus,
lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva,
amniotic fluid, amniotic cord blood, urine, vaginal fluid and
semen). A sample further can include a homogenate, lysate or
extract prepared from a whole organism or a subset of its tissues,
cells or component parts, or a fraction or portion thereof,
including but not limited to, for example, plasma, serum, spinal
fluid, lymph fluid, the external sections of the skin, respiratory,
intestinal, and genitourinary tracts, tears, saliva, milk, blood
cells, tumors, organs. A sample further refers to a medium, such as
a nutrient broth or gel, which can contain cellular components,
such as proteins or nucleic acid molecule.
[1594] Signal Sequences: As used herein, the phrase "signal
sequences" refers to a sequence that can direct the transport or
localization of a protein.
[1595] Single unit dose: As used herein, a "single unit dose" is a
dose of any therapeutic administered in one dose/at one time/single
route/single point of contact, i.e., single administration
event.
[1596] Similarity: As used herein, the term "similarity" refers to
the overall relatedness between polymeric molecules, e.g., between
polynucleotide molecules (e.g., DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. Calculation of percent
similarity of polymeric molecules to one another can be performed
in the same manner as a calculation of percent identity, except
that calculation of percent similarity takes into account
conservative substitutions as is understood in the art.
[1597] Split dose: As used herein, a "split dose" is the division
of single unit dose or total daily dose into two or more doses.
[1598] Stable: As used herein "stable" refers to a compound that is
sufficiently robust to survive isolation to a useful degree of
purity from a reaction mixture, and in some cases capable of
formulation into an efficacious therapeutic agent.
[1599] Stabilized: As used herein, the term "stabilize,"
"stabilized," "stabilized region" means to make or become
stable.
[1600] Stereoisomer: As used herein, the term "stereoisomer" refers
to all possible different isomeric as well as conformational forms
that a compound can possess (e.g., a compound of any formula
described herein), in particular all possible stereochemically and
conformationally isomeric forms, all diastereomers, enantiomers
and/or conformers of the basic molecular structure. Some compounds
of the present disclosure can exist in different tautomeric forms,
all of the latter being included within the scope of the present
disclosure.
[1601] Subject: As used herein, the term "subject" or "patient"
refers to any organism to which a composition in accordance with
the disclosure can be administered, e.g., for experimental,
diagnostic, prophylactic, and/or therapeutic purposes. Typical
subjects include animals (e.g., mammals such as mice, rats,
rabbits, non-human primates, and humans).
[1602] Substantially: As used herein, the term "substantially"
refers to the qualitative condition of exhibiting total or
near-total extent or degree of a characteristic or property of
interest. One of ordinary skill in the biological arts will
understand that biological and chemical phenomena rarely, if ever,
go to completion and/or proceed to completeness or achieve or avoid
an absolute result. The term "substantially" is therefore used
herein to capture the potential lack of completeness inherent in
many biological and chemical phenomena.
[1603] Substantially equal: As used herein as it relates to time
differences between doses, the term means plus/minus 2%.
[1604] Substantially simultaneously: As used herein and as it
relates to plurality of doses, the term means within 2 seconds.
[1605] Suffering from: An individual who is "suffering from" a
disease, disorder, and/or condition has been diagnosed with or
displays one or more symptoms of a disease, disorder, and/or
condition.
[1606] Susceptible to: An individual who is "susceptible to" a
disease, disorder, and/or condition has not been diagnosed with
and/or can not exhibit symptoms of the disease, disorder, and/or
condition but harbors a propensity to develop a disease or its
symptoms. In some embodiments, an individual who is susceptible to
a disease, disorder, and/or condition (for example, cancer) can be
characterized by one or more of the following: (1) a genetic
mutation associated with development of the disease, disorder,
and/or condition; (2) a genetic polymorphism associated with
development of the disease, disorder, and/or condition; (3)
increased and/or decreased expression and/or activity of a protein
and/or nucleic acid associated with the disease, disorder, and/or
condition; (4) habits and/or lifestyles associated with development
of the disease, disorder, and/or condition; (5) a family history of
the disease, disorder, and/or condition; and (6) exposure to and/or
infection with a microbe associated with development of the
disease, disorder, and/or condition. In some embodiments, an
individual who is susceptible to a disease, disorder, and/or
condition will develop the disease, disorder, and/or condition. In
some embodiments, an individual who is susceptible to a disease,
disorder, and/or condition will not develop the disease, disorder,
and/or condition.
[1607] Sustained release: As used herein, the term "sustained
release" refers to a pharmaceutical composition or compound release
profile that conforms to a release rate over a specific period of
time.
[1608] Synthetic: The term "synthetic" means produced, prepared,
and/or manufactured by the hand of man. Synthesis of
polynucleotides or polypeptides or other molecules of the present
disclosure can be chemical or enzymatic.
[1609] Targeted Cells: As used herein, "targeted cells" refers to
any one or more cells of interest. The cells can be found in vitro,
in vivo, in situ or in the tissue or organ of an organism. The
organism can be an animal, for example a mammal, a human or a
patient.
[1610] Targeting sequence: As used herein, the phrase "targeting
sequence" refers to a sequence that can direct the transport or
localization of a protein.
[1611] Therapeutic Agent: The term "therapeutic agent" refers to
any agent that, when administered to a subject, has a therapeutic,
diagnostic, and/or prophylactic effect and/or elicits a desired
biological and/or pharmacological effect.
[1612] Therapeutically effective amount: As used herein, the term
"therapeutically effective amount" means an amount of an agent to
be delivered (e.g., nucleic acid, drug, therapeutic agent,
diagnostic agent, prophylactic agent, etc.) that is sufficient,
when administered to a subject suffering from or susceptible to an
infection, disease, disorder, and/or condition, to treat, improve
symptoms of, diagnose, prevent, and/or delay the onset of the
infection, disease, disorder, and/or condition.
[1613] Therapeutically effective outcome: As used herein, the term
"therapeutically effective outcome" means an outcome that is
sufficient in a subject suffering from or susceptible to an
infection, disease, disorder, and/or condition, to treat, improve
symptoms of, diagnose, prevent, and/or delay the onset of the
infection, disease, disorder, and/or condition.
[1614] Total daily dose: As used herein, a "total daily dose" is an
amount given or prescribed in 24 hr. period. It can be administered
as a single unit dose.
[1615] Transcription factor: As used herein, the term
"transcription factor" refers to a DNA-binding protein that
regulates transcription of DNA into RNA, for example, by activation
or repression of transcription. Some transcription factors effect
regulation of transcription alone, while others act in concert with
other proteins. Some transcription factor can both activate and
repress transcription under certain conditions. In general,
transcription factors bind a specific target sequence or sequences
highly similar to a specific consensus sequence in a regulatory
region of a target gene. Transcription factors can regulate
transcription of a target gene alone or in a complex with other
molecules.
[1616] Transcription: As used herein, the term "transcription"
refers to methods to introduce exogenous nucleic acids into a cell.
Methods of transfection include, but are not limited to, chemical
methods, physical treatments and cationic lipids or mixtures.
[1617] Treating: As used herein, the terms "treating" or
"treatment" or "therapy" refers to partially or completely
alleviating, ameliorating, improving, relieving, delaying onset of,
inhibiting progression of, reducing severity of, and/or reducing
incidence of one or more symptoms or features of a particular
infection, disease, disorder, and/or condition. Treatment can be
administered to a subject who does not exhibit signs of a disease,
disorder, and/or condition and/or to a subject who exhibits only
early signs of a disease, disorder, and/or condition for the
purpose of decreasing the risk of developing pathology associated
with the disease, disorder, and/or condition.
[1618] Unmodified: As used herein, "unmodified" refers to any
substance, compound or molecule prior to being changed in any way.
Unmodified may, but does not always, refer to the wild type or
native form of a biomolecule. Molecules can undergo a series of
modifications whereby each modified molecule can serve as the
"unmodified" starting molecule for a subsequent modification.
[1619] Viral protein: As used herein, the phrase "viral protein"
means any protein originating from a virus.
X. Cross-Reference to Related Applications
[1620] This application claims priority to U.S. Provisional Patent
Application No. 62/269,089 filed Dec. 17, 2015, entitled
Polynucleotides Encoding Methylmalonyl-CoA Mutase; U.S. Provisional
Patent Application No. 62/269,092 filed Dec. 17, 2015, entitled
Methods of Using MCM-Enconding Polynucleotides; U.S. Provisional
Patent Application No. 62/273,112 filed Dec. 30, 2015, entitled
Polynucleotides Encoding Methylmalonyl-CoA Mutase; U.S. Provisional
Patent Application No. 62/273,108 filed Dec. 30, 2015, entitled
Methods of Using MCM-Enconding Polynucleotides; U.S. Provisional
Patent Application No. 62/274,727 filed Jan. 4, 2016, entitled
Polynucleotides Encoding Methylmalonyl-CoA Mutase; U.S. Provisional
Patent Application No. 62/274,733 filed Jan. 4, 2016, entitled
Methods of Using MCM-Enconding Polynucleotides; U.S. Provisional
Patent Application No. 62/274,722 filed Jan. 4, 2016, entitled
Polynucleotides Encoding Methylmalonyl-CoA Mutase; U.S. Provisional
Patent Application No. 62/274,726 filed Jan. 4, 2016, entitled
Methods of Using MCM-Enconding Polynucleotides; U.S. Provisional
Patent Application No. 62/338,478 filed Can 18, 2016, entitled
Polynucleotides Encoding Methylmalonyl-CoA Mutase; U.S. Provisional
Patent Application No. 62/338,456 filed Can 18, 2016, entitled
Polynucleotides Encoding Methylmalonyl-CoA Mutase; and U.S.
Provisional Patent Application No. 62/409,343 filed Oct. 14, 2016,
entitled Polynucleotides Encoding Methylmalonyl-CoA Mutase, the
contents of each of which are herein incorporated by reference in
its entirety.
XI. Reference to Sequence Listing Submitted Electronically
[1621] The content of the electronically submitted sequence listing
(Name: "3529_052PC07_SeqListing_ST25.txt"; Size: 1,080,572 bytes;
and date of creation: Dec. 16, 2016) filed herewith the application
is incorporated by reference in its entirety.
XII. Equivalents and Scope
[1622] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments in accordance with the
disclosure described herein. The scope of the present disclosure is
not intended to be limited to the above Description, but rather is
as set forth in the appended claims.
[1623] In the claims, articles such as "a," "an," and "the" can
mean one or more than one unless indicated to the contrary or
otherwise evident from the context. Claims or descriptions that
include "or" between one or more members of a group are considered
satisfied if one, more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process unless indicated to the contrary or otherwise evident
from the context. The disclosure includes embodiments in which
exactly one member of the group is present in, employed in, or
otherwise relevant to a given product or process. The disclosure
includes embodiments in which more than one, or all of the group
members are present in, employed in, or otherwise relevant to a
given product or process.
[1624] It is also noted that the term "comprising" is intended to
be open and permits but does not require the inclusion of
additional elements or steps. When the term "comprising" is used
herein, the term "consisting of" is thus also encompassed and
disclosed.
[1625] Where ranges are given, endpoints are included. Furthermore,
it is to be understood that unless otherwise indicated or otherwise
evident from the context and understanding of one of ordinary skill
in the art, values that are expressed as ranges can assume any
specific value or subrange within the stated ranges in different
embodiments of the disclosure, to the tenth of the unit of the
lower limit of the range, unless the context clearly dictates
otherwise.
[1626] In addition, it is to be understood that any particular
embodiment of the present disclosure that falls within the prior
art can be explicitly excluded from any one or more of the claims.
Since such embodiments are deemed to be known to one of ordinary
skill in the art, they can be excluded even if the exclusion is not
set forth explicitly herein. Any particular embodiment of the
compositions of the disclosure (e.g., any nucleic acid or protein
encoded thereby; any method of production; any method of use; etc.)
can be excluded from any one or more claims, for any reason,
whether or not related to the existence of prior art.
[1627] All cited sources, for example, references, publications,
databases, database entries, and art cited herein, are incorporated
into this application by reference, even if not expressly stated in
the citation. In case of conflicting statements of a cited source
and the instant application, the statement in the instant
application shall control.
[1628] Section and table headings are not intended to be
limiting.
EXAMPLES
Example 1
Chimeric Polynucleotide Synthesis
Triphosphate Route
[1629] Two regions or parts of a chimeric polynucleotide can be
joined or ligated using triphosphate chemistry. According to this
method, a first region or part of 100 nucleotides or less can be
chemically synthesized with a 5' monophosphate and terminal 3'desOH
or blocked OH. If the region is longer than 80 nucleotides, it can
be synthesized as two strands for ligation.
[1630] If the first region or part is synthesized as a
non-positionally modified region or part using in vitro
transcription (IVT), conversion the 5'monophosphate with subsequent
capping of the 3' terminus can follow. Monophosphate protecting
groups can be selected from any of those known in the art.
[1631] The second region or part of the chimeric polynucleotide can
be synthesized using either chemical synthesis or IVT methods. IVT
methods can include an RNA polymerase that can utilize a primer
with a modified cap. Alternatively, a cap of up to 80 nucleotides
can be chemically synthesized and coupled to the IVT region or
part.
[1632] It is noted that for ligation methods, ligation with DNA T4
ligase, followed by treatment with DNAse should readily avoid
concatenation.
[1633] The entire chimeric polynucleotide need not be manufactured
with a phosphate-sugar backbone. If one of the regions or parts
encodes a polypeptide, then such region or part can comprise a
phosphate-sugar backbone.
[1634] Ligation can then be performed using any known click
chemistry, orthoclick chemistry, solulink, or other bioconjugate
chemistries known to those in the art.
Synthetic Route
[1635] The chimeric polynucleotide can be made using a series of
starting segments. Such segments include: [1636] (a) Capped and
protected 5' segment comprising a normal 3'OH (SEG. 1) [1637] (b)
5' triphosphate segment which can include the coding region of a
polypeptide and comprising a normal 3'OH (SEG. 2) [1638] (c) 5'
monophosphate segment for the 3' end of the chimeric polynucleotide
(e.g., the tail) comprising cordycepin or no 3'OH (SEG. 3)
[1639] After synthesis (chemical or IVT), segment 3 (SEG. 3) can be
treated with cordycepin and then with pyrophosphatase to create the
5'monophosphate.
[1640] Segment 2 (SEG. 2) can then be ligated to SEG. 3 using RNA
ligase. The ligated polynucleotide can then be purified and treated
with pyrophosphatase to cleave the diphosphate. The treated
SEG.2-SEG. 3 construct is then purified and SEG. 1 is ligated to
the 5' terminus. A further purification step of the chimeric
polynucleotide can be performed.
[1641] Where the chimeric polynucleotide encodes a polypeptide, the
ligated or joined segments can be represented as: 5'UTR (SEG. 1),
open reading frame or ORF (SEG. 2) and 3'UTR+PolyA (SEG. 3).
[1642] The yields of each step can be as much as 90-95%.
Example 2
PCR for cDNA Production
[1643] PCR procedures for the preparation of cDNA can be performed
using 2.times. KAPA HIFI.TM. HotStart ReadyMix by Kapa Biosystems
(Woburn, Mash.). This system includes 2.times. KAPA ReadyMix12.5
.mu.l; Forward Primer (10 .mu.M) 0.75 .mu.l; Reverse Primer (10
.mu.M) 0.75 .mu.l; Template cDNA-100 ng; and dH.sub.20 diluted to
25.0 .mu.l. The PCR reaction conditions can be: at 95.degree. C.
for 5 min. and 25 cycles of 98.degree. C. for 20 sec, then
58.degree. C. for 15 sec, then 72.degree. C. for 45 sec, then
72.degree. C. for 5 min. then 4.degree. C. to termination.
[1644] The reverse primer of the instant disclosure can incorporate
a poly-T.sub.120 for a poly-A.sub.120 in the mRNA. Other reverse
primers with longer or shorter poly(T) tracts can be used to adjust
the length of the poly(A) tail in the polynucleotide mRNA.
[1645] The reaction can be cleaned up using Invitrogen's
PURELINK.TM. PCR Micro Kit (Carlsbad, Calif.) per manufacturer's
instructions (up to 5 .mu.g). Larger reactions will require a
cleanup using a product with a larger capacity. Following the
cleanup, the cDNA can be quantified using the NANODROP.TM. and
analyzed by agarose gel electrophoresis to confirm the cDNA is the
expected size. The cDNA can then be submitted for sequencing
analysis before proceeding to the in vitro transcription
reaction.
Example 3
In Vitro Transcription (IVT)
[1646] The in vitro transcription reactions can generate
polynucleotides containing uniformly modified polynucleotides. Such
uniformly modified polynucleotides can comprise a region or part of
the polynucleotides of the disclosure. The input nucleotide
triphosphate (NTP) mix can be made using natural and un-natural
NTPs.
[1647] A typical in vitro transcription reaction can include the
following: [1648] 1 Template cDNA--1.0 .mu.g [1649] 2 10.times.
transcription buffer (400 mM Tris-HCl pH 8.0, 190 mM MgCl.sub.2, 50
mM DTT, 10 mM Spermidine)--2.0 .mu.l [1650] 3 Custom NTPs (25 mM
each)--7.2 .mu.l [1651] 4 RNase Inhibitor--20 U [1652] 5 T7 RNA
polymerase--3000 U [1653] 6 dH.sub.20--Up to 20.0 .mu.l. and [1654]
7 Incubation at 37.degree. C. for 3 hr-5 hrs.
[1655] The crude IVT mix can be stored at 4.degree. C. overnight
for cleanup the next day. 1 U of RNase-free DNase can then be used
to digest the original template. After 15 minutes of incubation at
37.degree. C., the mRNA can be purified using Ambion's
MEGACLEAR.TM. Kit (Austin, Tex.) following the manufacturer's
instructions. This kit can purify up to 500 .mu.g of RNA. Following
the cleanup, the RNA can be quantified using the NanoDrop and
analyzed by agarose gel electrophoresis to confirm the RNA is the
proper size and that no degradation of the RNA has occurred.
Example 4
Enzymatic Capping
[1656] Capping of a polynucleotide can be performed with a mixture
includes: IVT RNA 60 .mu.g-180 .mu.g and dH.sub.20 up to 72 .mu.l.
The mixture can be incubated at 65.degree. C. for 5 minutes to
denature RNA, and then can be transferred immediately to ice.
[1657] The protocol can then involve the mixing of 10.times.
Capping Buffer (0.5 M Tris-HCl (pH 8.0), 60 mM KCl, 12.5 mM
MgCl.sub.2) (10.0 .mu.l); 20 mM GTP (5.0 .mu.l); 20 mM S-Adenosyl
Methionine (2.5 .mu.l); RNase Inhibitor (100 U);
2'-O-Methyltransferase (400 U); Vaccinia capping enzyme (Guanylyl
transferase) (40 U); dH.sub.20 (Up to 28 .mu.l); and incubation at
37.degree. C. for 30 minutes for 60 .mu.g RNA or up to 2 hours for
180 .mu.g of RNA.
[1658] The polynucleotide can then be purified using Ambion's
MEGACLEAR.TM. Kit (Austin, Tex.) following the manufacturer's
instructions. Following the cleanup, the RNA can be quantified
using the NANODROP.TM. (ThermoFisher, Waltham, Mass.) and analyzed
by agarose gel electrophoresis to confirm the RNA is the proper
size and that no degradation of the RNA has occurred. The RNA
product can also be sequenced by running a
reverse-transcription-PCR to generate the cDNA for sequencing.
Example 5
PolyA Tailing Reaction
[1659] Without a poly-T in the cDNA, a poly-A tailing reaction must
be performed before cleaning the final product. This can be done by
mixing Capped IVT RNA (100 .mu.l); RNase Inhibitor (20 U);
10.times. Tailing Buffer (0.5 M Tris-HCl (pH 8.0), 2.5 M NaCl, 100
mM MgCl.sub.2) (12.0 .mu.l); 20 mM ATP (6.0 .mu.l); Poly-A
Polymerase (20 U); dH.sub.20 up to 123.5 .mu.l and incubating at
37.degree. C. for 30 min. If the poly-A tail is already in the
transcript, then the tailing reaction can be skipped and proceed
directly to cleanup with Ambion's MEGACLEAR.TM. kit (Austin, Tex.)
(up to 500 .mu.g). Poly-A Polymerase is, in some cases, a
recombinant enzyme expressed in yeast.
[1660] It should be understood that the processivity or integrity
of the polyA tailing reaction does not always result in an exact
size polyA tail. Hence polyA tails of approximately between 40-200
nucleotides, e.g., about 40, 50, 60, 70, 80, 90, 91, 92, 93, 94,
95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108,
109, 110, 150-165, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164
or 165 are within the scope of the disclosure.
Example 6
Natural 5' Caps and 5' Cap Analogues
[1661] 5'-capping of polynucleotides can be completed concomitantly
during the in vitro-transcription reaction using the following
chemical RNA cap analogs to generate the 5'-guanosine cap structure
according to manufacturer protocols: 3'-O-Me-m7G(5')ppp(5') G [the
ARCA cap]; G(5')ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A;
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). 5'-capping
of modified RNA can be completed post-transcriptionally using a
Vaccinia Virus Capping Enzyme to generate the "Cap 0" structure:
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). Cap 1
structure can be generated using both Vaccinia Virus Capping Enzyme
and a 2'-O methyl-transferase to generate:
m7G(5')ppp(5')G-2'-O-methyl. Cap 2 structure can be generated from
the Cap 1 structure followed by the 2'-O-methylation of the
5'-antepenultimate nucleotide using a 2'-O methyl-transferase. Cap
3 structure can be generated from the Cap 2 structure followed by
the 2'-O-methylation of the 5'-preantepenultimate nucleotide using
a 2'-O methyl-transferase. Enzymes can be derived from a
recombinant source.
[1662] When transfected into mammalian cells, the modified mRNAs
can have a stability of between 12-18 hours or more than 18 hours,
e.g., 24, 36, 48, 60, 72 or greater than 72 hours.
Example 7
Capping Assays
A. Protein Expression Assay
[1663] Polynucleotides encoding a polypeptide, containing any of
the caps taught herein, can be transfected into cells at equal
concentrations. After 6, 12, 24 and 36 hours post-transfection, the
amount of protein secreted into the culture medium can be assayed
by ELISA. Synthetic polynucleotides that secrete higher levels of
protein into the medium would correspond to a synthetic
polynucleotide with a higher translationally-competent Cap
structure.
B. Purity Analysis Synthesis
[1664] Polynucleotides encoding a polypeptide, containing any of
the caps taught herein, can be compared for purity using denaturing
Agarose-Urea gel electrophoresis or HPLC analysis. Polynucleotides
with a single, consolidated band by electrophoresis correspond to
the higher purity product compared to polynucleotides with multiple
bands or streaking bands. Synthetic polynucleotides with a single
HPLC peak would also correspond to a higher purity product. The
capping reaction with a higher efficiency would provide a more pure
polynucleotide population.
C. Cytokine Analysis
[1665] Polynucleotides encoding a polypeptide, containing any of
the caps taught herein, can be transfected into cells at multiple
concentrations. After 6, 12, 24 and 36 hours post-transfection the
amount of pro-inflammatory cytokines such as TNF-alpha and IFN-beta
secreted into the culture medium can be assayed by ELISA.
Polynucleotides resulting in the secretion of higher levels of
pro-inflammatory cytokines into the medium would correspond to
polynucleotides containing an immune-activating cap structure.
D. Capping Reaction Efficiency
[1666] Polynucleotides encoding a polypeptide, containing any of
the caps taught herein, can be analyzed for capping reaction
efficiency by LC-MS after nuclease treatment. Nuclease treatment of
capped polynucleotides would yield a mixture of free nucleotides
and the capped 5'-5-triphosphate cap structure detectable by LC-MS.
The amount of capped product on the LC-MS spectra can be expressed
as a percent of total polynucleotide from the reaction and would
correspond to capping reaction efficiency. The cap structure with
higher capping reaction efficiency would have a higher amount of
capped product by LC-MS.
Example 8
Agarose Gel Electrophoresis of Modified RNA or RT PCR Products
[1667] Individual polynucleotides (200-400 ng in a 20 .mu.l volume)
or reverse transcribed PCR products (200-400 ng) can be loaded into
a well on a non-denaturing 1.2% Agarose E-Gel (Invitrogen,
Carlsbad, Calif.) and run for 12-15 minutes according to the
manufacturer protocol.
Example 9
Nanodrop Modified RNA Quantification and UV Spectral Data
[1668] Modified polynucleotides in TE buffer (1 .mu.l) can be used
for Nanodrop UV absorbance readings to quantitate the yield of each
polynucleotide from an chemical synthesis or in vitro transcription
reaction.
Example 10
Formulation of Modified mRNA Using Lipidoids
[1669] Polynucleotides can be formulated for in vitro experiments
by mixing the polynucleotides with the lipidoid at a set ratio
prior to addition to cells. In vivo formulation can require the
addition of extra ingredients to facilitate circulation throughout
the body. To test the ability of these lipidoids to form particles
suitable for in vivo work, a standard formulation process used for
siRNA-lipidoid formulations can be used as a starting point. After
formation of the particle, polynucleotide can be added and allowed
to integrate with the complex. The encapsulation efficiency can be
determined using a standard dye exclusion assays.
Example 11
Method of Screening for Protein Expression
A. Electrospray Ionization
[1670] A biological sample that can contain proteins encoded by a
polynucleotide administered to the subject can be prepared and
analyzed according to the manufacturer protocol for electrospray
ionization (ESI) using 1, 2, 3 or 4 mass analyzers. A biologic
sample can also be analyzed using a tandem ESI mass spectrometry
system.
[1671] Patterns of protein fragments, or whole proteins, can be
compared to known controls for a given protein and identity can be
determined by comparison.
B. Matrix-Assisted Laser Desorption/Ionization
[1672] A biological sample that can contain proteins encoded by one
or more polynucleotides administered to the subject can be prepared
and analyzed according to the manufacturer protocol for
matrix-assisted laser desorption/ionization (MALDI).
[1673] Patterns of protein fragments, or whole proteins, can be
compared to known controls for a given protein and identity can be
determined by comparison.
C. Liquid Chromatography-Mass Spectrometry-Mass Spectrometry
[1674] A biological sample, which can contain proteins encoded by
one or more polynucleotides, can be treated with a trypsin enzyme
to digest the proteins contained within. The resulting peptides can
be analyzed by liquid chromatography-mass spectrometry-mass
spectrometry (LC/MS/MS). The peptides can be fragmented in the mass
spectrometer to yield diagnostic patterns that can be matched to
protein sequence databases via computer algorithms. The digested
sample can be diluted to achieve 1 ng or less starting material for
a given protein. Biological samples containing a simple buffer
background (e.g., water or volatile salts) are amenable to direct
in-solution digest; more complex backgrounds (e.g., detergent,
non-volatile salts, glycerol) require an additional clean-up step
to facilitate the sample analysis.
[1675] Patterns of protein fragments, or whole proteins, can be
compared to known controls for a given protein and identity can be
determined by comparison.
Example 12
Synthesis of mRNA Encoding MCM
[1676] The sequence optimized polynucleotides encoding MCM
polypeptides, i.e., SEQ ID NOs: 1-207, 732-765, and 772, are
synthesized as described in Examples 1 to 12.
[1677] Further, mRNA's encoding both mouse MCM and human MCM were
prepared for Examples 13-19 described below, and they were
synthesized as described in Examples 1 to 12.
[1678] An mRNA encoding human MCM ("hMCM-mRNA") was constructed
that encodes the naturally-occurring V671 mutation of MCM. The
nucleotide sequence of hMCM-mRNA is provided in SEQ ID NO: 249. The
hMCM-mRNA sequence includes both 5' and 3' UTR regions (SEQ ID NOs:
266 and 267, respectively):
TABLE-US-00008 5'UTR: TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTAT
AGGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGAGC CACC 3'UTR:
TGATAATAGGCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCC
GTGGTCTTTGAATAAAGTCTGAGTGGGCGGC
[1679] A mRNA encoding mouse MCM ("mMCM-mRNA") was also constructed
using standard molecular biology techniques. The nucleotide
sequence of mMCM-mRNA is provided in SEQ ID NO: 250, and it encodes
mouse MCM (SEQ ID NO: 268). The mMCM-mRNA sequence includes the
same 5' and 3' UTR regions as hMCM-mRNA.
[1680] Both hMCM-mRNA and mMCM-mRNA were prepared as modified mRNA.
Specifically, during in vitro translation, modified mRNA was
generated using 1-methyl-pseudoUTP to ensure that the mRNAs
contained 100% 1-methyl-pseudouridine instead of uridine. Further,
both hMCM-mRNA and mMCM-mRNA were synthesized with a primer that
introduced a 100 nucleotide polyA-tail, and a Cap 1 structure was
generated on both mRNAs using Vaccinia Virus Capping Enzyme and a
2'-O methyl-transferase to generate:
m7G(5')ppp(5')G-2'-O-methyl.
Example 13
Detecting Endogenous MCM Expression In Vitro
[1681] MCM expression was characterized in a variety of cell lines,
including cells derived from both mice and human sources. The cell
lines tested included Hepa1-6 (mouse), HepG2 (human), SNU423
(human), and HeLa cells. Cell were cultured in standard conditions
and cell extracts were obtained by placing the cells in lysis
buffer. For comparison purposes, a mitochondrial extract from mouse
liver was also prepared. To prepare the liver extract, whole liver
was homogenized in an ice-cold sucrose-containing hypotonic buffer
at neutral pH adjusted with 0.1 molarTrizma base-MOPS
(3-(N-morpholino)propanesulfonic acid). The liver homogenates were
centrifuged at 600 g in a cold table-top centrifuge to remove the
nuclear fraction. The mitochondrial fraction was then collected by
centrifugation of the cleared lysates at 7000 g.
[1682] To analyze MCM expression, 15 .mu.g of each lysate was
prepared in a 40 .mu.L, volume with lithium dodecyl sulfate sample
loading buffer and subjected to standard Western blot analysis. For
detection of MCM, the antibody used was anti-methylmalonyl-CoA
mutase (mouse polyclonal; Ab67869; ABCAM.RTM.) at a 1:1000
dilution. For detection of a load control, the antibody used was
anti-citrase synthase (rabbit polyclonal; PAS-22126; Thermo-Fisher
SCIENTIFIC.RTM.). In FIG. 1, the signal provided by anti-MCM is
provided in green, while the anti-citrate synthase signal is
provided in red. FIG. 1 shows that MCM was found in all cell lines
tested, including both mouse and human liver-derived cell lines.
For all cell lines, the expression of MCM was in roughly the same
proportion to the control citrate synthase signal, though less
signal was observed in HeLa cells. FIG. 1 also shows that the cell
lines expressed MCM at a level comparable to mouse liver
mitochondrial mitochondrial extract.
[1683] To examine the localization of endogenous MCM,
immunofluorescence analysis was performed on HeLa cells. MCM
expression was detected using anti-methylmalonyl-CoA mutase (mouse
monoclonal; Ab67869; ABCAM.RTM.), mitochondria were detected using
Mitotracker, and the nucleus was stained with DAPI. Image analysis
was performed on a Zeiss ELYRA imaging system. As seen in FIGS.
2(A)-(C), the HeLa immunofluorescent staining reveals extensive
colocalization between mitochondria (red) and MCM
immunofluorescence (green), with little to no colocalization
between the nucleus (DAPI stain) and MCM. The finding that the
majority of endogenous MCM localizes with mitochondria is
consistent with MCM's known metabolic function and
localization.
Example 14
In Vitro Expression of MCM in HeLa Cells
[1684] To measure in vitro expression of human MCM in HeLa cells,
those cells were seeded on 12-well plates (BD Biosciences, San
Jose, USA) one day prior to transfection. mRNA formulations
comprising human MCM (SEQ ID NO: 249) or a GFP control (encoding
SEQ ID NO: 269) were transfected using 800 ng mRNA and 2 .mu.L
Lipofectamin 2000 in 60 .mu.L OPTI-MEM per well and incubated.
After 24 hours, the cells in each well were lysed using a
consistent amount of lysis buffer. For comparison purposes, mouse
liver mitochondrial extract was also prepared as described in
Example 13. Protein concentrations of each were determined using a
BCA assay according to manufacturer's instructions. To analyze MCM
expression, equal load of each lysate (24 .mu.g) was prepared in a
loading buffer and subjected to standard Western blot analysis. For
detection of MCM, the antibody used was anti-methylmalonyl-CoA
mutase (rabbit monoclonal; ab133672; Abcam.RTM.) at a 1:1000
dilution.
[1685] The resulting Western blot, shown in FIG. 3, demonstrates
that introduction of a mRNA formulation comprising hMCM sequence
(SEQ ID NO: 249) greatly increased the level of MCM expression in
HeLa cells relative to cells transfected with a control construct.
The MCM expression level observed after introduction of mRNA
encoding MCM were even higher than the levels present in liver
mitochondrial mitochondrial extract. While FIG. 1 indicates that at
least some endogenous MCM is present in HeLa cells, FIG. 3 shows
that the MCM expression levels far exceed that baseline after
introduction of mRNAs comprising hMCM.
Example 15
In Vitro MCM Activity in HeLa Cells
[1686] While the Western blots of FIG. 3 demonstrate that MCM is
expressed after introduction of mRNA comprising an MCM sequence,
FIG. 3 does not address whether the exogenously-expressed MCM is
active. To answer this question, an in vitro MCM activity assay was
performed.
A. Expression
[1687] HeLa cells were transfected with mRNA formulations
comprising human MCM (SEQ ID NO: 249) or a GFP control (encoding
SEQ ID NO: 269) were transfected with Lipofectamin 2000 and lysed
as described in Example 14 above. For comparison purposes, mouse
liver mitochondrial extract was also prepared as described in
Example 13 above.
B. Activity Assay
[1688] To assess whether exogenous MCM can function, an in vitro
activity assay was performed using transfected HeLa cell lysates as
the source of enzymatic activity. To begin, 60 .mu.L of lysate
containing 132 .mu.g protein was mixed with 30 .mu.L of MCM
coenzyme adocobalimin (1 mM in distilled water) at 37.degree. C.
for 5 minutes. Equal amounts of
DL-2-[methyl-.sup.14C]-methylmalonyl-CoA (50-60 mCi per mmol; Cat
ARC0847; American Radiolabeled Chemicals) were then added to each
reaction, which was further incubated at 37.degree. C. for 10
minutes. The reaction was stopped by adding 50 .mu.L of 100 g/L TCA
and vortexing. The reaction tubes were then centrifuged at 13,000 g
for 1 min, and the supernatant was analyzed for the presence of
[.sup.14C]-succinyl-CoA using HPLC-based separation and
quantification. Specifically, 20 .mu.L of each activity reaction
supernatant was analyzed using a HPLC system equipped with a
Quaternary-Pump, a Multi-sampler, a Thermostated
Column-Compartment, a Poroshell EC-C18 120 HPLC-column and a
Radiometric Detector controlled by OpenLAB Chromatography Data
System, all used according to the manufacturers' recommendations.
Elusion was with a linear methanol gradient: 0-15 min (Solvent A:
95% 100 mM acetic acid in 100 mM sodium phosphate buffer, pH 7.0)
and 15-25 min (95% Solvent A with 5% of an 18% v/v methanol/water
solution) with a flow rate of 0.5 mL/min.
[1689] FIG. 4 shows that there was very low to no MCM activity
detected in control transfected HeLa cells. FIG. 4 also shows,
however, that transfection with mRNA encoding hMCM led to MCM
activity of almost 0.2 mM/min/mg. The MCM activity of cell lysate
generated by transfection with mRNA encoding hMCM was roughly half
of that observed in mouse liver mitochondrial extract.
Example 16
Measuring In Vitro Expression of MCM
[1690] Hepa1-6 cells and fibroblasts from normal subject (NHDF) and
MMA patients (GM50 and GM1673) were examined for their capacity to
express exogenous MCM.
[1691] Cells were transfected with mRNA formulations comprising
human MCM (SEQ ID NO: 249), mouse MCM (SEQ ID NO: 250), or a GFP
control (encoding SEQ ID NO: 269) via electroporation using a
standard protocol. Each construct was tested separately. After 24
hours incubation, cells were lysed and protein concentration in
each lysate was measured by BCA assay. To analyze MCM expression,
equal load of each lysate (26 .mu.g) was prepared in a loading
buffer and subjected to standard Western blot analysis. For
detection of MCM, the antibody used was anti-methylmalonyl-CoA
mutase (mouse monoclonal; Anti-MUT TRUEMAB Antibody Clone OTI2C8;
OriGene.RTM.) at a 1:5000 dilution. For detection of a load
control, the antibody used was anti-citrase synthase (rabbit
polyclonal; MA5-17625; Pierce.RTM.).
[1692] FIG. 5 shows that introduction of formulations containing a
human MCM sequence (SEQ ID NO: 249) greatly increased the level of
MCM expression in normal human cells and in cells from MMA
patients, relative to cells transfected with a control construct.
The increased MCM expression level observed after introduction of
mRNA encoding hMCM were reflected in the appearance in FIG. 5 of an
MCM band in cells transfected with mRNA encoding hMCM. While no
significant difference in MCM levels was noted after transfection
with mouse MCM (SEQ ID NO: 250), this could be due to a specific
interaction of the MCM antibody with only the human form of the
enzyme.
[1693] FIGS. 6A-6D show co-localization of MCM and mitochondria in
human fibroblasts transfected with eGFP or MCM mRNAs. To examine
the localization of mRNA-encoded hMCM in mitochondria,
1.times.10.sup.6 MCM-deficient patient fibroblasts (GM01673) were
transfected with 1 .mu.g of hMCM mRNA. 24 hours after transfection,
the cells were incubated with 200 nM MitoTracker Red CMXRos (M7512,
ThermoFisher Scientific) for 30 min to mark mitochondria and
stained with anti-MCM mouse mAb (TA506873, Origene) to examine the
cellular localization.). FIGS. 6A and 6C are images taken of
patient fibroblasts transfected with mRNA encoding eGFP. FIGS. 6B
and 6D are images taken of patient fibroblasts transfected with
mRNA encoding hMCM. A co-localization of MCM and mitochondria was
observed, suggesting expressed MCM proteins reside inside
mitochondria.
Example 17
Measuring In Vitro MCM Activity
A. Expression
[1694] Hepa1-6 cells and fibroblasts from normal human subject
(NHDF) and MIVIA patients (GM50 and GM1673) were cultured. Cells
were transfected with mRNA formulations comprising human MCM (SEQ
ID NO: 249), mouse MCM (SEQ ID NO: 250), or a GFP control (encoding
SEQ ID NO: 269) via electroporation using a standard protocol.
B. Activity Assay
[1695] To assess whether exogenous MCM can function, an in vitro
activity assay was performed using transfected cell lysates as the
source of enzymatic activity. To begin, 60 .mu.L of lysate
containing 100 .mu.g protein was mixed with 30 .mu.L of MCM
coenzyme adocobalimin (1 mM in distilled water) at 37.degree. C.
for 5 minutes. Equal amounts of
DL-2-[methyl-.sup.14C]-methylmalonyl-CoA (50-60 mCi per mmol; Cat
ARC0847; American Radiolabeled Chemicals) were then added to each
reaction, which was further incubated at 37.degree. C. for 10
minutes. The reaction was stopped by adding 50 .mu.L of 100 g/L TCA
and vortexing. The reaction tubes were then centrifuged at 13,000 g
for 1 min, and the supernatant was analyzed for the presence of
[.sup.14C ]-succinyl-CoA succinyl-CoA using HPLC-based separation
and quantification. Specifically, 20 .mu.L of each activity
reaction supernatant was analyzed using a HPLC system equipped with
a Quaternary-Pump, a Multi-sampler, a Thermostated
Column-Compartment, a Poroshell EC-C18 120 HPLC-column and a
Radiometric Detector controlled by OpenLAB Chromatography Data
System, all used according to the manufacturers' recommendations.
Elusion was with a linear methanol gradient: 0-15 min (Solvent A:
95% 100 mM acetic acid in 100 mM sodium phosphate buffer, pH 7.0)
and 15-25 min (95% Solvent A with 5% of an 18% v/v methanol/water
solution) with a flow rate of 0.5 mL/min.
[1696] FIG. 7 shows that, for each cell lines tested, transfection
with mRNA's encoding either mouse MCM or human MCM increased the
level of MCM activity in all cell types tested. Thus this data
demonstrates that transfection of mRNA encoding MCM leads to the
expression of active MM enzyme in Hepa1-6 cells, fibroblasts from
normal human subjects, and fibroblasts from MMA patients. Further,
human MCM increased MCM activity to a greater degree than did mouse
MCM when transfected into Hepa1-6 cells.
Example 18
Increased In Vivo MCM Expression
[1697] To assess the ability of MCM-containing mRNA's to facilitate
MCM expression in vivo, mRNA encoding human MCM (SEQ ID NO: 249)
was introduced into C57B/L6 mice. C57B/L6 mice were injected
intravenously with either control mRNA (NT-FIX) or hMCM mRNA at 0.5
mg/kg. The mRNA was formulated in lipid nanoparticles for delivery
into the mice. Mice were sacrificed after 24 or 48 hrs. and MCM
protein levels in liver lysates were determined by capillary
electrophoresis (CE). Citrate synthase expression was examined for
use as a loading control. For control NT-FIX injections, 4 mice
were tested for each time point. For hMCM mRNA injections, 6 mice
were tested for each time point.
[1698] As shown in FIGS. 8A and 8B, MCM expression was drastically
increased in all mice injected with mRNA encoding human MCM. The
MCM expression peaked at the 24 hour time point, and was still
higher than control mice at 48 hours. Relatively low levels of
variance were observed between mice of each experimental condition,
indicating that treatment with mRNA encoding MCM is capable of
reliably inducing expression of MCM.
Example 19
Human MCM Mutant Constructs
[1699] According to the present disclosure, the polynucleotide can
comprise at least a first region of linked nucleosides encoding
human MCM. Exemplary human MCM protein sequences of the present
disclosure are listed in Table 3 above.
Example 20
MMA Levels and Body Weight Change in MCK mouse model
[1700] A MCK mouse model of MMA (Mut-/-; Tg.sup.INS-MCK-Mut) is
known in the literature and lacks exon 3 of the MCM allele, which
encodes the substrate-binding pocket of MCM. Manoli 2013 (PNAS
110(33):13552-13557 (2013); and Harrington et al., "Stable Isotope
Breath Tests to Assess Metabolite Flux in Methylmalonic Acidemia
(MMA)", American Society of Human Genetics, Abstract, 2014, which
are incorporated herein by reference in their entireties. The MCM
knockout mice exhibit a semipenetrant neonatal lethal phenotype,
with most mice perishing in the early neonatal period. This mouse
model is described in WO 2014/143884 A2, hereby incorporated by
reference in its entirety. Because the severe phenotype associated
with the knockout makes study difficult, researchers have prepared
partial rescues of the MCM knockout mice by transgenic rescue with
tissue-specific expression or expression of mutants that mimic
those mutations associated with human MMA. For example, transgenic
mice that express MCM in the knockout background under the control
of the muscle-specific creatine kinase promoter ("the MCK mice")
survive but still display severe metabolic perturbations and growth
abnormalities.
[1701] The effectiveness of mRNA encoding human MCM was assessed in
the MCK mouse model of MMA (Mut-/-; Tg.sup.INS-MCK-mut) N=3-4. MCK
mice were injected intravenously with either control mRNA (NT-FIX)
or codon optimized human MCM mRNA at 0.16 mg/kg. Five (5)
injections were done with MCM mRNA (SEQ ID NO: 734, FIG. 9) at 0.16
mg/kg; and two injections were done with MCM mRNA (SEQ ID NO: 735,
FIG. 10) at 0.2 mg/kg. The mRNA was formulated in lipid
nanoparticles (Compound 18) for delivery into the mice via tail
vein injection. Plasma was collected twice a week, 3 and 6 days
after dosing. Plasma MMA was determined by LC-MS/MS. Body weight
was measured twice a week at time of dosing. Mice were not
sacrificed at the end of this study and were used for other
studies. On the third scheduled injection (day 15), one of the mice
that had previously been administered control mRNA was switched to
being administered hMCM mRNA and the other mouse administered
control mRNA was found dead. This testing demonstrated that repeat
intravenous dosing of hMCM mRNA corrected biochemical and growth
abnormalities in an animal model of Methylmalonic acidemia
(MMA-emia).
[1702] Although expression of MCM in skeletal muscle rescues MCK
mice from neonatal lethality, these mice display severe metabolic
perturbations and growth retardation that resembles clinical
characteristics observed in methylmalonic acidemia patients. In the
present example, repeat IV dosing of Compound 18 LNP-encapsulated
hMCM mRNA (fully modified with mo5U) was investigated to determine
whether mRNA therapy can correct biochemical and growth
abnormalities. MCK mice were administered weekly IV injections of
0.16 mg/kg hMCM mRNA (encoding SEQ ID NO: 734) or a vehicle control
(non-translating factor IX, NTFIX) mRNA. MCK mice that received
hMCM mRNA injections showed decreased plasma MMA levels 3 and 6
days following each dose throughout the entire treatment period
(FIG. 16A). Importantly, treated MCK mice also showed increased
weight gain which was correlated to decreased plasma MMA levels
(FIG. 16B). In contrast, MCK mice that received vehicle mRNA
control (NTFIX) showed neither reduction in plasma MMA levels nor
increase in body weight following 2 doses (FIG. 16A). Indeed, after
2 IV doses of NTFIX injections, one of the MCK mice died likely due
to metabolic decompensation although the cause of death is unknown.
To present further loss of MCK mouse, the vehicle control (NTFIX)
mRNA treated mouse was switched to hMCM mRNA therapy.
Interestingly, once that MCK mouse started to receive hMCM mRNA
treatment, plasma MMA levels of this mouse quickly decreased from
835 .mu.M to 153 .mu.M within 3 days (FIG. 16A). Moreover, this
mouse gained 4.8 g in body weight in just one week following
crossover to hMCM mRNA therapy. After the fifth IV dose, the MCK
mice were given a 10 day washout period (FIG. 16B). Interestingly,
there was a partial rebound of plasma MIVIA to 955+/-SD .mu.M in
these mice 10 days following their last hMCM mRNA injection (FIG.
16A). Moreover, during this washout period, decreased body weight
was observed in these mice (0.13+/-SD to 2.8+/-SD g) from day 6 to
day 10 (FIG. 16B). When MCK mice were re-dosed with 0.2 mg/kg IV
hMCM mRNA (encoding SEQ ID NO: 734) after the 10 day washout,
plasma MMA levels decreased to 226+/-.mu.M and body weight
increased from 1.38+/-g to 3.81+/-g in 4 days. These data
demonstrates that LNP-formulated hMCM mRNA is efficacious in
lowering plasma MIVIA levels and simultaneously increasing body
weight in this methylmalonic acidemia mouse model of the more
severe Mut0 subtype.
Example 21
Expression of MCM in Liver of Wild-Type Mice Dosed with Codon
Optimized MCM Human mRNA Compared to Endogenous MCM in Normal Mouse
and Human Liver
[1703] To assess MCM expression in vivo, codon optimized MCM human
mRNA (SEQ ID NO: 734) was introduced into wild-type CD1 mice. CD1
mice were injected intravenously with a single dose of codon
optimized MCM mRNA (SEQ ID NO: 734) at 0.2 mg/kg. The mRNA was
formulated in lipid nanoparticles (Compound 18) for delivery into
the mice via tail vein injection (N=3). Mice were sacrificed 24
hours after dosing, and MCM protein levels in liver lysates were
determined by LC-MS/MS. As shown in FIG. 17, dosing at 0.2 mg/kg in
wild-type mice resulted in abundant expression of human MCM, higher
than endogenous MCM found in human and normal mouse livers.
Example 22
MCM Expression in Liver of Mice Administered Codon Optimized MCM
mRNA
[1704] LNP encapsulates hMUT mRNA and distributes the mRNA to the
liver, where it is subsequently translated to its functional
protein. The half-life of the mRNA and protein product are critical
determinants of the pharmacokinetics of mRNA-based therapeutics. To
understand the kinetics of hMUT mRNA, the LNP, and the encoded MUT
protein, we performed a PK study in wild type CD1 mice in which
mice were administered a single IV bolus of 0.5 mg/kg hMUT mRNA or
vehicle control (NTFIX) mRNA. Our data showed that 2 hours after
administration, 939 ng/g LNP was detected in livers and by 6 hours,
LNP concentrations decreased by almost 98.5% (FIG. 18A). At 16
hours, LNP concentrations are not detectable in the liver
suggesting that the LNP is highly degradable and is rapidly cleared
in liver. hMUT mRNA was also cleared quickly as shown in FIG. 18B,
with a precipitous drop of hMut mRNA levels at 6 hours following a
single IV hMUT mRNA administration (FIG. 18B). Over 98% Mut mRNA
was cleared 48 hours after administration. In contrast, human MUT
protein is rapidly expressed and showed a significantly longer
half-life (FIG. 18C). Human MUT protein is detectable 2 hours and
peaks at 16 hours after hMUT IV mRNA administration (FIG. 18C). Our
data suggested that the half-life if expressed human Mut is
approximately 1.6 days. The data show a decline in mRNA levels in
the liver with levels reaching baseline by about 2 days. The
sustained expression of MCM protein out to 5 days following a
single administration of MCM-encoding mRNA demonstrates potential
advantages in treating MMA patients with weekly dosing being a
potentially acceptable dosing regimen to achieve therapeutically
effective doses in humans.
Example 23
Lipid Nanoparticle Quantification and Kidney, Liver and Spleen
Analysis
[1705] In vivo analysis of lipid nanoparticles quanification, in
situ hybridization for kidney, and bDNA for spleen is assessed.
Codon optimized MCM mRNA (SEQ ID NO: 735) is administered to CD1
mice. CD1 mice are injected intravenously with either control mRNA
(NT-FIX) or codon optimized MCM mRNA at 0.5 mg/kg. The mRNA was
formulated in lipid nanoparticles (Compound 18) for delivery into
the mice via tail vein injection. Mice (N=3/time point) are
sacrificed after 2, 6, 16, 24, 48, 72, 120, or 168 hours. Lipid
nanoparticles are quantified at early time points (2, 6, and 16
hours). ISH of kidney and bDNA of liver and spleen are analyzed and
compared to untreated CD1 mice.
Example 24
In Vivo Delivery of mRNA Encoding MCM
[1706] To assess methods of delivering MCM in vivo, codon optimized
MCM human mRNA, i.e., mRNA1, mRNA2, mRNA3, mRNA4, and mRNA5 (SEQ ID
NOs: 775, 776, 777, 734 and 778, respectively) or a vehicle control
(non-translating factor IX, NTFIX) mRNA was introduced into
wild-type CD1 mice. The mice were injected intravenously with a
single dose of mRNA at 0.2 mg/kg. The mRNA was formulated for
delivery into the mice via tail vein injection (N=3 per
formulation). Compositions were formulated with either MC3 or
Compound 18. Mice were sacrificed 24 hours after dosing, and MCM
protein levels in liver lysates were determined by Western blot.
FIG. 19A is a Western blot with equal loading of each lysate. FIG.
19B is a quantification of the expression patterns in the Western
blot of FIG. 19A. As shown in FIGS. 19A and 19B, both MC3
formulations and Compound 18 formulations were effective in
facilitating delivery and expression of mRNA encoding MCM.
Delivering mRNAs encoding MCM in wild-type mice resulted in
expression of human MCM at levels much higher than that of
endogenous MCM in control mice.
Example 24
In Vivo MMA Level and Body Weight Effect on MCK Mice
[1707] Two MCK mice were administered weekly IV injections of 0.2
mg/kg hMCM mRNA and the other two received a vehicle control
(non-translating factor IX, NTFIX) mRNA at 0.2 mg/kg. The study
encompasses 2 doses. The MCK mice that received hMCM mRNA
injections showed decreased plasma MMA levels 3 days following each
dose (FIG. 20A). Importantly, treated MCK mice also showed
significantly increased body weight which was correlated to
decreased plasma MMA levels. See FIG. 20B. In contrast, the MCK
mouse that received vehicle mRNA control (NTFIX) showed no
significant reduction in plasma MMA levels nor increase in body
weight following 2 doses. One MCK mouse received the vehicle
control died.
[1708] Certain exemplary mRNA sequences are shown below:
TABLE-US-00009 hMCM mRNA
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGAAATAAGAGAGAAAA-
GAAGAGTAAGA (SEQ ID
AGAAATATAAGAGCCACCATGCTGCGGGCCAAGAACCAGCTGTTCCTGCTGAGCCCTCACTACCTG-
CGGCAGGT NO: 769)
GAAGGAGAGCAGCGGCAGCCGGCTGATCCAGCAGCGGCTGCTGCACCAGCAGCAGCCCCTGCACC-
CCGAGTGGG
CCGCCCTGGCCAAGAAGCAGCTGAAGGGCAAGAACCCCGAGGACCTGATCTGGCACACGCCCGAGGGCATCAG-
C
ATCAAGCCCCTGTACAGCAAGCGGGACACCATGGACCTGCCCGAGGAGCTGCCCGGCGTGAAGCCCTTCACCC-
G
GGGCCCCTACCCCACCATGTACACCTTCCGGCCCTGGACCATCCGGCAGTACGCCGGCTTCAGCACCGTGGAG-
G
AGAGCAACAAGTTCTACAAGGACAACATCAAGGCCGGCCAGCAGGGCCTGAGCGTGGCCTTCGACCTGGCCAC-
C
CACCGGGGCTACGACAGCGACAACCCACGGGTGCGGGGCGACGTGGGCATGGCCGGCGTGGCCATCGACACCG-
T
GGAGGACACCAAGATCCTGTTCGACGGCATCCCTCTGGAGAAGATGAGCGTGAGCATGACCATGAACGGCGCC-
G
TGATCCCCGTGCTGGCCAACTTCATCGTGACCGGCGAGGAGCAGGGCGTGCCCAAGGAGAAGCTGACCGGCAC-
C
ATCCAGAACGACATCCTGAAGGAGTTCATGGTGCGGAACACCTACATCTTCCCTCCCGAGCCCAGCATGAAGA-
T
CATCGCCGACATCTTCGAGTACACCGCCAAGCACATGCCCAAGTTCAACAGCATCAGCATCAGCGGCTACCAC-
A
TGCAGGAGGCCGGCGCCGACGCCATCCTGGAGCTGGCCTACACCCTGGCCGACGGCCTGGAGTACAGCCGGAC-
C
GGCCTGCAGGCCGGCCTGACCATCGACGAGTTCGCGCCCCGGCTGAGCTTCTTCTGGGGCATCGGCATGAACT-
T
CTACATGGAGATCGCCAAGATGCGGGCCGGCCGGCGGCTGTGGGCCCACCTGATCGAGAAGATGTTCCAGCCC-
A
AGAACAGCAAGAGCCTGCTGCTGCGGGCCCACTGCCAGACCAGCGGCTGGAGCCTGACCGAGCAGGACCCCTA-
C
AACAACATCGTGCGGACCGCCATCGAGGCCATGGCCGCCGTGTTCGGCGGCACCCAGAGCCTGCACACCAACA-
G
CTTCGACGAGGCCCTGGGCCTGCCCACCGTGAAGAGCGCCCGGATCGCCCGGAACACCCAGATCATCATCCAG-
G
AGGAGAGCGGCATCCCCAAGGTGGCCGACCCCTGGGGCGGCAGCTACATGATGGAGTGCCTGACCAACGACGT-
G
TACGACGCCGCCCTGAAGCTGATCAACGAGATCGAGGAGATGGGCGGCATGGCCAAGGCCGTGGCCGAGGGCA-
T
CCCCAAGCTGCGGATCGAGGAGTGCGCCGCCCGGCGGCAGGCCCGGATCGACAGCGGCAGCGAGGTGATCGTG-
G
GCGTGAACAAGTACCAGCTGGAGAAGGAGGACGCCGTGGAGGTGCTGGCCATCGACAACACCAGCGTGCGGAA-
C
CGGCAGATCGAGAAGCTGAAGAAGATCAAGAGCAGCCGGGACCAGGCCCTGGCCGAGCGGTGCCTGGCCGCCC-
T
GACCGAGTGCGCCGCCAGCGGCGACGGCAACATCCTGGCCCTGGCCGTGGACGCCAGCCGGGCCCGGTGCACC-
G
TGGGCGAGATCACCGACGCCCTGAAGAAGGTGTTCGGCGAGCACAAGGCCAACGACCGGATGGTGAGCGGCGC-
C
TACCGGCAGGAGTTCGGCGAGAGCAAGGAGATCACCAGCGCCATCAAGCGGGTGCACAAGTTCATGGAGCGGG-
A
GGGCCGGCGGCCCCGGCTGCTGGTGGCCAAGATGGGCCAGGACGGCCACGACCGGGGCGCCAAGGTGATCGCC-
A
CCGGCTTCGCCGACCTGGGCTTCGACGTGGACATCGGCCCACTGTTCCAGACGCCCCGGGAGGTGGCCCAGCA-
G
GCCGTGGACGCCGACGTGCACGCCGTGGGCGTGAGCACCCTGGCCGCCGGCCACAAGACCCTGGTGCCCGAGC-
T
GATCAAGGAGCTGAACAGCCTGGGCCGGCCCGACATCCTGGTGATGTGCGGCGGCGTGATCCCGCCCCAGGAC-
T
ACGAGTTCCTGTTCGAGGTGGGCGTGAGCAACGTGTTCGGCCCCGGCACCCGGATCCCCAAGGCCGCCGTGCA-
G
GTGCTGGACGACATCGAGAAGTGCCTGGAGAAGAAGCAGCAGAGCGTGTGATAATAGTCCATAAAGTAGGAAA-
C
ACTACAGCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGC-
A CCCGTACCCCCCGCATTATTACTCACGGTACGAGTGGTCTTTGAATAAAGTCTGAGTGGGCGGC
hMCM mRNA
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGAAATAAGAGAGAAAAG-
AAGAGTAAGA (SEQ ID
AGAAATATAAGAGCCACCATGCTGCGGGCCAAGAACCAGCTGTTCCTGCTGAGCCCCCACTACCTG-
CGGCAGGT NO: 770)
GAAGGAGAGCAGCGGCAGCCGGCTGATCCAGCAGCGCCTCCTCCACCAGCAGCAGCCCCTCCACC-
CCGAGTGGG
CCGCCCTCGCCAAGAAGCAGCTCAAGGGCAAGAACCCCGAGGACCTCATCTGGCACACCCCCGAGGGCATCTC-
C
ATCAAGCCCCTCTACTCCAAGCGCGACACCATGGACCTCCCCGAGGAGCTCCCCGGCGTCAAGCCCTTCACCC-
G
CGGCCCCTACCCCACCATGTACACCTTCCGCCCCTGGACCATCCGCCAGTACGCCGGCTTCTCCACCGTCGAG-
G
AGTCCAACAAGTTCTACAAGGACAACATCAAGGCCGGCCAGCAGGGCCTCTCCGTCGCCTTCGACCTCGCCAC-
C
CACCGCGGCTACGACTCCGACAACCCCCGCGTCCGCGGCGACGTCGGCATGGCCGGCGTCGCCATCGACACCG-
T
CGAGGACACCAAGATCCTCTTCGACGGCATCCCCCTCGAGAAGATGTCCGTCTCCATGACCATGAACGGCGCC-
G
TCATCCCCGTCCTCGCCAACTTCATCGTCACCGGCGAGGAGCAGGGCGTCCCCAAGGAGAAGCTCACCGGCAC-
C
ATCCAGAACGACATCCTCAAGGAGTTCATGGTCCGCAACACCTACATCTTCCCCCCCGAGCCCTCCATGAAGA-
T
CATCGCCGACATCTTCGAGTACACCGCCAAGCACATGCCCAAGTTCAACTCCATCTCCATCTCCGGCTACCAC-
A
TGCAGGAGGCCGGCGCCGACGCCATCCTCGAGCTCGCCTACACCCTCGCCGACGGCCTCGAGTACTCCCGCAC-
C
GGCCTCCAGGCCGGCCTCACCATCGACGAGTTCGCCCCCCGCCTCTCCTTCTTCTGGGGCATCGGCATGAACT-
T
CTACATGGAGATCGCCAAGATGCGCGCCGGCCGCCGCCTCTGGGCCCACCTCATCGAGAAGATGTTCCAGCCC-
A
AGAACTCCAAGTCCCTCCTCCTCCGCGCCCACTGCCAGACCTCCGGCTGGTCCCTCACCGAGCAGGACCCCTA-
C
AACAACATCGTCCGCACCGCCATCGAGGCCATGGCCGCCGTCTTCGGCGGCACCCAGTCCCTCCACACCAACT-
C
CTTCGACGAGGCCCTCGGCCTCCCCACCGTCAAGTCCGCCCGCATCGCCCGCAACACCCAGATCATCATCCAG-
G
AGGAGTCCGGCATCCCCAAGGTCGCCGACCCCTGGGGCGGCTCCTACATGATGGAGTGCCTCACCAACGACGT-
C
TACGACGCCGCCCTCAAGCTCATCAACGAGATCGAGGAGATGGGCGGCATGGCCAAGGCCGTCGCCGAGGGCA-
T
CCCCAAGCTCCGCATCGAGGAGTGCGCCGCCCGCCGCCAGGCCCGCATCGACTCCGGCTCCGAGGTCATCGTC-
G
GCGTCAACAAGTACCAGCTCGAGAAGGAGGACGCCGTCGAGGTCCTCGCCATCGACAACACCTCCGTCCGCAA-
C
CGCCAGATCGAGAAGCTCAAGAAGATCAAGTCCTCCCGCGACCAGGCCCTCGCCGAGCGCTGCCTCGCCGCCC-
T
CACCGAGTGCGCCGCCTCCGGCGACGGCAACATCCTCGCCCTCGCCGTCGACGCCTCCCGCGCCCGCTGCACC-
G
TCGGCGAGATCACCGACGCCCTCAAGAAGGTCTTCGGCGAGCACAAGGCCAACGACCGCATGGTCTCCGGCGC-
C
TACCGCCAGGAGTTCGGCGAGTCCAAGGAGATCACCTCCGCCATCAAGCGCGTCCACAAGTTCATGGAGCGCG-
A
GGGCCGCCGCCCCCGCCTCCTCGTCGCCAAGATGGGCCAGGACGGCCACGACCGCGGCGCCAAGGTCATCGCC-
A
CCGGCTTCGCCGACCTCGGCTTCGACGTCGACATCGGCCCCCTCTTCCAGACCCCCCGCGAGGTCGCCCAGCA-
G
GCCGTCGACGCCGACGTCCACGCCGTCGGCGTCTCCACCCTCGCCGCCGGCCACAAGACCCTCGTCCCCGAGC-
T
CATCAAGGAGCTCAACTCCCTCGGCCGCCCCGACATCCTCGTCATGTGCGGCGGCGTCATCCCCCCCCAGGAC-
T
ACGAGTTCCTCTTCGAGGTCGGCGTCTCCAACGTCTTCGGCCCCGGCACCCGCATCCCCAAGGCCGCCGTCCA-
G
GTCCTCGACGACATCGAGAAGTGCCTCGAGAAGAAGCAGCAGTCCGTCTGATAATAGGCTGGAGCCTCGGTGG-
C
CATGCTTCTTGCCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCCGCATTATTAC-
T CACGGTACGAGTGGTCTTTGAATAAAGTCTGAGTGGGCGGC hMCM ORF
ATGTTAAGAGCTAAGAATCAGCTTTTTTTACTTTCACCTCATTACCTGAGGCAGGTAAAAGAATC-
ATCAGGCTC (SEQ ID
CAGGCTCATACAGCAACGACTTCTACACCAGCAACAGCCCCTTCACCCAGAATGGGCTGCCCTGGC-
TAAAAAGC NO: 775)
AGCTGAAAGGCAAAAACCCAGAAGACCTAATATGGCACACCCCGGAAGGGATCTCTATAAAACCC-
TTGTATTCC
AAGAGAGATACTATGGACTTACCTGAAGAACTTCCAGGAGTGAAGCCATTCACACGTGGACCATATCCTACCA-
T
GTATACCTTTAGGCCCTGGACCATCCGCCAGTATGCTGGTTTTAGTACTGTGGAAGAAAGCAATAAGTTCTAT-
A
AGGACAACATTAAGGCTGGTCAGCAGGGATTATCAGTTGCCTTTGATCTGGCGACACATCGTGGCTATGATTC-
A
GACAACCCTCGAGTTCGTGGTGATGTTGGAATGGCTGGAGTTGCTATTGACACTGTGGAAGATACCAAAATTC-
T
TTTTGATGGAATTCCTTTAGAAAAAATGTCAGTTTCCATGACTATGAATGGAGCAGTTATTCCAGTTCTTGCA-
A
ATTTTATAGTAACTGGAGAAGAACAAGGTGTACCTAAAGAGAAACTTACTGGTACCATCCAAAATGATATACT-
A
AAGGAATTTATGGTTCGAAATACATACATTTTTCCTCCAGAACCATCCATGAAAATTATTGCTGACATATTTG-
A
ATATACAGCAAAGCACATGCCAAAATTTAATTCAATTTCAATTAGTGGATACCATATGCAGGAAGCAGGGGCT-
G
ATGCCATTCTGGAGCTGGCCTATACTTTAGCAGATGGATTGGAGTACTCTAGGACTGGACTCCAGGCTGGCCT-
G
ACAATTGATGAATTTGCACCAAGGTTGTCTTTCTTCTGGGGAATTGGAATGAATTTCTATATGGAAATAGCAA-
A
GATGAGAGCTGGTAGAAGACTCTGGGCTCACTTAATAGAGAAAATGTTTCAGCCTAAAAACTCAAAATCTCTT-
C
TTCTAAGAGCACACTGTCAGACATCTGGATGGTCACTTACTGAGCAGGATCCCTACAATAATATTGTCCGTAC-
T
GCAATAGAAGCAATGGCAGCAGTATTTGGAGGGACTCAGTCTTTGCACACAAATTCTTTTGATGAAGCTTTGG-
G
TTTGCCAACTGTGAAAAGTGCTCGAATTGCCAGGAACACACAAATCATCATTCAAGAAGAATCTGGGATTCCC-
A
AAGTGGCTGATCCTTGGGGAGGTTCTTACATGATGGAATGTCTCACAAATGATGTTTATGATGCTGCTTTAAA-
G
CTCATTAATGAAATTGAAGAAATGGGTGGAATGGCCAAAGCTGTAGCTGAGGGAATACCTAAACTTCGAATTG-
A
AGAATGTGCTGCCCGAAGACAAGCTAGAATAGATTCTGGTTCTGAAGTAATTGTTGGAGTAAATAAGTACCAG-
T
TGGAAAAAGAAGACGCTGTAGAAGTTCTGGCAATTGATAATACTTCAGTGCGAAACAGGCAGATTGAAAAACT-
T
AAGAAGATCAAATCCAGCAGGGATCAAGCTTTGGCTGAACGTTGCCTTGCTGCACTAACCGAATGTGCTGCTA-
G
CGGAGATGGAAATATCCTGGCTCTTGCAGTGGATGCATCTCGGGCAAGATGTACAGTGGGAGAAATCACAGAT-
G
CCCTGAAAAAGGTATTTGGTGAACATAAAGCGAATGATCGAATGGTGAGTGGAGCATATCGCCAGGAATTTGG-
A
GAAAGTAAAGAGATAACATCTGCTATCAAGAGGGTTCATAAATTCATGGAACGTGAAGGTCGCAGACCTCGTC-
T
TCTTGTAGCAAAAATGGGACAAGATGGCOATGACAGAGGAGCAAAAGTTATTGCTACAGGATTTGCTGATCTT-
G
GTTTTGATGTGGACATAGGCCCTCTTTTCCAGACTCCTCGTGAAGTGGCCCAGCAGGCTGTGGATGCGGATGT-
G
CATGCTGTGGGCGTAAGCACCCTCGCTGCTGGTCATAAAACCCTAGTTCCTGAACTCATCAAAGAACTTAACT-
C
CCTTGGACGGCCAGATATTCTTGTCATGTGTGGAGGGGTGATACCACCTCAGGATTATGAATTTCTGTTTGAA-
G
TTGGTGTTTCCAATGTATTTGGTCCTGGGACTCGAATTCCAAAGGCTGCCGTTCAGGTGCTTGATGATATTGA-
G AAGTGTTTGGAAAAGAAGCAGCAATCTGTA hMCM ORF
ATGCTGAGGGCCAAGAACCAGCTGTTTCTCCTGTCGCCCCACTACCTGAGGCAGGTGAAGGAGTC-
CTCCGGCAG (SEQ ID
CAGGCTCATTCAGCAGAGGCTGTTGCACCAGCAGCAGCCCCTGCACCCAGAGTGGGCCGCCCTCGC-
CAAGAAGC NO: 776)
AGCTGAAGGGGAAGAACCCCGAGGACCTGATCTGGCATACGCCCGAGGGTATCTCCATAAAACCC-
CTCTACAGT
AAGAGGGACACCATGGACCTGCCCGAGGAACTGCCCGGCGTGAAGCCGTTCACGCGGGGCCCATACCCCACCA-
T
GTACACCTTCCGGCCGTGGACCATCAGGCAATACGCCGGCTTCAGCACCGTGGAGGAGAGCAACAAGTTCTAC-
A
AAGACAACATCAAAGCCGGTCAGCAAGGGCTGAGCGTAGCCTTCGACCTGGCCACCCACAGGGGCTACGACTC-
C
GACAACCCCAGGGTGCGCGGCGACGTGGGCATGGCCGGCGTGGCCATCGACACCGTGGAAGACACCAAGATCC-
T
CTTCGACGGCATCCCCCTGGAAAAGATGTCCGTGTCCATGACCATGAACGGGGCCGTTATACCGGTGCTGGCC-
A
ACTTCATAGTCACCGGCGAGGAGCAGGGGGTCCCGAAGGAGAAGTTAACCGGCACGATTCAGAACGACATCCT-
G
AAAGAGTTCATGGTGAGGAACACCTATATCTTCCCCCCCGAGCCCTCCATGAAAATCATCGCCGACATCTTCG-
A
GTACACCGCGAAGCACATGCCCAAGTTCAACTCCATCAGCATCTCCGGATATCACATGCAGGAAGCCGGCGCC-
G
ACGCCATCCTGGAGCTGGCCTACACCCTGGCGGACGGACTGGAGTACAGCCGCACGGGCCTGCAGGCGGGCCT-
G
ACCATAGACGAATTTGCCCCGCGGCTGAGCTTTTTCTGGGGGATCGGCATGAATTTCTACATGGAGATCGCCA-
A
GATGCGGGCCGGCAGACGGCTGTGGGCCCATCTGATCGAAAAAATGTTCCAGCCCAAAAACAGCAAGTCCCTG-
C
TGCTGCGGGCCCACTGCCAGACCAGCGGCTGGAGCCTGACCGAGCAGGACCCGTACAATAACATCGTGAGGAC-
C
GCCATCGAGGCCATGGCCGCCGTGTTCGGCGGGACGCAAAGCCTGCACACGAACTCCTTCGACGAGGCGCTCG-
G
CCTGCCCACCGTGAAGTCCGCTAGGATCGCCAGGAACACACAGATCATCATCCAGGAGGAGAGCGGCATCCCC-
A
AGGTGGCCGACCCCTGGGGCGGCTCCTACATGATGGAGTGCCTGACGAACGACGTGTACGACGCCGCCCTGAA-
G
CTGATCAACGAGATCGAGGAGATGGGCGGCATGGCCAAGGCCGTCGCCGAGGGCATCCCCAAGCTGCGCATCG-
A
GGAGTGCGCCGCCAGGCGCCAAGCCCGGATCGATAGCGGCAGCGAGGTGATCGTGGGGGTGAACAAGTACCAG-
C
TGGAGAAGGAGGACGCGGTCGAGGTCCTGGCCATAGACAACACGAGCGTGCGGAACAGGCAGATCGAGAAGCT-
C
AAGAAAATCAAGAGCAGCCGGGACCAGGCCCTGGCCGAAAGGTGCCTCGCCGCCCTCACGGAATGCGCCGCCA-
G
CGGCGACGGCAATATCCTGGCCCTGGCGGTCGATGCCAGCCGCGCTCGGTGCACCGTGGGGGAGATCACCGAT-
G
CCCTCAAGAAAGTGTTCGGGGAGCACAAGGCCAACGACAGGATGGTGTCCGGCGCCTACAGGCAGGAGTTCGG-
C
GAAAGCAAGGAAATCACGAGCGCCATCAAGCGGGTCCATAAGTTCATGGAGAGGGAGGGCCGGAGGCCCAGGC-
T
GCTCGTGGCCAAAATGGGCCAGGACGGCCATGACAGGGGCGCCAAGGTGATCGCCACCGGGTTCGCCGACCTC-
G
GCTTCGACGTGGACATCGGGCCGCTGTTCCAGACGCCGCGGGAGGTCGCCCAGCAAGCGGTGGACGCCGACGT-
G
CACGCCGTCGGGGTGAGCACCCTCGCCGCTGGGCATAAGACCCTGGTGCCCGAGCTGATCAAAGAGCTCAACA-
G
CCTCGGCAGGCCCGACATTCTCGTTATGTGCGGCGGCGTCATCCCGCCCCAGGACTACGAGTTCCTGTTTGAG-
G
TCGGCGTCTCCAACGTGTTCGGCCCAGGCACCAGGATCCCCAAGGCCGCCGTGCAGGTGTTGGACGATATCGA-
G AAATGCCTCGAGAAAAAGCAGCAGAGCGTC hMCM ORF
ATGCTGCGGGCCAAGAACCAGCTGTTCCTGCTGAGCCCCCACTACCTGCGGCAGGTGAAGGAGAG-
CAGCGGCAG (SEQ ID
CCGGCTGATCCAGCAGCGCCTCCTCCACCAGCAGCAGCCCCTCCACCCCGAGTGGGCCGCCCTCGC-
CAAGAAGC NO: 777)
AGCTCAAGGGCAAGAACCCCGAGGACCTCATCTGGCACACCCCCGAGGGCATCTCCATCAAGCCC-
CTCTACTCC
AAGCGCGACACCATGGACCTCCCCGAGGAGCTCCCCGGCGTCAAGCCCTTCACCCGCGGCCCCTACCCCACCA-
T
GTACACCTTCCGCCCCTGGACCATCCGCCAGTACGCCGGCTTCTCCACCGTCGAGGAGTCCAACAAGTTCTAC-
A
AGGACAACATCAAGGCCGGCCAGCAGGGCCTCTCCGTCGCCTTCGACCTCGCCACCCACCGCGGCTACGACTC-
C
GACAACCCCCGCGTCCGCGGCGACGTCGGCATGGCCGGCGTCGCCATCGACACCGTCGAGGACACCAAGATCC-
T
CTTCGACGGCATCCCCCTCGAGAAGATGTCCGTCTCCATGACCATGAACGGCGCCGTCATCCCCGTCCTCGCC-
A
ACTTCATCGTCACCGGCGAGGAGCAGGGCGTCCCCAAGGAGAAGCTCACCGGCACCATCCAGAACGACATCCT-
C
AAGGAGTTCATGGTCCGCAACACCTACATCTTCCCCCCCGAGCCCTCCATGAAGATCATCGCCGACATCTTCG-
A
GTACACCGCCAAGCACATGCCCAAGTTCAACTCCATCTCCATCTCCGGCTACCACATGCAGGAGGCCGGCGCC-
G
ACGCCATCCTCGAGCTCGCCTACACCCTCGCCGACGGCCTCGAGTACTCCCGCACCGGCCTCCAGGCCGGCCT-
C
ACCATCGACGAGTTCGCCCCCCGCCTCTCCTTCTTCTGGGGCATCGGCATGAACTTCTACATGGAGATCGCCA-
A
GATGCGCGCCGGCCGCCGCCTCTGGGCCCACCTCATCGAGAAGATGTTCCAGCCCAAGAACTCCAAGTCCCTC-
C
TCCTCCGCGCCCACTGCCAGACCTCCGGCTGGTCCCTCACCGAGCAGGACCCCTACAACAACATCGTCCGCAC-
C
GCCATCGAGGCCATGGCCGCCGTCTTCGGCGGCACCCAGTCCCTCCACACCAACTCCTTCGACGAGGCCCTCG-
G
CCTCCCCACCGTCAAGTCCGCCCGCATCGCCCGCAACACCCAGATCATCATCCAGGAGGAGTCCGGCATCCCC-
A
AGGTCGCCGACCCCTGGGGCGGCTCCTACATGATGGAGTGCCTCACCAACGACGTCTACGACGCCGCCCTCAA-
G
CTCATCAACGAGATCGAGGAGATGGGCGGCATGGCCAAGGCCGTCGCCGAGGGCATCCCCAAGCTCCGCATCG-
A
GGAGTGCGCCGCCCGCCGCCAGGCCCGCATCGACTCCGGCTCCGAGGTCATCGTCGGCGTCAACAAGTACCAG-
C
TCGAGAAGGAGGACGCCGTCGAGGTCCTCGCCATCGACAACACCTCCGTCCGCAACCGCCAGATCGAGAAGCT-
C
AAGAAGATCAAGTCCTCCCGCGACCAGGCCCTCGCCGAGCGCTGCCTCGCCGCCCTCACCGAGTGCGCCGCCT-
C
CGGCGACGGCAACATCCTCGCCCTCGCCGTCGACGCCTCCCGCGCCCGCTGCACCGTCGGCGAGATCACCGAC-
G
CCCTCAAGAAGGTCTTCGGCGAGCACAAGGCCAACGACCGCATGGTCTCCGGCGCCTACCGCCAGGAGTTCGG-
C
GAGTCCAAGGAGATCACCTCCGCCATCAAGCGCGTCCACAAGTTCATGGAGCGCGAGGGCCGCCGCCCCCGCC-
T
CCTCGTCGCCAAGATGGGCCAGGACGGCCACGACCGCGGCGCCAAGGTCATCGCCACCGGCTTCGCCGACCTC-
G
GCTTCGACGTCGACATCGGCCCCCTCTTCCAGACCCCCCGCGAGGTCGCCCAGCAGGCCGTCGACGCCGACGT-
C
CACGCCGTCGGCGTCTCCACCCTCGCCGCCGGCCACAAGACCCTCGTCCCCGAGCTCATCAAGGAGCTCAACT-
C
CCTCGGCCGCCCCGACATCCTCGTCATGTGCGGCGGCGTCATCCCCCCCCAGGACTACGAGTTCCTCTTCGAG-
G
TCGGCGTCTCCAACGTCTTCGGCCCCGGCACCCGCATCCCCAAGGCCGCCGTCCAGGTCCTCGACGACATCGA-
G AAGTGCCTCGAGAAGAAGCAGCAGTCCGTC hMCM ORF
ATGCTGCGGGCCAAGAACCAGCTGTTCCTGCTGAGCCCCCACTACCTGCGGCAGGTGAAGGAGAG-
CAGCGGCAG (SEQ ID
CCGGCTGATCCAGCAGCGCCTCCTCCACCAGCAGCAGCCCCTCCACCCCGAGTGGGCCGCCCTCGC-
CAAGAAGC NO: 778)
AGCTCAAGGGCAAGAACCCCGAGGACCTCATCTGGCACACCCCCGAGGGCATCTCCATCAAGCCC-
CTCTACTCC
AAGCGCGACACCATGGACCTCCCCGAGGAGCTCCCCGGCGTCAAGCCCTTCACCCGCGGCCCCTACCCCACCA-
T
GTACACCTTCCGCCCCTGGACCATCCGCCAGTACGCCGGCTTCTCCACCGTCGAGGAGTCCAACAAGTTCTAC-
A
AGGACAACATCAAGGCCGGCCAGCAGGGCCTCTCCGTCGCCTTCGACCTCGCCACCCACCGCGGCTACGACTC-
C
GACAACCCCCGCGTCCGCGGCGACGTCGGCATGGCCGGCGTCGCCATCGACACCGTCGAGGACACCAAGATCC-
T
CTTCGACGGCATCCCCCTCGAGAAGATGTCCGTCTCCATGACCATGAACGGCGCCGTCATCCCCGTCCTCGCC-
A
ACTTCATCGTCACCGGCGAGGAGCAGGGCGTCCCCAAGGAGAAGCTCACCGGCACCATCCAGAACGACATCCT-
C
AAGGAGTTCATGGTCCGCAACACCTACATCTTCCCCCCCGAGCCCTCCATGAAGATCATCGCCGACATCTTCG-
A
GTACACCGCCAAGCACATGCCCAAGTTCAACTCCATCTCCATCTCCGGCTACCACATGCAGGAGGCCGGCGCC-
G
ACGCCATCCTCGAGCTCGCCTACACCCTCGCCGACGGCCTCGAGTACTCCCGCACCGGCCTCCAGGCCGGCCT-
C
ACCATCGACGAGTTCGCCCCCCGCCTCTCCTTCTTCTGGGGCATCGGCATGAACTTCTACATGGAGATCGCCA-
A
GATGCGCGCCGGCCGCCGCCTCTGGGCCCACCTCATCGAGAAGATGTTCCAGCCCAAGAACTCCAAGTCCCTC-
C
TCCTCCGCGCCCACTGCCAGACCTCCGGCTGGTCCCTCACCGAGCAGGACCCCTACAACAACATCGTCCGCAC-
C
GCCATCGAGGCCATGGCCGCCGTCTTCGGCGGCACCCAGTCCCTCCACACCAACTCCTTCGACGAGGCCCTCG-
G
CCTCCCCACCGTCAAGTCCGCCCGCATCGCCCGCAACACCCAGATCATCATCCAGGAGGAGTCCGGCATCCCC-
A
AGGTCGCCGACCCCTGGGGCGGCTCCTACATGATGGAGTGCCTCACCAACGACGTCTACGACGCCGCCCTCAA-
G
CTCATCAACGAGATCGAGGAGATGGGCGGCATGGCCAAGGCCGTCGCCGAGGGCATCCCCAAGCTCCGCATCG-
A
GGAGTGCGCCGCCCGCCGCCAGGCCCGCATCGACTCCGGCTCCGAGGTCATCGTCGGCGTCAACAAGTACCAG-
C
TCGAGAAGGAGGACGCCGTCGAGGTCCTCGCCATCGACAACACCTCCGTCCGCAACCGCCAGATCGAGAAGCT-
C
AAGAAGATCAAGTCCTCCCGCGACCAGGCCCTCGCCGAGCGCTGCCTCGCCGCCCTCACCGAGTGCGCCGCCT-
C
CGGCGACGGCAACATCCTCGCCCTCGCCGTCGACGCCTCCCGCGCCCGCTGCACCGTCGGCGAGATCACCGAC-
G
CCCTCAAGAAGGTCTTCGGCGAGCACAAGGCCAACGACCGCATGGTCTCCGGCGCCTACCGCCAGGAGTTCGG-
C
GAGTCCAAGGAGATCACCTCCGCCATCAAGCGCGTCCACAAGTTCATGGAGCGCGAGGGCCGCCGCCCCCGCC-
T
CCTCGTCGCCAAGATGGGCCAGGACGGCCACGACCGCGGCGCCAAGGTCATCGCCACCGGCTTCGCCGACCTC-
G
GCTTCGACGTCGACATCGGCCCCCTCTTCCAGACCCCCCGCGAGGTCGCCCAGCAGGCCGTCGACGCCGACGT-
C
CACGCCGTCGGCGTCTCCACCCTCGCCGCCGGCCACAAGACCCTCGTCCCCGAGCTCATCAAGGAGCTCAACT-
C
CCTCGGCCGCCCCGACATCCTCGTCATGTGCGGCGGCGTCATCCCCCCCCAGGACTACGAGTTCCTCTTCGAG-
G
TCGGCGTCTCCAACGTCTTCGGCCCCGGCACCCGCATCCCCAAGGCCGCCGTCCAGGTCCTCGACGACATCGA-
G AAGTGCCTCGAGAAGAAGCAGCAGTCCGTC
Other Embodiments
[1709] It is to be understood that the words that have been used
are words of description rather than limitation, and that changes
can be made within the purview of the appended claims without
departing from the true scope and spirit of the disclosure in its
broader aspects.
[1710] While the present disclosure has been described at some
length and with some particularity with respect to the several
described embodiments, it is not intended that it should be limited
to any such particulars or embodiments or any particular
embodiment, but it is to be construed with references to the
appended claims so as to provide the broadest possible
interpretation of such claims in view of the prior art and,
therefore, to effectively encompass the intended scope of the
disclosure.
[1711] All publications, patent applications, patents, and other
references mentioned herein are incorporated by reference in their
entirety. In case of conflict, the present specification, including
definitions, will control. In addition, section headings, the
materials, methods, and examples are illustrative only and not
intended to be limiting.
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20190022019A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20190022019A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References