U.S. patent application number 16/007681 was filed with the patent office on 2019-01-03 for neuropeptide y-derived peptides.
The applicant listed for this patent is N.ae butted.stved Hospital, The University of Copenhagen. Invention is credited to Vladimir Berezin, Elisabeth Bock, Casper Rene Gotzsche, Kristian Klemp, David-Paul D. Woldbye.
Application Number | 20190002517 16/007681 |
Document ID | / |
Family ID | 48082801 |
Filed Date | 2019-01-03 |
![](/patent/app/20190002517/US20190002517A1-20190103-D00001.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00002.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00003.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00004.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00005.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00006.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00007.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00008.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00009.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00010.png)
![](/patent/app/20190002517/US20190002517A1-20190103-D00011.png)
View All Diagrams
United States Patent
Application |
20190002517 |
Kind Code |
A1 |
Woldbye; David-Paul D. ; et
al. |
January 3, 2019 |
NEUROPEPTIDE Y-DERIVED PEPTIDES
Abstract
The present invention discloses peptide fragments derived from
neuropeptide Y (NPY), which are capable of selective binding to the
neural cell adhesion molecule (NCAM) and inducing neuroplastic and
neuroprotective effects, and the use of said peptide fragments as
neuritogenic agents for treatment of pathological conditions in
which neuroprotection and neuroplastic changes are desired, such as
brain and retina disorders.
Inventors: |
Woldbye; David-Paul D.;
(Copenhagen O, DK) ; Gotzsche; Casper Rene;
(Copenhagen O, DK) ; Klemp; Kristian;
(Charlottenlund, DK) ; Berezin; Vladimir;
(Copenhagen N, DK) ; Bock; Elisabeth;
(Charlottenlund, DK) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The University of Copenhagen
N.ae butted.stved Hospital |
Copenhagen K
N.ae butted.stved |
|
DK
DK |
|
|
Family ID: |
48082801 |
Appl. No.: |
16/007681 |
Filed: |
June 13, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14782912 |
Oct 7, 2015 |
10017554 |
|
|
PCT/DK2014/050086 |
Apr 10, 2014 |
|
|
|
16007681 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 38/00 20130101;
A61K 38/2271 20130101; C07K 14/57545 20130101; A61K 45/06
20130101 |
International
Class: |
C07K 14/575 20060101
C07K014/575; A61K 45/06 20060101 A61K045/06; A61K 38/22 20060101
A61K038/22 |
Foreign Application Data
Date |
Code |
Application Number |
Apr 10, 2013 |
DK |
PA201370193 |
Claims
1.-18. (canceled)
19. A nucleic acid construct encoding a peptide derived from
neuropeptide Y (NPY) (SEQ ID NO:22), wherein said peptide is
selected from the group consisting of: a peptide consisting of 33
contiguous amino acid residues having the sequence
SKPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY3-35, SEQ ID NO: 1), a
peptide consisting of 32 contiguous amino acid residues having the
sequence KPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY4-35, SEQ ID NO: 2),
a peptide consisting of 31 contiguous amino acid residues having
the sequence PDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY5-35, SEQ ID NO:
3), a peptide consisting of 30 contiguous amino acid residues
having the sequence DNPGEDAPAEDMARYYSALRHYINLITRQR (NPY6-35, SEQ ID
NO: 4), a peptide consisting of 29 contiguous amino acid residues
having the sequence NPGEDAPAEDMARYYSALRHYINLITRQR (NPY7-35, SEQ ID
NO: 5), a peptide consisting of 28 contiguous amino acid residues
having the sequence PGEDAPAEDMARYYSALRHYINLITRQR (NPY8-35, SEQ ID
NO: 6), a peptide consisting of 27 contiguous amino acid residues
having the sequence GEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID
NO: 7), a peptide consisting of 26 contiguous amino acid residues
having the sequence EDAPAEDMARYYSALRHYINLITRQR (NPY10-35, SEQ ID
NO: 8), a peptide consisting of 25 contiguous amino acid residues
having the sequence DAPAEDMARYYSALRHYINLITRQR (NPY11-35, SEQ ID NO:
9), a peptide consisting of 24 contiguous amino acid residues
having the sequence APAEDMARYYSALRHYINLITRQR (NPY12-35, SEQ ID NO:
10), a peptide consisting of 23 contiguous amino acid residues
having the sequence PAEDMARYYSALRHYINLITRQR (NPY13-35, SEQ ID NO:
11), a peptide consisting of 22 contiguous amino acid residues
having the sequence AEDMARYYSALRHYINLITRQR (NPY14-35, SEQ ID NO:
12), a peptide consisting of 21 contiguous amino acid residues
having the sequence EDMARYYSALRHYINLITRQR (NPY15-35, SEQ ID NO:
13), a peptide consisting of 20 contiguous amino acid residues
having the sequence DMARYYSALRHYINLITRQR (NPY16-35, SEQ ID NO: 14),
a peptide consisting of 19 contiguous amino acid residues having
the sequence MARYYSALRHYINLITRQR (NPY17-35, SEQ ID NO: 15), a
peptide consisting of 18 contiguous amino acid residues having the
sequence ARYYSALRHYINLITRQR (NPY8-35, SEQ ID NO: 16), a peptide
consisting of 17 contiguous amino acid residues having the sequence
RYYSALRHYINLITRQR (NPY19-35, SEQ ID NO: 17), a peptide consisting
of 16 contiguous amino acid residues having the sequence
YYSALRHYINLITRQR (NPY20-35, SEQ ID NO: 18), and a peptide
consisting of 15 contiguous amino acid residues having the sequence
YSALRHYINLITRQR (NPY21-35, SEQ ID NO: 19), or a variant of any one
of the above peptides, wherein said variant comprises 1) one
conservative amino acid substitution in the core sequence
YSALRHYINLITROR (NPY21-35, SEQ ID NO: 19), 2) one amino acid
substitution outside said core sequence, or 3) both 1) and 2),
provided that the peptide has at least 90% sequence identity to any
one of the above peptides, wherein said peptide or variant thereof
stimulates neurite outgrowth, and wherein said peptide or variant
thereof does not bind to and/or does not activate cognate
NPY-receptors Y1, Y2 and/or Y5.
20. The nucleic acid construct according to claim 19, wherein said
nucleic acid construct is an expression vector or a plasmid.
21. A delivery vehicle comprising a nucleic acid construct
according to claim 19.
22. The delivery vehicle according to claim 21, wherein said
delivery vehicle is selected from the group consisting of: RNA
based vehicles, DNA based vehicles or vectors, chemical delivery
vehicles, lipid based vehicles (e.g. a liposome), polymer based
vehicles (e.g. a cationic polymer DNA carrier), colloidal gold
particles (e.g. coating), virally derived DNA or RNA vehicles or
vectors and carrier-free delivery.
23. The delivery vehicle according to claim 21, wherein said
vehicle is a viral vector selected from the group consisting of
adenoviruses, retroviruses, lentiviruses, adeno-associated viruses,
recombinant adeno-associated viruses (rAAV), herpesviruses,
vaccinia viruses, foamy viruses, cytomegaloviruses, Semliki forest
virus, poxviruses, RNA virus vector and DNA virus vector.
24. The nucleic acid construct according to claim 19, wherein said
nucleic acid construct encodes a peptide selected from the group
consisting of: TABLE-US-00006 (NPY3-35, SEQ ID NO: 1)
SKPDNPGEDAPAEDMARYYSALRHYINLIFRQR (NPY4-35, SEQ ID NO: 2)
KPDNPGEDAPAEDMARYYSALRHYINLITRQR, (NPY5-35, SEQ ID NO: 3)
PDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY6-35, SEQ ID NO: 4)
DNPGEDAPAEDMARYYSALRHYINLITRQR (NPY7-35, SEQ ID NO: 5)
NPGEDAPAEDMARYYSALRHYINLITRQR (NPY8-35, SEQ ID NO: 6)
PGEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID NO: 7)
GEDAPAEDMARYYSALRRYINLITRQR, (NPY10-35, SEQ ID NO: 8)
EDAPAEDMARYYSALRHYINLITRQR, (NPY11-35, SEQ ID NO: 9)
DAPAEDMARYYSALRHYINLITRQR, (NPY12-35, SEQ ID NO: 10)
APAEDMARYYSALRHYINLITRQR (NPY13-35, SEQ ID NO: 11)
PAEDMARYYSALRHYINLITRQR, (NPY14-35, SEQ ID NO: 12)
AEDMARYYSALRHYINLITRQR, (NPY15-35, SEQ ID NO: 13)
EDMARYYSALRHYINLITRQR, (NPY16-35, SEQ ID NO: 14)
DMARYYSALRHYINLITRQR, (NPY17-35, SEQ ID NO: 15)
MARYYSALRHYINLITRQR, (NPY18-35, SEQ ID NO: 16) ARYYSALRHYINLITRQR,
(NPY19-35, SEQ ID NO: 17) RYYSALRHYINLITRQR, (NPY20-35, SEQ ID NO:
18) YYSALRHYINLITRQR, and (NPY21-35, SEQ. ID NO: 19)
YSALRHYINLITRQR.
25. The nucleic acid construct according to claim 19, wherein said
nucleic acid construct encodes a peptide which is a monomer.
26. The nucleic acid construct according to claim 19, wherein said
nucleic acid construct encodes a peptide which is a multimer
comprising two or more peptides.
27. A method of treating a disease or disorder of the central
nervous system selected from the group consisting of a
neurodegenerative disorder or disease, stroke, and epilepsy and an
eye disease involving neurons and/or stimulating learning and
memory, said method comprising administering to an individual in
need thereof a composition comprising a nucleic acid construct
according to claim 19.
28. The method according to claim 27, wherein said eye disease
involving neurons is selected from the group consisting of: a
retinal disease; an optic nerve disease; retinal dystrophy or
degeneration; retinal detachment; a retinopathy; macular
degeneration; retinitis pigmentosa; cone-rod dystrophy; glaucoma;
retinal vein occlusion; artery vein occlusion; uveitis; ocular
hypertension; optic neuropathies; optic neuritis; optic nerve
hypoplasia; Leber's congenital amaurosis (LCA); lipemia retinalis;
eye injuries; angioid streaks; and cancers of the retina.
29. The method according to claim 27, wherein said composition
comprising a nucleic acid construct is administered directly into
an eye of an individual in need thereof.
30. The method according to claim 27, wherein said composition
comprising a nucleic acid construct is administered in combination
with one or more further active ingredients and/or surgery.
31. The nucleic acid construct according to claim 30, wherein said
composition comprising a nucleic acid construct is administered
simultaneously, separately or sequentially with respect to said one
or more further active ingredients or surgery.
32. The nucleic acid construct according to claim 30, wherein said
further active ingredient comprises an agent capable of inhibiting
vascular endothelial growth factor (VEGF).
Description
REFERENCE TO RELATED APPLICATION
[0001] This application is a divisional of U.S. patent application
Ser. No. 14/782,912, filed Oct. 7, 2015, which is a U.S. national
stage application of PCT/DK2014/050086, filed Apr. 10, 2014, which
claims priority from Denmark patent application No. PA201370193,
filed Apr. 10, 2013. The entire content of each application is
incorporated herein by reference.
FIELD OF THE INVENTION
[0002] The present invention provides neuropeptide Y (NPY)-derived
peptide fragments and their use for treating diseases and disorders
of the eye and central nervous system.
BACKGROUND OF THE INVENTION
[0003] Neuropeptide Y (NPY) is a 36 amino acid-long polypeptide
(NPY1-36; SEQ ID NO:22) widely distributed in the central and
peripheral nervous system of mammals. NPY is the most abundant
neuropeptide in the brain and is known to induce vasoconstriction,
to inhibit noradrenaline release at a pre-synaptic level, and to
regulate diverse functions including blood pressure, stress, pain,
hormone secretion, reproduction, circadian rhythm and food intake.
NPY has been implicated in feeding disorders, epilepsy,
hypertension, pain disorders, depression and anxiety.
[0004] NPY is known to bind and stimulate receptors belonging to
the GPCR family, also known as seven-transmembrane receptors (7TM);
including Y1, Y2, Y3, Y4, Y5 and Y6 (aka y6). In the central
nervous system, NPY predominantly acts via Y1, Y2 and Y5. These 7TM
receptors display different affinities for full-length NPY and
N-terminally truncated fragments thereof such as NPY3-36; a
physiological cleavage product which loses affinity for the Y1
receptor to become an Y2/Y5 receptor agonist. NPY is known to exert
neuroprotective and neurogenic effects reported to occur via
activation of the GPCR NPY-receptors.
[0005] Nyce et al (U.S. Pat. No. 6,426,330) discloses NPY fragments
of between 8 to 18 amino acids in length with a D-Thr amino acid
substitution of the Thr32 position. A few specific peptide
sequences are mentioned comprising the most C-terminal amino acid
at position 36 of NPY, such as NPY27-36. The peptides are used for
inducing satiety and lowering blood pressure.
[0006] During et al. (US2010/0168215) discloses expression vectors
comprising a nucleic acid encoding NPY or a functional fragment
thereof. The vector is for treating a neurological disease. The
functional fragment of NPY is defined as retaining activity of full
length NPY, namely being capable of binding to cognate
NPY-receptors (especially Y2). Specific fragments include NPY2-36,
NPY13-36, NPY16-36 and NPY18-36, thus the disclosed fragments
include the most C-terminal amino acid at position 36 of NPY.
[0007] Boublik et al (U.S. Pat. No. 5,026,685 and U.S. Pat. No.
5,328,899) discloses NPY analogues (NPY19-36 and NPY 17-36,
respectively) shortened at the N-terminus, and their use i.a. for
lowering blood pressure.
[0008] Abid et al. (J Biol Chem Vol 284, No 37, pp. 24715-24724,
2009) discloses that NPY1-36 is rapidly cleaved in serum to produce
three main fragments namely NPY3-36, NPY3-35 and NPY2-36. NPY3-35
is shown to be unable to bind NPY Y1, Y2 and Y5 receptors and thus
it is concluded to represent the major metabolic clearance product
of the Y2/Y5 agonist NPY3-36.
[0009] Current clinical trials involving NPY are largely focused on
treating obesity although its more recently discovered
neuroprotective and neurogenic effects make it a potential
candidate for treating nervous system disorders including
depression, Alzheimer's disease, Parkinson's disease and epilepsy.
However, NPY-based treatments have a range of potential serious
adverse effects because of the broad functions exerted by the
various GPCR NPY-receptors targeted: As an example, targeting Y1
via NPY is likely to cause hypertension, anxiety, depression and
altered pain perception.
SUMMARY OF THE INVENTION
[0010] NPY is known to bind to and exert its various biological
effects through NPY receptors Y1-Y6. NPY as an Y1-Y6 ligand or
agonist is dependent on amino acid residue 36 (Tyr36), which
position is amidated. It has previously been shown that NPY not
comprising Tyr36 lacks the classical NPY effects such as on food
intake which is mediated through the classical or cognate
NPY-receptors (Y1-Y6). Also, NPY3-35 is known in the art as a
degradation product with no biological effects through the known
NPY-receptors.
[0011] The present inventors have now surprisingly found that not
only NPY/NPY 1-36 (SEQ ID NO:22) but in particular specified
peptide fragments thereof not comprising Tyr36, including fragments
such as NPY3-35 (SEQ ID NO:1), bind to NCAM (neural cell adhesion
molecule), an interaction that has not previously been identified.
Specifically, NPY and specified fragments thereof according to the
present invention, bind predominantly to the Ig1 module of NCAM, in
the area where two NCAM molecules would otherwise interact.
[0012] This new finding of an interaction with NCAM potentially
holds promise of achieving new effects of specified NPY fragments,
which effects may be achieved even in the absence of Tyr36 of
NPY1-36. Without residue Tyr36, the NPY fragments will not bind to
and activate the cognate NPY-receptors thus effectively avoiding
the risk of adverse effects through general activation of Y1-Y6
receptors.
[0013] The present inventors have surprisingly found that specified
NPY peptides according to the present invention have several
neuronal effects, which have not previously been associated with
such NPY peptides, namely stimulating neuritogenesis, increasing
neuronal survival and neuroplasticity.
[0014] These properties make the NPY fragments of the present
invention potentially useful for treatment of a range of diseases
and disorders where neuritogenic, neuroplastic and neuroprotective
effects are desired, in particular disorders of the central nervous
system or brain, and the eye or retina/optic nerve.
[0015] Surprisingly, the NPY peptides according to the present
invention are even more potent that full-length NPY with respect to
at least inducing neuritogenesis, and with respect to
neuroprotection. Furthermore, the NPY peptides according to the
present invention surprisingly increase or enhance long-term
potentation, whereas full-length NPY even has the opposite
effect.
[0016] Thus, provided herein is an isolated peptide consisting of a
peptide sequence of from 15 to 33 contiguous amino acid residues
derived from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said
peptide comprises the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID
NO:19), or a functional variant having at least 60% sequence
identity to SEQ ID NO:19, wherein said peptide does not comprise
the Tyr amino acid of position 36 of SEQ ID NO:22, for use in a
method of treating a disease or disorder of the central nervous
system and/or the eye.
[0017] Said peptide for use in a method of treating a disease or
disorder of the central nervous system and/or the eye may be
selected from the group consisting of SEQ ID NOs:1-19 (NPY3-35 to
NPY21-35), or a functional variant thereof having at least 60%
sequence identity thereto.
[0018] Also provided herein is an isolated peptide consisting of a
peptide sequence of 15 to 32 contiguous amino acid residues derived
from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said peptide
comprises the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19), or
a functional variant having at least 60% sequence identity to SEQ
ID NO:19, wherein said peptide does not comprise the Tyr amino acid
of position 36 of NPY (SEQ ID NO:22).
[0019] Said isolated peptide may be selected from the group
consisting of SEQ ID NOs:2-19 (NPY4-35 to NPY21-35), or a
functional variant thereof having at least 60% sequence identity
thereto.
[0020] The NPY-fragment peptides according to the present invention
may be formulated as a monomer, or as a multimer comprising two,
three, four or more peptides.
[0021] It is also an aspect of the present invention to provide a
nucleic acid construct encoding a peptide consisting of a peptide
sequence of from 15 to 33 contiguous amino acid residues derived
from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said peptide
comprises or consists of the sequence YSALRHYINLITRQR (NPY21-35;
SEQ ID NO:19), or a functional variant having at least 60% sequence
identity to SEQ ID NO:19, wherein said peptide does not comprise
the Tyr amino acid of position 36 of SEQ ID NO:22; and also their
use in a method of treating a disease or disorder of the central
nervous system and/or the eye.
[0022] Said nucleic acid construct may be comprised in a delivery
vehicle, such as a delivery vector, such as a viral vector. Said
viral vector may be a recombinant adeno-associated virus (rAAV)
vector.
[0023] The disease or disorder of the eye to be treated according
to the present invention is preferably a retinal or optic nerve
disease or disorder. Said retinal or optic nerve disorder may be
selected from the group consisting of retinal detachment,
retinopathies including diabetic, radiation and hypertension
retinopathies, macular degeneration such as age-related macular
degeneration (AMD) of any stage, retinitis pigmentosa, cone-rod
dystrophy, glaucoma, optic neuropathies, Leber's congenital
amaurosis (LCA), lipemia retinalis, eye injury, angioid streaks,
myopic degeneration, retinal vein and artery occlusion, ocular
ischemic syndrome, uveitis/vasculitis, and cancers of the retina
including retinoblastoma and metastatic eye cancer.
[0024] For the treatment of retinal or optic nerve disorders, said
peptide or nucleic acid construct encoding said peptide, may be
administered directly into the eye by means of intravitreal or
subretinal administration.
[0025] The peptide or nucleic acid construct encoding said peptide
of the invention may also be used for treatment of a disease or
disorder of the central nervous system, including neurodegenerative
disorder such as Parkinson's disease, Alzheimer's disease,
Huntington's disease Amyotrophic lateral sclerosis (ALS),
spinocerebellar ataxias, Multiple Sclerosis, and other
polyglutamine diseases.
[0026] The peptide or nucleic acid construct encoding said peptide
of the invention may also be used for treatment of a disease or
disorder of the central nervous system, including stroke, epilepsy
and peripheral nerve lesion.
[0027] For the treatment of CNS disorders, said peptide or nucleic
acid construct encoding said peptide may be administered directly
into the brain or brain area by means of intracerebral or
intrathecal administration.
BRIEF DESCRIPTION OF THE DRAWINGS
[0028] FIGS. 1A-1D show SPR measurement of NPY and NPY3-35 binding
to NCAM. The Ig1 or Ig2 module of NCAM was immobilized on a sensor
chip and a series of peptide fragments of NPY or NPY antagonists
injected to obtain binding and dissociation curves by use of
surface plasmon resonance (SPR) (Biacore 2000). CPON=C-Flanking
Peptide of Neuropeptide Y, RU=resonance units. FIG. 1A: NPY and
NPY3-35 binds to the NCAM Ig1-module. FIG. 1B: NPY and NPY3-35
binds to the Ig2-module. FIG. 1C: NCAM Ig1 was coupled to the chip
and binding to NPY was measured in a concentration range between 10
.mu.M and 160 .mu.M (1-5). CPON at a concentration of 80 .mu.M was
used as a negative control (6). FIG. 1D: NCAM Ig1 was coupled to
the chip and binding to NPY3-35 was measured in a concentration
range between 10 .mu.M and 160 .mu.M (1-5). A peptide with the
reverse amino acid sequence of NPY3-35 was used as a negative
control (6).
[0029] FIGS. 2A-2F shows that NPY binds and activates G-protein
coupled receptors Y1, Y2 and Y5, while NPY3-35 does not. FIG. 2A:
NPY displaces I.sup.125-NPY binding to cognate NPY receptors Y1, Y2
and Y5 in HEK293 cell cultures overexpressing Y1, Y2 or Y5
receptors, while NPY3-35 does not. FIG. 2B: NPY but not NPY3-35
could stimulate activation of G-protein coupled receptors in the
agonist stimulated [35S]GTPgammaS functional binding assay (scale
bar=1 .mu.m). FIG. 2C shows quantitative measures of the levels of
binding seen in FIG. 2B. FIG. 2D: NPY3-35 could displace
125I-labelled NPY3-35 binding NCAM-180-expressing HEK293 cells, but
not after NCAM knockdown which per se decreased the 125I-labelled
NPY3-35 binding. FIGS. 2E-2F: NCAM knockdown was confirmed by
immunoblotting.
[0030] FIG. 3 shows that NPY and NPY3-35 induce neurite outgrowth
in E19 prenatal rat hippocampal cultures (24 h). **P<0.01,
***P<0.001 vs. control, Dunnett's post-hoc test after
significant repeated-measures one-way ANOVA.
[0031] FIG. 4 shows that the neuritogenic effect of NPY is not
mediated through the cognate NPY-receptors Y1, Y2 and Y5;
administration of NPY receptor agonists does not negatively affect
neurite outgrowth induced by NPY (A: NPY Y1 receptor agonist
BIBP3226; B: NPY Y2 receptor agonist BIIE0246 and C: NPY Y5
receptor agonist L-152,804). **P<0.01, ***P<0.001 vs.
control, Dunnett's post-hoc test after significant
repeated-measures one-way ANOVA.
[0032] FIG. 5 shows that the neuritogenic effect of NPY and NPY3-35
is not mediated through the cognate NPY-receptors Y1, Y2 and Y5;
administration of NPY Y1, Y2 and Y5 receptor agonists BIBP3226,
BIIE0246 and L-152,804 in combination does not negatively affect
neurite outgrowth. **P<0.01, ***P<0.001 vs. control,
Dunnett's post-hoc test after significant repeated-measures one-way
ANOVA.
[0033] FIG. 6 shows that the neuritogenic effect of NPY and NPY3-35
is mediated through interaction with NCAM as NCAM knockdown
abolishes the beneficial effects of NPY and NPY3-35 on neurite
outgrowth. Knockdown achieved with short-hairpin DNA plasmid
targeting NCAM. **P<0.01, ***P<0.001 vs. corresponding
control, ##P<0.01 vs. NPY- or NPY3-35-treated control cultures,
Bonferroni post-hoc test after significant one-way ANOVA.
[0034] FIGS. 7A-7C show that NPY does not induce neurite outgrowth
in NCAM-KO (knock-out) mice. FIG. 7A shows four panels, labeled D,
E, F, and G, of Microscopy images. Panel D of FIG. 7A shows:
Neurite outgrowth in wild-type mouse neuronal cultures after
addition of 9 .mu.M NPY ligand. Panel F of FIG. 7A shows: Neurite
outgrowth in wild-type mouse neuronal cultures, control treatment.
Panel E of FIG. 7A shows: Neurite outgrowth in neuronal cultures
from NCAM knock-out mice with addition of 9 .mu.M NPY ligand. Panel
G of FIG. 7A shows: Neurite outgrowth in neuronal cultures from
NCAM KO mice, control treatment. Prenatal cultures. FIGS. 7B and 7C
show graphical illustrations of neuritogenic effect of NPY (a) and
NPY3-35 (b) on wildtype and NCAM-/- cells (neuronal cultures from
WT or NCAM KO mice). **P<0.01, ***P<0.001 vs. control,
Dunnett's post-hoc test after significant repeated-measures one-way
ANOVA.
[0035] FIGS. 8A and 8B show that NPY and NPY3-35 signalling via
NCAM is blocked by addition of Ig1 module. Neuritogenic effects of
NPY FIG. 8A and NPY3-35 FIG. 8B are abolished or diminished after
addition of Ig1, not Ig3 module. **P<0.01, ***P<0.001 vs.
control, +P<0.05, +++P<0.001 vs. NPY- or NPY3-35-treated
control cultures, Bonferroni post-hoc test after significant
one-way ANOVA.
[0036] FIGS. 9A-9E show mechanisms of NPY and NPY3-35 neuritogenic
effects in rat hippocampal neuron cultures. FIG. 9A shows that a
peptide with reverse sequence of NPY3-35
(YRQRTILNIYHRLASYYRAMDEAPADEGPNDPKSPY; SEQ ID NO:45) did not induce
the same neuritogenic effects as seen with NPY3-35. *: p<0.05,
**: p<0.01, compared to untreated controls (one-way ANOVA,
follow by Dunnett's post hoc test n=2-6). FIGS. 9B and 9C show that
inhibition of two well described signaling pathways used by NCAM
when inducing neurite outgrowth, also abrogated the neuritogenic
effects of NPY and NPY3-35. NPY and NPY3-35 induce NCAM-mediated
neurite outgrowth via both Fyn/Fak and FGFR pathways. Use of
specific pharmacological inhibitors of these pathways (PP2:
Inhibititor of src family of tyrosine kinases (Fyn) and SU5402:
Inhibitor of tyrosine kinase activity of FGFR1) inhibited the
neuritogenic effects of NPY (FIG. 9B) and NPY3-35 (FIG. 9C) on
neurite outgrowth. **P<0.01, ***P<0.001 vs. control,
#P<0.05, ##P<0.01, ###P<0.001 vs. NPY- or NPY3-35-treated
cultures, Bonferroni post-hoc test after significant one-way ANOVA.
FIGS. 9D and 9E show that FGFR plays an important role in NPY and
NPY3-35 induced neuritogenesis, as evident by the absent
neuritogenic effects of (FIG. 9D) NPY and (FIG. 9E) NPY3-35 in
cultures with kinase-defect dominant negative versions of FGFR1. *:
p<0.0.sup.5, **: p<0.01, ***: p<0.001, compared to
untreated controls or control vector transfectants
(repeated-measures one-way ANOVA, follow by Dunnett's post hoc test
n=3-6).
[0037] FIGS. 10A-10M show that NPY and NPY3-35 induce NCAM
dependent neurite outgrowth. To investigate potential neuritogenic
effects of NPY and derived peptides we added peptides to freshly
prepared hippocampal neuronal cultures from rat fetuses, embryonic
day 19. Neuritogenic effects of NPY (FIG. 10A) and NPY3-35 (FIG.
10F) were absent in neurons deprived of NCAM (FIGS. 10B, 10G) and
in neurons from NCAM (-/-) knockout mice (FIGS. 10C, 10H). The
neuritogenic effects of 1 M NPY or NPY3-35 were also attenuated by
addition of 1 .mu.M soluble NCAM Ig1 but not Ig3 modules (FIGS.
10D, 10I) whereas a mixture of NPY Y1, Y2, and Y5 receptor
antagonists (Y1: BIBP3226, Y2: BIIE0246, Y5: L-152,804; 0.1-10
.mu.M of each) was ineffective (FIGS. 10E, 10J). *: p<0.05, **:
p<0.01, ***: p<0.001, compared to untreated controls or
control vector transfectants (repeated-measures one-way ANOVA,
follow by Dunnett's post hoc test n=4-8. Representative images of
cell cultures treated with vehicle (FIG. 10K), 1 .mu.M NPY (FIG.
10L) or 1 .mu.M NPY3-35 (FIG. 10M), scale bar=20 .mu.m.
[0038] FIGS. 11A-11C show differential effects of NPY and NPY3-35
on synaptic neurotransmission in the hippocampus. FIG. 11A shows
that in acute rat slice preparations, supplication of NPY3-35
caused a slight but significant increase in the magnitude of evoked
fEPSPs (fast excitatory postsynaptic potentials) when compared to
ACSF (artificial cerebrospinal fluid (control)) in CA1 synapses,
whereas NPY strongly attenuated the magnitude of fEPSPs. ACSF is
without effect. Paired pulse stimulation in the stratum radiatum of
the rat CA1 Schaffer collateral-CA pyramidal synapse. 0.067 Hz
stimulation. Stimulation and recording electrodes are both in the
CA1 stratum radiatum. Solid black horizontal bar shows 10-min
period for peptide application. FIG. 11B shows that NPY3-35
application causes a small, but significant, increase in the
magnitude of evoked fEPSPs as revealed by the average during 30 min
after the application of peptide has ended. *p<0.05,
***p<0.001 vs. ACSF, Bonferroni-adjusted post-hoc t-test
following significant one-way ANOVA. FIG. 11C, bottom, shows that
consistent with a stimulatory effect on excitatory transmission,
the paired-pulse facilitation (PPF) ratio decreases slightly
following NPY3-35 application whereas NPY induces significant
increase in the PPF ratio (1-10 vs. 21-30 min). At 61-70 min,
complete washout is observed for NPY, but not for NPY3-35. FIG.
11C, top, shows that the PPF ratio is unaltered during ACSF
conditions. Representative traces show average paired-pulse fEPSPs
recorded during baseline (1-10 min, black lines) and after
peptide/ACSF application (21-30 min, red lines NPY, blue line
NPY3-35). Scale bar applies for all traces. *p<0.05,
**p<0.01, ***p<0.001, paired t-test; NPY, n=8 slices, 7
animals; NPY3-35, n=8 slices, 7 animals; ACSF, n=8 slices, 4
animals.
[0039] FIGS. 12A-12C show that NPY3-35 enhances LTP (long term
potentiation) in the mouse hippocampus while NPY inhibits LTP. FIG.
12A shows that the effect of NPY3-35 is blocked by addition of
soluble Ig1 module, confirming involvement of NCAM Ig1 module in
mediating the effects of NPY3-35 on LTP. Rat Schaeffer collateral
CA1 pyramidal synapses were stimulated and the field potentials in
the stratum radiatum of CA1 were recorded. The stimulus intensity
was set 30 .mu.A above threshold. After 15-min baseline was
obtained by stimulating at 0.05 Hz. Subsequently (first arrow),
either NPY3-35 (1 .mu.M; n=7), NPY3-35+Ig1 (both 1 .mu.M; n=5), NPY
(1 .mu.M; n=5), or control ACSF (n=8) was applied to the
extracellular medium. After 15 min (second arrow), LTP was induced
by stimulating the Schaffer collaterals. Data are normalized to
15-min baseline before application of peptide. FIG. 12B shows that
the statistical analysis of the average effect on fEPSP slopes
during the 30-min after induction of LTP normalized to 10-min
interval immediately before induction of LTP, confirms the effects
reported in d. *p<0.05, **p<0.01, Bonferroni-adjusted
post-hoc t-test following significant one-way ANOVA. FIG. 12C shows
traces showing average effects on fEPSPs during baseline (black
curves) and after induction of LTP (lighter curves).
[0040] FIGS. 13A-13E show that NPY and NPY3-35 increase the
synaptic densities in a NCAM-dependent manner in hippocampal
neurons. Rat hippocampal neurons were seeded on a confluent glia
cell layer in culture chamber slides, and grown for 14 days
(37.degree. C., 5% CO2). After the first 6 days, in vitro, the
cultures were lipofectamin transfected with a plasmid with the
coding sequence for green fluorescence protein. At day 14, 1 .mu.M
of NPY or NPY3-35 were added 2, 6, or 24 hours before the cultures
were fixated and immunostained for presynaptic protein synapsin 1
and presynaptic protein PSD-95. Punctas with colocalized
GFP-positive cells (green), synapsin 1 (red) and PSD-95 (blue) were
regarded as synapses and the synapse density was estimated from
total number of punctas per area. To investigate NCAM dependence of
any effects a subset of cultures were incubated with peptide
together with soluble NCAM Ig1. FIG. 13A shows how NPY and NPY3-35
significantly increased synaptic density at 2 hours, and NPY3-35
also after 6 hours, an effect which was shown to be NCAM dependent
since co-incubation with NCAM Ig1 abolished the effect. FIG. 13B
shows a representative micrograph of one of the neurons in the
study (scale bar=20 .mu.m). FIG. 13C shows a magnified dendrite
from the boxed area in FIG. 13B, with white arrows pointing to
synaptic punctas (scale bar=4 .mu.m). The observed NPY and NPY3-35
induced upregulations in synaptic densities was only correlated
with upregulations in (FIG. 13E) postsynaptic PSD-95, whereas no
changes was seen in (FIG. 13D) synapsin 1 levels. Statistics:
*P<0.05 versus control, one-way ANOVA, followed by Tukeys post
hoc test (control n=9, NPY n=7-9, NPY3-35 n=7-8, NPY+Ig1 n=6,
NPY3-35+Ig1 n=5-6, Ig1 n=3-5).
[0041] FIGS. 14A-14D show that NPY3-35 improves consolidation of
spatial memory in rats performing the water maze test. NPY3-35
treated animals display shorter escape latencies to find platform
at the first trial on day 2 and 3 (a:T4 and T7) of training than
vehicle treated rats indicating improved memory of platform
location. The Morris Water Maze test: Reference memory training
consisted of 3 consecutive trials daily for 3 days. Each trial
started with the animal being placed in the water facing the wall
of the pool. The starting position differed for each trial but was
identical for all animals. In each trial, the animal was allowed 90
s to locate the platform. On the first 3 days immediately after
training, the animals were given a 4 .mu.l intracerebroventricular
injection of either NPY3-35 (10 nmol) or saline. To test for the
effects on long-term memory, the animals were given a 60 s probe
trial 24 h, 1 and 2 weeks after reference memory training. In the
probe trials, the platform was removed, and the animals started
from a position in a quadrant adjacent to the original platform
quadrant. Subsequently, after the 24 h and 1 wk probe trial, the
animal was given one relearning trial under conditions identical to
reference memory training to counteract memory extinction. NPY3-35
(10 nmol; indicated by arrows) improved the memory in rats as seen
by lower latency times in the Morris Water maze task (FIG. 14A),
and increased searching time in the platform quadrant in the probe
test 2 weeks later (FIG. 14B). The memory enhancing effect was
abolished when soluble NCAM Ig1 module (10 nmol) was injected
together with NPY3-35, consistent with the NCAM specific effect of
NPY3-35. *: p<0.05, **p<0.01 (Student's t-test, two-tailed,
n=15-20 in each group). (FIGS. 14C, 14D) NPY3-35 facilitates
hippocampal upregulations in synaptic proteins 24 hours after three
training trials and a single ICV injection. (FIG. 14C)
Synaptotagmin, pCaMKII, sphinophilin, PSD-95 and AMPAR GluR2
subunit were all found to be upregulated, whereas synapsin1,
synaptophysin, PKCalfa, GluR1 and NMDR were unaffected. *:
p<0.05, (Student's t-test, two-tailed, n=5 in each group) (FIG.
14D) Immunoblots corresponding to data in FIG. 14C. FIGS. 14E, 14F
show that the improved memory after NPY3-35 treatment was blocked
by adding Ig1-module (disrupts binding to NCAM) and lasted at least
2 weeks (end of experiment) as shown by better performance in a
classical probe test. *P<0.05, **P<0.01 vs. vehicle,
Bonferroni post-hoc test after significant ANOVA.
[0042] FIG. 15 shows the neuroprotective effects of NPY and NPY3-35
in kainate treated neurons. Neuropetide Y (NPY1-36) and NPY3-35
protects hippocampal neurons against kainate-induced
excitotoxicity. Hippocampal neurons from rat embryos, embryonic
stage day 19, were cultivated for 7 days before incubation with 300
.mu.M kainate for 24 hrs. NPY or NPY3-35 was added 1 hour before
kainate addition. Data are shown as mean values.+-.SEM (n=8). 100%
corresponds to untreated controls and 0% corresponds to kainate
treated cultures. *P<0.05, **P<0.01, ***P<0.001,
repeated-measures one-way ANOVA with Dunnett's post-hoc test versus
kainate treated cultures.
[0043] FIG. 16 shows that NPY21-35 induces neurite outgrowth in E19
prenatal rat hippocampal cultures (24 h). This peptide is the
shortest peptide that induces neuritogenesis as a monomer, when
amino acids are removed successively from the N-terminus of
NPY3-35. I.e. NPY3-35 to NPY21-35 induce neuritogenesis, while i.a.
NPY22-35 does not (cf. example 2 for further data of neuritogenic
effects of specified fragments).
DEFINITIONS AND ABBREVIATIONS
[0044] Affinity: the strength of binding between receptors and
their ligands.
[0045] The term "agonist" in the present context refers to a
peptide as defined herein, capable of binding to and activating a
receptor.
[0046] The term "Individual" refers to vertebrates, particular
members of the mammalian species, preferably primates including
humans. As used herein, `subject` and `individual` may be used
interchangeably.
[0047] A "polypeptide", "peptide" or "protein" is a polymer of
amino acid residues preferably joined exclusively by peptide bonds,
whether produced naturally or synthetically. The term "polypeptide"
as used herein covers proteins, peptides and polypeptides, wherein
said proteins, peptides or polypeptides may or may not have been
post-translationally modified.
[0048] A peptide is usually shorter in length than a protein, and
single-chained.
[0049] An "isolated polypeptide" is a polypeptide separated and/or
recovered from a component of their natural, typically cellular,
environment, that is essentially free from contaminating cellular
components, such as carbohydrate, lipid, or other proteinaceous
impurities associated with the polypeptide in nature. Typically, a
preparation of isolated polypeptide contains the polypeptide in a
highly purified form, i.e., at least about 80% pure, at least about
90% pure, at least about 95% pure, greater than 95% pure, or
greater than 99% pure. One way to show that a particular protein
preparation contains an isolated polypeptide is by the appearance
of a single band following sodium dodecyl sulfate
(SDS)-polyacrylamide gel electrophoresis of the protein preparation
and Coomassie Brilliant Blue staining of the gel. However, the term
"isolated" does not exclude the presence of the same polypeptide in
alternative physical forms, such as dimers, tetramers or
alternatively glycosylated or derived forms.
[0050] An "amino acid residue" can be a natural or non-natural
amino acid residue linked peptide bonds or bonds different from
peptide bonds. The amino acid residues can be in D-configuration or
L-configuration. An amino acid residue comprises an amino terminal
part (NH.sub.2) and a carboxy terminal part (COOH) separated by a
central part comprising a carbon atom, or a chain of carbon atoms,
at least one of which comprises at least one side chain or
functional group. NH.sub.2 refers to the amino group present at the
amino terminal end of an amino acid or peptide, and COOH refers to
the carboxy group present at the carboxy terminal end of an amino
acid or peptide. The generic term amino acid comprises both natural
and non-natural amino acids. Natural amino acids of standard
nomenclature as listed in J. Biol. Chem., 243:3552-59 (1969) and
adopted in 37 C.F.R., section 1.822(b)(2) belong to the group of
amino acids listed in Table 1 herein below. Non-natural amino acids
are those not listed in Table 1. Also, non-natural amino acid
residues include, but are not limited to, modified amino acid
residues, L-amino acid residues, and stereoisomers of D-amino acid
residues.
TABLE-US-00001 TABLE 1 Natural amino acids and their respective
codes. Symbols 1-Letter 3-Letter Amino acid Y Tyr tyrosine G Gly
glycine F Phe phenylalanine M Met methionine A Ala alanine S Ser
serine I Ile isoleucine L Leu leucine T Thr threonine V Val valine
P Pro proline K Lys lysine H His histidine Q Gln glutamine E Glu
glutamic acid W Trp tryptophan R Arg arginine D Asp aspartic acid N
Asn asparagine C Cys cysteine
[0051] An "equivalent amino acid residue" refers to an amino acid
residue capable of replacing another amino acid residue in a
polypeptide without substantially altering the structure and/or
functionality of the polypeptide. Equivalent amino acids thus have
similar properties such as bulkiness of the side-chain, side chain
polarity (polar or non-polar), hydrophobicity (hydrophobic or
hydrophilic), pH (acidic, neutral or basic) and side chain
organization of carbon molecules (aromatic/aliphatic). As such,
"equivalent amino acid residues" can be regarded as "conservative
amino acid substitutions".
[0052] The classification of equivalent amino acids refers in one
embodiment to the following classes: 1) HRK, 2) DENQ, 3) C, 4)
STPAG, 5) MILV and 6) FYW.
[0053] Within the meaning of the term "equivalent amino acid
substitution" as applied herein, one amino acid may be substituted
for another, in one embodiment, within the groups of amino acids
indicated herein below: [0054] i) Amino acids having polar side
chains (Asp, Glu, Lys, Arg, His, Asn, Gin, Ser, Thr, Tyr, and Cys,)
[0055] ii) Amino acids having non-polar side chains (Gly, Ala, Val,
Leu, Ile, Phe, Trp, Pro, and Met) [0056] iii) Amino acids having
aliphatic side chains (Gly, Ala Val, Leu, Ile) [0057] iv) Amino
acids having cyclic side chains (Phe, Tyr, Trp, His, Pro) [0058] v)
Amino acids having aromatic side chains (Phe, Tyr, Trp) [0059] vi)
Amino acids having acidic side chains (Asp, Glu) [0060] vii) Amino
acids having basic side chains (Lys, Arg, His) [0061] viii) Amino
acids having amide side chains (Asn, Gin) [0062] ix) Amino acids
having hydroxy side chains (Ser, Thr) [0063] x) Amino acids having
sulphur-containing side chains (Cys, Met), [0064] xi) Neutral,
weakly hydrophobic amino acids (Pro, Ala, Gly, Ser, Thr) [0065]
xii) Hydrophilic, acidic amino acids (Gin, Asn, Glu, Asp), and
[0066] xiii) Hydrophobic amino acids (Leu, Ile, Val)
[0067] In the present context the standard one-letter code for
amino acid residues as well as the standard three-letter code is
applied. Abbreviations for amino acids are in accordance with the
recommendations in the IUPAC-IUB Joint Commission on Biochemical
Nomenclature Eur. J. Biochem, 1984, vol. 184, pp 9-37. Throughout
the application either the three letter code or the one letter code
for natural amino acids are used. Where the L or D form (optical
isomers) has not been specified it is to be understood that the
amino acid in question has the natural L form, cf. Pure & Appl.
Chem. Vol. (56(5) pp 595-624 (1984) or the D form, so that the
peptides formed may be constituted of amino acids of L form, D
form, or a sequence of mixed L forms and D forms.
[0068] A "Bioactive agent" (i. e., biologically active
substance/agent) is any agent, drug, compound, composition of
matter or mixture which provides some pharmacologic, often
beneficial, effect that can be demonstrated in-vivo or in vitro. It
may refer to the peptide sequences according to the present
invention, compounds or compositions comprising these and nucleic
acid constructs encoding said peptides. As used herein, this term
further includes any physiologically or pharmacologically active
substance that produces a localized or systemic effect in an
individual. Further examples of bioactive agents include, but are
not limited to, agents comprising or consisting of an
oligosaccharide, agents comprising or consisting of a
polysaccharide, agents comprising or consisting of an optionally
glycosylated peptide, agents comprising or consisting of an
optionally glycosylated polypeptide, agents comprising or
consisting of a nucleic acid, agents comprising or consisting of an
oligonucleotide, agents comprising or consisting of a
polynucleotide, agents comprising or consisting of a lipid, agents
comprising or consisting of a fatty acid, agents comprising or
consisting of a fatty acid ester and agents comprising or
consisting of secondary metabolites. It may be used either
prophylactically, therapeutically, in connection with treatment of
an individual, such as a human or any other animal.
[0069] The terms "drug", "medicament" as used herein include
biologically, physiologically, or pharmacologically active
substances that act locally or systemically in the human or animal
body.
[0070] The terms "treatment" and "treating" as used herein refer to
the management and care of a patient for the purpose of combating a
condition, disease or disorder. The term is intended to include the
full spectrum of treatments for a given condition from which the
patient is suffering, and refer equally to curative therapy,
prophylactic or preventative therapy and ameliorating or palliative
therapy, such as administration of the peptide or composition for
the purpose of: alleviating or relieving symptoms or complications;
delaying the progression of the condition, partially arresting the
clinical manifestations, disease or disorder; curing or eliminating
the condition, disease or disorder; amelioration or palliation of
the condition or symptoms, and remission (whether partial or
total), whether detectable or undetectable; and/or preventing or
reducing the risk of acquiring the condition, disease or disorder,
wherein "preventing" or "prevention" is to be understood to refer
to the management and care of a patient for the purpose of
hindering the development of the condition, disease or disorder,
and includes the administration of the active compounds to prevent
or reduce the risk of the onset of symptoms or complications. The
term "palliation", and variations thereof, as used herein, means
that the extent and/or undesirable manifestations of a
physiological condition or symptom are lessened and/or time course
of the progression is slowed or lengthened, as compared to not
administering compositions of the present invention.
[0071] The individual to be treated is preferably a mammal, in
particular a human being. Treatment of animals, such as mice, rats,
dogs, cats, cows, horses, sheep and pigs, is, however, also within
the scope of the present invention.
[0072] An "individual in need thereof" refers to an individual who
may benefit from the present invention. In one embodiment, said
individual in need thereof is a diseased individual, wherein said
disease may be a disease or disorder of the CNS and/or eye.
[0073] A "treatment effect" or "therapeutic effect" is manifested
if there is a change in the condition being treated, as measured by
the criteria constituting the definition of the terms "treating"
and "treatment." There is a "change" in the condition being treated
if there is at least 5% improvement, preferably 10% improvement,
more preferably at least 25%, even more preferably at least 50%,
such as at least 75%, and most preferably at least 100%
improvement. The change can be based on improvements in the
severity of the treated condition in an individual, or on a
difference in the frequency of improved conditions in populations
of individuals with and without treatment with the bioactive agent,
or with the bioactive agent in combination with a pharmaceutical
composition of the present invention. A treatment according to the
invention may be prophylactic, ameliorating or curative.
"Pharmacologically effective amount", "pharmaceutically effective
amount" or "physiologically effective amount" of a "bioactive
agent" is the amount of an active agent present in a pharmaceutical
composition as described herein that is needed to provide a desired
level of active agent in the bloodstream or at the site of action
in an individual (e.g. the lungs, the gastric system, the
colorectal system, prostate, etc.) to be treated to give an
anticipated physiological response when such composition is
administered. The precise amount will depend upon numerous factors,
e.g., the active agent, the activity of the composition, the
delivery device employed, the physical characteristics of the
composition, intended patient use (i.e. the number of doses
administered per day), patient considerations, and the like, and
can readily be determined by one skilled in the art, based upon the
information provided herein. An "effective amount" of a bioactive
agent can be administered in one administration, or through
multiple administrations of an amount that total an effective
amount, preferably within a 24-hour period. It can be determined
using standard clinical procedures for determining appropriate
amounts and timing of administration. It is understood that the
"effective amount" can be the result of empirical and/or
individualized (case-by-case) determination on the part of the
treating health care professional and/or individual.
[0074] The terms "enhancing" and "improving" a beneficial effect,
and variations thereof, as used herein, refers to the therapeutic
effect of the bioactive agent against placebo, or an increase in
the therapeutic effect of a state-of-the-art medical treatment
above that normally obtained when a pharmaceutical composition is
administered without the bioactive agent of this invention. "An
increase in the therapeutic effects" is manifested when there is an
acceleration and/or increase in intensity and/or extent of the
therapeutic effects obtained as a result of administering the
bioactive agent(s). It also includes extension of the longevity of
therapeutic benefits. It can also manifest where a lower amount of
the pharmaceutical composition is required to obtain the same
benefits and/or effects when it is co-administered with bioactive
agent(s) provided by the present invention as compared to the
administration in a higher amount of the pharmaceutical composition
in the absence of bioactive agent. The enhancing effect preferably,
but not necessarily, results in treatment of acute symptoms for
which the pharmaceutical composition alone is not effective or is
less effective therapeutically. Enhancement is achieved when there
is at least a 5% increase in the therapeutic effects, such as at
least 10% increase in the therapeutic effects when a bioactive
agent of the present invention is co-administered with a
pharmaceutical composition compared with administration of the
pharmaceutical composition alone. Preferably the increase is at
least 25%, more preferably at least 50%, even more preferably at
least 75%, most preferably at least 100%.
[0075] "Co-administering" or "co-administration" of bioactive
agents/peptides of the invention and state-of-the-art medicaments,
as used herein, refers to the administration of one or more
bioactive agents of the present invention, or administration of one
or more bioactive agents of the present invention and a
state-of-the-art pharmaceutical composition within a certain time
period. The time period is preferably less than 72 hours, such as
48 hours, for example less than 24 hours, such as less than 12
hours, for example less than 6 hours, such as less than 3 hours.
However, these terms also mean that the bioactive agent and a
therapeutic composition can be administered together.
[0076] Due to the imprecision of standard analytical methods,
molecular weights and lengths of polymers are understood to be
approximate values. When such a value is expressed as "about" X or
"approximately" X, the stated value of X will be understood to be
accurate to +/-20%, such as +/-10%, for example +/-5%.
DETAILED DESCRIPTION OF THE INVENTION
[0077] Pro-neuropeptide Y is a 97-amino acid long peptide (SEQ ID
NO:32) which is cleaved into the following 2 chains: Neuropeptide Y
(alternative name: neuropeptide tyrosine), and C-flanking peptide
of NPY (Short name=CPON: SEQ ID NO:33).
[0078] Neuropeptide Y (NPY; NPY1-36; SEQ ID NO:22) is a highly
conserved 36-amino acid endogenous peptide neurotransmitter, the
most abundant neuropeptide in the brain and the autonomic nervous
system of humans. Classically, the effects of NPY1-36 are mediated
through binding to cognate NPY-receptors with varying degree. AT
least six NPY receptors have been identified so far; Y1, Y2, Y3,
Y4, Y5 and Y6; five NPY receptors in mammals: Y1, Y2, Y4, Y5 and Y6
(or y6; used interchangeably herein). They are G-protein coupled
receptors belonging to the 7TM (7 transmembrane domains)
family.
[0079] These receptors display different affinities for different
forms of NPY. The Y1 receptor has highest affinity for full-length
NPY, while Y2 and Y5 bind and are stimulated by full-length NPY and
N-terminally truncated NPY. The physiological effects associated
with the Y1 and Y2 receptors are the best known; exposure to a Y1
agonist causes an increase in blood pressure and potentiates
postsynaptically the action of other vasoactive substances, whereas
Y2 receptors are mainly located presynaptically, and upon
stimulation mediate the inhibition of neurotransmitter release.
Moreover, Y2 exerts a negative-feedback pathway in that its
activation by NPY or NPY fragments in turn negatively regulates NPY
release.
[0080] NPY is a prototype of peptide whose function can be altered
by proteases. Among peptidases displaying a high affinity for NPY,
the primary role appears to be played by serine-type protease
dipeptidyl peptidase IV (CD26) that releases an N-terminal
dipeptide. By cleaving the N-terminal Tyr-Pro dipeptide off NPY
CD26 generates NPY3-36, a truncated form that loses its affinity
for the Y1 receptor and becomes a Y2/Y5 receptor agonist. NPY can
also be degraded by aminopeptidase P (AmP) by removing the
N-terminal tyrosine from NPY to generate NPY2-36, a selective Y2
agonist. It has been indicated that the 36th, 35th, and 33rd
residues of NPY analogues may also be removed by
carboxypeptidases.
[0081] In addition to the brain, NPY and its receptors are
expressed throughout the body, both in the central nervous system
(CNS) and in the sympathetic nervous system. NPY regulates
cardiovascular and other sympathetic functions together with
norepinephrine. NPY displays vasoconstrictor activity exerted by
inhibiting Ca.sup.2+-activated K.sup.+ channels in vascular smooth
muscle, and it has been implicated in the control of blood
pressure, sexual behaviour, food intake, neurological disorders,
alcoholism, bone physiology, regulation of energy, circadian
rhythms, balance, memory and learning.
[0082] Further, NPY plays an important role in mood disorders,
anxiety, epilepsy and depression. Central NPY levels in the
cerebrospinal fluid are low in subjects suffering from depression
and correlate inversely with anxiety. Anti-depressant-like effects
can be achieved in mice by administering a Y2 antagonist or a Y1
agonist. Y1 has also been implicated in the mediation of adult
neuronal proliferation and hippocampal neurogenesis. Importantly,
the effects of NPY are commonly accepted to be a result of its
interactions with its 7TM receptors.
[0083] Because NPY and the 7TM receptors are thought to be involved
in so many pathways, NPY-based treatments such as treatments
involving receptor agonists are likely to cause severe pleiotropic
effects, such as obesity, anxiety and hypertension.
[0084] NPY1-36 is characterised by C-terminal amidation of amino
acid at position 36 (Tyr36), which amino acid position and its
amidation is important for its classical binding to the cognate
NPY-receptors (Y1-Y6/y6) (Berglund et al. 2003).
[0085] Interestingly, the present inventors have now identified
herein a hitherto unknown interaction between NPY and NCAM (Neural
Cell Adhesion Molecule). This novel interaction with NCAM is shown
herein not only for full-length NPY1-36 and certain N-terminally
truncated fragments, but to a greater extent for specified NPY
fragments not comprising Tyr36, including NPY3-35 (SEQ ID NO:1).
This interaction is shown herein to occur predominantly through
binding to the Ig1 module of NCAM (i.e. where two NCAM molecules
usually interact--NCAM homophilic cis-interaction). No binding is
observed to the Ig3 module of NCAM.
[0086] NPY1-36 retains its binding capability to its cognate
NPY-receptors (Y1-Y6) besides the new interaction with NCAM.
However, the peptide fragments of the present invention not
comprising Tyr36 (SEQ ID NO:s 1-19), including NPY3-35 (SEQ ID
NO:1), interacts with NCAM without a concomitant binding of the
cognate NPY-receptors. This may largely be due to the lack of Tyr36
of SEQ ID NO:s 1-19.
[0087] Thus, both NPY1-36 and peptide fragments of the present
invention in some embodiments not comprising Tyr36 (SEQ ID NO:s
1-19), including NPY3-35, bind to NCAM, and there are overlapping
biological effects associated with this binding to a certain
degree. However, SEQ ID NO:s 1-19 binds to NCAM without a
concomitant binding to and stimulation of the cognate
NPY-receptors. Thus, the SEQ ID NO:s 1-19-NCAM binding is highly
specific. This holds great potential in reducing the risk of
adverse effects associated with administering NPY1-36, by avoiding
the general activation of the cognate NPY-receptors.
[0088] Thus, SEQ ID NO:s 1-19, and functional variants thereof are
potential new candidates for a much more specific induction of
neuroprotective and neurogenic effects. This holds true even for
NPY3-35 (SEQ ID NO:1) which has hitherto been regarded as an
inactive degradation product of NPY.
Neural Cell Adhesion Molecule (NCAM)
[0089] NCAM is a homophilic binding glycoprotein expressed on the
surface of neurons, glia, skeletal muscle and natural killer cells.
NCAM has been implicated as having a role in cell-cell adhesion,
neurite outgrowth, synaptic formation and plasticity, path-finding
of axons, early synaptogenesis, synaptic maturation and learning
and memory. Many aspects of neuronal development involve cell-cell
adhesion mechanisms; these include neuronal cell migration,
axon-bundle and synapse formation, formation of glial networks
surrounding axons and synapses.
[0090] NCAM is a member of the Ig superfamily Cell Adhesion
Molecules (CAMs) and is found predominantly in the synapses.
Evidence suggests that NCAM mediates neuritogenesis by signalling
via the Fibroblast growth factor receptor (FGFR) and the p59Fyn
signalling pathway. NCAM comprises five Ig-like domains (Ig1, Ig2,
Ig3, Ig4 and Ig5) and two fibronectin type III (FNIII) repeats.
NCAM is known to have heterophilic and homophilic interactions with
various ligands at the synapses. The different domains of NCAM have
different roles, with the Ig domains being involved in homophilic
(NCAN-NCAM) binding, while the FNIII domains are involved in
signalling leading to neurite outgrowth.
[0091] Alternative splicing of NCAM results in at least 27
isoforms, of which the main three vary only by their cytoplasmic
domain: NCAM-120 kDa (GPI anchored); NCAM-140 kDa (short
cytoplasmic domain); NCAM-180 kDa (long cytoplasmic domain). NCAM
can also be modified by the insertion of minor exons, which can
modulate its activities. NCAM can further be modified by the
addition to its fifth Ig domain of the negatively charged,
polysialic acid (PSA) which appears to play an important role in
the synapse formation mediated by NCAM. PSA has indeed been shown
to be important for long-term potentiation (LTP). NCAM further
interacts with to brain derived neurotrophic factor (BDNF) and to
Glial cell-derived neurotrophic factor (GDNF).
Peptides of the Present Invention
[0092] The present inventors have identified novel NPY fragments
and surprisingly found that the NPY peptides according to the
present invention have several neuronal effects, which effects have
not previously been associated with such NPY peptides, namely
[0093] i) Neuritogenic properties, e.g. are capable of stimulating
neurite outgrowth, [0094] ii) Neuroprotective properties, e.g. are
capable of enhancing neuronal cell survival/neuroprotection, and
[0095] iii) Neuroplastic effects, e.g. having an effect on LTP
(long-term potentiation) and memory consolidation.
[0096] These properties make the NPY fragments of the present
invention potentially useful for treatment of a range of diseases
and disorders where neuritogenic, neuroplastic and/or
neuroprotective effects are desired, in one embodiment disorders of
the central nervous system or brain, and the eye especially the
retina and optic nerve.
[0097] These effects on neurons surprisingly occur through a
specific and new interaction with NCAM, and not via the cognate
NPY-receptors.
[0098] Thus, the NPY peptides according to the present invention in
one embodiment are capable of interacting (i.e. interacts) with
and/or binding to NCAM. In one embodiment the NPY peptides
according to the present invention are capable of interacting with
and/or binding to NCAM via the Ig1 module, and/or the Ig2 module of
NCAM, and/or not the Ig3 module of NCAM.
[0099] In another embodiment, the NPY peptides according to the
present invention do not bind to and/or do not stimulate or
activate the cognate NPY-receptors. In one embodiment said cognate
NPY-receptors comprise G-protein coupled receptors, in one
embodiment receptors Y1, Y2 and/or Y5.
[0100] In one embodiment the NPY peptides according to the present
invention are potent inducers of neuritogenesis, and/or
neuroprotectors.
[0101] In one embodiment the NPY peptides according to the present
invention increase or enhance LTP.
Peptide for Use
[0102] It is an aspect of the present invention to provide an
isolated peptide consisting of a peptide sequence of from 15 to 33
contiguous amino acid residues derived from neuropeptide Y (NPY)
(SEQ ID NO:22),
wherein said peptide comprises or consists of the sequence
YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19), or a functional variant
having at least 60% sequence identity to SEQ ID NO:19, wherein said
peptide does not comprise the Tyr amino acid of position 36 of SEQ
ID NO:22, for use in a method of treating a disease or disorder of
the central nervous system and/or the eye.
[0103] The terms `peptide` and `isolated peptide` may be used
interchangeably herein. The terms `variant` and `functional
variant` may be used interchangeably herein.
[0104] It is also an aspect of the present invention to provide a
peptide consisting of 15 to 33 contiguous amino acid residues
derived from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said
peptide comprises at least the sequence YSALRHYINLITRQR (NPY21-35;
SEQ ID NO:19), or a variant thereof,
wherein said peptide does not comprise the Tyr amino acid of
position 36 of SEQ ID NO:22, for use in a method of treating a
disease or disorder of the central nervous system and/or the
eye.
[0105] In one embodiment there is provided provide a peptide
consisting of 15 to 33 contiguous amino acid residues derived from
neuropeptide Y (NPY) (SEQ ID NO:22),
said peptide comprising at least the sequence YSALRHYINLITRQR
(NPY21-35; SEQ ID NO: 19), or a variant thereof, said peptide not
comprising the Tyr amino acid of position 36 of SEQ ID NO:22,
wherein said peptide is selected from the group consisting of:
TABLE-US-00002 (NPY3-35, SEQ ID NO: 1)
SKPDNPGEDAPAEDMARYYSALRHYINLITRQR, (NPY4-35, SEQ ID NO: 2)
KPDNPGEDAPAEDMARYYSALRHYINLITRQR, (NPY5-35, SEQ ID NO: 3)
PDNPGEDAPAEDMARYYSALRHYINLITRQR, (NPY6-35, SEQ ID NO: 4)
DNPGEDAPAEDMARYYSALRHYINLITRQR, (NPY7-35, SEQ ID NO: 5)
NPGEDAPAEDMARYYSALRHYINLITRQR, (NPY8-35, SEQ ID NO: 6)
PGEDAPAEDMARYYSALRHYINLITRQR, (NPY9-35, SEQ ID NO: 7)
GEDAPAEDMARYYSALRRYINLITRQR, (NPY10-35, SEQ ID NO: 8)
EDAPAEDMARYYSALRHYINLITRQR, (NPY11-35, SEQ ID NO: 9)
DAPAEDMARYYSALRHYINLITRQR, (NPY12-35, SEQ ID NO: 10)
APAEDMARYYSALRHYINLITRQR (NPY13-35, SEQ ID NO: 11)
PAEDMARYYSALRHYINLITRQR, (NPY14-35, SEQ ID NO: 12)
AEDMARYYSALRHYINLITRQR, (NPY15-35, SEQ ID NO: 13)
EDMARYYSALRHYINLITRQR, (NPY16-35, SEQ ID NO: 14)
DMARYYSALRHYINLITRQR, (NPY17-35, SEQ ID NO: 15)
MARYYSALRHYINLITRQR, (NPY18-35, SEQ ID NO: 16) ARYYSALRHYINLITRQR,
(NPY19-35, SEQ ID NO: 17) RYYSALRHYINLITRQR, (NPY20-35, SEQ ID NO:
18) YYSALRHYINLITRQR, and (NPY21-35, SEQ. ID NO: 19)
YSALRHYINLITRQR.
or a variant thereof, for use in a method of treating a disease or
disorder of the central nervous system and/or the eye.
[0106] A peptide that `comprises or consist of` a sequence means
that the peptide may either comprise the sequence, consist of the
sequence, or comprise at least the full sequence. A peptide that
`comprises at least` a peptide sequence, such as `comprising at
least the sequence YSALRHYINLITRQR` means that the peptide will
include all of the peptide sequence YSALRHYINLITRQR (NPY21-35; SEQ
ID NO:19). It does, however, not exclude that additional components
or amino acids may be present.
[0107] In one embodiment the peptide according to the present
invention for use in a method of treating a disease or disorder of
the central nervous system and/or the eye is a variant having at
least 60% sequence identity to any one of SEQ ID NO:s 1 to 19, such
as at least 65% sequence identity, for example at least 70%
sequence identity, such as at least 75% sequence identity, for
example at least 80% sequence identity, such as at least 85%
sequence identity, for example at least 90% sequence identity, such
as at least 95% sequence identity, for example at least 99%
sequence identity to any one of SEQ ID NO: s 1 to 19.
[0108] In another embodiment, the peptide according to the present
invention for use in a method of treating a disease or disorder of
the central nervous system and/or the eye is a variant having at
from 60 to 65% sequence identity, for example from 65 to 70%
sequence identity, such as from 70 to 75% sequence identity, for
example from 75 to 80% sequence identity, such as from 80 to 85%
sequence identity, for example from 85 to 90% sequence identity,
such as from 90 to 95% sequence identity, for example from 95 to
99% sequence identity to any one of SEQ ID NO: s 1 to 19.
[0109] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is selected from the group consisting of: SEQ ID NO: 1, SEQ
ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6,
SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO:
11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ
ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19; or
a functional variant having at least 60% sequence identity to a
peptide selected from the group consisting of SEQ ID NO: 1, SEQ ID
NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ
ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11,
SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID
NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19.
[0110] In another embodiment said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye has at least 60% sequence identity, such as at least 65%
sequence identity, for example at least 70% sequence identity, such
as at least 75% sequence identity, for example at least 80%
sequence identity, such as at least 85% sequence identity, for
example at least 90% sequence identity, such as at least 95%
sequence identity, for example at least 99% sequence identity to a
peptide selected from the group consisting of SEQ ID NO: 1, SEQ ID
NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ
ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11,
SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID
NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19.
[0111] It follows that said peptide for use in a method of treating
a disease or disorder of the central nervous system and/or the eye
may in one embodiment have from 60% to 65 sequence identity, such
as from 65 to 70% sequence identity, for example from 70 to 75%
sequence identity, such as from 75 to 80% sequence identity, for
example from 80 to 85% sequence identity, such as from 85 to 90%
sequence identity, for example from 90 to 95% sequence identity,
such as from 95 to 99% sequence identity to a peptide selected from
the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3,
SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO:
8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ
ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO:
17, SEQ ID NO: 18 and SEQ ID NO: 19.
[0112] In one embodiment the peptide according to the present
invention for use in a method of treating a disease or disorder of
the central nervous system and/or the eye is a variant having
between 1-10 amino acid substitutions as compared to any one of SEQ
ID NO:s 1 to 19, such as 1 amino acid substitution, for example 2
amino acid substitutions, such as 3 amino acid substitutions, for
example 4 amino acid substitutions, such as 5 amino acid
substitutions, for example 6 amino acid substitutions, such as 7
amino acid substitutions, for example 8 amino acid substitutions,
such as 9 amino acid substitutions, for example 10 amino acid
substitutions as compared to any one of SEQ ID NO:s 1 to 19.
[0113] In one embodiment the peptide according to the present
invention for use in a method of treating a disease or disorder of
the central nervous system and/or the eye is a variant having
between 1-10 amino acid substitutions as compared to SEQ ID NO:19,
such as 1 amino acid substitution, for example 2 amino acid
substitutions, such as 3 amino acid substitutions, for example 4
amino acid substitutions, such as 5 amino acid substitutions, for
example 6 amino acid substitutions, such as 7 amino acid
substitutions, for example 8 amino acid substitutions, such as 9
amino acid substitutions, for example 10 amino acid substitutions
as compared to SEQ ID NO:19.
[0114] In one embodiment, one or more, or all, of said amino acid
substitutions are conservative amino acid substitutions.
[0115] It follows that in one embodiment a peptide variant of a
sequence as defined herein is a functional variant, i.e. a variant
retaining some biological function and/or activity associated with
the native sequence. In one embodiment a peptide variant according
to the present invention is capable of binding to NCAM. In one
embodiment a variant is capable of binding to the NCAM Ig1 module.
In one embodiment a variant does not bind to and/or activate Y1, Y2
and/or Y5.
[0116] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO: 1 (NPY3-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:1.
[0117] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:2 (NPY4-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:2.
[0118] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:3 (NPY5-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:3.
[0119] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:4 (NPY6-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:4.
[0120] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:5 (NPY7-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:5.
[0121] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:6 (NPY8-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:6.
[0122] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:7 (NPY9-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:7.
[0123] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:8 (NPY10-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:8.
[0124] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:9 (NPY11-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:9.
[0125] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:10 (NPY12-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO: 10.
[0126] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:11 (NPY13-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:11.
[0127] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO: 12 (NPY14-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:12.
[0128] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:13 (NPY15-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:13.
[0129] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:14 (NPY16-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:14.
[0130] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:15 (NPY17-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:15.
[0131] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:16 (NPY18-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:16.
[0132] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO: 17 (NPY 19-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:17.
[0133] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO:18 (NPY20-35), or a functional variant thereof
having at least 60% sequence identity to SEQ ID NO:18.
[0134] In one embodiment, said peptide for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye is SEQ ID NO: 19 (NPY21-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:19.
Peptide
[0135] It is also an aspect of the present invention to provide an
isolated peptide consisting of a peptide sequence of 15 to 32
contiguous amino acid residues derived from neuropeptide Y (NPY)
(SEQ ID NO:22),
wherein said peptide comprises or consist of the sequence
YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19), or a variant having at
least 60% sequence identity to SEQ ID NO:19, wherein said peptide
does not comprise the Tyr amino acid of position 36 of NPY (SEQ ID
NO:22).
[0136] The terms `peptide` and `isolated peptide` may be used
interchangeably herein. The terms `variant` and `functional
variant` may be used interchangeably herein.
[0137] It is also an aspect of the present invention to provide an
isolated peptide consisting of a peptide sequence of 15 to 32
contiguous amino acid residues derived from neuropeptide Y (NPY)
(SEQ ID NO:22),
wherein said peptide comprises at least the sequence
YSALRHYINLITRQR (NPY21-35; SEQ ID NO: 19), or a variant thereof,
wherein said peptide does not comprise the Tyr amino acid of
position 36 of NPY (SEQ ID NO:22).
[0138] It one embodiment there is provided an isolated peptide
consisting of a peptide sequence of 15 to 32 contiguous amino acid
residues derived from neuropeptide Y (NPY) (SEQ ID NO:22),
said peptide comprising at least the sequence YSALRHYINLITRQR
(NPY21-35; SEQ ID NO: 19), or a variant thereof,
[0139] said peptide not comprising the Tyr amino acid of position
36 of NPY (SEQ ID NO:22), wherein said peptide is selected from the
group consisting of:
TABLE-US-00003 (NPY4-35, SEQ ID NO: 2)
KPDNPGEDAPAEDMARYYSALRHYINLITRQR, (NPY5-35, SEQ ID NO: 3)
PDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY6-35, SEQ ID NO: 4)
DNPGEDAPAEDMARYYSALRHYINLITRQR (NPY7-35, SEQ ID NO: 5)
NPGEDAPAEDMARYYSALRHYINLITRQR (NPY8-35, SEQ ID NO: 6)
PGEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID NO: 7)
GEDAPAEDMARYYSALRRYINLITRQR, (NPY10-35, SEQ ID NO: 8)
EDAPAEDMARYYSALRHYINLITRQR, (NPY11-35, SEQ ID NO: 9)
DAPAEDMARYYSALRHYINLITRQR, (NPY12-35, SEQ ID NO: 10)
APAEDMARYYSALRHYINLITRQR (NPY13-35, SEQ ID NO: 11)
PAEDMARYYSALRHYINLITRQR, (NPY14-35, SEQ ID NO: 12)
AEDMARYYSALRHYINLITRQR, (NPY15-35, SEQ ID NO: 13)
EDMARYYSALRHYINLITRQR, (NPY16-35, SEQ ID NO: 14)
DMARYYSALRHYINLITRQR, (NPY17-35, SEQ ID NO: 15)
MARYYSALRHYINLITRQR, (NPY18-35, SEQ ID NO: 16) ARYYSALRHYINLITRQR,
(NPY19-35, SEQ ID NO: 17) RYYSALRHYINLITRQR, (NPY20-35, SEQ ID NO:
18) YYSALRHYINLITRQR, and (NPY21-35, SEQ. ID NO: 19)
YSALRHYINLITRQR.
or a variant thereof.
[0140] A peptide that `comprises or consist of` a sequence means
that the peptide may either comprise the sequence, consist of the
sequence, or comprise at least the full sequence. A peptide that
`comprises at least` a peptide sequence, such as `comprising at
least the sequence YSALRHYINLITRQR` means that the peptide will
include all of the peptide sequence YSALRHYINLITRQR (NPY21-35; SEQ
ID NO: 19). It does, however, not exclude that additional
components or amino acids may be present.
[0141] In one embodiment the peptide according to the present
invention is a variant having at least 60% sequence identity to any
of SEQ ID NO:s 2 to 19, such as at least 65% sequence identity, for
example at least 70% sequence identity, such as at least 75%
sequence identity, for example at least 80% sequence identity, such
as at least 85% sequence identity, for example at least 90%
sequence identity, such as at least 95% sequence identity, for
example at least 99% sequence identity to any one of SEQ ID NO:s 2
to 19.
[0142] In another embodiment, the peptide according to the present
invention is a variant having at from 60 to 65% sequence identity,
for example from 65 to 70% sequence identity, such as from 70 to
75% sequence identity, for example from 75 to 80% sequence
identity, such as from 80 to 85% sequence identity, for example
from 85 to 90% sequence identity, such as from 90 to 95% sequence
identity, for example from 95 to 99% sequence identity to any one
of SEQ ID NO:s 2 to 19.
[0143] In one embodiment, said peptide is selected from the group
consisting of: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO:
5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID
NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14,
SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ
ID NO: 19; or
a variant having at least 60% sequence identity to a peptide
selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3,
SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO:
8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ
ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO:
17, SEQ ID NO: 18 and SEQ ID NO: 19.
[0144] In another embodiment said peptide has at least 60% sequence
identity, such as at least 65% sequence identity, for example at
least 70% sequence identity, such as at least 75% sequence
identity, for example at least 80% sequence identity, such as at
least 85% sequence identity, for example at least 90% sequence
identity, such as at least 95% sequence identity, for example at
least 99% sequence identity to a peptide selected from the group
consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO:
5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID
NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14,
SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ
ID NO: 19.
[0145] It follows that said peptide may in one embodiment have from
60% to 65 sequence identity, such as from 65 to 70% sequence
identity, for example from 70 to 75% sequence identity, such as
from 75 to 80% sequence identity, for example from 80 to 85%
sequence identity, such as from 85 to 90% sequence identity, for
example from 90 to 95% sequence identity, such as from 95 to 99%
sequence identity to a peptide selected from the group consisting
of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID
NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ
ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO:
15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO:
19.
[0146] In one embodiment the peptide according to the present
invention is a variant having between 1-10 amino acid substitutions
as compared to any one of SEQ ID NO:s 2 to 19, such as 1 amino acid
substitution, for example 2 amino acid substitutions, such as 3
amino acid substitutions, for example 4 amino acid substitutions,
such as 5 amino acid substitutions, for example 6 amino acid
substitutions, such as 7 amino acid substitutions, for example 8
amino acid substitutions, such as 9 amino acid substitutions, for
example 10 amino acid substitutions as compared to any one of SEQ
ID NO:s 2 to 19.
[0147] In one embodiment, one or more, or all, of said amino acid
substitutions are conservative amino acid substitutions.
[0148] It follows that in one embodiment a peptide variant of a
sequence as defined herein is a functional variant, i.e. a variant
retaining some biological function and/or activity associated with
the native sequence. In one embodiment a peptide variant according
to the present invention is capable of binding to NCAM. In one
embodiment a variant is capable of binding to the NCAM Ig1 module.
In one embodiment a variant does not bind to and/or activate Y1, Y2
and/or Y5.
[0149] In one embodiment, the peptide according to the present
invention does not comprise or consist of the amino acid sequence
SKPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY3-35, SEQ ID NO: 1).
[0150] In one embodiment, the peptide according to the present
invention does not comprise or consist of the amino acid sequence
SKPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY3-35, SEQ ID NO: 1), unless
used in a method of of treating a disease or disorder of the
central nervous system and/or the eye.
[0151] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:2 (NPY4-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:2.
[0152] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:3 (NPY5-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:3.
[0153] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:4 (NPY6-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:4.
[0154] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:5 (NPY7-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:5.
[0155] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:6 (NPY8-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:6.
[0156] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:7 (NPY9-35), or a functional variant
thereof having at least 60% sequence identity to SEQ ID NO:7.
[0157] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:8 (NPY10-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:8.
[0158] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:9 (NPY11-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:9.
[0159] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:10 (NPY12-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:10.
[0160] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:11 (NPY 13-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:11.
[0161] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:12 (NPY14-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:12.
[0162] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:13 (NPY15-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:13.
[0163] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:14 (NPY16-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:14.
[0164] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:15 (NPY17-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:15.
[0165] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:16 (NPY18-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:16.
[0166] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:17 (NPY19-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:17.
[0167] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO:18 (NPY20-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:18.
[0168] In one embodiment, the isolated peptide according to the
present invention is SEQ ID NO: 19 (NPY21-35), or a functional
variant thereof having at least 60% sequence identity to SEQ ID
NO:19.
Peptide and Peptide for Use
[0169] The present inventors have surprisingly shown that the
peptides according to the present invention bind to Neural Cell
Adhesion Molecule (NCAM).
[0170] In one embodiment, the peptides according to the present
invention are capable of binding to and/or interacting with and/or
stimulating (or activating) Neural Cell Adhesion Molecule
(NCAM).
[0171] When reference is made to a `peptide`, this term will
encompass both references to a peptide per se, and also to a
peptide for use according to the present invention.
[0172] In a particular embodiment, the present peptides bind to the
NCAM Ig1 module. In a particular embodiment, the peptides bind to
the NCAM Ig1 module and not the NCAM Ig3 module. In a particular
embodiment, the peptides do not bind to the NCAM Ig3 module.
[0173] In one embodiment, the peptides of the invention do not bind
to the cognate NPY-receptors. In one embodiment, the peptides do
not bind to the cognate NPY-receptors Y1, Y2 and Y5.
[0174] In one embodiment, the peptides according to the present
invention are capable of stimulating neurite outgrowth.
[0175] In one embodiment, the peptides according to the present
invention are capable of promoting or stimulating or increasing the
survival of neurons.
[0176] In one embodiment, the peptides according to the present
invention are capable of enhancing long-term potentiation
(LTP).
[0177] In one embodiment, the peptides according to the present
invention are capable of regulating neuroplasticity.
[0178] In one embodiment, the peptides according to the present
invention are capable of stimulating learning and memory.
[0179] According to the present invention, a peptide as defined
herein above may be a functional variant of said defined amino acid
sequences.
[0180] Variants of peptides according to the present invention are
meant to be the functional equivalents of said sequences, i.e.
retaining their ability to bind to NCAM.
[0181] A functional variant is a variant that retains the same
biological activity or capabilities as the peptide from which it is
derived; such as those listed herein above: Capable of binding to
NCAM, such as the Ig1 module of NCAM, stimulating neurite
outgrowth, promoting or stimulating or increasing the survival of
neurons, enhancing long-term potentiation, regulating
neuroplasticity, and/or stimulating learning and memory.
[0182] The peptide variants according to the present invention may
comprise one or more amino acid substitutions introduced
independently of one another. In one embodiment, peptide variants
according to the present invention comprises 1 amino acid
substitution, for example 2 amino acid substitutions, such as 3
amino acid substitutions, for example 4 amino acid substitutions,
such as 5 amino acid substitutions, for example 6 amino acid
substitutions, such as 7 amino acid substitutions, for example 8
amino acid substitutions, such as 9 amino acid substitutions, for
example 10 amino acid substitutions.
[0183] In one embodiment, said one or more amino acid substitution
is a conservative amino acid substitution (or synonymous
substitution), that is the substitution of amino acids whose side
chains have similar biochemical properties and thus do not affect
the function of the peptide.
[0184] Among the common amino acids, for example, a "conservative
amino acid substitution" can also be illustrated by a substitution
among amino acids within each of the following groups: (1) glycine,
alanine, valine, leucine, and isoleucine, (2) phenylalanine,
tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate
and glutamate, (5) glutamine and asparagine, and (6) lysine,
arginine and histidine.
[0185] In one embodiment, a serine residue (Ser) of SEQ ID NO: 1,
or a fragment thereof, is substituted with an amino acid selected
from the group consisting of Gln, Asn and Thr (all amino acids with
polar uncharged side chains); and independently thereof, a glycine
residue (Gly) is substituted with an amino acid selected from the
group consisting of Ala, Val, Leu, and Ile; and independently
thereof, an arginine residue (Arg) is substituted with an amino
acid selected from the group consisting of Lys and His (all have
positively charged side chains); and independently thereof, a
lysine residue (Lys) is substituted with an amino acid selected
from the group consisting of Arg and His; and independently
thereof, a methionine residue (Met) is substituted with an amino
acid selected from the group consisting of Leu, Pro, Ile, Val, Phe,
Tyr and Trp (all have hydrophobic side chains); and independently
thereof, a glutamine residue (Gln) is substituted with an amino
acid selected from the group consisting of Asp, Glu, and Asn; and
independently thereof, an alanine residue (Ala) is substituted with
an amino acid selected from the group consisting of Gly, Val, Leu,
and Ile.
[0186] The identity between amino acid sequences may be calculated
using well known algorithms such as BLOSUM 30, BLOSUM 40, BLOSUM
45, BLOSUM 50, BLOSUM 55, BLOSUM 60, BLOSUM 62, BLOSUM 65, BLOSUM
70, BLOSUM 75, BLOSUM 80, BLOSUM 85, or BLOSUM 90, or by simple
comparison of the specific amino acids present at corresponding
positions in two peptide sequences to be compared.
[0187] Homology may be used as a synonym to identity/sequence
identity.
[0188] A variant of a peptide of the invention may also be an amino
acid sequence which has about 10% positive amino acid matches with
any of SEQ ID NOs: 1 to 19, such as about 20% positive amino acid
matches, for example about 30% positive amino acid matches, such as
about 40% positive amino acid matches, for example about 50%
positive amino acid matches, such as about 60% positive amino acid
matches, for example about 70% positive amino acid matches, such as
about 80% positive amino acid matches, for example about 90%
positive amino acid matches, wherein a positive amino acid match is
defined as the presence at the same position in two compared
sequences of amino acid residues which has similar physical and/or
chemical properties. Particular positive amino acid matches of the
present invention are K to R, E to D, L to M, Q to E, I to V, I to
L, A to S, Y to W, K to Q, S to T, N to S and Q to R.
[0189] In another embodiment, a variant according to the present
invention include sequences wherein an alkyl amino acid is
substituted for an alkyl amino acid, wherein an aromatic amino acid
is substituted for an aromatic amino acid, wherein a
sulfur-containing amino acid is substituted for a sulfur-containing
amino acid, wherein a hydroxy-containing amino acid is substituted
for a hydroxy-containing amino acid, wherein an acidic amino acid
is substituted for an acidic amino acid, wherein a basic amino acid
is substituted for a basic amino acid, and/or wherein a dibasic
monocarboxylic amino acid is substituted for a dibasic
monocarboxylic amino acid.
[0190] Conservative substitutions may be introduced in any one or
more positions of a peptide according to the invention or a
fragment thereof, as long as the variant remains functional. It may
however also be desirable to introduce non-conservative
substitutions in one or more positions (non-synonymous
substitutions).
[0191] A non-conservative substitution leading to the formation of
a variant of the peptide according to the invention would for
example differ substantially in polarity, for example a residue
with a non-polar side chain (Ala, Leu, Pro, Trp, Val, Ile, Leu, Phe
or Met) substituted for a residue with a polar side chain such as
Gly, Ser, Thr, Cys, Tyr, Asn, or Gln or a charged amino acid such
as Asp, Glu, Arg, or Lys, or substituting a charged or a polar
residue for a non-polar one; and/or ii) differ substantially in its
effect on peptide backbone orientation such as substitution of or
for Pro or Gly by another residue; and/or iii) differ substantially
in electric charge, for example substitution of a negatively
charged residue such as Glu or Asp for a positively charged residue
such as Lys, His or Arg (and vice versa); and/or iv) differ
substantially in steric bulk, for example substitution of a bulky
residue such as His, Trp, Phe or Tyr for one having a minor side
chain, e.g. Ala, Gly or Ser (and vice versa).
[0192] Substitution of amino acids may in one embodiment be made
based upon their hydrophobicity and hydrophilicity values and the
relative similarity of the amino acid side-chain substituents,
including charge, size, and the like.
[0193] The peptides according to the present invention comprise
proteinogenic or natural amino acids, ie. the 22 amino acids
naturally incorporated into polypeptides. Of these, 20 are encoded
by the universal genetic code (cf. table 1 above) and the remaining
2; selenocysteine (Sec, U) and pyrrolysine (Pyl, O), are
incorporated into proteins by unique synthetic mechanisms.
[0194] A peptide according to the invention in one embodiment may
also comprise one or more non-naturally occurring amino acid
residues (unnatural, non-proteinogenic or non-standard amino
acids). Non-naturally occurring amino acids include e.g., without
limitation, beta-2-naphthyl-alanine, trans-3-methylproline,
2,4-methanoproline, cis-4-hydroxyproline, trans-4-hydroxyproline,
N-methylglycine, allo-threonine, methylthreonine,
hydroxyethylcysteine, hydroxyethylhomocysteine, nitroglutamnine,
homoglutamine, pipecolic acid, thiazolidine carboxylic acid,
dehydroproline, 3- and 4-methylproline, 3,3-dimethylproline,
tert-leucine, norleucine, norvaline, 2-azaphenylalanine,
3-azaphenylalanine, 4-azaphenylalanine, and
4-fluorophenylalanine.
[0195] Any amino acids according to the present invention may be in
the L- or D-configuration. If nothing is specified, reference to
the L-isomeric form is preferably meant.
[0196] The standard and/or non-standard amino acids may be linked
by peptide bonds (to form a linear peptide chain), or by
non-peptide bonds (e.g. via the variable side-chains of the amino
acids). Preferably, the amino acids of the present invention are
linked by peptide bonds.
[0197] In one embodiment the peptide according to the present
invention comprises Tyr at position 21 (Tyr21), ie. Tyr of position
21 is not substituted.
[0198] The term peptide also embraces post-translational
modifications introduced by chemical or enzyme-catalyzed reactions,
as are known in the art. These include acetylation,
phosphorylation, methylation, glucosylation, glycation, amidation,
hydroxylation, deimination, deamidation, carbamylation and
sulfation of one or more amino acid residues, and also proteolytic
modification by known proteinases including lysosomal kathepsins,
and also calpains, secretases and matrix-metalloproteinases.
[0199] Also, functional equivalents of the peptides may comprise
chemical modifications such as ubiquitination, labeling (e.g., with
radionuclides, various enzymes, etc.), pegylation (derivatization
with polyethylene glycol), or by insertion (or substitution by
chemical synthesis) of amino acids such as ornithine, which do not
normally occur in human proteins (non-proteinogenic).
[0200] Sterically similar compounds may be formulated to mimic the
key portions of the peptide structure. This may be achieved by
techniques of modelling and chemical designing known to those of
skill in the art. For example, esterification and other alkylations
may be employed to modify the amino terminus of e.g a di-arginine
peptide backbone, to mimic a tetra peptide structure. It will be
understood that all such sterically similar constructs fall within
the scope of the present invention. Peptides with N-terminal and
C-terminal alkylations and esterifications are also encompassed
within the present invention.
[0201] Where nothing is specified it is to be understood that the
C-terminal amino acid of a peptide according to the present
invention exists as the free carboxylic acid, this may also be
specified as "--OH". However, the C-terminal amino acid of a
peptide for use according to the invention may in another
embodiment be the amidated derivative, which is indicated as
"--NH.sub.2" (or CONH.sub.2").
[0202] Where nothing else is stated the N-terminal amino acid of
the peptide comprises a free amino-group, this may also be
specified as "H--" (or "NH.sub.2"). However, the N-terminal amino
acid of a peptide according to the invention may in another
embodiment be the acetylated derivative, which is indicated as
"Acetyl" or "COCH.sub.3".
[0203] In one embodiment the C-terminal amino acid of the peptide
according to the present invention exists as the free carboxylic
acid ("--OH"). In another embodiment the C-terminal amino acid of
the peptide according to the present invention is an amidated
derivative ("--NH.sub.2"). In one embodiment the N-terminal amino
acid of the peptide according to the present invention comprises a
free amino-group ("H--"). In another embodiment the N-terminal
amino acid of the peptide according to the present invention is the
acetylated derivative ("-Acetyl" or "COCH.sub.3").
[0204] A contiguous or consecutive peptide sequence is a sequence
of consecutive amino acids being linked linearly by peptide bonds.
Contiguous and consecutive amino acid sequence is used
interchangeably herein.
[0205] In one embodiment, the peptide according to the present
invention comprises a contiguous amino acid sequence of 32 amino
acids, such as 31 amino acids, for example 30 amino acids, for
example 29 amino acids, such as 28 amino acids, for example 27
amino acids, such as 26 amino acids, for example 25 amino acids,
such as 24 amino acids, for example 23 amino acids, such as 22
amino acids, for example 21 amino acids, such as 20 amino acids,
for example 19 amino acids, such as 18 amino acids, for example 17
amino acids, such as 16 amino acids, for example 15 amino acids
derived from NPY (SEQ ID NO:22) which comprises at least NPY21-35
(SEQ ID NO:19) or a variant thereof.
[0206] In one embodiment, the peptide according to the present
invention comprises a contiguous amino acid sequence of at most 32
amino acids, such as at most 31 amino acids, for example at most 30
amino acids, for example at most 29 amino acids, such as at most 28
amino acids derived from NPY (SEQ ID NO:22) which comprises at
least NPY21-35 (SEQ ID NO:19) or a variant thereof.
[0207] In another embodiment, the peptide comprises a contiguous
amino acid sequence of at least 15 amino acids, for example at
least 16 amino acids, for example at least 17 amino acids, such as
at least 18 amino acids, for example at least 19 amino acids, such
as at least 20 amino acids derived from NPY (SEQ ID NO:22) which
comprises at least NPY21-35 (SEQ ID NO:19) or a variant
thereof.
[0208] A peptide of the present invention in one embodiment
consists of from 15-32 contiguous amino acids. In one embodiment,
the peptide of the invention consists of from 15-16, for example
16-17, such as 17-18, for example 18-19, such as 19-20, for example
20-21, such as 21-22, for example 22-23, such as 23-24, for example
24-25, such as 25-26, for example 26-27, such as 27-28, for example
28-29, such as 29-30, for example 30-31, such as 31-32 contiguous
amino acids derived from NPY (SEQ ID NO:22) which comprises at
least NPY21-35 (SEQ ID NO:19) or a variant thereof.
[0209] The peptide of the present invention in another embodiment
comprises a contiguous amino acid sequence having a total length of
more than or equal to 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
26, 27, 28, 29, 30, 31 or 32 contiguous amino acid residues derived
from NPY (SEQ ID NO:22) and comprising at least NPY21-35 (SEQ ID
NO:19) or a variant thereof.
Compound of the Present Invention
[0210] It is an aspect of the present invention to provide a
compound comprising or consisting of a peptide according to the
present invention. In one embodiment, said peptide is formulated as
a monomer (i.e. comprising 1 copy of the peptide), whereas in
another embodiment, said peptide is formulated as a multimer.
[0211] It is an aspect of the present invention to provide a
compound according to the present invention for use as a medicament
and/or for use in a method of treating a disease or disorder of the
central nervous system and/or the eye.
Multimeric Compound
[0212] In one embodiment the peptide according to the present
invention is formulated as a multimer. A multimer is a protein
comprising or consisting of multiple monomers. A multimer is an
aggregate of multiple molecules (aka monomers, as mono=one) that is
usually held together with non-covalent bonds. This definition
distinguishes a multimer from a polymer, which is a series of
monomers that are held together with covalent bonds.
[0213] A peptide sequence of the present invention may be connected
to another (identical or non-identical) peptide sequence of the
present invention by a chemical bond or through a linker group. In
some embodiments a peptide of the invention may be formulated as an
oligomer or multimer of monomers, wherein each monomer is as a
peptide sequence as defined according to the present invention.
[0214] Thus, according to the invention a multimeric compound may
be a polymer comprising two or more peptide sequences of the
invention, said peptide sequences being identical or non-identical,
wherein at least one of the two or more peptide sequences is a
peptide according to the present invention. Preferably, both
peptide sequences are a peptide according to the present
invention.
[0215] In one embodiment the multimeric compound is a dimer,
comprising two peptides according to the present invention, said
two peptides being identical or non-identical with respect to each
other.
[0216] In another embodiment the multimeric compound is a trimer,
comprising three peptides according to the present invention, said
peptides being identical or non-identical with respect to each
other.
[0217] In another embodiment the multimeric compound is a tetramer,
comprising four peptides according to the present invention, said
peptides being identical or non-identical with respect to each
other.
[0218] In one embodiment the multimeric compound is a dendrimer,
such as a tetrameric or octameric dendrimer. Dendrimers are
repeatedly branched, roughly spherical large molecules, typically
symmetric around the core, and often adopts a spherical
three-dimensional morphology.
[0219] Dendrimers according to the present invention may comprise 4
peptides, 8 peptides, 16 peptides, or 32 peptides. In one
particular embodiment said dendrimer comprises four peptides (i.e.
a tetrameric dendrimer) or eight peptides (octameric
dendrimer).
[0220] In some particular embodiments, the multimeric compound may
comprise two identical amino acid sequences of the present
invention (dimer) or the compound may comprise four identical
copies of an amino acid sequence of the present invention
(tetrameric dendrimer).
[0221] The multimers according to the invention may be made by
linking two or more peptide monomers via a peptide bond or a linker
group. They may be linked to a lysine backbone, such as a lysine
residue (each peptide chain is linked to a single lysine residue),
or coupled to a polymer carrier, for example a protein carrier.
Said linker group in one embodiment comprises a plurality of lysine
residues, such as a core moiety having a plurality of lysine
residues, such as seen in a lysine-based dendromeric structure
containing three, seven, fifteen and more lysine residues However,
any other linking of peptide monomers known to the skilled person
may be envisioned.
[0222] The linking may in one embodiment occur at the N-terminal or
C-terminal end of the peptide monomers.
Nucleic Acid Constructs Encoding NPY Peptide
[0223] There are a variety of diseases of the retina arising from
genetic and non-genetic causes, or a combination of both. The
retina is a prime location for gene therapy because of its
accessibility, immune privileged status, and susceptible cell
types. Several strategies have been attempted to rescue retinal
disease, including gene replacement, gene knockdown with both
ribozymes and siRNA and therapeutic gene supplementation.
[0224] In one embodiment of the present invention there is provided
a nucleic acid construct encoding for and being capable of
expressing a peptide according to the present invention. Preferably
said nucleic acid construct will be able to continuously express a
peptide according to the present invention for a prolonged period
of time, such as at least 1 month, for example at least 2 months,
such as at least 3 months, for example at least 4 months, such as
at least 5 months, for example at least 6 months, such as at least
7 months, for example at least 8 months, such as at least 9 months,
for example at least 12 months.
[0225] It is an aspect of the present invention to provide a
nucleic acid construct encoding a peptide consisting of a peptide
sequence of from 15 to 33 contiguous amino acid residues derived
from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said peptide
comprises at least, or consists of, the sequence YSALRHYINLITRQR
(NPY21-35; SEQ ID NO:19), or a functional variant having at least
60% sequence identity to SEQ ID NO:19, wherein said peptide does
not comprise the Tyr amino acid of position 36 of SEQ ID NO:22.
[0226] It is also an aspect of the present invention to provide a
nucleic acid construct encoding a peptide consisting of a peptide
sequence of 15 to 32 contiguous amino acid residues derived from
neuropeptide Y (NPY) (SEQ ID NO:22), wherein said peptide comprises
or consist of the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID
NO:19), or a variant having at least 60% sequence identity to SEQ
ID NO: 19, wherein said peptide does not comprise the Tyr amino
acid of position 36 of NPY (SEQ ID NO:22).
[0227] It is also an aspect of the present invention to provide a
nucleic acid construct encoding a peptide consisting of 15 to 33
contiguous amino acid residues derived from neuropeptide Y (NPY)
(SEQ ID NO:22), wherein said peptide comprises at least, or
consists of, the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19),
or a functional variant thereof, wherein said peptide does not
comprise the Tyr amino acid of position 36 of SEQ ID NO:22, for use
in a method of treating a disease or disorder of the central
nervous system and/or the eye.
[0228] In one embodiment the encoded peptide of the a nucleic acid
construct is a variant having at least 60% sequence identity to any
one of SEQ ID NO:s 1 to 19, such as at least 65% sequence identity,
for example at least 70% sequence identity, such as at least 75%
sequence identity, for example at least 80% sequence identity, such
as at least 85% sequence identity, for example at least 90%
sequence identity, such as at least 95% sequence identity, for
example at least 99% sequence identity to any one of SEQ ID NO:s 1
to 19.
[0229] In one embodiment the encoded peptide of the a nucleic acid
construct is a variant having from 60 to 65% sequence identity, for
example from 65 to 70% sequence identity, such as from 70 to 75%
sequence identity, for example from 75 to 80% sequence identity,
such as from 80 to 85% sequence identity, for example from 85 to
90% sequence identity, such as from 90 to 95% sequence identity,
for example from 95 to 99% sequence identity to any one of SEQ ID
NO:s 1 to 19.
[0230] In one embodiment, said encoded peptide of the nucleic acid
construct is selected from the group consisting of: SEQ ID NO: 1,
SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:
6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15,
SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19;
or
a functional variant having at least 60% sequence identity, such as
at least 65% sequence identity, for example at least 70% sequence
identity, such as at least 75% sequence identity, for example at
least 80% sequence identity, such as at least 85% sequence
identity, for example at least 90% sequence identity, such as at
least 95% sequence identity, for example at least 99% sequence
identity to a peptide selected from the group consisting of SEQ ID
NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ
ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10,
SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID
NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO:
19.
[0231] In one embodiment, said encoded peptide of the nucleic acid
construct does not comprise or consist of SEQ ID NO:1 (NPY3-35),
unless when used in a method of treating a disease or disorder of
the central nervous system and/or the eye.
[0232] By nucleic acid construct is understood a genetically
engineered nucleic acid. The nucleic acid construct may be a
non-replicating and linear nucleic acid, a circular expression
vector or an autonomously replicating plasmid. A nucleic acid
construct may comprise several elements such as, but not limited to
genes or fragments of same, promoters, enhancers, terminators,
poly-A tails, linkers, polylinkers, operative linkers, multiple
cloning sites (MCS), markers, STOP codons, internal ribosomal entry
sites (IRES) and host homologous sequences for integration or other
defined elements. It is to be understood that the nucleic acid
construct according to the present invention may comprise all or a
subset of any combination of the above-mentioned elements.
[0233] Methods for engineering nucleic acid constructs are well
known in the art (see, e.g., Molecular Cloning: A Laboratory
Manual, Sambrook et al., eds., Cold Spring Harbor Laboratory, 2nd
Edition, Cold Spring Harbor, N.Y., 1989). Further, nucleic acid
constructs according to the present invention may be synthesized
without template, and may be obtained from various commercial
suppliers (e.g. Genscript Corporation).
[0234] In one embodiment, the nucleic acid construct are naked DNA
constructs comprising sequences encoding the peptide of the
invention.
[0235] It is also an aspect of the present invention to provide the
nucleic acid construct as described herein above comprised within a
delivery vehicle. A delivery vehicle is an entity whereby a
nucleotide sequence or polypeptide or both can be transported from
at least one media to another. Delivery vehicles are generally used
for expression of the sequences encoded within the nucleic acid
construct and/or for the intracellular delivery of the construct or
the polypeptide encoded therein.
[0236] In one embodiment, there is provided a delivery vehicle
comprising the nucleic acid construct according to the present
invention. A delivery vehicle may be selected from the group
consisting of: RNA based vehicles, DNA based vehicles/vectors,
lipid based vehicles (such as a liposome), polymer based vehicles
(such as a cationic polymer DNA carrier), colloidal gold particles
(coating) and virally derived DNA or RNA vehicles or vectors.
[0237] Methods of non-viral delivery include physical (carrier-free
delivery) and chemical approaches (synthetic vector-based
delivery).
[0238] Physical approaches, including needle injection, gene gun,
jet injection, electroporation, ultrasound, and hydrodynamic
delivery, employ a physical force that permeates the cell membrane
and facilitates intracellular gene transfer. Said physical force
may be electrical or mechanical.
[0239] Examples of chemical delivery vehicles include, but are not
limited to: biodegradable polymer microspheres, lipid based
formulations such as liposome carriers, cationically charged
molecules such as liposomes, calcium salts or dendrimers,
lipopolysaccharides, polypeptides and polysaccharides.
[0240] Another embodiment of the present invention comprises a
vector which herein is denoted a viral vector (i.e. not a virus) as
a delivery vehicle. Viral vectors according to the present
invention are made from a modified viral genome, i.e. the actual
DNA or RNA forming the viral genome, and introduced in naked form.
Thus, any coat structures surrounding the viral genome made from
viral or non-viral proteins are not part of the viral vector
according to the present invention.
[0241] The virus from which the viral vector is derived may be
selected from the non-exhaustive group of: adenoviruses,
retroviruses, lentiviruses, adeno-associated viruses,
herpesviruses, vaccinia viruses, foamy viruses, cytomegaloviruses,
Semliki forest virus, poxviruses, RNA virus vector and DNA virus
vector. Such viral vectors are well known in the art.
[0242] In one embodiment, said viral vectors may be selected from
the group consisting of adenoviruses, lentiviruses,
adeno-associated viruses (AAV) and recombinant adeno-associated
viruses (rAAV). In one preferred embodiment, said viral vector is a
therapeutic rAAV vector such as a therapeutic rAAV vector.
[0243] An adenovirus is a group of double-stranded DNA containing
viruses. Adenoviruses can be genetically modified making them
replication incompetent or conditionally replication incompetent.
In this form, as adenoviral constructs or adenovectors, they can be
used as gene delivery vehicles for vaccination or gene therapy.
[0244] Gene therapy vectors using AAV can infect both dividing and
quiescent cells and persist in an extrachromosomal state without
integrating into the genome of the host cell. These features make
AAV a very attractive candidate for creating viral vectors for gene
therapy. To date, AAV vectors have been used in over 80 clinical
trials worldwide.
[0245] At least 11 serotypes of AAV exists, and all of these are
encompassed by the present invention.
[0246] Viral expression vectors that have been utilized to target
retinal cells include adenoviruses, lentiviruses, and recombinant
adeno-associated viruses (rAAV).
[0247] Recombinant adeno-associated viral vectors (rAAV) are moving
to the forefront of gene therapy experiments. Given the
non-pathogenic nature, low immunogenicity, ease of delivery,
persistence, and targeting possibilities of rAAV, it is poised to
become a major player in retinal gene therapy.
[0248] Vectors derived from adeno-associated virus (AAV) are
currently the most promising vehicles for therapeutic gene delivery
to the retina. Recently, subretinal administration of AAV2 has been
demonstrated to be safe and effective in patients with a rare form
of inherited childhood blindness, suggesting that AAV-mediated
retinal gene therapy may be successfully extended to other blinding
conditions. This is further supported by the great versatility of
AAV as a vector platform as there are a large number of AAV
variants and many of these have unique transduction characteristics
useful for targeting different cell types in the retina including
glia, epithelium and many types of neurons. Naturally occurring,
rationally designed or in vitro evolved AAV vectors are currently
being utilized to transduce several different cell types in the
retina and to treat a variety of animal models of retinal disease.
See e.g. Vandenberghe & Auricchio (Gene Ther 2012 February;
19(2):162-8 `Novel adeno-associated viral vectors for retinal gene
therapy`).
Recombinant Cell
[0249] An aspect of the present invention relates to a cell
comprising the nucleic acid construct according to the present
invention. Such a recombinant cell can be used a tool for in vitro
research, as a delivery vehicle for the nucleic acid construct or
as part of a gene-therapy regime. The nucleic acid construct
according to the invention can be introduced into cells by
techniques well known in the art and which include microinjection
of DNA into the nucleus of a cell, transfection, electroporation,
lipofection/liposome fusion and particle bombardment. Suitable
cells include autologous and non-autologous cells, and may include
xenogenic cells.
Method of Treatment
[0250] It is also an aspect of the present invention to provide a
peptide or a nucleic acid construct encoding a peptide according to
the present invention for use as a medicament.
[0251] It is a further aspect of the present invention to provide a
peptide, or a nucleic acid construct encoding a peptide, said
peptide consisting of 15 to 33 contiguous amino acid residues
derived from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said
peptide comprises at least, or consist of, the sequence
YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19), or a functional variant
thereof, wherein said peptide does not comprise the Tyr amino acid
of position 36 of SEQ ID NO:22, for use in a method of treating a
disease or disorder of the central nervous system and/or the
eye.
[0252] Also provided is a method for treating a disease or disorder
of the central nervous system and/or the eye, said method
comprising administering to an individual in need thereof an
effective amount of a peptide, or a nucleic acid construct encoding
a peptide, said peptide consisting of 15 to 33 contiguous amino
acid residues derived from neuropeptide Y (NPY) (SEQ ID NO:22),
wherein said peptide comprises at least, or consist of, the
sequence YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19), or a functional
variant thereof, wherein said peptide does not comprise the Tyr
amino acid of position 36 of SEQ ID NO:22.
[0253] An individual in need as referred to herein, is an
individual that may benefit from the administration of a peptide or
pharmaceutical composition according to the present invention. Such
an individual may suffer from a disease or disorder of the central
nervous system and/or the eye or be in risk of suffering therefrom.
The individual may be any human being, male or female, infant,
middle-aged or old. The disorder to be treated or prevented in the
individual may relate to the age of the individual, the general
health of the individual, the medications used for treating the
individual and whether or not the individual has a prior history of
suffering from diseases or disorders that may have or have induced
a disease or disorder of the central nervous system and/or the eye
in the individual.
[0254] By `treating a disease or disorder` is meant one or more of
treatment, prevention and alleviation.
[0255] Also provided is the use of a peptide, or a nucleic acid
construct encoding a peptide, said peptide consisting of 15 to 33
contiguous amino acid residues derived from neuropeptide Y (NPY)
(SEQ ID NO:22), wherein said peptide comprises at least, or consist
of, the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID NO:19), or a
functional variant thereof, wherein said peptide does not comprise
the Tyr amino acid of position 36 of SEQ ID NO:22, for the
manufacture of a medicament for use in a method of treating a
disease or disorder of the central nervous system and/or the
eye.
Method of Treatment--Diseases and Disorders of the Eye
[0256] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in a
method of treating a disease or disorder of the eye.
[0257] In one embodiment said disease or disorder of the eye is a
disease or disorder involving neurons, in one embodiment retinal or
optic nerve neurons.
[0258] In one embodiment said disease or disorder of the eye is a
retinal or optic nerve disease or disorder.
[0259] In one embodiment said disease or disorder of the eye is a
retinal disease or disorder. In another embodiment said disease or
disorder of the eye is an optic nerve disease or disorder.
[0260] A retinal disease or disorder implies that the retina of the
eye is involved in the disease or disorder. The retina comprises
neurons, and as such retinal disorders as such are disorders in
which neuritogenesis and/or neuroprotection are desirable.
[0261] The vertebrate retina is a light-sensitive layer of tissue,
lining the inner surface of the eye. The optics of the eye creates
an image of the visual world on the retina, which serves much the
same function as the film in a camera. Light striking the retina
initiates a cascade of chemical and electrical events that
ultimately trigger nerve impulses. These are sent to various visual
centers of the brain through the fibers of the optic nerve. In
vertebrate embryonic development, the retina and the optic nerve
originate as outgrowths of the developing brain, so the retina may
be considered part of the central nervous system (CNS).
[0262] The retina is a layered structure with several layers of
neurons interconnected by synapses. The only neurons that are
directly sensitive to light are the photoreceptor cells. These are
mainly of two types: the rods and cones. The entire retina contains
about 7 million cones and 75 to 150 million rods. Rods function
mainly in dim light and provide black-and-white vision, while cones
support daytime vision and the perception of colour. A third, much
rarer type of photoreceptor, the photosensitive ganglion cell, is
important for reflexive responses to bright daylight. Neural
signals from the rods and cones undergo processing by other neurons
of the retina. The output takes the form of action potentials in
retinal ganglion cells whose axons form the optic nerve.
[0263] The macula or macula lutea is an oval-shaped highly
pigmented yellow spot near the center of the retina of the human
eye. It has a diameter of around 1.5 mm and is often histologically
defined as having two or more layers of ganglion cells. Near its
center is the fovea, a small pit that contains the largest
concentration of cone cells in the eye and is responsible for
central, high resolution vision. The macula also contains the
parafovea and perifovea.
[0264] There are many inherited and acquired diseases and disorders
that affect the retina.
[0265] In one embodiment there is provided a peptide according to
the present invention for use in a method of treating a retinal
disease or disorder, wherein said retinal disease or disorder is
selected from the group consisting of [0266] retinitis pigmentosa
(group of genetic diseases that affect the retina and cause the
loss of night vision and peripheral vision); [0267] macular
degeneration (diseases characterized by loss of central vision
because of death or impairment of the cells in the macula); [0268]
cone-rod dystrophy (CORD) (diseases where vision loss is caused by
deterioration of the cones and/or rods in the retina); [0269]
retinal detachment or separation (in which the retina detaches from
the back of the eyeball; the term retinal detachment is used to
describe a separation of the neurosensory retina from the retinal
pigment epithelium); [0270] hypertensive retinopathy and diabetic
retinopathy (hypertension and diabetes mellitus can cause damage to
the tiny blood vessels that supply the retina).
[0271] An optic nerve disease or disorder implies that the optic
nerve of the eye is involved in the disease or disorder. The optic
nerve is the second of twelve paired cranial nerves but is commonly
considered to be part of the central nervous system, as it is
derived from an outpouching of the diencephalon during embryonic
development, covered with myelin and ensheathed in all three
meningeal layers. Also it does not regenerate after injury. The
optic nerve, also known as cranial nerve 2, transmits visual
information from the retina to the brain. The fibers from the
retina run along the optic nerve to nine primary visual nuclei in
the brain, from which a major relay inputs into the primary visual
cortex. The optic nerve is composed of retinal ganglion cell axons
and support cells.
[0272] Damage or injury to the optic nerve typically causes
permanent and potentially severe loss of vision, as well as an
abnormal pupillary reflex, which is diagnostically important. The
type of visual field loss will depend on which portions of the
optic nerve were damaged.
[0273] Injury to the optic nerve can be the result of congenital or
inheritable problems like Leber's Hereditary Optic Neuropathy,
glaucoma, trauma, toxicity, inflammation, ischemia, infection (very
rarely), or compression from tumors or aneurysms. By far, the three
most common injuries to the optic nerve are from glaucoma, optic
neuritis (especially in those younger than 50 years of age), and
anterior ischemic optic neuropathy (usually in those older than
50).
[0274] In one embodiment, said optic nerve disease or disorder is
selected from the group consisting of injury to the optic nerve,
including traumatic and congenital injuries to the optic nerve,
including Leber's Hereditary Optic Neuropathy, glaucoma, trauma,
toxicity, inflammation, ischemia, infection (very rarely),
compression from tumors or aneurysms, optic neuritis and anterior
ischemic optic neuropathy.
Retinitis Pigmentosa
[0275] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of retinitis pigmentosa.
[0276] Retinitis pigmentosa (commonly referred to as "RP") is a
disease characterized by progressive loss of the light sensing
photoreceptor cells that line the back of the eye. Usually the rod
photoreceptors (responsible for night vision) are affected first,
which is why loss of night vision (nyctalopia) is usually the first
symptom. Loss of daytime vision (mediated by the cone
photoreceptors) is usually preserved until the late stages of the
disease. It may eventually lead to blindness.
[0277] Mottling of the retinal pigment epithelium with black
bone-spicule pigmentation is typically indicative of retinitis
pigmentosa. Other ocular features include waxy pallor of the optic
nerve head, attenuation (thinning) of the retinal vessels,
cellophane maculopathy, cystic macular edema, and posterior
subcapsular cataract.
[0278] RP is one of the most common forms of inherited retinal
degeneration. There are multiple genes that, when mutated, can
cause the Retinitis pigmentosa phenotype, including the gene coding
for rhodopsin and opsin. When a specific gene is implicated the RP
may be diagnosed accordingly based on the specific mutation, and is
denoted by a suffix (e.g. RP4 is the RHO mutation).
[0279] Currently there is no cure for retinitis pigmentosa, but
treatments are now available in some countries. The progression of
the disease can be reduced by the daily intake of vitamin A. A very
recent approach for therapy is the Argus II retinal implant
(anelaborate epiretinal prosthesis surgically implanted in and on
the eye that includes an antenna, an electronics case, and an
electrode array).
Retinal Detachment
[0280] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of retinal detachment.
[0281] Retinal detachment is a disorder of the eye in which the
retina peels away from its underlying layer of support tissue.
Initial detachment may be localized, but without rapid treatment
the entire retina may detach, leading to vision loss and
blindness.
[0282] The optical system of the eye focuses light on the retina,
and the retina translates that focused image into neural impulses
and sends them to the brain via the optic nerve. Occasionally,
posterior vitreous detachment, injury or trauma to the eye or head
may cause a small tear in the retina. The tear allows vitreous
fluid to seep through it under the retina, and peel it away.
Photoreceptors in patients with retinal detachment display abundant
structural plasticity in the form of axonal retraction, neurite
extension, and formation of presynaptic varicosities.
[0283] A retinal detachment is commonly preceded by posterior
vitreous detachment. A posterior vitreous detachment (PVD) is a
condition of the eye in which the vitreous membrane separates from
the retina. It refers to the separation of the posterior hyaloid
membrane from the retina anywhere posterior to the vitreous base (a
3-4 mm wide attachment to the ora serrata). Broadly speaking, the
condition is common for older adults and over 75% of those over the
age of 65 develop it. Although less common among people in their
40s or 50s, the condition is not rare for those individuals.
[0284] Retinal detachment may be caused by e.g. AIDS, cataract
surgery, diabetic retinopathy, eclampsia, homocysteinuria,
malignant hypertension, retinoblastoma, metastatic eye cancer,
stickler syndrome and Von Hippel-Lindau disease.
[0285] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of posterior vitreous detachment.
[0286] Retinal detachment may be sub-classified into the following
three types, which are all encompassed by the present
invention:
1) Rhegmatogenous retinal detachment--occurs due to a break in the
retina (called a retinal tear) that allows fluid to pass from the
vitreous space into the subretinal space. Retinal breaks are
divided into three types--holes, tears and dialyses. Holes form due
to retinal atrophy especially within an area of lattice
degeneration. Tears are due to vitreoretinal traction. Dialyses
which are very peripheral and circumferential may be either
tractional or atrophic, the atrophic form most often occurring as
idiopathic dialysis of the young. A minority of rhegmatogenous
retinal detachments result from trauma, including blunt blows to
the orbit, penetrating trauma, and concussions to the head. Gradual
onset appears to be the norm, with over 50% presenting more than
one month after the inciting injury. 2) Exudative, serous, or
secondary retinal detachment--occurs due to inflammation, injury or
vascular abnormalities that results in fluid accumulating
underneath the retina without the presence of a hole, tear, or
break. In evaluation of retinal detachment it is critical to
exclude exudative detachment as surgery will make the situation
worse, not better. Although rare, exudative retinal detachment can
be caused by the growth of a tumor on the layers of tissue beneath
the retina, namely the choroid. This cancer is called a choroidal
melanoma, and 3) Tractional retinal detachment--occurs when fibrous
or fibrovascular tissue, caused by an injury, inflammation or
neovascularization, pulls the sensory retina from the retinal
pigment epithelium.
[0287] Treatment of retinal detachment by use of the peptides
according to the present invention is an alternative or may be an
add-on to the surgical treatment employed today, including Cryopexy
and laser photocoagulation, Scleral buckle surgery, Pneumatic
retinopexy and Vitrectomy.
Retinopathies
[0288] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of a retinopathy.
[0289] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of a retinopathy selected from the group consisting of
diabetic retinopathy, hypertensive retinopathy, radiation
retinopathy, proliferative vitreoretinopathy (PVR), retinopathy due
to autoimmune disease, retinopathy due to anemia, and retinopathy
due to retinal vein or artery occlusion.
[0290] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of diabetic retinopathy.
[0291] Diabetic retinopathy is retinopathy (damage to the retina)
caused by complications of diabetes, which can eventually lead to
blindness. It is an ocular manifestation of diabetes, a systemic
disease, which affects up to 80 percent of all patients who have
had diabetes for 10 years or more.
http://en.wikipedia.org/wiki/Diabetic_retinopathy-cite_note-kertes2-
007-3 The longer a person has diabetes, the higher his or her
chances of developing diabetic retinopathy.
[0292] Diabetic retinopathy is the result of microvascular retinal
changes. Hyperglycemia-induced intramural pericyte death and
thickening of the basement membrane lead to incompetence of the
vascular walls. These damages change the formation of the
blood-retinal barrier and also make the retinal blood vessels
become more permeable. Small blood vessels such as those in the eye
are especially vulnerable to poor blood glucose control. During the
initial stage, called non-proliferative diabetic retinopathy
(NPDR), most people do not notice any change in their vision. Early
changes that are reversible and do not threaten central vision are
sometimes termed simplex retinopathy or background retinopathy As
the disease progresses, severe non-proliferative diabetic
retinopathy enters an advanced, or proliferative (PDR), stage when
blood vessels proliferate. The lack of oxygen in the retina causes
fragile, new, blood vessels to grow along the retina and in the
clear, gel-like vitreous humour that fills the inside of the eye.
Without timely treatment, these new blood vessels can bleed, cloud
vision, and destroy the retina. Fibrovascular proliferation can
also cause tractional retinal detachment. The new blood vessels can
also grow into the angle of the anterior chamber of the eye and
cause neovascular glaucoma.
[0293] There is no cure for diabetic retinopathy, however further
vision loss may be slowed or stopped by laser surgery/laser
photocoagulation, injection of corticosteroids or Anti-VEGF (VEGF
antibody) into the eye, or vitrectomy (surgery to remove some or
all of the vitreous humor from the eye).
[0294] Hypertensive retinopathy is damage and adaptive changes to
the retina and retinal circulation due to high blood pressure (i.e.
hypertension).
[0295] Radiation retinopathy is damage to retina due to exposure to
ionizing radiation. Said radiation may be administered for
treatment of ocular and other cancers, such as cancers of the head
and neck area. Radiation retinopathy has a delayed onset, typically
after months or years of radiation, and is slowly progressive. An
exposure to doses of 30-35 Gy or more is usually required to induce
clinical symptoms, however, retinopathy may develop after as little
as 15 Gy of external-beam radiation.
[0296] Proliferative vitreoretinopathy (PVR) is a disease that
develops as a complication, secondary to rhegmatogenous retinal
detachment (occurs due to a break in the retina) following retinal
disease, injury or surgery. PVR occurs in about 8-10% of patients
undergoing primary retinal detachment surgery and prevents the
successful surgical repair of rhegmatogenous retinal detachment.
PVR is nowadays be treated with surgery to reattach the detached
retina but the visual outcome of the surgery is very poor.
Age-Related Macular Degeneration (AMD)
[0297] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of age-related macular degeneration.
[0298] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of any stage of age-related macular degeneration
(AMD).
[0299] Age-related macular degeneration (AMD) is a medical
condition which usually affects older adults and results in a loss
of vision in the center of the visual field (the macula) because of
damage to the retina. It is a major cause of blindness and visual
impairment in older adults (>50 years).
[0300] AMD occurs in a "dry" and a "wet" form. The dry
(nonexudative) form results from atrophy of the retinal pigment
epithelial layer below the retina, which causes vision loss through
loss of photoreceptors (rods and cones) in the central part of the
eye. Cellular debris called drusen accumulates between the retina
and the choroid, and the retina can become detached. The wet
(exudative) form, which is more severe, causes vision loss due to
abnormal blood vessel growth (choroidal neovascularization) where
blood vessels grow up from the choroid behind the retina, whereby
the retina can become detached. Bleeding, leaking, and scarring
from these blood vessels eventually cause irreversible damage to
the photoreceptors and rapid vision loss if left untreated.
Myopic Degeneration
[0301] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of myopic degeneration (also known as degenerative myopia
or myopic macular degeneration).
[0302] Myopia, also commonly known as near-sightedness, occurs
because the eye is longer than average, causing a blurry image on
the retina. In healthy myopic people, vision can be corrected using
eyeglasses, contact lenses or laser vision correction. Unlike
age-related macular degeneration, myopic macular degeneration can
occur at ages as young as 30 years old.
Cone Dystrophy
[0303] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of cone dystrophy.
[0304] A cone dystrophy is an inherited ocular disorder
characterized by the loss of cone cells, the photoreceptors
responsible for both central and color vision. The pathogenesis of
cone dystrophy has yet to be elucidated. It appears that the
dystrophy is primary. However, the retinal pigment epithelium (RPE)
rapidly becomes involved, leading to a retinal dystrophy primarily
involving the macula.
Other Eye Diseases
[0305] There are many inherited and acquired diseases or disorders
that may affect the retina and/or optic nerve. In one embodiment
there is provided a peptide or a nucleic acid construct according
to the present invention for use in the treatment of a condition
selected from the group consisting of retinal vein occlusion and
retinal artery occlusion, such as central retinal vein occlusion
(CRVO) and Branch retinal vein occlusion (BRVO) (which may in turn
cause e.g. glaucoma and retinopathy); Uveitis/Vasculitis; Ocular
hypertension (when consistent over longer periods of time, can
result in nerve damage); Optic neuropathy (aka. optic atrophy,
which is damage to the optic nerve due to any cause) including
Ischemic optic neuropathy, Optic neuritis, Compressive optic
neuropathy, Infiltrative optic neuropathy, Traumatic optic
neuropathy, Mitochondrial optic neuropathies, Nutritional optic
neuropathies, Toxic optic neuropathies and Hereditary optic
neuropathies; Leber's congenital amaurosis (LCA), Lipemia
retinalis, eye injury, Angioid streaks (aka. Knapp streaks or Knapp
striae), and cancers of the retina including retinoblastoma and
metastatic eye cancer.
[0306] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in a
method of treating a disease or disorder of the eye, wherein said
disease or disorder of the eye is an optic nerve disease. In one
embodiment, said optic nerve disease is injury to the optic nerve
such as injury caused by glaucoma, Optic neuritis, Anterior
Ischemic Optic Neuropathy, or Optic nerve hypoplasia.
[0307] Optic neuritis is inflammation of the optic nerve. It is
associated with a number of diseases, the most notable one being
multiple sclerosis. Up to 50% of patients with MS will develop an
episode of optic neuritis, and 20-30% of the time optic neuritis is
the presenting sign of MS. Some other causes of optic neuritis
include infection (e.g. syphilis, Lyme disease, herpes zoster),
autoimmune disorders (e.g. lupus), inflammatory bowel disease, drug
induced (e.g. chloramphenicol, ethambutol) vasculitis, and
diabetes.
[0308] Ischemic optic neuropathy (ION) is the loss of structure and
function of a portion of the optic nerve due to obstruction of
blood flow to the nerve (i.e. ischemia). Anterior Ischemic Optic
Neuropathy (AION) is a particular type of infarct that affects
patients with an anatomical predisposition and cardiovascular risk
factors. It is caused by damage to the optic nerve from
insufficient blood supply. AION is generally divided into two
types: arteritic AION (or AAION) and non-arteritic AION (NAION or
simply AION), both of which are encompassed by the present
invention. AAION is due to temporal arteritis (also called giant
cell arteritis), an inflammatory disease of medium-sized blood
vessels that occurs especially with advancing age. In contrast,
NAION results from the coincidence of cardiovascular risk factors
in a patient with "crowded" optic discs. Non-arteritic AION is more
common than AAION.
[0309] Optic nerve hypoplasia is the underdevelopment of the optic
nerve causing little to no vision in the affected eye. This
condition is the most common congenital optic nerve anomaly. The
optic disc appears abnormally small, because not all the optic
nerve axons have developed properly. It is often associated with
endocrinopathies (hormone deficiencies), developmental delay, and
brain malformations.
[0310] Leber's congenital amaurosis (LCA) is a rare inherited eye
disease, an autosomal recessive disorder thought to be caused by
abnormal development of photoreceptor cells.
[0311] Uveitis is broadly defined as inflammation of the uvea. The
uvea consists of the middle, pigmented, vascular structures of the
eye and includes the iris, ciliary body, and choroid.
Glaucoma
[0312] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of glaucoma.
[0313] Glaucoma is a group of diseases in which the optic nerve is
damaged, involving loss of retinal ganglion cells causing optic
neuropathy in a pattern of peripheral vision loss, initially
sparing central vision. Untreated glaucoma can lead to permanent
damage of the optic nerve and resultant visual field loss, which
over time can progress to blindness. It is normally associated with
increased fluid pressure in the eye (aqueous humour). The nerve
damage involves loss of retinal ganglion cells in a characteristic
pattern. The many different subtypes of glaucoma can all be
considered to be a type of optic neuropathy.
[0314] Glaucoma can be roughly divided into two main categories,
"open-angle" and "closed-angle" (or "angle closure") glaucoma. The
angle refers to the area between the iris and cornea, through which
fluid must flow to escape via the trabecular meshwork. Closed-angle
glaucoma can appear suddenly and is often painful; visual loss can
progress quickly, but the discomfort often leads patients to seek
medical attention before permanent damage occurs. Open-angle,
chronic glaucoma tends to progress at a slower rate and patients
may not notice they have lost vision until the disease has
progressed significantly. Open-angle glaucoma accounts for 90% of
glaucoma cases in the US. It is painless and does not have acute
attacks
[0315] Worldwide, glaucoma is the second-leading cause of blindness
after cataracts. Glaucoma affects one in 200 people aged 50 and
younger, and one in 10 over the age of eighty. If the condition is
detected early enough, it is possible to arrest the development or
slow the progression with medical and surgical means; however no
cure or improvement is possible at present.
[0316] Of the several causes for glaucoma, ocular hypertension
(increased pressure within the eye) is the most important risk
factor in most glaucomas, but in some populations, only 50% of
people with primary open-angle glaucoma actually have elevated
ocular pressure. Positive family history is a risk factor for
glaucoma. Intraocular pressure can be lowered with medication,
usually eye drops. Both laser and conventional surgeries are
performed to treat glaucoma. Surgery is the primary therapy for
those with congenital glaucoma (including Canaloplasty, Laser
surgery, Trabeculectomy and Glaucoma drainage implants). Generally,
these operations are a temporary solution, as there is not yet a
cure for glaucoma.
Method of Treatment--Diseases and Disorders of the Central Nervous
System
[0317] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in a
method of treating a disease or disorder of the central nervous
system (CNS).
Neurodegenerative Disorders
[0318] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of a neurodegenerative disorder.
[0319] Particularly, said neurodegenerative disorder is such that
neuritogenesis, neuroprotection and/or neuroplastic changes are
desired. Neurodegeneration is the umbrella term for the progressive
loss of structure or function of neurons, including death of
neurons. Many neurodegenerative diseases including Parkinson's,
Alzheimer's, and Huntington's occur as a result of
neurodegenerative processes.
[0320] Neurodegenerative diseases are a growing cause of disability
in the aging community. Alzheimer's disease (AD) is the most common
neurodegenerative disorder. The annual incidence of AD worldwide is
estimated to be 4.6 million cases, with one new case every 7 s.
Neurodegeneration, the slow progression of dysfunction associated
with a loss of neurons and axonal connections in the central
nervous system (CNS), is the primary pathological characteristic of
such neurological disorders as AD, Parkinson's disease (PD) and
Huntington's disease (HD). This loss results in gross atrophy of
the affected regions, including degeneration in the temporal lobe
and parietal lobe, and parts of the frontal cortex and cingulate
gyrus.
[0321] Many neurodegenerative diseases are caused by genetic
mutations, most of which are located in completely unrelated genes.
In many of the different diseases, the mutated gene has a common
feature: a repeat of the CAG nucleotide triplet (encodes
glutamine). A repeat of CAG results in a polyglutamine (polyQ)
tract, and diseases showing this are known as polyglutamine
diseases (polyQ diseases). These include Huntington's disease,
spinocerebellar ataxias, DRPLA (Dentatorubropallidoluysian atrophy)
and SBMA (Spinobulbar muscular atrophy or Kennedy disease).
[0322] In one embodiment, the there is provided a peptide according
to the present invention for use in the treatment of a
neurodegenerative disorder selected from the group consisting of
Alzheimer's disease, Parkinson's disease, Huntington's disease,
Amyotrophic lateral sclerosis (ALS; Lou Gehrig's Disease), Multiple
Sclerosis,
and the polyglutamine diseases including spinocerebellar ataxias
(Spinocerebellar ataxia type 1, Spinocerebellar ataxia type 2,
Spinocerebellar ataxia type 3 (aka Machado-Joseph's disease),
Spinocerebellar ataxia type 6, Spinocerebellar ataxia type 7 and
Spinocerebellar ataxia type 17), DRPLA (Dentatorubropallidoluysian
atrophy) and SBMA (Spinobulbar muscular atrophy or Kennedy
disease).
Alzheimer's Disease
[0323] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of Alzheimer's disease.
[0324] Alzheimer's disease (AD) is the most common form of
dementia. Most often, it is diagnosed in people over 65 years of
age, although the less-prevalent early-onset Alzheimer's can occur
much earlier.
[0325] Although the course of Alzheimer's disease is unique for
every individual, there are many common symptoms. The earliest
observable symptoms are often mistakenly thought to be
`age-related` concerns, or manifestations of stress. In the early
stages, the most commonly recognised symptom is inability to
acquire new memories, such as difficulty in recalling recently
observed facts. As the disease advances, symptoms include
confusion, irritability and aggression, mood swings, language
breakdown, long-term memory loss, and the general withdrawal of the
sufferer as their senses decline. Gradually, bodily functions are
lost, ultimately leading to death. The mean life expectancy
following diagnosis is approximately seven years.
[0326] Specific brain regions have been shown to shrink as AD
patients progress from mild cognitive impairment to AD. Hallmarks
of AD can be found in the brains of AD patients, who have a greater
number of amyloid plaques (insoluble deposits of amyloid beta
around neurons) and neurofibrillary tangles (aggregates of the
microtubule-associated, hyper-phosphorylated protein Tau, within
the cells) in specific brain regions such as the temporal lobe. The
accumulation of neurofibrillary tangles leads to disintegration of
the neuron transport system.
Parkinson's Disease
[0327] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of Parkinson's disease.
[0328] Parkinson's disease (PD) is a degenerative disorder of the
central nervous system. It results from the death by unknown causes
of the dopamine-containing cells of the substantia nigra, which is
a region of the midbrain. Early in the course of the disease
symptoms are movement-related, including shaking, rigidity,
slowness of movement and difficulty with walking and gait. Later,
cognitive and behavioural problems may arise, with dementia
commonly occurring in the advanced stages of the disease. PD is
more common in the elderly with most cases occurring after the age
of 50 years.
[0329] The pathology of the disease is characterized by the
accumulation of a protein called .alpha.-synuclein into inclusions
called Lewy bodies in neurons, and from insufficient formation and
activity of dopamine produced in certain neurons of parts of the
midbrain.
Huntington's Disease
[0330] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of Huntington's disease.
[0331] Huntington's disease, chorea, or disorder (HD), is a
neurodegenerative genetic disorder that affects muscle coordination
and leads to cognitive decline and dementia. It typically becomes
noticeable in middle age.
[0332] The disease is caused by an autosomal dominant mutation on
either of an individual's two copies of a gene called Huntingtin.
The Huntingtin gene (HTT) codes for the protein Huntingtin (Htt).
Part of this gene is a repeated section called a trinucleotide
repeat, which varies in length between individuals and may change
length between generations. When the length of this repeated
section reaches a certain threshold, it produces an altered form of
the protein, called mutant Huntingtin protein (mHtt). The differing
functions of these proteins are the cause of pathological changes
which in turn cause the disease symptoms as the mutated protein
results in gradual damage to specific areas of the brain.
Multiple Sclerosis
[0333] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of Multiple sclerosis.
[0334] Multiple sclerosis (MS, also known as disseminated sclerosis
or encephalomyelitis disseminata) is an inflammatory disease in
which the fatty myelin sheaths around the axons of the brain and
spinal cord are damaged, leading to demyelination and scarring as
well as a broad spectrum of signs and symptoms.
[0335] MS affects the ability of nerve cells in the brain and
spinal cord to communicate with each other. Nerve cells communicate
by sending electrical signals called action potentials down long
fibers called axons, which are wrapped in an insulating substance
called myelin. In MS, the body's own immune system attacks and
damages the myelin. When myelin is lost, the axons can no longer
effectively conduct signals. The name multiple sclerosis refers to
scars (scleroses--better known as plaques or lesions) particularly
in the white matter of the brain and spinal cord, which is mainly
composed of myelin.
[0336] Almost any neurological symptom can appear with the disease,
and often progresses to physical and cognitive disability. MS takes
several forms, with new symptoms occurring either in discrete
attacks (relapsing forms) or slowly accumulating over time
(progressive forms). Between attacks, symptoms may go away
completely, but permanent neurological problems often occur,
especially as the disease advances.
[0337] There is no known cure for Multiple sclerosis. Treatments
attempt to return function after an attack, prevent new attacks,
and prevent disability.
Polyglutamine Diseases
[0338] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of a polyglutamine (polyQ) disease. In one embodiment,
said polyglutamine disease is a spinocerebellar ataxias. In one
embodiment, said polyglutamine disease is Spinocerebellar ataxia
type 1, Spinocerebellar ataxia type 2, Spinocerebellar ataxia type
3 (aka Machado-Joseph's disease), Spinocerebellar ataxia type 6,
Spinocerebellar ataxia type 7 and Spinocerebellar ataxia type 17,
DRPLA (Dentatorubropallidoluysian atrophy) and SBMA (Spinobulbar
muscular atrophy or Kennedy disease).
[0339] In one embodiment there is provided a peptide according to
the present invention for use in the treatment of Machado-Joseph's
disease. Machado-Joseph's disease (MJD) or Spinocerebellar ataxia
type 3 (SCA3) is a rare autosomal, dominantly inherited
neurodegenerative disease that causes progressive cerebellar
ataxia, which results in a lack of muscle control and coordination
of the upper and lower extremities. The symptoms are caused by a
genetic mutation that results in an expansion of abnormal CAG
trinucleotide repeats in the ATXN3 gene, that results in
degeneration of cells in the hindbrain. Some symptoms, such as
clumsiness and rigidity, make MJD commonly mistaken for drunkenness
and/or Parkinson's disease. Eventually, MJD leads to paralysis;
however, intellectual functions usually remain the same.
[0340] In one embodiment there is provided a peptide according to
the present invention for use in the treatment of SBMA (Spinobulbar
muscular atrophy or Kennedy disease).
[0341] SBMA is a debilitating neurodegenerative disease resulting
in muscle cramps and progressive weakness due to degeneration of
motor neurons in the brain stem and spinal cord. The condition is
associated with mutation of the androgen receptor (AR) gene and is
inherited in a X-linked recessive manner. No cure is known.
[0342] In one embodiment there is provided a peptide according to
the present invention for use in the treatment of DRPLA.
Dentatorubral-pallidoluysian atrophy (DRPLA) is an autosomal
dominant spinocerebellar degeneration caused by an expansion of a
CAG repeat encoding a polyglutamine tract in the atrophin-1
protein. It is also known as Haw River Syndrome and Naito-Oyanagi
disease. While several sporadic cases have been reported from
Western countries, this disorder seems to be very rare except in
Japan.
[0343] In one embodiment there is provided a peptide according to
the present invention for use in the treatment of Spinocerebellar
ataxia.
Other CNS Disorders
[0344] In one embodiment, the there is provided a peptide or a
nucleic acid construct according to the present invention for use
in the treatment of a disease or disorder of the central nervous
system, wherein said disorder may be selected from the group
consisting of peripheral nerve lesions, stroke and epilepsy.
Epilepsy
[0345] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of epilepsy.
[0346] Epilepsy is a common and diverse set of chronic neurological
disorders characterized by seizures. Epilepsy can involve recurrent
and unprovoked seizures, or a single seizure combined with brain
alterations which increase the chance of future seizures. In many
cases a cause cannot be identified, but epilepsy is often
associated with brain trauma (sometimes as a consequence of brain
surgery), strokes, brain cancer, and drug and alcohol misuse among
others.
[0347] Epileptic seizures result from abnormal, excessive or
hypersynchronous neuronal activity in the brain. About 50 million
people worldwide have epilepsy, and nearly 80% of epilepsy occurs
in developing countries. Epilepsy becomes more common as people
age. Most epilepsy syndromes are lifelong but some forms are
confined to particular stages of childhood. Epilepsy should not be
understood as a single disorder, but rather as syndromic disorder
with vastly divergent symptoms, all involving episodic abnormal
electrical activity in the brain and numerous seizures. Epilepsy is
usually controlled, but not cured, with medication. However, over
30% of people with epilepsy do not have seizure control even with
the best available medications. Surgery may be considered in
difficult cases.
Stroke or Cerebrovascular Accident (CVA)
[0348] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of stroke.
[0349] A stroke, or cerebrovascular accident (CVA), is the rapid
loss of brain function due to disturbance in the blood supply to
the brain. This can be due to ischemia caused by blockage
(thrombosis, arterial embolism) or a hemorrhage. As a result, the
affected area of the brain cannot function, which might result in
an inability to move one or more limbs on one side of the body,
inability to understand or formulate speech, or an inability to see
one side of the visual field. A stroke is a medical emergency and
can cause permanent neurological damage and death.
[0350] Ischemic stroke occurs because of a loss of blood supply to
part of the brain, initiating the ischemic cascade, to which brain
tissue is especially vulnerable since it has little respiratory
reserve and is completely dependent on aerobic metabolism.
[0351] In addition to injurious effects on brain cells, ischemia
and infarction can result in loss of structural integrity of brain
tissue and blood vessels, partly through the release of matrix
metalloproteases. The loss of vascular structural integrity results
in a breakdown of the protective blood brain barrier that
contributes to cerebral edema, which can cause secondary
progression of the brain injury.
Peripheral Nerve Lesions
[0352] In one embodiment there is provided a peptide or a nucleic
acid construct according to the present invention for use in the
treatment of peripheral nerve lesions.
[0353] A neuron's response to trauma can often be determined by the
severity of the injury, classified by Seddon's classification. In
Seddon's Classification, nerve injury is described as either
neurapraxia (a temporary interruption of conduction without loss of
axonal continuity; a physiologic block of nerve conduction in the
affected axons), axonotmesis (loss of the relative continuity of
the axon and its covering of myelin, but preservation of the
connective tissue framework of the nerve), or neurotmesis (a total
severance or disruption of the entire nerve fiber).
[0354] Following trauma to the nerve, a short onset of afferent
impulses, termed "injury discharge", occurs. While lasting only
minutes, this occurrence has been linked to the onset of
neuropathic pain. When an axon is severed, the segment of the axon
distal to the cut degenerates and is absorbed by Schwann cells. The
proximal segment fuses, retracts, and swells, forming a "retraction
bulb." The synaptic terminal function is lost, as axoplasmic
transport ceases and no neurotransmitters are created. The nucleus
of the damaged axon undergoes chromatolysis in preparation for axon
regeneration. Schwann cells in the distal stump of the nerve and
basal lamina components secreted by Schwann cells guide and help
stimulate regeneration. The regenerating axon must make connections
with the appropriate receptors in order to make an effective
regeneration. If proper connections to the appropriate receptors
are not established, aberrant reinnervation may occur. If the
regenerating axon is halted by damaged tissue, neurofibrils may
create a mass known as a neuroma.
[0355] In the event that an injured neuron degenerates or does not
regenerate properly, the neuron loses its function or may not
function properly. Neuron trauma is not an isolated event and may
cause degenerative changes in surrounding neurons. When one or more
neurons lose their function or begin to malfunction, abnormal
signals sent to the brain may be translated as painful signals.
Method of Preparation (Peptide)
[0356] The peptides according to the present invention may be
prepared by any methods known in the art. Thus, the NPY-derived
peptides may be prepared by standard peptide-preparation techniques
such as solution synthesis or Merrifield-type solid phase
synthesis.
[0357] In one embodiment, a peptide according to the invention is a
non-naturally occurring peptide; being derived from a naturally
occurring protein (NPY; SEQ ID NO:22). This applies especially to
SEQ ID NOs:2-19.
[0358] In another embodiment, the peptide according to the
invention is a naturally occurring peptide being derived from a
naturally occurring protein (NPY; SEQ ID NO:22). This applies
especially to SEQ ID NO:1, being a metabolic clearance or
degradation product of NPY of hitherto no or unknown function.
[0359] In one embodiment a peptide according to the present
invention is purified from a naturally occurring source thereof,
such as serum. Protein purification is a series of processes
intended to isolate a single type of protein from a complex
mixture. The starting material is usually a biological tissue. The
various steps in the purification process may free the protein from
a matrix that confines it, separate the protein and non-protein
parts of the mixture, and finally separate the desired protein from
all other proteins. Separation steps may exploit differences in
(for example) protein size, physico-chemical properties, binding
affinity and biological activity.
[0360] In one embodiment a peptide according to the invention is
synthetically made or produced. The methods for synthetic
production of peptides are well known in the art. Detailed
descriptions as well as practical advice for producing synthetic
peptides may be found in Synthetic Peptides: A User's Guide
(Advances in Molecular Biology), Grant G. A. ed., Oxford University
Press, 2002, or in: Pharmaceutical Formulation: Development of
Peptides and Proteins, Frokjaer and Hovgaard eds., Taylor and
Francis, 1999.
[0361] In one embodiment the peptide or peptide sequences of the
invention are produced synthetically, in particular, by the
Sequence Assisted Peptide Synthesis (SAPS) method, by solution
synthesis, by Solid-phase peptide synthesis (SPPS) such as
Merrifield-type solid phase synthesis, by recombinant techniques
(production by host cells comprising a first nucleic acid sequence
encoding the peptide operably associated with a second nucleic acid
capable of directing expression in said host cells) or enzymatic
synthesis. These are well-known to the skilled person.
[0362] Peptides may be synthesised either batch-wise on a fully
automated peptide synthesiser using 9-fluorenylmethyloxycarbonyl
(Fmoc) or tert-Butyloxycarbonyl (Boc) as N-a-amino protecting group
and suitable common protection groups for side-chain
functionalities.
[0363] After purification such as by reversed phase HPLC, peptides
may be further processed to obtain for example cyclic or C- or
N-terminal modified isoforms. The methods for cyclization and
terminal modification are well-known in the art.
[0364] Peptides according to the invention may be synthesized as
monomers or multimers such as dimers or tetramers (>80% purity,
Schafer-N, Copenhagen, Denmark).
Administration and Dosage
[0365] According to the present invention, a peptide or a nucleic
acid construct encoding said peptide, or a composition comprising a
peptide as defined herein is administered to individuals in need of
treatment in pharmaceutically effective doses or a therapeutically
effective amount. The dosage requirements will vary with the
particular drug composition employed, the route of administration
and the particular subject being treated, which depend on the
severity and the sort of the disorder as well as on the weight and
general state of the subject. It will also be recognized by one
skilled in the art that the optimal quantity and spacing of
individual dosages of a peptide compound will be determined by the
nature and extent of the condition being treated, the form, route
and site of administration, and the particular patient being
treated, and that such optima can be determined by conventional
techniques. It will also be appreciated by one of skill in the art
that the optimal course of treatment, i.e., the number of doses of
a compound given per day for a defined number of days, can be
ascertained using conventional course of treatment determination
tests.
[0366] A `bioactive agent` will be used to denote collectively a
peptide, a nucleic acid construct encoding said peptide, and a
composition comprising a peptide according to the present
invention.
[0367] In one embodiment of the present invention, the bioactive
agent is administered in doses of from 1 .mu.g/day to 100 mg/day;
such as from 1 .mu.g/day to 10 .mu.g/day, such as 10 .mu.g/day to
100 .mu.g/day, such as 100 .mu.g/day to 250 .mu.g/day, such as 250
.mu.g/day to 500 .mu.g/day, such as 500 .mu.g/day to 750 .mu.g/day,
such as 750 .mu.g/day to 1 mg/day, such as 1 mg/day to 2 mg/day,
such as 2 mg/day to 5 mg/day, or such as 5 mg/day to 10 mg/day,
such as 10 mg/day to 20 mg/day, such as 20 mg/day to 30 mg/day,
such as 30 mg/day to 40 mg/day, such as 40 mg/day to 50 mg/day,
such as 50 mg/day to 75 mg/day, or such as 75 mg/day to 100
mg/day.
[0368] In one embodiment of the present invention, one single dose
of the bioactive agent is administered and may comprise of from 1
.mu.g/kg body weight to 100 mg/kg body weight; such as from 1 to 10
.mu.g/kg body weight, such as 10 to 100 .mu.g/day, such as 100 to
250 .mu.g/kg body weight, such as 250 to 500 .mu.g/kg body weight,
such as 500 to 750 .mu.g/kg body weight, such as 750 .mu.g/kg body
weight to 1 mg/kg body weight, such as 1 mg/kg body weight to 2
mg/kg body weight, such as 2 to 5 mg/kg body weight, such as 5 to
10 mg/kg body weight, such as 10 to 20 mg/kg body weight, such as
20 to 30 mg/kg body weight, such as 30 to 40 mg/kg body weight,
such as 40 to 50 mg/kg body weight, such as 50 to 75 mg/kg body
weight, or such as 75 to 100 mg/kg body weight.
[0369] A dose according to the present invention may be
administered one or several times per day, such as from 1 to 6
times per day, such as from 1 to 5 times per day, such as from 1 to
4 times per day, such as from 1 to 3 times per day, such as from 1
to 2 times per day, such as from 2 to 4 times per day, such as from
2 to 3 times per day, wherein administration from 1 to 3 times per
day is preferred. A dose may also be administered in intermittent
intervals, or intervals, whereby a dose is not administered every
day. Rather one or more doses may be administered every second day,
every third day, every fourth day, every fifth day, every sixth
day, every week, every second week, every third week, every fourth
week, every fifth week, every sixth week, or intervals within those
ranges (such as every 2 to 4 weeks, or 4 to 6 weeks).
Routes of Administration
[0370] It will be appreciated that the preferred route of
administration will depend on the general condition and age of the
subject to be treated, the nature of the condition to be treated,
the location of the tissue to be treated in the body and the active
ingredient chosen.
[0371] In one embodiment of the present invention, the route of
administration allows for the bioactive agent to cross the
blood-brain barrier.
Systemic Treatment
[0372] For systemic treatment according to the present invention
the route of administration is capable of introducing the bioactive
agent (a peptide, a nucleic acid construct encoding said peptide,
and a composition comprising a peptide according to the present
invention) into the blood stream to ultimately target the sites of
desired action.
[0373] Such routes of administration are any suitable routes, such
as an enteral route (including the oral, rectal, nasal, pulmonary,
buccal, sublingual, transdermal, intracisternal and intraperitoneal
administration), and/or a parenteral route (including subcutaneous,
intramuscular, intrathecal, intracerebral, intravenous and
intradermal administration).
Parenteral Administration
[0374] Parenteral administration is any administration route not
being the oral/enteral route whereby the medicament avoids
first-pass degradation in the liver. Accordingly, parenteral
administration includes any injections and infusions, for example
bolus injection or continuous infusion, such as intravenous
administration, intramuscular administration or subcutaneous
administration. Furthermore, parenteral administration includes
inhalations and topical administration.
[0375] Accordingly, the bioactive agent may be administered
topically to cross any mucosal membrane of an animal to which the
biologically active substance is to be given, e.g. in the nose,
vagina, eye, mouth, genital tract, lungs, gastrointestinal tract,
or rectum, preferably the mucosa of the nose, or mouth, and
accordingly, parenteral administration may also include buccal,
sublingual, nasal, rectal, vaginal and intraperitoneal
administration as well as pulmonal and bronchial administration by
inhalation or installation. Also, the agent may be administered
topically to cross the skin.
Local Treatment
[0376] The bioactive agent according to the invention may in one
embodiment be used as a local treatment, i.e. be introduced
directly to the site(s) of action. Accordingly, the bioactive agent
may be applied to the skin or mucosa directly, or the bioactive
agent may be injected into the site of action, for example into the
diseased tissue or to an end artery leading directly to the
diseased tissue.
[0377] These administration forms preferably avoid the blood brain
barrier, and the blood-retina barrier.
Local Treatment--Injection into the Eye
[0378] In one particular embodiment, the bioactive agent according
to the present invention is injected directly into the eye, i.e.
into the vitreous humour of the eye. This is termed intravitreal or
intraocular injection. This will allow the injected matter to reach
also the retina lining the inner surface of the eye. After the
pupil is dilated and the eye is numbed with anesthesia, the
medication is injected into the vitreous, or jelly-like substance
in the back chamber of the eye. The medication may be administered
by an injection into the eye as needed at regular intervals.
[0379] In another embodiment, the bioactive agent according to the
present invention is injected into the retina, such as one or more
of the layers of the retina. In one embodiment, said administration
is subretinal administration.
[0380] Preferably, injection into the eye will occur in order to
allow the injected matter to reach the retina, such as the neurons
of the retina. Instruments developed for performing vitrectomies
(surgery to remove some or all of the vitreous humor from the eye),
or instruments developed for silicone oil injection (filling of the
eye with liquid silicone to hold the retina in place) may be
employed for this purpose, including cannulas and syringes.
[0381] Patients may use eye drops for several weeks or longer to
allow the surface of the eye to heal after injection. In some cases
heavy lifting is avoided for a few weeks.
Local Treatment--Injection into the Brain Area
[0382] In one particular embodiment, the bioactive agent according
to the present invention is applied or injected directly into the
brain, such as into a specific region of the brain. Thus, an effect
of the bioactive agent may be achieved in the region of the brain
where it is mainly required. This may depend on the condition being
treated. This may be termed intracerebral administration.
[0383] In another embodiment, the bioactive agent is administered
via intrathecal administration or injection, i.e. in the space
under the arachnoid membrane of the brain or spinal cord.
Pharmaceutical Formulation
[0384] Whilst it is possible for the bioactive agent of the present
invention (a peptide, a nucleic acid construct encoding said
peptide, and a composition comprising a peptide) to be administered
as the raw chemical (peptide), it is sometimes preferred to present
them in the form of a pharmaceutical formulation. Such a
pharmaceutical formulation may be referred to as a pharmaceutical
composition, pharmaceutically acceptable composition or
pharmaceutically safe composition.
[0385] Accordingly, the present invention further provides a
pharmaceutical formulation, which comprises a bioactive agent of
the present invention, or a pharmaceutically acceptable salt or
ester thereof, and a pharmaceutically acceptable carrier, excipient
and/or diluent. The pharmaceutical formulations may be prepared by
conventional techniques, e.g. as described in Remington: The
Science and Practice of Pharmacy 2005, Lippincott, Williams &
Wilkins.
[0386] The pharmaceutically acceptable carriers can be either solid
or liquid. Solid form preparations include powders, tablets, pills,
capsules, cachets, suppositories, and dispersible granules. A solid
carrier can be one or more excipients which may also act as
diluents, flavouring agents, solubilizers, lubricants, suspending
agents, binders, preservatives, wetting agents, tablet
disintegrating agents, or an encapsulating material.
[0387] Examples of solid carriers are lactose, terra alba, sucrose,
cyclodextrin, talc, gelatin, agar, pectin, acacia, magnesium
stearate, stearic acid or lower alkyl ethers of cellulose. Examples
of liquid carriers are syrup, peanut oil, olive oil, phospholipids,
fatty acids, fatty acid amines, polyoxyethylene, water, saline or a
glucose solution. Similarly, the carrier or diluent may include any
sustained release material known in the art, such as glycerol
monostearate or glycerol distearate, alone or mixed with a wax.
[0388] Also included are solid form preparations which are intended
to be converted, shortly before use, to liquid form preparations.
Such liquid forms include solutions, suspensions, and emulsions.
These preparations may contain, in addition to the active
component, colorants, flavours, stabilizers, buffers, artificial
and natural sweeteners, dispersants, thickeners, solubilizing
agents, and the like.
[0389] The bioactive agent of the present invention may be
formulated for parenteral administration and may be presented in
unit dose form in ampoules, pre-filled syringes, small volume
infusion or in multi-dose containers, optionally with an added
preservative. The compositions may take such forms as suspensions,
solutions, or emulsions in oily or aqueous vehicles, for example
solutions in aqueous polyethylene glycol.
[0390] Examples of oily or non-aqueous carriers, diluents, solvents
or vehicles include propylene glycol, polyethylene glycol,
vegetable oils (e.g., olive oil), and injectable organic esters
(e.g., ethyl oleate), and may contain agents such as preserving,
wetting, emulsifying or suspending, stabilizing and/or dispersing
agents. Alternatively, the active ingredient may be in powder form,
obtained by aseptic isolation of sterile solid or by lyophilisation
from solution for constitution before use with a suitable vehicle,
e.g., sterile, pyrogen-free water.
[0391] The bioactive agent of the invention may also be formulated
for topical delivery. Regions for topical administration include
the eye or the cornea, the skin surface and also mucous membrane
tissues of the vagina, rectum, nose, mouth, and throat. The topical
formulation may include a pharmaceutically acceptable carrier
adapted for topical administration. Thus, the composition may take
the form of a suspension, solution, ointment, lotion, sexual
lubricant, cream, foam, aerosol, spray, suppository, implant,
inhalant, tablet, capsule, dry powder, syrup, balm or lozenge, for
example.
[0392] Lotions according to the present invention also include
those suitable for application to the eye. An eye lotion may
comprise a sterile aqueous solution optionally containing a
bactericide.
[0393] The formulations of the present embodiment may also include
other agents useful for pH maintenance, solution stabilization, or
for the regulation of osmotic pressure.
[0394] Pharmaceutically acceptable salts of the instant peptide
compounds, where they can be prepared, are also intended to be
covered by this invention. These salts will be ones which are
acceptable in their application to a pharmaceutical use. By that it
is meant that the salt will retain the biological activity of the
parent compound and the salt will not have untoward or deleterious
effects in its application and use in treating diseases.
[0395] Pharmaceutically acceptable salts are prepared in a standard
manner. If the parent compound is a base it is treated with an
excess of an organic or inorganic acid in a suitable solvent. If
the parent compound is an acid, it is treated with an inorganic or
organic base in a suitable solvent.
[0396] The peptide compounds of the invention may be administered
in the form of an alkali metal or earth alkali metal salt thereof,
concurrently, simultaneously, or together with a pharmaceutically
acceptable carrier or diluent, especially and preferably in the
form of a pharmaceutical composition thereof, whether by oral,
rectal, or parenteral (including subcutaneous) route, in an
effective amount.
[0397] Examples of pharmaceutically acceptable acid addition salts
for use in the present inventive pharmaceutical composition include
those derived from mineral acids, such as hydrochloric,
hydrobromic, phosphoric, metaphosphoric, nitric and sulfuric acids,
and organic acids, such as tartaric, acetic, citric, malic, lactic,
fumaric, benzoic, glycolic, gluconic, succinic, p-toluenesulphonic
acids, and arylsulphonic, for example.
Second Active Ingredients
[0398] The bioactive agent of the present invention may be combined
with or comprise one or more second or further active ingredients
which are understood as other therapeutical compounds or
pharmaceutically acceptable derivatives thereof.
[0399] Methods for treatment according to the present invention may
thus further comprise one or more steps of administration of one or
more second active ingredients, either concomitantly or
sequentially, and in any suitable ratios. Such second active
ingredients may, for example, be selected from compounds used to
treat or prevent symptoms and complications associated with a
disease or disorder of the CNS or eye.
[0400] Methods of treatment according to the present invention may
include a step wherein the pharmaceutical composition or peptide as
defined herein is administered simultaneously, sequentially or
separately in combination with one or more second active
ingredients.
[0401] It follows, that co-administration should be targeted so
that to optimise treatment of the patient, i.e. in a patient with
multiple sclerosis, a drug approved for this specific purpose may
be complemented with the peptide, compound or composition according
to the present invention to optimise and improve treatment outcome
for the patient. This is regardless of whether the approved drug
for the specific purpose is prophylactic, ameliorating or
curative.
[0402] In one embodiment, the bioactive agent of the invention is
used in combination with an (one or more) agent(s) known for
treating a disease or disorder of the eye or retina/optic nerve. In
one embodiment said agent is capable of inhibiting VEGF (vascular
endothelial growth factor), for example an anti-VEGF antibody, such
as Avastin, Macugen and Lucentis, which are approved for treatment
of macular degeneration, diabetic retinopathy and retinal vein
occlusion. In one embodiment anti-VEGF treatment may inhibit the
neuroprotective effects of VEGF, thus warranting the
co-administration of an agent with neuroprotective effects, such as
the bioactive agent of the invention.
[0403] Thus in one embodiment there is provided a method of
treating a disease or disorder of the eye or retina/optic nerve
comprising use of or co-administration of a bioactive agent of the
present invention and an agent capable of inhibiting VEGF.
Co-administration may in one embodiment be simultaneous, separate
or sequential.
[0404] Thus in one embodiment there is provided a method of
treating a disease or disorder of the eye or retina/optic nerve
comprising use of or administration of a bioactive agent of the
invention in connection with surgery such as eye surgery. Thus, the
bioactive agent may in one embodiment be administered before eye
surgery and/or during eye surgery and/or after eye surgery.
[0405] Thus in one embodiment there is provided a method of
treating retinal detachment comprising administration of a
bioactive agent of the invention in connection with eye surgery,
such as before eye surgery and/or during eye surgery and/or after
eye surgery.
[0406] In one embodiment, the bioactive agent of the invention is
used in combination with other peptides or peptide fragments which
are not derived from NPY. In one particular embodiment, said
peptide is derived from BDNF or GDNF. In one particular embodiment
the bioactive agent of the invention is used in combination with a
GDNF peptide, such as the GDNF peptides disclosed in WO
2007/019860.
Kit-of-Parts
[0407] The present invention also relates to a kit-of-parts
comprising one or more of the bioactive agents described above (a
peptide, a nucleic acid construct or a composition), and at least
one additional or further component.
[0408] A kit of parts according to the present invention comprises
one or more of the bioactive agents as defined herein for
treatment, prevention or alleviation of a disease or disorder of
the CNS or eye. Kits according to the present invention allows for
simultaneous, sequential or separate administration of the
bioactive agent according to the present invention and/or one or
more second active ingredients as described herein elsewhere.
TABLE-US-00004 SEQ ID NO DESCRIPTION SEQ ID NO: 1 NPY3-35
SKPDNPGEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 2 NPY4-35
KPDNPGEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 3 NPY5-35
PDNPGEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 4 NPY6-35
DNPGEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 5 NPY7-35
NPGEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 6 NPY8-35
PGEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 7 NPY9-35
GEDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 8 NPY10-35
EDAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 9 NPY11-35
DAPAEDMARYYSALRHYINLITRQR SEQ ID NO: 10 NPY12-35
APAEDMARYYSALRHYINLITRQR SEQ ID NO: 11 NPY13-35
PAEDMARYYSALRHYINLITRQR SEQ ID NO: 12 NPY14-35
AEDMARYYSALRHYINLITRQR SEQ ID NO: 13 NPY15-35 EDMARYYSALRHYINLITRQR
SEQ ID NO: 14 NPY16-35 DMARYYSALRHYINLITRQR SEQ ID NO: 15 NPY17-35
MARYYSALRHYINLITRQR SEQ ID NO: 16 NPY18-35 ARYYSALRHYINLITRQR SEQ
ID NO: 17 NPY189-35 RYYSALRHYINLITRQR SEQ ID NO: 18 NPY20-35
YYSALRHYINLITRQR SEQ ID NO: 19 NPY21-35 YSALRHYINLITRQR SEQ ID NO:
20 NPY22-35 SALRHYINLITRQR SEQ ID NO: 21 NPY23-35 ALRHYINLITRQR SEQ
ID NO: 22 NPY1-36 (NPY, full-length NPY)(Tyr36 amidated)
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY SEQ ID NO: 23 NPY21-36 (Tyr36
amidated) YSALRHYINLITRQRY SEQ ID NO: 24 NPY23-36 (Tyr36 amidated)
ALRHYINLITRQRY SEQ ID NO: 25 NPY25-36 (Tyr36 amidated) RHYINLITRQRY
SEQ ID NO: 26 NPY27-36 (Tyr36 amidated) YINLITRQRY SEQ ID NO: 27
NPY31-36 (Tyr36 amidated) ITRQRY SEQ ID NO: 28 NPY1-30
YPSKPDNPGEDAPAEDMARYYSALRHYINL SEQ ID NO: 29 NPY1-36
SKPDNPGEDAPAEDMARYYSALRHYINL SEQ ID NO: 30 NPY1-36
YPSKPDNPGEDAPAEDMARY SEQ ID NO: 31 NPY21-34 YSALRHYINLITRQ SEQ ID
NO: 32 Pro-NPY, UnitProt Accession No.: P0103 (NPY_HUMAN; 97 amino
acides) MLGNKRLGLS GLTLALSLLV CLGALAEAYP SKPDNPGEDA PAEDMARYYS
ALRHYINLIT RQRYGKRSSP ETLISDLLMR ESTENVPRTR LEDPAMW SEQ ID NO: 33
CPON aa 68-97 of Pro-NPY (last 30 aa) SEQ ID NO: 34 NPY24-35
LRHYINLITRQR SEQ ID NO: 35 NPY3-35 reversed sequence
RQRTILNIYHRLASYYRAMDEAPADEGPNDPKS SEQ ID NO: 36 NPY21-35 ALA-21
ASALRHYINLITRQR SEQ ID NO: 37 Free acid NPY (C-terminal -OH)-TYR
not amidated YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY SEQ ID NO: 38
NPY21-36 (Tyr36 amidated) SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY SEQ ID
NO: 39 NPY21-36 (Tyr36 amidated) YSALRHYINLITRQRY SEQ ID NO: 40
NPY23-36 (Tyr36 amidated) ALRHYINLITRQRY SEQ ID NO: 41 NPY23-36
ALA-36 ALRHYINLITRQRA SEQ ID NO: 42 NPY25-36 (Tyr36 amidated)
RHYINLITRQRY SEQ ID NO: 43 NPY27-36 (Tyr36 amidated) YINLITRQRY SEQ
ID NO: 44 NPY31-36 (Tyr36 amidated) ITRQRY
EXAMPLES
Example 1: Methods
Peptides
[0409] Peptides were synthesized as monomers from Schafer-N,
Copenhagen, Denmark. If dimers or tetramers were used they
consisted of two and four chains, respectively, coupled to a lysine
backbone, as previously described (Pankratova et al., 2010).
Surface Plasmon Resonance Analysis
[0410] The analysis was performed with a Biacore 2000 machine (GE
Healthcare, Hilleroed, Denmark). NCAM Ig1 module was immobilized on
a sensor chip. NPY, NPY fragments or control molecules were infused
over the chip. The data were analyzed by non-linear curve fitting
using the software package BIAevaluation v. 4 (GE Healthcare). The
curves were fitted to a 1:1 Langmuir binding model, and rate and
equilibrium constants were calculated. Cf. FIG. 1.
NPY Receptor Binding
[0411] HEK293 cells stably transfected to express NPY Y1, Y2 or Y5
receptors were treated with [.sup.125I]-labeled NPY and
subsequently supplied with rising concentrations of NPY or NPY3-35
to displace the cell bound [.sup.125I]-labeled NPY. Cf. FIG. 2.
Neurite Outgrowth
[0412] Cultures of Wistar rat hippocampal neurons, embryonic stage
day 19 (E19), seeded at a density of 12,500 cells/cm.sup.2 in
LabTek permanox slides and incubated for 24 hours (37.degree. C.,
5% CO.sub.2) in supplemented neurobasal medium with raising
concentrations of NPY or NPY3-35. When pharmacological inhibitors
or antagonist are applied these are added to cultures 10 min prior
to peptide addition. When soluble immunoglobulin modules are used,
these are preincubated with peptide solution for 10 min before
addition of the mix to the cultures. To knock down NCAM expression,
the neurons were transfected with a p-GFP-V-RS vector that encodes
short-hairpin RNA targeting NCAM (OriGene, Rockville, Md., USA)
using a nucleofector device and a Rat Neuron Nucleofector kit
(Amaxa, Gaithersburg, Md., USA). NCAM knock-out mice (C57Bl/6JZtm)
were a kind gift from prof. Herbert Hildebrandt (Hannover Medical
School) and were created as previous described (Cremer et al.,
1994). The neurons were fixed, immunostained, and micrographs were
recorded and evaluated as previously described (Renn et al., 2000;
Nielsen et al., 2009). Cf. FIGS. 3-9
Electrophysiology
[0413] Evoked fEPSPs
[0414] Naive SD rats (n=14, all males, 42.+-.2 days old, Charles
River, Germany) were briefly sedated with isoflurane before
decapitation. The skull was rapidly removed and the brain was
immersed in ice-cold sucrose-based solution containing in mM:
sucrose 75, NaCl 67, NaHCO.sub.3 26, Glucose 25, KCl 2.5,
NaH.sub.2PO.sub.4 1.25, CaCl.sub.2 0.5, MgCl.sub.2 7 (equilibrated
with 5% CO.sub.2 and 95% O.sub.2, mean pH: 7.4 and mOsm: 308).
Within the same solution, coronal slices of 400 .mu.m thickness
were cut on a Leica VT1200S vibratome. Slices were rested for
>90 min at 34.degree. C. in ACSF containing in mM: NaCl 119,
NaHCO.sub.3 26, Glucose 25, KCl 2.5, NaH.sub.2PO.sub.4 1.25,
CaCl.sub.2 2.5, MgSO.sub.4 1.3; mean pH: 7.4 and mOsm: 303). In a
submerged recording chamber, slices were constantly perfused with
ACSF (32.5.degree. C.) at a flow rate of 2.5 ml/min. Stimulation
and recording electrode, both filled with ACSF (1.5-2 M.OMEGA. tip
resistance) were placed in CA1 stratum radiatum. Current
stimulation intensity was adjusted to generate 50-60% of maximal
field excitatory postsynaptic potential (fEPSP). Paired-pulse
stimulations (i.e. fEPSP1 and fEPSP2) with interstimulus interval
of 50 ms were applied at 0.067 HZ throughout the entire experiment.
Once stable fEPSPs were generated for 10 min or more, a 10 min
baseline was acquired. Average amplitudes of fEPSP1 between groups
were not different during baseline recordings (NPY3-35,
1.13.+-.0.05 mV; NPY1-36, 0.94.+-.0.08 mV; ACSF: 1.05.+-.0.04 mV;
p=0.08, one-way ANOVA). Next, NPY3-35 (1 .mu.l), NPY1-36 (1 .mu.l)
or ACSF (control solution) was applied for 10 min during
recordings. To avoid excessive loss of peptide and to avoid
cross-contamination, silicon tubing and separate Sylgard
silicon-coated glass bottles were used for each condition (i.e.
NPY3-35, NPY1-36, ACSF). Recordings were continued for another 60
min. Data was acquired at 20 kHz using HEKA EPC-10 amplifier and
PATCHMASTER software (HEKA Elektronik, Lambrecht/Pfalz, Germany).
FITMASTER software (HEKA Elektronik) was used for off-line
analysis. Four consecutive paired-pulse fEPSPs were averaged and
expressed per min. For each recording, field EPSPs amplitudes
(fEPSP1) were normalized to individual baseline values, and
averaged per group. Changes in paired-pulse facilitation was
calculated as the average ratio of [fEPSP2]/[fEPSP1] at 1-10, 21-30
and 71-80 min. Cf. FIG. 10.
Mouse Hippocampus LTP Protocol
Slice Preparation
[0415] Hippocampal slices were obtained from the left hemisphere of
juvenile C57BL/6N mice (Taconic) (P12-22). After decapitation
para-sagittal slices (300 .mu.m) were cut on a vibratome (MicroM
slicer HM 650V equipped with cooling unit CU65), while the tissue
was immersed in ACSF of the following composition: (in mM NaCl,
125; KCl, 2.5; NaHCO.sub.3, 26; NaH.sub.2PO.sub.4.H.sub.2O, 1.25;
MgCl.sub.2, 1; CaCl.sub.2, 2; Glucose, 25; bubbled with 5% CO.sub.2
in 95% O.sub.2). The slices rested in oxygenated ACSF (35.degree.
C.) for at least 1 hour before measurements were performed.
Long Term Potentiation (LTP) Protocol
[0416] Hippocampal slices were obtained from the left hemisphere of
juvenile C57BL/6N mice (Taconic) (P12-22). After decapitation
para-sagittal slices (300 .mu.m) were cut on a vibratome (MicroM
slicer HM 650V equipped with cooling unit CU65), while the tissue
was immersed in ACSF of the following composition: (in mM NaCl,
125; KCl, 2.5; NaHCO.sub.3, 26; NaH2PO4.H2O, 1.25; MgCl2, 1; CaCl2,
2; Glucose, 25; bubbled with 5% CO2 in 95% O2). The slices rested
in oxygenated ACSF (35.degree. C.) for at least 1 hour before
measurements were performed.
[0417] Measurements were performed in oxygenated ACSF at room
temperature (1.1 ml/min). Schaeffer collaterals were stimulated
with a bipolar concentric electrode. The field potential in the
stratum radiatum of CA1 was recorded with an extracellular glass
microelectrode (4-6 M.OMEGA., filled with ACSF), positioned at
least 500 .mu.m away from the stimulation electrode. The stimulus
intensity was set 0.03 mA above threshold. After a 15-min baseline
obtained while stimulating at 0.05 Hz, a treatment consisting
either of ACSF, NPY 3-35 (1 .mu.M), NPY 3-35 (1 .mu.M)+Ig1 (1
.mu.M) or NPY (1 .mu.M) was applied to the extracellular medium.
After 15 min, LTP was induced by stimulating the Schaeffer
collaterals at 100 Hz for 1 s, 4 times with a 20 s interval. A new
baseline was established over the following 30 min with continuous
treatment. Potentiation was estimated by measuring the rising slope
of the field EPSP (fEPSP). Cf. FIG. 11
Spatial Memory in the Morris Water Maze Test
[0418] The Morris water maze test was a 160 cm wide circular black
tank placed in a dimly lit room and filled with 21.degree. C. water
up to 20 cm from the top. The tank was surrounded by visual
orientation marks, and a 10 cm wide escape platform was placed 1.5
cm below the surface for it to be unseen. A video camera was placed
above the tank and connected to a computerized tracking system
(Ethovision 3.1, Noldus IT, Wageningen, the Netherlands). The tank
was divided into 4 equally large quadrants that also served as
starting positions. The escape latency time to locate the platform
and the time spent in each quadrant was recorded. Prior to
training, an intracerebroventricular cannula was inserted in the
anaesthetized rats and the animals were allowed 1 week for
recovery. The rats were handled 2 min daily for 5 days prior to
start of the xperiment. Reference memory training consisted of 3
consecutive trials daily for 3 days. Each trial started with the
animal being placed in the water facing the wall of the pool. The
starting position differed for each trial but was identical for all
animals. In each trial, the animal was allowed 90 s to locate the
platform. The animals that did not find the platform were guided to
the platform and given a latency score of 90 s. After each trial,
the rats were allowed 20 s of orientation time on the platform and
then removed from the pool for 20 s before the next trial was
initiated. After the last trial each day, the animals were dried
and returned to their home cages. On the first 3 days immediately
after training, the animals were given an intracerebroventricular 4
.mu.l injection of NPY3-35 or PBS/1% BSA solution. To test for the
effects on long-term memory, the animals were given a 60 s probe
test 24 h, 1 and 2 weeks after reference memory training. In the
probe tests, the platform was removed, and the animals started from
a position in a quadrant adjacent to the original platform
quadrant. At the end of the probe test, the animal was guided to
the reintroduced platform and allowed to stay there for 20 s.
Subsequently, after the 24 h and the 1 week probe test, the animal
was given one relearning test under conditions identical to
reference memory training to counteract memory extinction. Cf.
FIGS. 12a-b
Kainate-Induced Cytotoxicity
[0419] Cultures of rat hippocampal neurons, embryonic stage day 19
(E19), seeded at a density of 50,000 cells/cm.sup.2 in
poly-L-lysine coated LabTek permanox slides. Cultures were
incubated for 7 days (37.degree. C., 5% CO.sub.2) in supplemented
neurobasal medium and treated with with raising concentrations of
NPY or NPY3-35. 1 hour later 300 mM kainate was added and cultures
were incubated for 24 hours before being fixed, stained and
analysed as previous described (Pankratova et al., 2010). Cf. FIG.
13
REFERENCES
[0420] Cremer, H., et al. Nature 367:455-459 (1994) [0421] Nielsen
J., et al. J. Neurosci. 29, 11360-11376 (2009) [0422] Pankratova
S., et al. Brain. 133:2281-2294 (2010) [0423] Ronn L. C., et al. J.
Neurosci. Methods. 100, 25-32 (2000) [0424] Berglund et al. 2003:
Recent developments in our understanding of the physiological role
of PP-fold peptide receptor subtypes. Exp. Biol. Med. 228,
217-244.
Example 2: Neurite Outgrowth
[0425] Neurite outgrowth in cultures of hippocampal neurons from
wistar rats, embryonic stage day 19, incubated for 24 hours
(37.degree. C., 5% CO.sub.2) in supplemented Neurobasal medium with
NPY fragments added; effect compared to un-stimulated controls (set
to 100%). Values are mean normalized to un-stimulated
controls.+-.standard error of mean (SEM). *P<0.05, **P<0.05,
***P<0.05, Student's t-test versus un-stimulated control.
TABLE-US-00005 Neuritogenic effect 1 .mu.M NPY 3 .mu.M NPY NPY
Sequences tested fragment (% fragment (% (tested sequence i bold,
underline of control) of control) NPY.sub.1-36 (full-length: SEQ ID
NO: 22) 166.3 .+-. 12.0 180.3 .+-. 13.5
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4)* (n = 4)* NPY.sub.3-36
(SEQ ID NO: 38) 112.1 .+-. 5.8 164.7 .+-. 11.7
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4) (n = 4)**
NPY.sub.21-36 (SEQ ID NO: 39) 107.8 .+-. 4.9 186.5 .+-. 25.8
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 8) (n = 8)**
NPY.sub.23-36 (SEQ ID NO: 40) 107.5 .+-. 5.0 156.1 .+-. 14.0
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4) (n = 4)**
NPY.sub.23-36 ala36 (SEQ ID NO: 41) 89.1 .+-. 8.0 91.7
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRA (n = 2) (n = 1) NPY.sub.25-36
(SEQ ID NO: 42) 95.9 .+-. 7.8 96.1 .+-. 4.3
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4) (n = 3) NPY.sub.27-36
(SEQ ID NO: 43) 106.6 .+-. 6.3 99.1 .+-. 4.5
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3) (n = 2) NPY.sub.31-36
(SEQ ID NO: 44) 100.2 .+-. 2.3 91.8 .+-. 8.3
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 2) (n = 2) NPY.sub.3-35
(SEQ ID NO: 1) 210.1 .+-. 4.2 889.4 .+-. 131.4
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 7)*** (n = 4)***
NPY.sub.3-35 reversed sequence (SEQ ID NO: 35) 109.9 .+-. 15.7
285.3 .+-. 100.9 YRQRTILNIYHRLASYYRAMDEAPADEGPNDPKSPY (n = 4) (n =
4) N.S., P = 0.08 NPY.sub.4-35 (SEQ ID NO: 2) 185.4 .+-. 8.1 637.3
.+-. 22.0 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3)** (n = 3)***
NPY.sub.5-35 (SEQ ID NO: 3) 193.5 .+-. 5.8 605.0 .+-. 9.8
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3)*** (n = 3)***
NPY.sub.6-35 (SEQ ID NO: 4) 165.9 .+-. 10.0 683.1 .+-. 65.7
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3)** (n = 3)***
NPY.sub.8-35 (SEQ ID NO: 6) 163.7 .+-. 19.3 909.4 .+-. 66.7
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3)* (n = 3)***
NPY.sub.10-35 (SEQ ID NO: 8) 169.1 .+-. 10.6 709.4 .+-. 11.3
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3)** (n = 3)***
NPY.sub.13-35 (SEQ ID NO: 11) 174.23 .+-. 6.9 305.43 .+-. 26.3
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 2)*; (n = 2)*; 164.2 .+-.
7.2 275.8 .+-. 31.2 (n = 4)*** (n = 4)*** NPY.sub.21-35 (SEQ ID NO:
19) 154.20 .+-. 20.4 232.69 .+-. 42.8
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 2)*; (n = 2)*; 154.1 .+-.
8.7 266.4 .+-. 26.6 (n = 4)** (n = 4)*** NPY2.sub.1-35 ala21 (SEQ
ID NO: 36) 95.4 .+-. 4.5 94.1 .+-. 6.8
YPSKPDNPGEDAPAEDMARYASALRHYINLITRQRY (n = 2) (n = 2) NPY.sub.1-30
(SEQ ID NO: 28) 76.9 98.7 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n =
1) (n = 1) NPY.sub.1-30 (SEQ ID NO: 30) 97.84 .+-. 5.5 99.09 .+-.
4.1 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4) (n = 4)
NPY.sub.1-30 (SEQ ID NO: 20) 103.96 .+-. 0.5 91.42 .+-. 12.8
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 2) (n = 2) NPY.sub.23-35
(SEQ ID NO: 21) 95.25 .+-. 6.0 103.68 .+-. 10.0
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4) (n = 4) NPY.sub.24-35
(SEQ ID NO: 34) 96.9 .+-. 5.6 103.2 .+-. 10.5
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 3) (n = 3) NPY.sub.21-34
(SEQ ID NO: 31) 87.7 .+-. 9.6 97.5 .+-. 6.9
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 2) (n = 2) NPY.sub.3-30
(SEQ ID NO: 29) 88.64 .+-. 8.3 105.07 .+-. 5.7
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 4) (n = 4) Free acid NPY
(C-terminal -OH)(SEQ ID NO: 37) 124.4 .+-. 10.7 179.6 .+-. 17.3
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (n = 5)* (n = 5)***
Example 3: Neuroprotective Effect of NPY-Derived Peptides in Mixed
Retinal Cell Cultures
[0426] The neuroprotective effect on the survival of retinal cells
of NPY-derived peptides of the present invention can be
demonstrated in the following way:
[0427] Wistar rat pups (3-5 days old) are sacrificed to prepare
primary mixed cultures of retinal cells. Retinas are dissected
under sterile conditions, using a light microscope, in Ca2+- and
Mg2+-free Hanks' balanced salt solution containing: 137 mM NaCl,
5.4 mM KCl, 0.45 mM KH2PO4, 0.34 mM Na2HPO4, 4 mM NaHCO.sub.3, 5 mM
glucose, pH 7.4), and digested with 0.1% trypsin (w/v) for 15 min
at 37.degree. C. Cells were diluted in MEM, supplemented with 25 mM
Hepes, 26 mM NaHCO.sub.3, 10% FBS and penicillin (100
U/mL)-streptomycin (100 .mu.g/mL), and plated on poly-D-lysine (0.1
mg/mL)-coated coverslips or 24-multiwell plates for 3-9 days, at a
density of 2.times.10.sup.6 cells/cm.sup.2 (37.degree. C., 5%
CO2).
Staining with
[3,8-diamino-5-(3-(diethylmethylamino)propyl)-6-phenyl
phetananthri-dinium diiodide] (PI) as a Marker of Retinal Cell
Death: PI is a marker of dying cells with disrupted cell membranes
due to necrosis or late apoptosis, and binds to DNA emitting a
bright red fluorescence (630 nm) when excited by blue-green light
(493 nm). Retinal cells plated on coverslips are exposed to the
toxic substance 3,4-methylenedioxymethamphetamine (MDMA; 400-1600
.mu.M), glutamate (500 .mu.M) or kainate for 24 h-48 h, at
37.degree. C. Retinal cells not treated with the toxic substances
are used as control. To demonstrate the neuroprotective effect of
NPY-derived peptides, the retinal cells are simultaneously
incubated with one or more NPY-derived peptides (e.g. 100 nM to 100
.mu.M). After drug incubations, the cells are washed twice and
incubated with PI (0.04 mg/mL) for 3 min, and then observed with a
fluorescence microscope (Zeiss Axioshop 2 Plus) coupled to an
Axiocam HRc camera. The number of PI-positive retinal cells is
subsequently counted in five random fields in each coverslip.
[0428] The neuroprotective effect of the NPY-derived peptides is
demonstrated as a significant decrease in the number of PI-positive
retinal cells induced by MDMA, glutamate or kainate after treatment
with the NPY-derived peptides compared to the control
condition.
Immunocytochemistry to Show Neuroprotection on Specific Populations
of Retinal Cells:
[0429] The neuroprotective effect of NPY-derived peptides on
selective types of retinal cells is demonstrated using
immunocytochemistry. Thus rat retinal neural cells plated on
coverslips as described above are exposed to MDMA (400-1600 .mu.M),
glutamate (500 .mu.M) or kainate (30-150 .mu.M) for 24 h-48 h at
37.degree. C. After incubation, retinal cells are washed twice with
phosphate-buffered saline (PBS) (137 mM NaCl, 27 mM KCl, 18 mM
KH2PO4, 100 mM Na2HPO4, pH 7.4) and fixed with 4% paraformaldehyde
for 20 min at room temperature. Cells are permeabilized with 1%
TritonX-100 for 5 min at room temperature, and non-specific binding
of the antibodies is prevented by incubation with 3% (w/v) fatty
acid-free bovine serum albumin containing with 0.2% Tween20 for 1
h. Cells are then incubated for 90 min at room temperature with
appropriate concentrations of the primary antibody: mouse anti-TUJ1
(neuronal marker), mouse anti-PKC (amacrine cells), or mouse
anti-Bmrn3a (ganglion cell marker). After incubation, cells are
washed three times with PBS and incubated with anti-mouse secondary
antibodies at appropriate concentrations for 1 h at room
temperature in the dark. After 5 min washing, cell nuclei are
stained for 5 min with Hoechst 33342 (1 .mu.g/mL in PBS). Cells are
washed twice in PBS and mounted using a Prolong Antifade Kit (Dako
Cytomation, Glostrup, Denmark). All antibody solutions are prepared
in 3% fatty acid-free BSA solution. Retinal cells are visualized
with a Zeiss Axioshop 2 Plus microscope, coupled to an Axiocam HRc
camera.
[0430] The neuroprotective effect of NPY-derived peptides on
neuronal retinal cells is demonstrated by increased number of the
different types of retinal neuronal cells. Since the loss of
retinal cells is centrally involved in the loss of vision in
several eye disorders, neuroprotective effect of NPY-derived
peptides demonstrates that these peptides are useful for treatment
of eye diseases with retinal damage.
Example 4: Pig Model of Acute Retinal Ischemia
[0431] The neuroprotective effect on the survival and function of
retinal cells of NPY-derived peptides according to the present
invention can be demonstrated by using a pig model of acute retinal
ischemia (previously described in Kyhn et al., 2009, Exp Eye Res
89:1012-20).
Induction of Retinal Ischemia for 2 Hours
[0432] Three month old female pigs of Danish
Landrace/Duroc/Hampshire/Yorkshire breed receive an anesthetic
cocktail of Tiletamine 1.19 mg/kg, Zolazepam 1.19 mg/kg (Zoletil 50
Vet Virbac SA, Carros, France), Methadone 0.24 mg/kg (Nycomed,
Roskilde, Denmark), Ketamine 1.43 mg/kg (Intervet, Skovlunde,
Denmark), and Xylazine 1.24 mg/kg (Intervet, Skovlunde, Denmark).
Thereafter the anesthesia is maintained with continuous intravenous
infusion of propofol 15 mg/kg/h (Fresenius Kabi, Bad Homburg,
Germany). After induction the pigs are relaxed with
pancuriumbromide 0.1 mg/kg (Organon, Holland). The animals are
endotracheally intubated and artificially ventilated on 34% oxygen.
The animals are placed resting on their elbows, to minimize the
impact on the cardiovascular system. To prevent hypothermia, the
pigs are wrapped in a blanket during anesthesia. Treatment of the
animals adheres to the ARVO Statement for the Use of Animals in
Ophthalmic and Vision Research. Ischemia in the retina is induced
in the following way. Through catheterization of the femoral artery
the mean arterial blood pressure (MAP) is monitored. The
intraocular pressure (IOP) is controlled by a 23 G cannula syringe
inserted in the anterior chamber of the eye, and connected to an
elevated bottle of Ringer Lactate. The ocular perfusion pressure
(OPP=MAP-IOP) is clamped at 5 mmHg for 2 h by adjusting the height
of the Ringer Lactate bottle. This procedure causes severe,
reproducible ischemic damage to the inner retina and particularly
its ganglion cells, as evidenced by multifocal electroretinography
(mfERG) and quantitative histology (Kyhn et al., 2009).
[0433] Before induction of retinal ischemia in the pigs, baseline
mfERG recording is performed as described below. Immediately after
termination of 2 h of ischemia, the NPY-derived peptides of the
invention dissolved in isotonic saline are injected intravitreally
in one eye in a volume of 0.1-0.2 ml to achieve concentrations in
the range of 1-100 .mu.M based on calculations that the intraocular
volume is approximately 4 ml. A control group receives intravitreal
saline injection.
Induced mfERG Recording
[0434] Multifocal stimulation is performed with VERIS Science
5.0.1. Visual stimuli are displayed on a 1.5-inch
fundus/stimulation camera (Electro-Diagnostic Imaging, San Mateo,
Calif., USA). Recordings are obtained by a Burian-Allen bipolar
contact lens electrode (BA) (VERIS Infrared (IR) Illuminating
Electrode; EDI Inc., San Mateo, Calif., USA) with hydroxypropyl
methylcellulose 2% (Excelvision, Annonay, France) contact fluid. A
reference electrode is placed behind the contralateral ear. The
animals, as well as the respirator, are electrically grounded. The
fundus area is monitored by means of a transpupillary IR light
source. All recordings are performed in the same examination room,
lit only by artificial light (28 cd/m.sup.2). Pupils of the eyes
are dilated to a diameter >8 mm with phenylephrine hydrochloride
10% (Metaoxedrin, SAD, Sonderborg, Denmark), topicamide 0.5%
(Mydriacyl, Alcon, Puurs, Belgium) and atropine 1% (Atropin, SAD,
Sonderborg, Denmark). Recordings are performed on both eyes after
15 min of light adaptation. The mfERG stimulus used to record the
induced mfERG response consists of a total of four frames: an
initial pseudorandom frame, followed by a dark frame, a full-flash
frame and finally another dark frame. A stimulus of 241 unscaled
hexagons is used, m-exponent 15. One-segment recordings are
performed at a frame rate of 75 Hz, with 16 samples per frame. Mean
luminance is 100 cd/m.sup.2. Responses are band-pass filtered
outside of 10-300 Hz. Total recording length is 14.37 min. The
stimulus grid and display luminance are calibrated as recommended
by the ISCEV standards. We measure the induced (late) components of
the mfERG as previously described (Kyhn et al., 2009). Recorded
traces are divided into three groups: 1) the optic nerve head, 2)
the inferior retina and 3) the visual streak. For each induced
mfERG recorded, we identify the hexagons connected to the visual
streak group and calculate the average amplitude. These averages
are used for further analysis. The highest changes in the
amplitudes are observed in the first induced negative component
(iN1) and in the second induced positive component (iP2), therefore
only these components are evaluated (Kyhn et al., 2009).
Histology
[0435] After the last induced mfERG recording, the eyes are
enucleated for histological examination and the pigs euthanized by
intravenous injection of 2-4 g pentobarbital (Pentobarbital 200
mg/mL KVL, Copenhagen, Denmark). Globes are placed in 4%
paraformaldehyde (PFA) for 10 min and the anterior segment and lens
are removed. The posterior segment is post-fixed for 2 h in 4% PFA,
with subsequent rinsing in increasing sucrose concentrations in
Strensen's phosphate buffer. A vertical cut is made extending from
the superior retinal margin to 2-3 mm inferior to the optic disc,
This comprises the superior ciliary margin, the visual streak and
the optic disc. The tissue is embedded in gelatin medium and
serially sectioned at 12 .mu.m on a cryostat.
[0436] For histopathological examination, sections are stained with
Hematoxylin-Eosin (Htx-Eosin). The degree of perivasculitis is
evaluated on a four step scale (0-3): 0=no perivasculitis;
1=discrete perivasculitis up until the maximum seen in normal eyes
as a result of prolonged anesthesia and delay between euthanasia
and fixation; 2=clearly pathological perivasculitis limited to the
immediate vicinity of the vessels; and 3=severe perivasculitis with
inflammation also present in adjacent layers of the retina). The
perivasculitis is scored by an experienced histopathologist masked
to the treatment of the pigs. Three sections from each eye are
scored and the mean score from each eye is used for statistical
analysis.
[0437] Immunohistochemical detection of neurons in the ganglion
cell layer is performed using a mouse monoclonal antibody,
antineuronal nuclei (NeuN) (1:100, MAB377, Chemicon International,
Temecula, Calif., USA). Sections are incubated in a moist chamber
for 16-18 h at 4.degree. C., followed by rinsing in 0.1 M
phosphate-buffered saline (PBS) with 0.25% Triton-X-100.
Subsequently, sections are incubated with secondary FITC-conjugated
antibodies (1:100, Jackson Immunoresearch, West Grove, Pa., USA)
for 1-2 h at room temperature in the dark. Normal eyes, processed
in parallel, are used as controls. The specimens are examined using
an epifluorescence microscope equipped with the software Analysis
Docu 3.2 (Soft Imaging System GmbH, Muenster, Germany) used in the
cell counting.
Cell Counting of Retinal Ganglion Cells
[0438] For each histological section, an overview was created by
mounting adjacent images magnified at 20 times. A grid
(500.times.500 .mu.m) is then placed onto the overview image. The
number of NeuN positive cells in the ganglion cell layer with
visible nucleoli is then counted. This process is repeated along
the vertical meridian, starting from the superior disc margin in
zones and ending 11,000 .mu.m away. Zones 500 .mu.m wide are
counted and, in order to avoid overlap, zones of 500 .mu.m are
skipped between counted zones. Three sections (with a minimum of
three sections between each used for measurements) from each pig
are used, and the average cell count from the three sections is
used. Measurements of normal eyes (three sections from each) are
used as controls.
Analysis of the Neuroprotective Effect of NPY-Derived Peptides on
the Retina
[0439] The neuroprotective effect of NPY-derived peptides of the
invention compared to saline on the function of the retina is
demonstrated by analysing mtfERG recorded both before ischemia
(i.e. baseline) and at 2 and 4 weeks after ischemia. We measure the
ratio of the amplitudes of the iN1 and the iP2 components between
the left (experimental) eye and the right (control) eye of the
pigs. The neuroprotective effect on function is revealed by better
mfERG signal in the NPY-derived peptide treated group compared to
saline.
[0440] In the eyes of the same animals, the neuroprotective effects
of NPY-derived peptides is demonstrated histologically by increased
survival of NeuN-positive cells in the retinal ganglion cell layer
at 2 and 4 weeks after induction of acute retinal ischemia. mfERG
and histological analysis will be performed by persons blinded to
the treatment of the animals.
Example 5: Neuroprotective Effect of NPY-Derived Peptides in
Retinal Detachment Model in Cynomolgus Monkeys
[0441] The neuroprotective effect on retinal function of
NPY-derived peptides of the invention can be further demonstrated
in a retinal detachment model using Cynomolgus monkeys.
[0442] The eyes of most animal species are quite different from the
human eye, making it difficult to transfer results to the treatment
of human retinal diseases. Limiting factors include the size of the
eye (rodents), the retinal blood-supply (rabbits), the
photoreceptor type and distribution (cats, rabbits and
ground-squirrels), special properties like the tapetum lucidum
(cat) and the cellular reaction to retinal detachment (rabbit and
ground-squirrel). Another limiting factor, in most animal models,
is the lack of a special feature of the human eye called the fovea.
The fovea is a small area where high visual acuity is generated
(reading, recognizing faces, and distinguish small details of an
image). The retinal physiology of the fovea, explains the severe
visual loss in patients with retinal diseases affecting this
particular area. The fovea is located in the central part of the
retina, it's only oxygen supply is from the underlying choroid. In
contrast, the peripheral retina has a duplex oxygen supply
consisting of an intraretinal and a choroidal arterial network.
Hence, the fovea represents a central avascular zone. In the
disease retinal detachment the central retina is affected so that
the fovea is separated from choroidea and thereby from its blood
supply. This results in foveal ischemia and neuroretinal damage
leading to permanent visual loss in the affected eye.
[0443] It is not possible to establish an animal model for retinal
detachment in pigs, the eyes of which in many ways resemble the
human eye except for the lack of a regular fovea. The porcine
retina tolerates retinal detachment far better than humans. In the
porcine model, the retinal function, as measured by mfERG, remained
normal despite seeks weeks of detachment (Sorensen N F et al.,
2012, Graefes Arch Clin Exp Ophthalmol 250:79-86). This is
different from humans, where studies have shown loss of function
within seven days of detachment. In humans, the prognosis for
visual acuity declines when the fovea is detached. Some of the
difference in retinal function following retinal detachment,
between the porcine and the human eye, can be explained by the
difference in retinal transduction. The central vision in the
porcine retina is gathered in an area called "the visual streak",
where each bipolar cell receives stimulus from several
photoreceptors. In comparison, the ratio between cone:bipolar
cell:ganglion cell in the human fovea is 1:1:1. A central avascular
foveal structure is only found in higher primates (humans and
non-human primates) and birds of prey. The eye of a bird of prey is
structurally different from the human eye in several aspects, and
it is technically challenging to perform surgery and follow-up
examinations on birds with the same equipment as used for human
patients. Ideally, a non-human primate Cynomolgus monkey model is
used to demonstrate a neuroprotective effect of NPY-derived
peptides in retinal detachment.
Retinal Detachment Procedure:
[0444] Cynomolgus monkeys are anesthetized by administration of
midazolam, Zoletil, Narcoxyl, Ketalar, Metadon and for maintenance:
Haldid, Mebumal and Pavulon. Subsequently, a tube is inserted into
the trachea of the animal for artificial ventilation
(intubation).
[0445] During the anesthesia, an operation is conducted on the
corpus vitreum of one eye of the Cynomolgus monkey where three
holes approximately 0.7 mm in size are made through the sclera. The
corpus vitreum is removed and at the same time substituted by water
containing salt. After this, a small amount (0.1 ml) of salty water
or a substance resembling the corpus vitreum (healon) will be
injected into the retina, inducing a localized retinal detachment.
Subsequently, the Cynomolgus monkeys will receive an injection
(0.1-0.2 ml volume) into the eye of one or more NPY-derived
peptides dissolved in isotonic saline aiming for a concentration of
1-100 .mu.M (based on an estimated intraocular volume of 2 ml) or
isotonic saline (control). Afterwards, bimanual palpation and
indirect ophthalmoscopy is performed to exclude complications, and
topical chloramphenicol ointment is given. Both before and 4-6
weeks after retinal detachment, the retinal function will be
evaluated by multifocal electroretinography (mfERG) and the animals
will be euthanized to allow for histological examination of the
retina.
[0446] The neuroprotective effect of NPY-derived peptides on
retinal function and neuronal survival in the retinal detachment
model is demonstrated by increased signal in mfERG and increased
number of surviving retinal neurons seen histologically after
treatment with NPY-derived peptides compared to saline-treated
eyes.
Items
[0447] 1. An isolated peptide consisting of a peptide sequence of
from 15 to 33 contiguous amino acid residues derived from
neuropeptide Y (SEQ ID NO:22), [0448] wherein said peptide
comprises the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID NO: 19),
or a functional variant having at least 60% sequence identity to
SEQ ID NO:19, wherein said peptide does not comprise the Tyr amino
acid of position 36 of SEQ ID NO:22, [0449] for use in a method of
treating a disease or disorder of the central nervous system and/or
the eye. [0450] 2. The peptide for use according to item 1, wherein
said peptide is selected from the group consisting of: SEQ ID NO:
1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID
NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ
ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO:
15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19;
or [0451] a functional variant having at least 60% sequence
identity to a peptide selected from the group consisting of SEQ ID
NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ
ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10,
SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID
NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO:
19. [0452] 3. An isolated peptide consisting of a peptide sequence
of 15 to 32 contiguous amino acid residues derived from
neuropeptide Y (SEQ ID NO:22), [0453] wherein said peptide
comprises the sequence YSALRHYINLITRQR (NPY21-35; SEQ ID NO: 19),
or a functional variant having at least 60% sequence identity to
SEQ ID NO:19, [0454] wherein said peptide does not comprise the Tyr
amino acid of position 36 of NPY (SEQ ID NO:22). [0455] 4. The
peptide according to item 3, wherein said peptide is selected from
the group consisting of: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4,
SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO:
9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ
ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO:
18 and SEQ ID NO: 19; or [0456] a functional variant having at
least 60% sequence identity to a peptide selected from the group
consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO:
5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID
NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14,
SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ
ID NO: 19. [0457] 5. The peptide or the peptide for use according
to any of items 1 and 3, wherein said peptide variant has at least
60% sequence identity to SEQ ID NO: 19, such as at least 65%
sequence identity, for example at least 70% sequence identity, such
as at least 75% sequence identity, for example at least 80%
sequence identity, such as at least 85% sequence identity, for
example at least 90% sequence identity, such as at least 95%
sequence identity, for example at least 99% sequence identity to
SEQ ID NO:19. [0458] 6. The peptide for use according to item 2,
wherein said peptide variant has at least 60% sequence identity,
such as at least 65% sequence identity, for example at least 70%
sequence identity, such as at least 75% sequence identity, for
example at least 80% sequence identity, such as at least 85%
sequence identity, for example at least 90% sequence identity, such
as at least 95% sequence identity, for example at least 99%
sequence identity to a peptide selected from the group consisting
of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID
NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ
ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:
14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and
SEQ ID NO: 19. [0459] 7. The peptide according to item 4, wherein
said peptide variant has at least 60% sequence identity, such as at
least 65% sequence identity, for example at least 70% sequence
identity, such as at least 75% sequence identity, for example at
least 80% sequence identity, such as at least 85% sequence
identity, for example at least 90% sequence identity, such as at
least 95% sequence identity, for example at least 99% sequence
identity to a peptide selected from the group consisting of SEQ ID
NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ
ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11,
SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID
NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19. [0460] 8.
The peptide or the peptide for use according to any of the
preceding items, wherein said peptide is capable of binding to
Neural Cell Adhesion Molecule (NCAM). [0461] 9. The peptide or the
peptide for use according to any of the preceding items, wherein
said peptide is capable of stimulating neurite outgrowth and/or
survival of neurons. [0462] 10. The peptide for use according to
any of items 1-2, wherein said peptide is
SKPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY3-35; SEQ ID NO:1), or a
functional variant thereof having at least 60% sequence identity to
SEQ ID NO:1. [0463] 11. The peptide or the peptide for use
according to according to any of the preceding items, wherein said
peptide variant comprises one amino acid substitution, for example
two amino acid substitutions, such as three amino acid
substitutions, for example four amino acid substitutions, such as
five amino acid substitutions, for example six amino acid
substitutions, such as seven amino acid substitutions. [0464] 12.
The peptide or the peptide for use according to item 11, wherein
said amino acid substitution is a conservative amino acid
substitution. [0465] 13. The peptide or the peptide for use
according to any of the preceding items, wherein the C-terminal
amino acid exists as the free carboxylic acid ("--OH"). [0466] 14.
The peptide or the peptide for use according to any of the
preceding items, wherein said peptide is formulated as a monomer.
[0467] 15. The peptide or the peptide for use according to any of
items 1 to 14, wherein said peptide is formulated as a multimer
comprising two or more peptides. [0468] 16. The multimer according
to item 15, wherein said multimeric peptide is a dimer (i.e.
comprises two peptides). [0469] 17. The multimer according to item
15, wherein said multimeric peptide is a trimer (i.e. comprises
three peptides). [0470] 18. The multimer according to item 15,
wherein said multimeric peptide is a tetramer (i.e. comprises four
peptides). [0471] 19. The multimer according to item 15, wherein
said multimeric peptide is a dendrimer. [0472] 20. The multimer
according to item 19, wherein said dendrimer comprises either 4, 8,
16 or 32 peptides. [0473] 21. The multimer according to item 15,
wherein said multimer is a tetrameric dendrimer or a octameric
dendrimer. [0474] 22. The multimer according to any of items 15 to
21, wherein said two or more peptides are identical with respect to
each other. [0475] 23. The multimer according to any of items 15 to
21, wherein said two or more peptides are not identical with
respect to each other. [0476] 24. The multimer according to any of
items 15 to 21, wherein said two or more peptides are linked via a
linker group. [0477] 25. The multimer according to any of items 15
to 21, wherein said linker group comprises one or more lysine
residues. [0478] 26. A pharmaceutically acceptable composition
comprising a peptide according to any of items 3-5 and 7-25. [0479]
27. A nucleic acid construct encoding a peptide consisting of a
peptide sequence of from 15 to 33 contiguous amino acid residues
derived from neuropeptide Y (NPY) (SEQ ID NO:22), wherein said
peptide comprises or consists of the sequence YSALRHYINLITRQR
(NPY21-35; SEQ ID NO:19), or a functional variant having at least
60% sequence identity to SEQ ID NO:19, wherein said peptide does
not comprise the Tyr amino acid of position 36 of SEQ ID NO:22.
[0480] 28. The nucleic acid construct according to item 27, wherein
said functional variant has at least 60% sequence identity to SEQ
ID NO:19, such as at least 65% sequence identity, for example at
least 70% sequence identity, such as at least 75% sequence
identity, for example at least 80% sequence identity, such as at
least 85% sequence identity, for example at least 90% sequence
identity, such as at least 95% sequence identity, for example at
least 99% sequence identity to SEQ ID NO: 19. [0481] 29. The
nucleic acid construct for use according to any of items 27 to 28,
wherein said encoded peptide is selected from the group consisting
of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID
NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ
ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:
14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and
SEQ ID NO: 19; or [0482] a functional variant having at least 60%
sequence identity, such as at least 65% sequence identity, for
example at least 70% sequence identity, such as at least 75%
sequence identity, for example at least 80% sequence identity, such
as at least 85% sequence identity, for example at least 90%
sequence identity, such as at least 95% sequence identity, for
example at least 99% sequence identity to a peptide selected from
the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3,
SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO:
8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ
ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO:
17, SEQ ID NO: 18 and SEQ ID NO: 19. [0483] 30. A delivery vehicle
comprising the nucleic acid construct according to any of items 27
to 29. [0484] 31. The delivery vehicle according to item 30,
wherein said vehicle is selected from the group consisting of: RNA
based vehicles, DNA based vehicles, lipid based vehicles, polymer
based vehicles, colloidal gold particles and virally derived DNA or
RNA vehicles. [0485] 32. The delivery vehicle according to item 30,
wherein said vehicle is a viral vector selected from the group
consisting of adenoviruses, retroviruses, lentiviruses,
adeno-associated viruses, herpesviruses, vaccinia viruses, foamy
viruses, cytomegaloviruses, Semliki forest virus, poxviruses, RNA
virus vector and DNA virus vector [0486] 33. The delivery vehicle
according to item 32, wherein said viral vector is a recombinant
adeno-associated viruses (rAAV). [0487] 34. The peptide for use
according to any of items 1-2, 5-6, and 8-25, or the nucleic acid
construct according to any of items 27-33, wherein said disease or
disorder of the central nervous system and/or the eye is a disease
of the eye. [0488] 35. The use according to item 34, wherein said
disease or disorder of the eye is a retinal or optic nerve disease
or disorder. [0489] 36. The use according to item 35, wherein said
disease or disorder is associated with retinal dystrophy or
degeneration. [0490] 37. The use according to item 35, wherein said
disease or disorder is retinal detachment, such as rhegmatogenous
retinal detachment, exudative or secondary retinal detachment, and
tractional retinal detachment. [0491] 38. The use according to item
35, wherein said disease or disorder is a retinopathy; such as
diabetic retinopathy, including non-proliferative diabetic
retinopathy (NPDR) and proliferative diabetic retinopathy (PDR);
radiation retinopathy; hypertensive retinopathy; proliferative
vitreoretinopathy; retinopathy due to autoimmune disease;
retinopathy due to anemia; and retinopathy due to retinal vein or
artery occlusion. [0492] 39. The use according to item 35, wherein
said disease or disorder is macular degeneration, such as
age-related macular degeneration (AMD), including dry or
nonexudative AMD and wet or exudative AMD or myopic macular
degeneration. [0493] 40. The use according to item 35, wherein said
disease or disorder is retinitis pigmentosa. [0494] 41. The use
according to item 35, wherein said disease or disorder is cone-rod
dystrophy. [0495] 42. The use according to item 35, wherein said
disease or disorder is glaucoma, including acute and chronic
glaucoma, open-angle glaucoma and closed-angle glaucoma. [0496] 43.
The use according to item 35, wherein said disease or disorder is
selected from the group consisting of retinal vein and artery
occlusion including central retinal vein occlusion and branch
retinal vein occlusion; uveitis; ocular hypertension; optic
neuropathy including ischemic optic neuropathy, compressive optic
neuropathy, infiltrative optic neuropathy, traumatic optic
neuropathy, mitochondrial optic neuropathies, nutritional optic
neuropathies, toxic optic neuropathies, hereditary optic
neuropathies; optic neuritis; optic nerve hypoplasia; Leber's
congenital amaurosis (LCA), Lipemia retinalis, eye injury, Angioid
streaks, and cancers of the retina including retinoblastoma and
metastatic eye cancer. [0497] 44. The use according to any of items
35 to 43, wherein said peptide or nucleic acid construct is to be
administered directly into the eye by means of intravitreal or
subretinal administration. [0498] 45. The peptide for use according
to any of items 1-2, 5-6, and 8-25, or the nucleic acid construct
according to any of items 27-33, wherein said disease or disorder
of the central nervous system and/or the eye is a disease or
disorder of the central nervous system. [0499] 46. The use
according to item 45, wherein said disease or disorder of the
central nervous system is a neurodegenerative disorder. [0500] 47.
The use according to item 46, wherein said neurodegenerative
disorder is selected from the group consisting of Parkinson's
disease, Alzheimer's disease, Huntington's disease Amyotrophic
lateral sclerosis (ALS), spinocerebellar ataxias and Multiple
Sclerosis. [0501] 48. The use according to item 46, wherein said
neurodegenerative disorder is a polyglutamine disease, wherein said
polyglutamine disease may be selected from the group consisting of
Spinocerebellar ataxia type 1, Spinocerebellar ataxia type 2,
Spinocerebellar ataxia type 3 (aka Machado-Joseph's disease),
Spinocerebellar ataxia type 6, Spinocerebellar ataxia type 7 and
Spinocerebellar ataxia type 17), DRPLA (Dentatorubropallidoluysian
atrophy) and SBMA (Spinobulbar muscular atrophy or Kennedy
disease). [0502] 49. The use according to item 45, wherein said
disease or disorder of the central nervous system is stroke. [0503]
50. The use according to item 45, wherein said disease or disorder
of the central nervous system is epilepsy. [0504] 51. The use
according to any of items 45 to 50, wherein said peptide or nucleic
acid construct is to be administered directly into the brain by
means of intracerebral injection. [0505] 52. The use according to
any of items 45 to 50, wherein said peptide or nucleic acid
construct is to be administered by means of intrathecal injection.
[0506] 53. The use according to item 45, wherein said disease or
disorder of the central nervous system is a peripheral nerve
lesion.
[0507] 54. The peptide for use according to any of items 34 to 53,
wherein said peptide is to be administered in combination with one
or more second active ingredients. [0508] 55. The use according to
item 54, wherein said second active ingredient is a GDNF-derived
peptide, such as the GDNF-derived peptides disclosed in WO
2007/019860. [0509] 56. A kit of parts comprising a peptide, a
nucleic acid construct or a composition according to any of the
preceding items and at least one additional component.
Sequence CWU 1
1
45133PRTHomo sapiens 1Ser Lys Pro Asp Asn Pro Gly Glu Asp Ala Pro
Ala Glu Asp Met Ala 1 5 10 15 Arg Tyr Tyr Ser Ala Leu Arg His Tyr
Ile Asn Leu Ile Thr Arg Gln 20 25 30 Arg 232PRTHomo sapiens 2Lys
Pro Asp Asn Pro Gly Glu Asp Ala Pro Ala Glu Asp Met Ala Arg 1 5 10
15 Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg
20 25 30 331PRTHomo sapiens 3Pro Asp Asn Pro Gly Glu Asp Ala Pro
Ala Glu Asp Met Ala Arg Tyr 1 5 10 15 Tyr Ser Ala Leu Arg His Tyr
Ile Asn Leu Ile Thr Arg Gln Arg 20 25 30 430PRTHomo sapiens 4Asp
Asn Pro Gly Glu Asp Ala Pro Ala Glu Asp Met Ala Arg Tyr Tyr 1 5 10
15 Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg 20 25 30
529PRTHomo sapiens 5Asn Pro Gly Glu Asp Ala Pro Ala Glu Asp Met Ala
Arg Tyr Tyr Ser 1 5 10 15 Ala Leu Arg His Tyr Ile Asn Leu Ile Thr
Arg Gln Arg 20 25 628PRTHomo sapiens 6Pro Gly Glu Asp Ala Pro Ala
Glu Asp Met Ala Arg Tyr Tyr Ser Ala 1 5 10 15 Leu Arg His Tyr Ile
Asn Leu Ile Thr Arg Gln Arg 20 25 727PRTHomo sapiens 7Gly Glu Asp
Ala Pro Ala Glu Asp Met Ala Arg Tyr Tyr Ser Ala Leu 1 5 10 15 Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg 20 25 826PRTHomo sapiens
8Glu Asp Ala Pro Ala Glu Asp Met Ala Arg Tyr Tyr Ser Ala Leu Arg 1
5 10 15 His Tyr Ile Asn Leu Ile Thr Arg Gln Arg 20 25 925PRTHomo
sapiens 9Asp Ala Pro Ala Glu Asp Met Ala Arg Tyr Tyr Ser Ala Leu
Arg His 1 5 10 15 Tyr Ile Asn Leu Ile Thr Arg Gln Arg 20 25
1024PRTHomo sapiens 10Ala Pro Ala Glu Asp Met Ala Arg Tyr Tyr Ser
Ala Leu Arg His Tyr 1 5 10 15 Ile Asn Leu Ile Thr Arg Gln Arg 20
1123PRTHomo sapiens 11Pro Ala Glu Asp Met Ala Arg Tyr Tyr Ser Ala
Leu Arg His Tyr Ile 1 5 10 15 Asn Leu Ile Thr Arg Gln Arg 20
1222PRTHomo sapiens 12Ala Glu Asp Met Ala Arg Tyr Tyr Ser Ala Leu
Arg His Tyr Ile Asn 1 5 10 15 Leu Ile Thr Arg Gln Arg 20
1321PRTHomo sapiens 13Glu Asp Met Ala Arg Tyr Tyr Ser Ala Leu Arg
His Tyr Ile Asn Leu 1 5 10 15 Ile Thr Arg Gln Arg 20 1420PRTHomo
sapiens 14Asp Met Ala Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn
Leu Ile 1 5 10 15 Thr Arg Gln Arg 20 1519PRTHomo sapiens 15Met Ala
Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr 1 5 10 15
Arg Gln Arg 1618PRTHomo sapiens 16Ala Arg Tyr Tyr Ser Ala Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg 1 5 10 15 Gln Arg 1717PRTHomo
sapiens 17Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr
Arg Gln 1 5 10 15 Arg 1816PRTHomo sapiens 18Tyr Tyr Ser Ala Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg 1 5 10 15 1915PRTHomo
sapiens 19Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln
Arg 1 5 10 15 2014PRTHomo sapiens 20Ser Ala Leu Arg His Tyr Ile Asn
Leu Ile Thr Arg Gln Arg 1 5 10 2113PRTHomo sapiens 21Ala Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg 1 5 10 2236PRTHomo
sapiensMOD_RES(36)..(36)AMIDATION 22Tyr Pro Ser Lys Pro Asp Asn Pro
Gly Glu Asp Ala Pro Ala Glu Asp 1 5 10 15 Met Ala Arg Tyr Tyr Ser
Ala Leu Arg His Tyr Ile Asn Leu Ile Thr 20 25 30 Arg Gln Arg Tyr 35
2316PRTHomo sapiensMOD_RES(16)..(16)AMIDATION 23Tyr Ser Ala Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr 1 5 10 15 2414PRTHomo
sapiensMOD_RES(14)..(14)AMIDATION 24Ala Leu Arg His Tyr Ile Asn Leu
Ile Thr Arg Gln Arg Tyr 1 5 10 2512PRTHomo
sapiensMOD_RES(12)..(12)AMIDATION 25Arg His Tyr Ile Asn Leu Ile Thr
Arg Gln Arg Tyr 1 5 10 2610PRTHomo
sapiensMOD_RES(10)..(10)AMIDATION 26Tyr Ile Asn Leu Ile Thr Arg Gln
Arg Tyr 1 5 10 276PRTHomo sapiensMOD_RES(6)..(6)AMIDATION 27Ile Thr
Arg Gln Arg Tyr 1 5 2830PRTHomo sapiens 28Tyr Pro Ser Lys Pro Asp
Asn Pro Gly Glu Asp Ala Pro Ala Glu Asp 1 5 10 15 Met Ala Arg Tyr
Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu 20 25 30 2928PRTHomo
sapiens 29Ser Lys Pro Asp Asn Pro Gly Glu Asp Ala Pro Ala Glu Asp
Met Ala 1 5 10 15 Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu
20 25 3020PRTHomo sapiens 30Tyr Pro Ser Lys Pro Asp Asn Pro Gly Glu
Asp Ala Pro Ala Glu Asp 1 5 10 15 Met Ala Arg Tyr 20 3114PRTHomo
sapiens 31Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln 1
5 10 3297PRTHomo sapiens 32Met Leu Gly Asn Lys Arg Leu Gly Leu Ser
Gly Leu Thr Leu Ala Leu 1 5 10 15 Ser Leu Leu Val Cys Leu Gly Ala
Leu Ala Glu Ala Tyr Pro Ser Lys 20 25 30 Pro Asp Asn Pro Gly Glu
Asp Ala Pro Ala Glu Asp Met Ala Arg Tyr 35 40 45 Tyr Ser Ala Leu
Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr 50 55 60 Gly Lys
Arg Ser Ser Pro Glu Thr Leu Ile Ser Asp Leu Leu Met Arg 65 70 75 80
Glu Ser Thr Glu Asn Val Pro Arg Thr Arg Leu Glu Asp Pro Ala Met 85
90 95 Trp 3330PRTHomo sapiens 33Ser Ser Pro Glu Thr Leu Ile Ser Asp
Leu Leu Met Arg Glu Ser Thr 1 5 10 15 Glu Asn Val Pro Arg Thr Arg
Leu Glu Asp Pro Ala Met Trp 20 25 30 3412PRTHomo sapiens 34Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg 1 5 10 3533PRTHomo sapiens
35Arg Gln Arg Thr Ile Leu Asn Ile Tyr His Arg Leu Ala Ser Tyr Tyr 1
5 10 15 Arg Ala Met Asp Glu Ala Pro Ala Asp Glu Gly Pro Asn Asp Pro
Lys 20 25 30 Ser 3615PRTHomo sapiens 36Ala Ser Ala Leu Arg His Tyr
Ile Asn Leu Ile Thr Arg Gln Arg 1 5 10 15 3736PRTHomo sapiens 37Tyr
Pro Ser Lys Pro Asp Asn Pro Gly Glu Asp Ala Pro Ala Glu Asp 1 5 10
15 Met Ala Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr
20 25 30 Arg Gln Arg Tyr 35 3834PRTHomo
sapiensMOD_RES(34)..(34)AMIDATION 38Ser Lys Pro Asp Asn Pro Gly Glu
Asp Ala Pro Ala Glu Asp Met Ala 1 5 10 15 Arg Tyr Tyr Ser Ala Leu
Arg His Tyr Ile Asn Leu Ile Thr Arg Gln 20 25 30 Arg Tyr
3916PRTHomo sapiensMOD_RES(16)..(16)AMIDATION 39Tyr Ser Ala Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr 1 5 10 15 4014PRTHomo
sapiensMOD_RES(14)..(14)AMIDATION 40Ala Leu Arg His Tyr Ile Asn Leu
Ile Thr Arg Gln Arg Tyr 1 5 10 4114PRTHomo sapiens 41Ala Leu Arg
His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Ala 1 5 10 4212PRTHomo
sapiensMOD_RES(12)..(12)AMIDATION 42Arg His Tyr Ile Asn Leu Ile Thr
Arg Gln Arg Tyr 1 5 10 4310PRTHomo
sapiensMOD_RES(10)..(10)AMIDATION 43Tyr Ile Asn Leu Ile Thr Arg Gln
Arg Tyr 1 5 10 446PRTHomo sapiensMOD_RES(6)..(6)ACETYLATION 44Ile
Thr Arg Gln Arg Tyr 1 5 4536PRTHomo sapiens 45Tyr Arg Gln Arg Thr
Ile Leu Asn Ile Tyr His Arg Leu Ala Ser Tyr Tyr 1 5 10 15 Arg Ala
Met Asp Glu Ala Pro Ala Asp Glu Gly Pro Asn Asp Pro Lys 20 25 30
Ser Pro Tyr 35
* * * * *
References