U.S. patent application number 15/918841 was filed with the patent office on 2018-10-25 for monoclonal antibodies to growth and differentiation factor 15 (gdf-15).
The applicant listed for this patent is JULIUS-MAXIMILLIANS-UNIVERSITAT WURZBURG. Invention is credited to Markus JUNKER, Thomas MULLER, Stefan SAREMBA, Jorg WISCHHUSEN.
Application Number | 20180305447 15/918841 |
Document ID | / |
Family ID | 46888333 |
Filed Date | 2018-10-25 |
United States Patent
Application |
20180305447 |
Kind Code |
A1 |
WISCHHUSEN; Jorg ; et
al. |
October 25, 2018 |
MONOCLONAL ANTIBODIES TO GROWTH AND DIFFERENTIATION FACTOR 15
(GDF-15)
Abstract
The present invention relates to novel monoclonal
anti-human-GDF-15 antibodies, pharmaceutical compositions, kits,
methods and uses and the cell lines capable of producing the
monoclonal antibodies described herein. The present invention
further relates to novel antibodies to human GDF-15 capable of
inhibiting cancer growth.
Inventors: |
WISCHHUSEN; Jorg; (Wurzburg,
DE) ; JUNKER; Markus; (Wurzburg, DE) ; MULLER;
Thomas; (Veitshochheim, DE) ; SAREMBA; Stefan;
(Wurzburg, DE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
JULIUS-MAXIMILLIANS-UNIVERSITAT WURZBURG |
Wurzburg |
|
DE |
|
|
Family ID: |
46888333 |
Appl. No.: |
15/918841 |
Filed: |
March 12, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14431281 |
Mar 25, 2015 |
|
|
|
PCT/EP2013/070127 |
Sep 26, 2013 |
|
|
|
15918841 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/505 20130101;
A61P 35/02 20180101; C07K 2317/34 20130101; A61K 45/06 20130101;
C07K 2317/92 20130101; C07K 2317/76 20130101; C07K 16/22 20130101;
A61P 35/00 20180101; C07K 2317/565 20130101 |
International
Class: |
C07K 16/22 20060101
C07K016/22; A61K 45/06 20060101 A61K045/06 |
Foreign Application Data
Date |
Code |
Application Number |
Sep 26, 2012 |
EP |
12186185.0 |
Claims
1-18. (canceled)
19. A monoclonal antibody, or an antigen-binding portion thereof,
that specifically binds to a conformational or discontinuous
epitope on human GDF-15 comprised by the amino acid sequences of
SEQ ID NO: 25 and SEQ ID NO: 26.
20. A monoclonal antibody that specifically binds to human GDF-15,
or an antigen-binding portion thereof, comprising a heavy chain
variable domain and a light chain variable domain, wherein: the
heavy chain variable domain comprises the heavy chain CDR1, CDR2
and CDR3 amino acid sequences of antibody B1-23; and the light
chain variable domain comprises the light chain CDR1, CDR2 and CDR3
amino acid sequences of antibody B1-23.
21. The monoclonal antibody or antigen-binding portion thereof of
claim 20, wherein: the heavy chain variable domain comprises the
CDR1, CDR2 and CDR3 amino acid sequences of SEQ ID Nos: 3, 4, and
5, respectively; and the light chain variable domain comprises the
CDR1, CDR2 and CDR3 amino acid sequences of SEQ ID NO. 6, SAS, and
SEQ ID NO. 7, respectively.
22. The monoclonal antibody or antigen-binding portion thereof of
claim 21, which is a humanized antibody.
23. A monoclonal antibody that specifically binds to human GDF-15,
or an antigen-binding portion thereof, comprising a heavy chain
variable domain comprising the amino acid sequence of the heavy
chain variable domain of antibody B1-23.
24. The monoclonal antibody or antigen-binding portion thereof of
claim 23, further comprising a light chain variable domain
comprising the amino acid sequence of the light chain variable
domain of antibody B1-23.
25. A monoclonal antibody that specifically binds to human GDF-15,
or an antigen-binding portion thereof, comprising a light chain
variable domain comprising the amino acid sequence of the light
chain variable domain of antibody B1-23.
26. The monoclonal antibody or an antigen-binding portion thereof
of claim 24, which is antibody B1-23 or an antigen-binding portion
thereof.
27. A monoclonal antibody, or an antigen-binding portion thereof,
that specifically binds to the same epitope of human GDF-15 as the
antibody of claim 26.
28. A monoclonal antibody, or an antigen-binding portion thereof,
that cross-competes for binding to human GDF-15 with the antibody
of claim 26.
29. A pharmaceutical composition comprising the antibody or
antigen-binding portion thereof of claim 21.
30. A nucleotide sequence encoding the heavy chain variable domain
and/or the light chain variable domain of the monoclonal antibody
or antigen-binding portion thereof of claim 21.
31. An expression vector comprising the nucleotide sequence of
claim 30.
32. A cell line capable of producing an antibody or antigen-binding
portion thereof of claim 21.
33. The cell line of claim 32, which is the hybridoma cell line
B1-23.
34. A method of inhibiting the proliferation of tumor cells, the
method comprising contacting the tumor cells with the monoclonal
antibody or antigen-binding portion thereof of claim 21.
35. A method of inhibiting tumor growth in a mammal, the method
comprising administering to the mammal the monoclonal antibody or
antigen-binding portion thereof of claim 21.
36. A method of inhibiting GDF-15 mediated downregulation of
Natural Killer Group 2D (NKG2D) receptor on Natural Killer (NK)
cells, the method comprising contacting the NK cells with the
monoclonal antibody or antigen-binding portion thereof of claim 21.
Description
FIELD OF THE INVENTION
[0001] The present invention relates to novel monoclonal
anti-human-GDF-15 antibodies, pharmaceutical compositions, kits,
methods and uses and the cell lines capable of producing the
monoclonal antibodies described herein. The present invention
further relates to novel antibodies to human GDF-15 capable of
inhibiting cancer growth.
BACKGROUND
[0002] To date, many cancers are still areas of unmet medical
needs, and accordingly, means to more effectively inhibit cancer
growth, and to inhibit cancer growth in a broader range of cancers
are needed.
[0003] Many types of cancer are known to express growth factors,
including factors such as VEGF, PDGF, TGF-.beta. and GDF-15.
[0004] GDF-15, growth and differentiation factor-15, is a divergent
member of the TGF-.beta. superfamily. It is a protein which is
intracellularly expressed as a precursor, subsequently processed
and eventually becomes secreted from the cell into the environment.
Both the active, fully processed (mature) form and the precursor of
GDF-15 can be found outside cells. The precursor covalently binds
via its COOH-terminal amino acid sequence to the extracellular
matrix (Bauskin A R et al., Cancer Research 2005) and thus resides
on the exterior of a cell. The active, fully processed (mature)
form of GDF-15 is soluble and is found in blood sera. Thus, the
processed form of GDF-15 may potentially act on any target cell
within the body that is connected to the blood circulation,
provided that the potential target cell expresses a receptor for
the soluble GDF-15 ligand.
[0005] During pregnancy, GDF-15 is found under physiological
conditions in the placenta. However, many malignant cancers
(especially aggressive brain cancers, melanoma, lung cancer,
gastrointestinal tumors, colon cancer, pancreatic cancer, prostate
cancer and breast cancer (Mimeault M and Batra S K, J. Cell Physiol
2010)) exhibit increased GDF-15 levels in the tumor as well as in
blood serum. Likewise, correlations have been described between
high GDF-15 expression and chemoresistance (Huang C Y et al., Clin.
Cancer Res. 2009) and between high GDF-15 expression and poor
prognosis, respectively (Brown D A et al., Clin. Cancer Res.
2009).
[0006] GDF-15 is expressed in gliomas of different WHO grades as
assessed by immunohistochemistry (Roth et al., Clin. Cancer Res.
2010). Further, Roth et al. stably expressed short hairpin
RNA-expressing DNA constructs targeting endogenous GDF-15 or
control constructs in SMA560 glioma cells. When using these
pre-established stable cell lines, they observed that tumor
formation in mice bearing GDF-15 knockdown SMA560 cells was delayed
compared to mice bearing control constructs.
[0007] Patent applications WO 2005/099746 and WO 2009/021293 relate
to an anti-human-GDF-15 antibody (Mab26) capable of antagonizing
effects of human GDF-15 on tumor-induced weight loss in vivo in
mice: In these documents, immunologically compromised mice were
administered with human tumor cells (prostate carcinoma cells
DU145) transfected with plasmids overexpressing human GDF-15. Tumor
cells carrying plasmids lacking a GDF-15 sequence served as a
negative control. Those mice expressing xenograft GDF-15 exhibited
a tumor-induced weight loss (clinical term: cachexia) and anorexia.
A single intraperitoneal administration of 1 mg of Mab26 from WO
2005/099746 resulted in a complete reversal of tumor-induced weight
loss. WO 2005/099746 and WO 2009/021293 do not disclose effects of
an anti-human-GDF-15 antibody on tumor growth.
[0008] Similarly, Johnen H et al. (Nature Medicine, 2007) reported
effects of an anti-human-GDF-15 monoclonal antibody on
cancer-induced anorexia and weight loss but did not observe any
effects of the anti-human-GDF-15 antibody on the size of the tumor
formed by the cancer, even when the antibody was administered at a
high dosage of 1 mg, and thus the antibody did not inhibit growth
of the cancer.
[0009] Accordingly, to date, there was still a need in the art for
means to effectively inhibit cancer growth, and for means to
inhibit cancer growth in a broader range of cancers.
[0010] It is therefore an object of the invention to obtain means
to effectively inhibit cancer growth, and means that can be used to
inhibit cancer growth in a broader range of cancers.
[0011] In an effort to find novel means to inhibit cancer growth,
the present inventors have surprisingly found that a novel
monoclonal antibody to human GDF-15 can inhibit cancer growth of
human xenograft tumors in mice.
[0012] Additionally, and in contrast to therapeutic antibodies
known in the art, an antibody to human GDF-15 according to the
present invention has an equilibrium dissociation constant of about
790 pM for recombinant GDF-15 even without additional affinity
maturation, which is a higher affinity compared to most known
therapeutic antibodies.
[0013] Thus, the antibody to human GDF-15 according to the present
invention has superior properties compared to antibodies known from
the art, and is particularly useful for inhibiting cancer growth.
Accordingly, the present invention was completed.
BRIEF DESCRIPTION OF THE INVENTION
[0014] The present invention solves the above-mentioned objects by
providing the monoclonal antibodies, pharmaceutical compositions,
kits, uses and the cell lines capable of producing the monoclonal
antibodies described herein.
[0015] In particular, the present inventors surprisingly show that
novel monoclonal antibodies to human GDF-15 and antigen binding
portions thereof according to the invention are capable of
inhibiting cancer growth. This was unexpected because those
monoclonal antibodies to GDF-15 that were previously known from the
art (WO 2005/099746, WO 2009/021293 and Johnen H et al., Nature
Medicine, 2007) were known to cause a reversal of cancer-induced
weight loss (i.e. a reversal of a secondary symptom induced by the
GDF-15 expressed by the cancer), but were shown to fail at
inhibiting growth of the cancer.
[0016] By showing that the novel monoclonal antibodies to human
GDF-according to the invention are capable of inhibiting cancer
growth, the present inventors also surprisingly show that human
GDF-15 protein can be targeted by the antibodies of the invention
in a way that cancer growth is inhibited. It is expected that the
same mechanism of cancer growth inhibition is applicable to a large
number of cancers that overexpress human GDF-15 including the
cancers listed below.
[0017] Thus, the present invention relates to a monoclonal antibody
capable of binding to human GDF-15, or an antigen-binding portion
thereof, wherein the heavy chain variable domain comprises a CDR3
region comprising the amino acid sequence of SEQ ID NO: 5 or an
amino acid sequence at least 90% identical thereto, and wherein the
light chain variable domain comprises a CDR3 region comprising the
amino acid sequence of SEQ ID NO: 7 or an amino acid sequence at
least 85% identical thereto.
[0018] The invention also relates to a pharmaceutical composition
comprising the antibody or antigen-binding portion thereof
according to the invention.
[0019] Further, the invention relates to an antibody or
antigen-binding portion thereof or a pharmaceutical composition
according to the invention for use in a method for treating cancer
in a mammal, the method comprising administering the antibody or
antigen-binding portion thereof or the pharmaceutical composition
to said mammal.
[0020] Additionally, the invention relates to a kit comprising the
pharmaceutical composition according to the invention.
[0021] The invention also relates to an expression vector
comprising a nucleotide sequence encoding the antibody or
antigen-binding portion thereof according to the invention.
[0022] Further, the invention relates to a cell line capable of
producing an antibody or antigen-binding portion thereof according
to the invention.
[0023] Thus, by providing novel monoclonal antibodies to human
GDF-15, the present invention provides a novel cancer growth
inhibitor that meets the above-defined needs in the art.
BRIEF DESCRIPTION OF THE DRAWINGS
[0024] FIG. 1: NKG2D Expression on NK Cells after Treatment with or
without GDF-15. The cell surface expression of NKG2D was determined
on NK cells after treatment with the indicated cytokines in the
presence or absence of the anti-GDF-15 antibody mAb B1-23. The
figure displays specific fluorescence intensities determined by
flow cytometry, quantified relative to an unspecific control
antibody.
[0025] FIG. 2: Akt Phosphorylation in the Ovarian Carcinoma Cell
Line SK-OV-3. In order to quantify the Western Blot for the ovarian
carcinoma cell line SK-OV-3, the ratio of phosphorylated Akt to the
total amount of Akt was calculated and normalized to the untreated
control.
[0026] FIG. 3: JNK1/2 Phosphorylation in Immune Cells. In order to
quantify the Western Blot, the ratio of phosphorylated JNK1/2 to
the total amount of JNK was calculated and normalized to the
untreated control.
[0027] FIG. 4: An anti-tumor effect of B1-23 in vivo.
Balb/c.sup.nu/nu nude mice were used in a xenograft setting with
the melanoma cell line UACC-257. The tumor size of the animal
cohort treated with B1-23 (open squares) was significantly
decreased, compared to the PBS control group (filled solid
circles). Significance was defined as p<0.05 as assessed by
Wilcoxon's log-rank test.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0028] Unless otherwise defined below, the terms used in the
present invention shall be understood in accordance with their
common meaning known to the person skilled in the art.
[0029] The term "antibody" as used herein refers to any functional
antibody that is capable of specific binding to the antigen of
interest, as generally outlined in chapter 7 of Paul, W. E. (Ed.).:
Fundamental Immunology 2nd Ed. Raven Press, Ltd., New York 1989,
which is incorporated herein by reference. Without particular
limitation, the term "antibody" encompasses antibodies from any
appropriate source species, including chicken and mammalian such as
mouse, goat, non-human primate and human. Preferably, the antibody
is a humanized antibody. The antibody is preferably a monoclonal
antibody which can be prepared by methods well-known in the art.
The term "antibody" encompasses an IgG-1, -2, -3, or -4, IgE, IgA,
IgM, or IgD isotype antibody. The term "antibody" encompasses
monomeric antibodies (such as IgD, IgE, IgG) or oligomeric
antibodies (such as IgA or IgM). The term "antibody" also
encompasses--without particular limitations--isolated antibodies
and modified antibodies such as genetically engineered antibodies,
e.g. chimeric antibodies.
[0030] The nomenclature of the domains of antibodies follows the
terms as known in the art. Each monomer of an antibody comprises
two heavy chains and two light chains, as generally known in the
art. Of these, each heavy and light chain comprises a variable
domain (termed V.sub.H for the heavy chain and V.sub.L for the
light chain) which is important for antigen binding. These heavy
and light chain variable domains comprise (in an N-terminal to
C-terminal order) the regions FR1, CDR1, FR2, CDR2, FR3, CDR3, and
FR4 (FR, framework region; CDR, complementarity determining region
which is also known as hypervariable region). The identification
and assignment of the above-mentioned antibody regions within the
antibody sequence is generally in accordance with Kabat et al.
(Sequences of proteins of immunological interest, U.S. Dept. of
Health and Human Services, Public Health Service, National
Institutes of Health, Bethesda, Md. 1983), or Chothia et al.
(Conformations of immunoglobulin hypervariable regions. Nature.
1989 Dec. 21-28; 342(6252):877-83.), or may be performed by using
the IMGT/V-QUEST software described in Giudicelli et al.
(IMGT/V-QUEST, an integrated software program for immunoglobulin
and T cell receptor V-J and V-D-J rearrangement analysis. Nucleic
Acids Res. 2004 Jul. 1; 32 (Web Server issue):W435-40.), which is
incorporated herein by reference. Preferably, the antibody regions
indicated above are identified and assigned by using the
IMGT/V-QUEST software.
[0031] A "monoclonal antibody" is an antibody from an essentially
homogenous population of antibodies, wherein the antibodies are
substantially identical in sequence (i.e. identical except for
minor fraction of antibodies containing naturally occurring
sequence modifications such as amino acid modifications at their N-
and C-termini). Unlike polyclonal antibodies which contain a
mixture of different antibodies directed to numerous epitopes,
monoclonal antibodies are directed to the same epitope and are
therefore highly specific. The term "monoclonal antibody" includes
(but is not limited to) antibodies which are obtained from a
monoclonal cell population derived from a single cell clone, as for
instance the antibodies generated by the hybridoma method described
in Kohler and Milstein (Nature, 1975 Aug. 7; 256(5517):495-7) or
Harlow and Lane ("Antibodies: A Laboratory Manual" Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y. 1988). A
monoclonal antibody may also be obtained from other suitable
methods, including phage display techniques such as those described
in Clackson et al. (Nature. 1991 Aug. 15; 352(6336):624-8) or Marks
et al. (J Mol Biol. 1991 Dec. 5; 222(3):581-97). A monoclonal
antibody may be an antibody that has been optimized for
antigen-binding properties such as decreased Kd values, optimized
association and dissociation kinetics by methods known in the art.
For instance, Kd values may be optimized by display methods
including phage display, resulting in affinity-matured monoclonal
antibodies. The term "monoclonal antibody" is not limited to
antibody sequences from particular species of origin or from one
single species of origin. Thus, the meaning of the term "monoclonal
antibody" encompasses chimeric monoclonal antibodies such as
humanized monoclonal antibodies.
[0032] "Humanized antibodies" are antibodies which contain human
sequences and a minor portion of non-human sequences which confer
binding specificity to an antigen of interest (e.g. human GDF-15).
Typically, humanized antibodies are generated by replacing
hypervariable region sequences from a human acceptor antibody by
hypervariable region sequences from a non-human donor antibody
(e.g. a mouse, rabbit, rat donor antibody) that binds to an antigen
of interest (e.g. human GDF-15). In some cases, framework region
sequences of the acceptor antibody may also be replaced by the
corresponding sequences of the donor antibody. In addition to the
sequences derived from the donor and acceptor antibodies, a
"humanized antibody" may either contain other (additional or
substitute) residues or sequences or not. Such other residues or
sequences may serve to further improve antibody properties such as
binding properties (e.g. to decrease Kd values) and/or immunogenic
properties (e.g. to decrease antigenicity in humans). Non-limiting
examples for methods to generate humanized antibodies are known in
the art, e.g. from Riechmann et al. (Nature. 1988 Mar. 24;
332(6162):323-7) or Jones et al. (Nature. 1986 May 29-Jun. 4;
321(6069):522-5).
[0033] The term "human antibody" relates to an antibody containing
human variable and constant domain sequences. This definition
encompasses antibodies having human sequences bearing single amino
acid substitutions or modifications which may serve to further
improve antibody properties such as binding properties (e.g. to
decrease Kd values) and/or immunogenic properties (e.g. to decrease
antigenicity in humans). The term "human antibody" excludes
humanized antibodies where a portion of non-human sequences confers
binding specificity to an antigen of interest.
[0034] An "antigen-binding portion" of an antibody as used herein
refers to a portion of an antibody that retains the capability of
the antibody to specifically bind to the antigen (e.g. GDF-15),
i.e. the "antigen-binding portion" is capable of competing with the
antibody for specific binding to the antigen. The "antigen-binding
portion" may contain one or more fragments of the antibody. Without
particular limitation, it can be produced by any suitable method
known in the art, including recombinant DNA methods and preparation
by chemical or enzymatic fragmentation of antibodies.
Antigen-binding portions may be Fab fragments, F(ab') fragments,
F(ab').sub.2 fragments, single chain antibodies (scFv),
single-domain antibodies, diabodies or any other portion(s) of the
antibody that allow(s) to retain binding to the antigen.
[0035] An "antibody" (e.g. a monoclonal antibody) or an
"antigen-binding portion" may have been derivatized or be linked to
a different molecule. For example, molecules that may be linked to
the antibody are other proteins (e.g. other antibodies), a
molecular label (e.g. a fluorescent, luminescent, colored or
radioactive molecule), a pharmaceutical and/or a toxic agent. The
antibody or antigen-binding portion may be linked directly (e.g. in
form of a fusion between two proteins), or via a linker molecule
(e.g. any suitable type of chemical linker known in the art).
[0036] As used herein, the terms "binding" or "bind" refer to
specific binding to the antigen of interest (e.g. human GDF-15).
Preferably, the Kd value is less than 100 nM, more preferably less
than 50 nM, still more preferably less than nM, still more
preferably less than 5 nM and most preferably less than 2 nM.
[0037] The term "epitope" as used herein refers to a small portion
of an antigen that forms the binding site for an antibody.
[0038] In the context of the present invention, binding or
competitive binding of antibodies or their antigen-binding portions
to the antigen of interest (e.g. human GDF-15) is measured by using
surface plasmon resonance measurements as a reference standard
assay, as described below.
[0039] The terms "K.sub.D" or "K.sub.D value" relate to the
equilibrium dissociation constant as known in the art. In the
context of the present invention, these terms relate to the
equilibrium dissociation constant of an antibody with respect to a
particular antigen of interest (e.g. human GDF-15) The equilibrium
dissociation constant is a measure of the propensity of a complex
(e.g. an antigen-antibody complex) to reversibly dissociate into
its components (e.g. the antigen and the antibody). For the
antibodies according to the invention, K.sub.D values (such as
those for the antigen human GDF-15) are generally determined by
using surface plasmon resonance measurements as described
below.
[0040] The term "cancer growth" as used herein relates to any
measurable growth of the cancer. For cancers forming solid tumors,
"cancer growth" relates to a measurable increase in tumor volume
over time. If the cancer has formed only a single tumor, "cancer
growth" relates only to the increase in volume of the single tumor.
If the cancer has formed multiple tumors such as metastases,
"cancer growth" relates to the increase in volume of all measurable
tumors. For solid tumors, the tumor volume can be measured by any
method known in the art, including magnetic resonance imaging and
computed tomography (CT scan).
[0041] For leukemias which are characterized by the presence of
cancerous cells of the blood system in blood, "cancer growth"
relates to a measurable increase in the number of cancer cells per
blood volume. In order to carry out such measurements, cancer cells
can be identified from blood samples by using any method known in
the art, including cell morphology measurements, or staining of
tumor cell marker proteins such as tumor marker cell surface
proteins, e.g. by staining with specific antibodies, and the cancer
cells can be counted.
[0042] Terms such as "inhibiting cancer growth" as used herein
refer to a measurable inhibition of cancer growth in patient
treated with the antibody. Preferably, the inhibition is
statistically significant. Inhibition of cancer growth may be
assessed by comparing cancer growth in a group of patients treated
in accordance with the present invention to a control group of
untreated patients, or by comparing a group of patients that
receive a standard cancer treatment of the art plus a treatment
according to the invention with a control group of patients that
only receive a standard cancer treatment of the art. Such studies
for assessing the inhibition of cancer growth are designed in
accordance with accepted standards for clinical studies, e.g.
double-blinded, randomized studies with sufficient statistical
power. The term "inhibiting cancer growth" includes an inhibition
of cancer growth where the cancer growth is inhibited partially
(i.e. where the cancer growth in the patient is delayed compared to
the control group of patients), an inhibition where the cancer
growth is inhibited completely (i.e. where the cancer growth in the
patient is stopped), and an inhibition where cancer growth is
reversed (i.e. the cancer shrinks).
[0043] An "isolated antibody" as used herein is an antibody that
has been identified and separated from the majority of components
(by weight) of its source environment, e.g. from the components of
a hybridoma cell culture or a different cell culture that was used
for its production (e.g. producer cells such as CHO cells that
recombinantly express the antibody). The separation is performed
such that it sufficiently removes components that may otherwise
interfere with the suitability of the antibody for the desired
applications (e.g. with a therapeutic use of the anti-human GDF-15
antibody according to the invention). Methods for preparing
isolated antibodies are known in the art and include Protein A
chromatography, anion exchange chromatography, cation exchange
chromatography, virus retentive filtration and ultrafiltration.
Preferably, the isolated antibody preparation is at least 70% pure
(w/w), more preferably at least 80% pure (w/w), still more
preferably at least 90% pure (w/w), still more preferably at least
95% pure (w/w), and most preferably at least 99% pure (w/w), as
measured by using the Lowry protein assay.
[0044] A "diabody" as used herein is a small bivalent
antigen-binding antibody portion which comprises a heavy chain
variable domain linked to a light chain variable domain on the same
polypeptide chain linked by a peptide linker that is too short to
allow pairing between the two domains on the same chain. This
results in pairing with the complementary domains of another chain
and in the assembly of a dimeric molecule with two antigen binding
sites. Diabodies may be bivalent and monospecific (such as
diabodies with two antigen binding sites for human GDF-15), or may
be bivalent and bispecific (e.g. diabodies with two antigen binding
sites, one being a binding site for human GDF-15, and the other one
being a binding site for a different antigen). A detailed
description of diabodies can be found in Holliger P et al.
(""Diabodies": small bivalent and bispecific antibody fragments."
Proc Natl Acad Sci USA. 1993 Jul. 15; 90(14):6444-8.).
[0045] A "single-domain antibody" (which is also referred to as
"Nanobody.TM.") as used herein is an antibody fragment consisting
of a single monomeric variable antibody domain. Structures of and
methods for producing single-domain antibodies are known from the
art, e.g. from Holt L J et al. ("Domain antibodies: proteins for
therapy." Trends Biotechnol. 2003 November; 21(11):484-90.),
Saerens D et al. ("Single-domain antibodies as building blocks for
novel therapeutics." Curr Opin Pharmacol. 2008 October; 8(5):600-8.
Epub 2008 Aug. 22.), and Arbabi Ghahroudi M et al. ("Selection and
identification of single domain antibody fragments from camel
heavy-chain antibodies." FEBS Lett. 1997 Sep. 15;
414(3):521-6.).
[0046] The term "higher" as used herein means that a value (e.g. a
GDF-15 level) in a patient sample is higher than a value in a
corresponding control sample or group of control samples.
Preferably, the difference is statistically significant.
[0047] The term "elevated GDF-15 levels" as used herein means that
the human patient has higher GDF-15 levels in blood serum before
administration of the antibody or antigen-binding portion thereof
or the pharmaceutical composition according to the invention, when
compared to median GDF-15 levels in blood sera of healthy human
control individuals as a reference.
[0048] A preferred median reference for GDF-15 level in blood sera
of healthy human control individuals is <0.8 ng/ml. The expected
range is between 0.2 ng/ml and 1.2 ng/ml in healthy human controls
(Reference: Tanno T et al.: "Growth differentiation factor 15 in
erythroid health and disease." Curr Opin Hematol. 2010 May; 17(3):
184-190.).
[0049] Preferably, the levels are 1.2-fold higher, more preferably
1.5-fold higher, still more preferably 2-fold higher and most
preferably 5-fold higher.
[0050] The term "prior to administration" as used herein means the
period of time immediately before administration of the antibody,
fragment thereof or the pharmaceutical composition according to the
invention. Preferably, the term "prior to administration" means a
period of 30 days immediately before administration; most
preferably a period of one week immediately before
administration.
[0051] The terms "significant", "significantly", etc. as used
herein refer to a statistically significant difference between
values.
[0052] The terms "cancer" and "cancer cell" is used herein in
accordance with their common meaning in the art (see for instance
Weinberg R. et al.: The Biology of Cancer. Garland Science: New
York 2006. 850p.).
[0053] In accordance with the present invention, each occurrence of
the term "comprising" may optionally be substituted with the term
"consisting of".
Methods and Techniques
[0054] Generally, unless otherwise defined herein, the methods used
in the present invention (e.g. cloning methods or methods relating
to antibodies) are performed in accordance with procedures known in
the art, e.g. the procedures described in Sambrook et al.
("Molecular Cloning: A Laboratory Manual.", 2.sup.nd Ed., Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. 1989),
Ausubel et al. ("Current Protocols in Molecular Biology." Greene
Publishing Associates and Wiley Interscience; New York 1992), and
Harlow and Lane ("Antibodies: A Laboratory Manual" Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y. 1988), all of
which are incorporated herein by reference.
[0055] Binding of monoclonal anti-human-GDF-15 antibodies according
to the invention is generally assessed by employing surface plasmon
resonance measurements using a Biorad ProteOn XPR36 system and
Biorad GLC sensor chips as described for anti-human GDF-15
mAb-B1-23 in Example 1.
[0056] Sequence Alignments of sequences according to the invention
are performed by using the BLAST algorithm (see Altschul et al.
(1990) "Basic local alignment search tool." Journal of Molecular
Biology 215. p. 403-410; Altschul et al.: (1997) Gapped BLAST and
PSI-BLAST: a new generation of protein database search programs.
Nucleic Acids Res. 25:3389-3402.). Preferably, the following
parameters are used: Max target sequences 10; Word size 3; BLOSUM
62 matrix; gap costs: existence 11, extension 1; conditional
compositional score matrix adjustment. Thus, when used in
connection with sequences, terms such as "identity" or "identical"
refer to the identity value obtained by using the BLAST
algorithm.
[0057] Monoclonal antibodies according to the invention can be
produced by any method known in the art, including but not limited
to the methods referred to in Siegel D L ("Recombinant monoclonal
antibody technology." Transfus Clin Biol. 2002 January;
9(1):15-22.). In a preferred embodiment, an antibody according to
the invention is produced by the hybridoma cell line B1-23
deposited with the Deutsche Sammlung fur Mikroorganismen and
Zellkulturen GmbH (DSMZ) under the accession No. DSM ACC3142 under
the Budapest treaty. The deposit was filed on Sep. 29, 2011.
[0058] Cell proliferation can be measured by suitable methods known
in the art, including (but not limited to) visual microscopy,
metabolic assays such as those which measure mitochondrial redox
potential (e.g. MTT
(3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide)
assay; Resazurin staining which is also known as Alamar Blue.RTM.
assay), staining of known endogenous proliferation biomarkers (e.g.
Ki-67), and methods measuring cellular DNA synthesis (e.g. BrdU and
[.sup.3H]-Thymidine incorporation assays).
[0059] Immunosuppression can be measured by suitable methods known
in the art, including (but not limited to) immune cell
proliferation, cytokine secretion, intracellular cytokine staining
by flow cytometry, cytokine measurement by qRT-PCR, redirected
target cell lysis, further cytotoxicity or degranulation assays,
downregulation of activating immune cell receptors (like NKG2D),
upregulation of inhibitory immune cell receptors, immunological
synapse formation, immune cell infiltration. For the term
immunosuppression to apply, an effect shall be measurable in at
least one of these or in any other suitable assay. The lack of
effect in a specific test does not imply a general absence of
immunosuppression.
[0060] Human GDF-15 levels can be measured by any method known in
the art, including measurements of GDF-15 mRNA levels by methods
including (but not limited to) quantitative real-time PCR (qRT-PCR)
for human GDF-15 mRNA using primers specific to human GDF-15, mRNA
in situ hybridization with probes specific to human GDF-15, mRNA
deep sequencing methods; and including measurements of GDF-15
protein levels by methods including (but not limited to) mass
spectrometry for proteins or peptides derived from human GDF-15,
Western Blotting using antibodies specific to human GDF-15, flow
cytometry using antibodies specific to human GDF-15, strip tests
using antibodies specific to human GDF-15, or immunocytochemistry
using antibodies specific to human GDF-15. For such methods using
antibodies specific to human GDF-15, the anti-human GDF-15
antibodies of the present invention are preferred, and the antibody
of the invention produced by the hybridoma cell line B1-23
deposited with the Deutsche Sammlung fur Mikroorganismen and
Zellkulturen GmbH (DSMZ) under the accession No. DSM ACC3142 is
most preferred.
EMBODIMENTS OF THE INVENTION
[0061] As described above, the inventors show that human GDF-15
protein can be targeted by an antibody of the invention in a way
that cancer growth is inhibited.
[0062] This is a surprising finding in view of the art teaching
that only cancer-induced weight loss can be reversed by
anti-GDF-antibodies, and that growth of the cancer cannot be
inhibited (WO 2005/099746, WO 2009/021293 and Johnen H et al.,
Nature Medicine, 2007).
[0063] When taking into account the present invention, it becomes
clear that the anti-GDF-15 antibodies known from WO 2005/099746, WO
2009/021293 and Johnen H et al., Nature Medicine, 2007 only inhibit
one of the effects of human GDF-15 (i.e. cancer-induced weight
loss), but fail to inhibit other effects of human GDF-15 such as
those related to cancer growth. In view of the present invention,
one possible explanation for this failure is that the antibodies
known from the above documents may only interfere with transport of
human GDF-15 across the blood-brain barrier (by forming a large
complex that cannot be transported across the blood-brain barrier)
but are incapable of binding human GDF-15 in a way that renders it
generally unable to interact with its receptor (e.g. a receptor
residing on cells outside the brain).
[0064] The following properties of the antibodies of the present
invention are expected to contribute to their capability of
inhibiting the effects of human GDF-15 more completely, including
the inhibition of cancer growth:
Broad Binding Specificity to Forms of Human GDF-15
[0065] The antibodies of the present invention are capable of
binding to mature recombinant human GDF-15 (represented by SEQ ID
No: 8) and are therefore capable of binding to active, fully
processed (mature) human GDF-15.
[0066] Additionally, by performing staining experiments with the
mAb-B1-23 antibody according to the invention on human cells, the
inventors show that the mAb-B1-23 antibody according to the
invention is capable of binding to the human GDF-15 precursor on
human cells.
[0067] Thus, it is expected that binding and effects of the
antibodies of the present invention (e.g. the inhibition of cancer
growth) are not limited to effects on a particular form of human
GDF-15.
High Binding Affinity
[0068] The antibodies and antigen binding portions thereof
according to the invention have high binding affinity, as
demonstrated by the mAb-B1-23 antibody according to the invention
which has an equilibrium dissociation constant of about 790 pM for
recombinant human GDF-15. Notably, such affinity values are
superior to most of the existing therapeutic antibodies, e.g. to
the therapeutic antibody Rituximab which has an equilibrium
dissociation constant of about 8 nM.
[0069] High binding affinity will ensure that the antibody to human
GDF-15 according to the invention stably binds to human GDF-15,
such that effects of human GDF-15 including effects on cancer
growth are effectively inhibited.
Binding to a Discontinuous or Conformational Epitope
[0070] The antibodies and antigen binding portions thereof
according to the invention bind to a discontinuous or
conformational epitope, as demonstrated below for the mAb-B1-23
antibody according to the invention.
[0071] Binding of antibodies and antigen binding portions thereof
according to the invention to a discontinuous or conformational
GDF-15 epitope may help to keep human GDF-15 in a specific
conformation and thereby contribute to the effective inhibition of
effects of human GDF-15 including effects on cancer growth.
[0072] Thus, the invention relates to the following
embodiments:
A) ANTIBODIES, VECTORS AND CELL LINES
[0073] Concretely, the invention relates to a monoclonal antibody
capable of binding to human GDF-15, or an antigen-binding portion
thereof, wherein the heavy chain variable domain comprises a CDR3
region comprising the amino acid sequence of SEQ ID NO: 5 or an
amino acid sequence at least 90% identical thereto, and wherein the
light chain variable domain comprises a CDR3 region comprising the
amino acid sequence of SEQ ID NO: 7 or an amino acid sequence at
least 85% identical thereto.
[0074] Alternatively, the invention relates to a monoclonal
antibody capable of binding to human GDF-15, or an antigen-binding
portion thereof, wherein the heavy chain variable domain comprises
a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or
an amino acid sequence that differs by not more than one amino acid
from the amino acid sequence of SEQ ID NO: 5, and wherein the light
chain variable domain comprises a CDR3 region comprising the amino
acid sequence of SEQ ID NO: 7 or an amino acid sequence or an amino
acid sequence that differs by not more than one amino acid from the
amino acid sequence of SEQ ID NO: 7.
[0075] In a second embodiment in accordance with the above
embodiments, the heavy chain variable domain of the monoclonal
antibody or antigen-binding portion thereof comprises a CDR3 region
comprising the amino acid sequence of SEQ ID NO: 5, or the light
chain variable domain comprises a CDR3 region comprising the amino
acid sequence of SEQ ID NO: 7.
[0076] In a third embodiment in accordance with the above
embodiments, the heavy chain variable domain of the monoclonal
antibody or antigen-binding portion thereof comprises a CDR3 region
comprising the amino acid sequence of SEQ ID NO: 5, and the light
chain variable domain comprises a CDR3 region comprising the amino
acid sequence of SEQ ID NO: 7.
[0077] In still another embodiment in accordance with the above
embodiments, the heavy chain variable domain comprises a region
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region and
comprising the amino acid sequence of SEQ ID NO: 1 or a sequence
85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical
thereto, and the light chain variable domain comprises a region
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region and
comprising the amino acid sequence of SEQ ID NO: 2 or a sequence
85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical
thereto.
[0078] In a preferred embodiment in accordance with the above
embodiments, the heavy chain variable domain comprises a region
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region and
comprising the amino acid sequence of SEQ ID NO: 1 or a sequence
95% identical thereto, and the light chain variable domain
comprises a region comprising an FR1, a CDR1, an FR2, a CDR2 and an
FR3 region and comprising the amino acid sequence of SEQ ID NO: 2
or a sequence 95% identical thereto.
[0079] In a more preferred embodiment in accordance with the above
embodiments, the heavy chain variable domain comprises a region
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region and
comprising the amino acid sequence of SEQ ID NO: 1 or a sequence
98% identical thereto, and the light chain variable domain
comprises a region comprising an FR1, a CDR1, an FR2, a CDR2 and an
FR3 region and comprising the amino acid sequence of SEQ ID NO: 2
or a sequence 98% identical thereto.
[0080] In a still more preferred embodiment in accordance with the
above embodiments, the heavy chain variable domain comprises a
region comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region
and comprising the amino acid sequence of SEQ ID NO: 1, and the
light chain variable domain comprises a region comprising an FR1, a
CDR1, an FR2, a CDR2 and an FR3 region and comprising the amino
acid sequence of SEQ ID NO: 2.
[0081] The invention also relates to a monoclonal antibody capable
of binding to human GDF-15, or an antigen-binding portion thereof,
wherein the heavy chain variable domain comprises a CDR1 region
comprising the amino acid sequence of SEQ ID NO: 3 and a CDR2
region comprising the amino acid sequence of SEQ ID NO: 4, and
wherein the light chain variable domain comprises a CDR1 region
comprising the amino acid sequence of SEQ ID NO: 6 and a CDR2
region comprising the amino acid sequence of SEQ ID NO: 7. In a
preferred aspect of this embodiment, the antibody may have CDR3
sequences as defined in any of the embodiments of the invention
described above.
[0082] In another embodiment, the invention relates to a monoclonal
antibody capable of binding to human GDF-15, or an antigen-binding
portion thereof, wherein the antibody or antigen-binding portion
thereof is capable of inhibiting cancer growth in a mammal,
preferably a human patient.
[0083] In another embodiment in accordance with the above
embodiment, the invention relates to an antigen-binding portion
capable of binding to human GDF-15, wherein the antigen-binding
portion is a single-domain antibody (also referred to as
"Nanobody.TM."). In one aspect of this embodiment, the
single-domain antibody comprises the CDR1, CDR2, and CDR3 amino
acid sequences of SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 5,
respectively. In another aspect of this embodiment, the
single-domain antibody comprises the CDR1, CDR2, and CDR3 amino
acid sequences of SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 7,
respectively. In a preferred aspect of this embodiment, the
single-domain antibody is a humanized antibody.
[0084] Preferably, the antibodies of the invention capable of
binding to human GDF-15 or the antigen-binding portions thereof
have an equilibrium dissociation constant for human GDF-15 that is
equal to or less than 100 nM, less than 20 nM, preferably less than
10 nM, more preferably less than 5 nM and most preferably between
0.1 nM and 2 nM.
[0085] In another embodiment of the invention, the antibody capable
of binding to human GDF-15 or the antigen-binding portion thereof
binds to the same human GDF-15 epitope as the antibody to human
GDF-15 obtainable from the cell line B1-23 deposited with the
Deutsche Sammlung fur Mikroorganismen and Zellkulturen GmbH (DMSZ)
under the accession No. DSM ACC3142. As described herein, antibody
binding to human GDF-15 in accordance with the present invention is
assessed by surface plasmon resonance measurements as a reference
standard method, in accordance with the procedures described in
Example 1. Binding to the same epitope on human GDF-15 can be
assessed similarly by surface plasmon resonance competitive binding
experiments of the antibody to human GDF-15 obtainable from the
cell line B1-23 and the antibody that is expected to bind to the
same human GDF-15 epitope as the antibody to human GDF-15
obtainable from the cell line B1-23.
[0086] In a very preferred embodiment, the antibody of the
invention is the monoclonal antibody capable of binding to human
GDF-15 obtainable from the cell line B1-23 deposited with the
Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ)
under the accession No. DSM ACC3142 or an antigen-binding portion
thereof.
[0087] In a preferred embodiment, the antibody capable of binding
to human GDF-15 or the antigen-binding portion thereof according to
the invention is a humanized monoclonal antibody or an
antigen-binding portion thereof. For any given non-human antibody
sequence in accordance with the invention (i.e. a donor antibody
sequence), humanized monoclonal anti-human-GDF-15 antibodies of the
invention or antigen-binding portions thereof can be generated in
accordance with techniques known in the art, as described
above.
[0088] In a very preferred embodiment, the monoclonal antibody
capable of binding to human GDF-15 or antigen-binding portion
thereof is a humanized antibody derived from the monoclonal
antibody capable of binding to human GDF-15 obtainable from the
cell line B1-23 deposited with the Deutsche Sammlung fur
Mikroorganismen und Zellkulturen GmbH (DMSZ) under the accession
No. DSM ACC3142, or an antigen-binding portion thereof. In a
non-limiting aspect of this embodiment, the heavy chain variable
domain of the humanized antibody or antigen-binding portion thereof
comprises a CDR3 region comprising the amino acid sequence of SEQ
ID NO: 5, and the light chain variable domain of the humanized
antibody or antigen-binding portion thereof comprises a CDR3 region
comprising the amino acid sequence of SEQ ID NO: 7. In a further
non-limiting aspect of this embodiment, the heavy chain variable
domain of the humanized antibody or antigen-binding portion thereof
comprises or further comprises a CDR1 region comprising the amino
acid sequence of SEQ ID NO: 3 and a CDR2 region comprising the
amino acid sequence of SEQ ID NO: 4, and the light chain variable
domain of the humanized antibody or antigen-binding portion thereof
comprises or further comprises a CDR1 region comprising the amino
acid sequence of SEQ ID NO: 6 and a CDR2 region comprising the
amino acid sequence of SEQ ID NO: 7.
[0089] The present invention also relates to a monoclonal antibody
capable of binding to human GDF-15, or an antigen-binding portion
thereof, wherein the binding is binding to a conformational or
discontinuous epitope on human GDF-15 comprised by the amino acid
sequences of SEQ ID No: 25 and SEQ ID No: 26. In a preferred aspect
of this embodiment, the antibody or antigen-binding portion thereof
is an antibody or antigen-binding portion thereof as defined in any
one of the above embodiments.
[0090] In another embodiment of the invention in accordance with
the above embodiments, the antibody capable of binding to human
GDF-15 or the antigen-binding portion thereof is a diabody. In one
aspect of this embodiment, the diabody is bivalent and
monospecific, with two identical antigen binding sites for human
GDF-15. In a second, alternative aspect of this embodiment, the
diabody is bivalent and bispecific, with one antigen binding site
being a binding site for human GDF-15, and the other antigen
binding site being a binding site for a different antigen.
Non-limiting examples for the different antigen according to this
second aspect of this embodiment are i) cell surface antigens that
are co-expressed with GDF-15 at high levels on the same cancer
(e.g. at higher levels compared to a control sample of the same
patient obtained from a non-cancerous part of the tissue which is
the tissue of origin of the cancer), and ii) cell surface antigens
on cells of the immune system which are known as useful antigens
for the recruitment of cells of the immune system to the tumor.
[0091] In still another embodiment of the invention in accordance
with the above embodiments, the antibody capable of binding to
human GDF-15 or the antigen-binding portion thereof is linked to a
drug. In non-limiting aspects of this embodiment, the drug can be a
known anticancer agent and/or an immune-stimulatory molecule. Known
anticancer agents include alkylating agents such as cisplatin,
carboplatin, oxaliplatin, mechlorethamine, cyclophosphamide,
chlorambucil, and ifosfamide; anti-metabolites such as azathioprine
and mercaptopurine; alkaloids such as vinca alkaloids (e.g.
vincristine, vinblastine, vinorelbine, and vindesine), taxanes
(e.g. paclitaxel, docetaxel) etoposide and teniposide;
topoisomerase inhibitors such as camptothecins (e.g. irinotecan and
topotecan); cytotoxic antibiotics such as actinomycin,
anthracyclines, doxorubicin, daunorubicin, valrubicin, idarubicin,
epirubicin, bleomycin, plicamycin and mitomycin; and radioisotopes.
Linking of the antibodies or the antigen-binding portions thereof
of the invention to anticancer agents is expected to result in
stronger cancer tumor growth inhibition compared to the antibody
without the anticancer agent, because the resulting conjugate will
accumulate at the site of the tumor due to the presence of GDF-15
in the tumor, leading to the accumulation of the anticancer agent
at the site of the tumor and to enhanced effects of the anticancer
agent on the tumor.
[0092] In a further embodiment in accordance with the above
embodiments, the antibody capable of binding to human GDF-15 or the
antigen-binding portion thereof is modified by an amino acid tag.
Non-limiting examples of such tags include Polyhistidin (His-)
tags, FLAG-tag, Hemagglutinin (HA) tag, glycoprotein D (gD) tag,
and c-myc tag. Tags may be used for various purposes. For instance,
they may be used to assist purification of the antibody capable of
binding to human GDF-15 or the antigen-binding portion thereof, or
they may be used for detection of the antibody or the
antigen-binding portion thereof (e.g. when used in diagnostic
assays). Preferably, such tags are present at the C-terminus or
N-terminus of the antibody capable of binding to human GDF-15 or
the antigen-binding portion thereof.
[0093] In a preferred embodiment of the present invention in
accordance with the above embodiments, the antibody capable of
binding to human GDF-15 or the antigen-binding portion thereof is
capable of inhibiting cancer growth in a mammal, preferably a human
patient.
[0094] In another preferred embodiment of the present invention in
accordance with the above embodiments, the human GDF-15 is
recombinant human GDF-15 having the amino acid sequence represented
by SEQ ID No: 8.
[0095] In still another preferred embodiment of the present
invention in accordance with the above embodiments, the binding of
the antibody capable of binding to human GDF-15 or the
antigen-binding portion thereof is a binding to a conformational or
discontinuous epitope on human GDF-15.
[0096] Preferably, the monoclonal antibodies of the present
invention capable of binding to human GDF-15 or the antigen-binding
portions thereof are isolated antibodies.
[0097] The invention also relates to an expression vector
comprising a nucleotide sequence encoding the antibody or
antigen-binding portion thereof as defined above.
[0098] Further, the present invention also provides a cell line
capable of producing an antibody or antigen-binding portion thereof
according to the present invention.
[0099] In one embodiment, the cell line can be derived from any
cell line that is known in that art and suitable for the production
of antibodies or antigen-binding portions thereof.
[0100] In a preferred embodiment, the cell line is the cell line
31-23 deposited with the Deutsche Sammlung far Mikroorganismen and
Zellkulturen GmbH (DMSZ) under the accession No. DSM ACC3142.
[0101] In another preferred embodiment, the cell line contains an
expression vector according to the invention as defined above.
B) PHARMACEUTICAL COMPOSITIONS
[0102] In a further embodiment, the present invention relates to a
pharmaceutical composition comprising any of the antibodies or
antigen-binding portions thereof as defined above.
[0103] Pharmaceutical compositions in accordance with the present
invention are prepared in accordance with known standards for the
preparation of pharmaceutical compositions containing antibodies
and portions thereof.
[0104] For instance, the compositions are prepared in a way that
they can be stored and administered appropriately, e.g. by using
pharmaceutically acceptable components such as carriers, excipients
or stabilizers.
[0105] Such pharmaceutically acceptable components are not toxic in
the amounts used when administering the pharmaceutical composition
to a patient. The pharmaceutical acceptable components added to the
pharmaceutical compositions may depend on the particular intended
use of the pharmaceutical compositions and the route of
administration.
[0106] In general, the pharmaceutically acceptable components used
in connection with the present invention are used in accordance
with knowledge available in the art, e.g. from Remington's
Pharmaceutical Sciences, Ed. AR Gennaro, 20th edition, 2000,
Williams & Wilkins, PA, USA.
C) THERAPEUTIC METHODS AND PRODUCTS FOR USE IN THESE METHODS
[0107] The present invention further relates to a method for
treating a cancer in a mammal, the method comprising administering
an antibody or antigen-binding portion thereof as defined above, or
a pharmaceutical composition as defined above to said mammal.
Alternatively, the present invention relates to an antibody or
antigen-binding portion thereof as defined above, or a
pharmaceutical composition as defined above for use in these
methods. In a very preferred aspect of these embodiments, the
mammal is a human patient.
[0108] All of the methods for treating a cancer according to the
invention exclude a treatment of cancer-induced weight loss
according to WO 2005/099746, WO 2009/021293 and Johnen H et al.,
Nature Medicine, 2007. This reflects the fact that according to
these art teachings only cancer-induced weight loss can be reversed
by anti-GDF-15 antibodies, and that growth of the cancer cannot be
inhibited.
[0109] When taking into account the present invention, it becomes
clear that the anti-GDF-15 antibodies known from WO 2005/099746, WO
2009/021293 and Johnen H et al., Nature Medicine, 2007 only inhibit
one of the effects of human GDF-15 (i.e. cancer-induced weight
loss), but fail to inhibit other effects of human GDF-15 such as
those related to cancer growth.
[0110] The inhibition of cancer growth according to the present
invention does not exclude that additional or secondary therapeutic
benefits also occur in patients. For example, an additional or
secondary benefit may be an influence on cancer-induced weight
loss. However it is understood that the primary treatment for which
protection is sought is for inhibiting cancer growth, any secondary
or additional effects only reflect optional, additional advantages
of the treatment of cancer growth.
[0111] In a preferred embodiment of the above methods, or
antibodies, antigen-binding portions thereof or pharmaceutical
compositions for use in these methods, the human patient has
elevated GDF-15 levels in blood serum before administration. In a
patient sub-group having elevated GDF-15 levels in blood serum, the
treatment methods according to the invention are expected to be
particularly effective at inhibiting cancer growth. In the most
preferred aspect of this embodiment, GDF-15 levels are GDF-15
protein levels measured using the antibody according to the
invention obtainable from the hybridoma cell line B1-23 deposited
with the Deutsche Sammlung fur Mikroorganismen and Zelikulturen
GmbH (DSMZ) under the accession No. DSM ACC3142, preferably
measured by immunochemistry.
[0112] In another embodiment of the above methods, or antibodies,
antigen-binding portions thereof or pharmaceutical compositions for
use in these methods, the antibody or antigen-binding portion
thereof is the sole ingredient pharmaceutically active against
cancer used in the method.
[0113] In an alternative embodiment of the above methods, or
antibodies, antigen-binding portions thereof or pharmaceutical
compositions for use in these methods, the antibody or
antigen-binding portion thereof is used in combination with one or
more further ingredients pharmaceutically active against cancer. In
one aspect of this embodiment, the one or more further ingredients
pharmaceutically active against cancer is a known anticancer agent
and/or an immune-stimulatory molecule as defined above.
[0114] In a preferred embodiment of the above methods, or
antibodies, antigen-binding portions thereof or pharmaceutical
compositions for use in these methods, the cancer is selected from
the group consisting of brain cancers including glioma, cancers of
the nervous system, melanoma, lung cancer, lip and oral cavity
cancer, hepatic carcinoma, leukemia, Hodgkin lymphoma, Non-Hodgkin
lymphoma, bladder cancer, cervix uteri cancer, corpus uteri cancer,
testis cancer, thyroid cancer, kidney cancer, gallbladder cancer,
multiple myeloma, nasopharynx cancer, larynx cancer, pharynx
cancer, esophagus cancer, gastrointestinal tumors including stomach
and colorectal cancer, pancreatic cancer, prostate cancer, ovarian
cancer and breast cancer, preferably from the group consisting of
melanoma, prostate cancer, breast cancer, brain cancers including
glioma, colorectal cancer, stomach cancer, esophagus cancer and
ovarian cancer, and most preferably is melanoma. In one embodiment
the cancer is selected from the above group, which further
comprises endometrial cancer, such as endometrial carcinoma, breast
cancer including subtypes of breast cancer, in particular
triple-negative breast cancer and bladder cancer such as urothelial
cell carcinoma.
[0115] In another preferred embodiment of the above methods, or
antibodies, antigen-binding portions thereof or pharmaceutical
compositions for use in these methods, the tumor or tumors formed
by the cancer have higher human GDF-15 levels prior to
administration compared to a control sample of the same patient
obtained from a non-cancerous part of the tissue which is the
tissue of origin of the cancer, preferably 1.2-fold higher levels,
more preferably 1.5-fold higher levels, still more preferably
2-fold higher levels and most preferably 5-fold higher levels. In a
patient sub-group having higher GDF-15 levels in the tumor or
tumors formed by the cancer compared to the above control sample,
the treatment methods according to the invention are expected to be
particularly effective at inhibiting cancer growth.
[0116] In a very preferred embodiment of the above methods, or
antibodies, antigen-binding portions thereof or pharmaceutical
compositions for use in these methods, the method comprises
inhibiting cancer growth. In a preferred aspect of this embodiment,
cancer growth is stopped. In a more preferred aspect, the cancer
shrinks.
[0117] In a preferred embodiment of the above methods, or
antibodies, antigen-binding portions thereof or pharmaceutical
compositions for use in these methods, the method comprises the
induction of killing of cancer cells by NK cells and CD8+ T cells
in the human patient. Due to their capability of preventing GDF-15
mediated down-regulation of the known immune surveillance regulator
NKG2D, the antibodies or antigen-binding portions thereof according
to the invention are expected to restore immune surveillance and
induce the killing of cancer cells by NK cells and CD8+ T cells, in
addition to effects of the antibodies or antigen-binding portions
thereof that are independent of the immune system.
D) KITS
[0118] The present invention also provides kits comprising the
pharmaceutical compositions as defined above.
[0119] In one embodiment, the kits are kits for use in the methods
according to the invention as defined above.
[0120] In further embodiments, the present invention also provides
a diagnostic kit comprising any of the antibodies or
antigen-binding portions thereof according to the invention.
[0121] In one embodiment, the diagnostic kit may be used to detect
whether the tumor or tumors of a cancer patient formed by the
cancer have higher human GDF-15 levels compared to a control sample
of the same patient obtained from a non-cancerous part of the
tissue which is the tissue of origin of the cancer.
[0122] In another embodiment, the diagnostic kit may be used to
detect whether a human cancer patient has elevated GDF-15 levels in
blood serum.
E) SEQUENCES
[0123] The amino acid sequences referred to in the present
application are as follows (in an N-terminal to C-terminal order;
represented in the one-letter amino acid code):
[0124] SEQ ID No: 1 (Region of the Heavy Chain Variable Domain
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region from
the Polypeptide Sequence of monoclonal anti-human GDF-15
mAb-B1-23):
TABLE-US-00001 QVKLQQSGPGILQSSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEW
LAHIYWDDDKRYNPTLKSRLTISKDPSRNQVFLKITSVDTADTATYYC
[0125] SEQ ID No: 2 (Region of the Light Chain Variable Domain
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region from
the Polypeptide Sequence of monoclonal anti-human GDF-15
mAb-B1-23):
TABLE-US-00002 DIVLTQSPKFMSTSVGDRVSVTCKASQNVGTNVAWFLQKPGQSPKALI
YSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFC
[0126] SEQ ID No: 3 (Heavy Chain CDR1 Region Peptide Sequence of
monoclonal anti-human GDF-15 mAb-B1-23):
TABLE-US-00003 GFSLSTSGMG
[0127] SEQ ID No: 4 (Heavy Chain CDR2 Region Peptide Sequence of
monoclonal anti-human GDF-15 mAb-B1-23):
TABLE-US-00004 IYWDDDK
[0128] SEQ ID No: 5 (Heavy Chain CDR3 Region Peptide Sequence of
monoclonal anti-human GDF-15 mAb-B1-23):
TABLE-US-00005 ARSSYGAMDY
[0129] SEQ ID No: 6 (Light Chain CDR1 Region Peptide Sequence of
monoclonal anti-human GDF-15 mAb-B1-23):
TABLE-US-00006 QNVGTN
[0130] Light Chain CDR2 Region Peptide Sequence of monoclonal
anti-human GDF-15 mAb-B1-23
TABLE-US-00007 SAS
[0131] SEQ ID No: 7 (Light Chain CDR3 Region Peptide Sequence of
monoclonal anti-human GDF-15 mAb-B1-23):
TABLE-US-00008 QQYNNFPYT
[0132] SEQ ID No: 8 (recombinant mature human GDF-15 protein):
TABLE-US-00009 GSARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGA
CPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGV
SLQTYDDLLAKDCHCI
[0133] SEQ ID No: 9 (human GDF-15 precursor protein):
TABLE-US-00010 MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSED
SRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGG
HLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLA
RPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRAR
ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGAC
PSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVS
LQTYDDLLAKDCHCI
[0134] SEQ ID No: 10 (human GDF-15 precursor protein+N-terminal and
C-terminal GSGS linker):
TABLE-US-00011 GSGSGSGMPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPG
PSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPE
VRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPL
RRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAA
RGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQV
TMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQK
TDTGVSLQTYDDLLAKDCHCIGSGSGSG
[0135] SEQ ID No: 11 (Flag peptide):
TABLE-US-00012 DYKDDDDKGG
[0136] SEQ ID No: 12 (HA peptide):
TABLE-US-00013 YPYDVPDYAG
[0137] SEQ ID No: 13 (peptide derived from human GDF-15):
TABLE-US-00014 ELHLRPQAARGRR
[0138] SEQ ID No: 14 (peptide derived from human GDF-15):
TABLE-US-00015 LHLRPQAARGRRR
[0139] SEQ ID No: 15 (peptide derived from human GDF-15):
TABLE-US-00016 HLRPQAARGRRRA
[0140] SEQ ID No: 16 (peptide derived from human GDF-15):
TABLE-US-00017 LRPQAARGRRRAR
[0141] SEQ ID No: 17 (peptide derived from human GDF-15):
TABLE-US-00018 RPQAARGRRRARA
[0142] SEQ ID No: 18 (peptide derived from human GDF-15):
TABLE-US-00019 PQAARGRRRARAR
[0143] SEQ ID No: 19 (peptide derived from human GDF-15):
TABLE-US-00020 QAARGRRRARARN
[0144] SEQ ID No: 20 (peptide derived from human GDF-15):
TABLE-US-00021 MHAQIKTSLHRLK
[0145] SEQ ID No: 25 (GDF-15 peptide comprising part of the GDF-15
Epitope that binds to B1-23):
TABLE-US-00022 EVQVTMCIGACPSQFR
[0146] SEQ ID No: 26 (GDF-15 peptide comprising part of the GDF-15
Epitope that binds to B1-23):
TABLE-US-00023 TDTGVSLQTYDDLLAKDCHCI
[0147] The nucleic acid sequences referred to in the present
application are as follows (in a 5' to 3' order; represented in
accordance with the standard nucleic acid code):
[0148] SEQ ID No: 21 (DNA nucleotide sequence encoding the amino
acid sequence defined in SEQ ID No: 1):
TABLE-US-00024 CAAGTGAAGCTGCAGCAGTCAGGCCCTGGGATATTGCAGTCCTCCCAGAC
CCTCAGTCTGACTTGTTCTTTCTCTGGGTTTTCACTGAGTACTTCTGGTA
TGGGTGTGAGCTGGATTCGTCAGCCTTCAGGAAAGGGTCTGGAGTGGCTG
GCACACATTTACTGGGATGATGACAAGCGCTATAACCCAACCCTGAAGAG
CCGGCTCACAATCTCCAAGGATCCCTCCAGAAACCAGGTATTCCTCAAGA
TCACCAGTGTGGACACTGCAGATACTGCCACATACTACTGT
[0149] SEQ ID No: 22 (DNA nucleotide sequence encoding the amino
acid sequence defined in SEQ ID No: 2):
TABLE-US-00025 GACATTGTGCTCACCCAGTCTCCAAAATTCATGTCCACATCAGTAGGAGA
CAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTGGGTACTAATGTGG
CCTGGTTTCTACAGAAACCAGGGCAATCTCCTAAAGCACTTATTTACTCG
GCATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCACAGGCAGTGGATC
TGGGACAGATTTCACTCTCACCATCAGCAACGTGCAGTCTGAAGACTTGG
CAGAGTATTTCTGT
[0150] SEQ ID No: 23 (DNA nucleotide sequence encoding the amino
acid sequence defined in SEQ ID No: 5):
TABLE-US-00026 GCTCGAAGTTCCTACGGGGCAATGGACTAC
[0151] SEQ ID No: 24 (DNA nucleotide sequence encoding the amino
acid sequence defined in SEQ ID No: 7):
TABLE-US-00027 CAGCAATATAACAACTTTCCGTACACG
F) EXAMPLES
[0152] The present invention is illustrated by the following
non-limiting Examples:
Example 1: Generation and Characterization of the GDF-15 Antibody
B1-23
[0153] The antibody B1-23 was generated in a GDF-15 knock out
mouse. Recombinant human GDF-15 (SEQ ID No: 8) was used as the
immunogen.
[0154] The hybridoma cell line B1-23 producing mAb-B1-23 was
deposited with the Deutsche Sammlung fur Mikroorganismen and
Zellkulturen GmbH (DMSZ) under the accession No. DSM ACC3142, in
accordance with the Budapest Treaty.
[0155] By means of a commercially available test strip system,
B1-23 was identified as an IgG2a (kappa chain) isotype. Using
surface plasmon resonance measurements, the dissociation constant
(Kd) was determined as follows:
[0156] Binding of the monoclonal anti-human-GDF-15 antibody
anti-human GDF-15 mAb-B1-23 according to the invention was measured
by employing surface plasmon resonance measurements using a Biorad
ProteOn XPR36 system and Biorad GLC sensor chips:
[0157] For preparing the biosensors recombinant mature human GDF-15
protein was immobilized on flow cells 1 and 2. On one flow cell
recombinant GDF-15 derived from Baculvirus-transfected insect cells
(HighFive insect cells) and on the other recombinant protein
derived from expression in E. coli was used. The GLC sensor chip
was activated using Sulfo-NHS (N-Hydroxysulfosuccinimide) and EDC
(1-Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride)
(Biorad ProteOn Amine Coupling Kit) according to the manufacturer's
recommendation, the sensor surface was subsequently loaded with the
proteins up to a density of about 600RU (1Ru=1 pg mm.sup.-2). The
non-reacted coupling groups were then quenched by perfusion with 1M
ethanolamine pH 8.5 and the biosensor was equilibrated by perfusing
the chip with running buffer (10M HEPES, 150 mM NaCl, 3.4 mM EDTA,
0.005% Tween-20, pH 7.4, referred to as HBS150). As controls two
flow cells were used, one empty with no protein coupled and one
coupled with an non-physiological protein partner (human
Interleukin-5), which was immobilized using the same coupling
chemistry and the same coupling density. For interaction
measurements anti-human GDF-15 mAb-B1-23 was dissolved in HBS150
and used in six different concentrations as analyte (concentration:
0.4, 0.8, 3, 12, 49 and 98 nM). The analyte was perfused over the
biosensor using the one-shot kinetics setup to avoid intermittent
regeneration, all measurements were performed at 25.degree. C. and
using a flow rate of 100 .mu.l min.sup.-1. For processing the bulk
face effect and unspecific binding to the sensor matrix was removed
by subtracting the SPR data of the empty flow cell (flow cell 3)
from all other SPR data. The resulting sensogram was analyzed using
the software ProteOn Manager version 3.0. For analysis of the
binding kinetics a 1:1 Langmuir-type interaction was assumed. For
the association rate constant a value of 5.4.+-.0.06.times.10.sup.5
M.sup.-1s.sup.-1 (k.sub.on) and for the dissociation rate constant
a value of 4.3.+-.0.03.times.10.sup.-4 s.sup.-1 (k.sub.off) could
be determined (values are for the interaction of anti-human GDF-15
mAb-B1-23 with GDF-15 derived from insect cell expression). The
equilibrium dissociation constant was calculated using the equation
K.sub.D=k.sub.off/k.sub.on to yield a value of about 790 pM.
Affinity values for the interaction of GDF-15 derived from E. coli
expression and the anti-human GDF-15 mAb-B1-23 differ by less than
a factor of 2, rate constants for GDF-15 derived from insect cells
and E. coli deviate by about 45% and are thus within the accuracy
of SPR measurements and likely do not reflect a real difference in
affinity. Under the conditions used the anti-human GDF-15 mAb-B1-23
shows no binding to human interleukin-5 and thus confirms the
specificity of the interaction data and the anti-human GDF-15
mAb-B1-23.
[0158] The amino acid sequence of recombinant human GDF-15 (as
expressed in Baculovirus-transfected insect cells) is:
TABLE-US-00028 (SEQ ID No: 8) GSARNGDHCP LGPGRCCRLH TVRASLEDLG
WADWVLSPRE VQVTMCIGAC PSQFRAANMH AQIKTSLHRL KPDTVPAPCC VPASYNPMVL
IQKTDTGVSL QTYDDLLAKD CHCI
[0159] Thus, using surface plasmon resonance measurements, the
dissociation constant (Kd) of 790 pM was determined. As a
comparison: the therapeutically used antibody Rituximab has a
significantly lower affinity (Kd=8 nM).
Example 2: Antagonization of GDF-15 Mediated Effects with mAB
B1-23
[0160] a) The NKG2D (Natural Killer Group 2D) receptor, which is
expressed on NK cells and CD8+ T cells, is known to play an
important role in the immune surveillance against tumors.
Transformed as well as viral infected cells express ligands, which
bind to the NKG2D receptor, thereby activating the cytotoxic
effector functions of the described immune cells. In that way
transformed cells can be detected and eliminated by the immune
system. After treatment of immune cells with either recombinant
human GDF-15 or tumor cell secreted GDF-15 in vitro for 72 hours,
the expression level of NKG2D on the cell surface of lymphocytes
was downregulated (FIG. 1). After 72 hours incubation the immune
cells were stained with the following FACS-antibodies: anti CD3,
anti CD56, anti-NKG2D. Using this antibody combination, the
experiment focused on NK cells and their NKG2D surface expression.
The low NKG2D level on immune cells led to an impaired tumor/target
cell lysis. The GDF-15 mediated downregulation of NKG2D was
prevented by mAb B1-23.
[0161] It is therefore concluded that human GDF-15 downregulates
expression of NKG2D on the cell surface of lymphocytes and thereby
downregulates immune surveillance against tumors. By binding to
human GDF-15, the antibodies of the present invention are capable
of preventing GDF-15 mediated downregulation of NKG2D and should be
capable of restoring immune surveillance and inducing the killing
of cancer cells by NK cells and CD8+ T cells.
[0162] b) The treatment of the ovarian cancer cell line SK-OV-3
with recombinant GDF-15 led to the phosphorylation of AKT. AKT is a
molecule, which is part of the PI3K-pathway and contributes to the
activation and proliferation of cells. In this experiment SK-OV-3
cells were treated with 10 ng/ml recombinant GDF-15 for 10 min at
37.degree. C., 5% CO2. 5 minutes preincubation of 2 .mu.g mAb-B1-23
with 10 ng/ml GDF-15 at 37.degree. C. blocked the GDF-15 mediated
AKT-phosphorylation (FIG. 2). This showed the neutralizing effect
of mAb-B1-23.
[0163] c) Treatment of immune cells with recombinant GDF-15 led to
the phosphorylation of JNK, a kinase, which is activated either by
cytokines or by stress. Antagonization of 10 ng/ml GDF-15 with 2
.mu.g mAb-B1-23 (5 minute preincubation at 37.degree.) blocked the
GDF-15 mediated JNK1/2-phosphorylation (FIG. 3).
Example 3: Inhibition of Cancer Cell Proliferation Using mAb
B1-23
[0164] Data generated with B1-23 showed an antiproliferative effect
of the antibody on cancer cells in vitro. The strongest
antiproliferative effect was observed using the prostate cancer
cell line LnCap, which produces lots of GDF-15. A metabolic assay
(Alamar Blue assay) showed a decrease of proliferation of 30% after
72 hrs when mAb-B1-23 was present, compared with the control group,
where the antibody was not applied. Since cytotoxic effects of the
antibody have been excluded in different assays, this effect proves
a significantly decreased cell division rate after blockade of
GDF-15.
Example 4: mAb B1-23 Inhibits Growth of Tumors In Vivo
[0165] In one experimental study setup, tumor growth is studied in
a SK-Mel28 human melanoma cell model in immunodeficient NMRI mice.
7.5.times.10.sup.6 melanoma cells are implanted subcutaneously into
each mouse. On day 23 after inoculation (i.e. during the
exponential growth phase of the malignoma), the mAb B1-23 antibody
is administered for the first time. After injection of mAb B1-23
(30 mg/kg body weight i.p.), no further tumor growth is observed in
the mAb B1-23-treated mice for one week, whereas the tumors in the
negative control samples continue growing.
[0166] This Example demonstrates that the mAb B1-23 antibody of the
present invention inhibits cancer growth in mice bearing tumors
derived from human cells.
[0167] Because this example uses human melanoma cells, the
anti-human GDF-15 antibodies of the present invention should also
inhibit cancer growth in a human patient. Inhibition of cancer
growth should be particularly effective if the patient has elevated
GDF-15 levels in blood serum before administration, or if the tumor
or tumors formed by the cancer have higher human GDF-15 levels
compared to a control sample of the same patient obtained from a
non-cancerous part of the tissue which is the tissue of origin of
the cancer.
[0168] The present Example uses immunodeficient mice. It is
therefore concluded that the antibodies of the present invention
are capable of inhibiting cancer growth in a manner that is
independent of an intact immune system.
[0169] In addition, it was shown above in Example 2 that the
anti-human GDF-15 antibodies of the present invention are capable
of preventing GDF-15 mediated downregulation of NKG2D and should be
capable of inducing the killing of cancer cells by NK cells and
CD8+ T cells. It is therefore expected that cancer growth
inhibition by anti-human GDF-15 antibodies is stronger in patients
than in the immunodeficient mice, since the patients do not have
the immune deficiencies of the mice used in the present
Example.
[0170] In an alternative experimental study setup, the following in
vivo study was carried out:
[0171] To assess an anti-tumor effect of B1-23 in vivo,
Balb/c.sup.nu/nu nude mice were used in a xenograft setting with
the melanoma cell line UACC-257. The mice were treated either with
the antibody B1-23 or with PBS. Each treatment cohort contained 10
Balb/c.sup.nu/nu nude mice.
[0172] Prior to injection, the UACC-257 melanoma cells were grown
in complete medium, excluding any contamination. The cells were
harvested when 70-80% confluence was reached in the cell culture
flask. Cells were then washed with PBS and counted.
1.times.10.sup.7 viable cells were suspended in PBS.
[0173] The first injection/treatment was administered in 6 week old
Balb/c.sup.nu/nu nude mice. The inoculation area of the mice was
cleaned with ethanol. The UACC 257 cells were mixed and drawn into
a syringe without a needle, in order to avoid negative pressure on
the tumor cells. The cell suspension containing 1.times.10.sup.7
cells in PBS was injected subcutaneously (s.c.) into the lower
flank of the mice.
[0174] The intraperitoneal (i.p.) injection of either B1-23 (25
mg/kg body weight) or the same volume of PBS started immediately
after the tumor cell inoculation (defined as day 1) and was
administered twice a week. The tumors were grown for 48 days. The
tumor diameters were measured with a caliper and the tumor volume
in mm3 was calculated by the formula:
Volume=(width).sup.2.times.length/2
[0175] The results which were obtained from the study are shown in
FIG. 4.
[0176] As demonstrated in the Figure, the tumor size of the animal
cohort treated with B1-23 was significantly decreased, compared to
the PBS control group.
Example 5: mAb B1-23 Recognizes a Conformational or a Discontinuous
Epitope of Human GDF-15
[0177] Epitope Mapping: Monoclonal mouse antibody GDF-15 against
13mer linear peptides derived from GDF-15
[0178] Antigen: GDF-15:
TABLE-US-00029 (322 amino acids with linker) (SEQ ID No: 10)
GSGSGSGMPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGP
SELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEV
RLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRR
QLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRR
RARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGA
CPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVS
LQTYDDLLAKDCHCIGSGSGSG
[0179] The protein sequence was translated into 13mer peptides with
a shift of one amino acid. The C- and N-termini were elongated by a
neutral GSGS linker to avoid truncated peptides (bold letters).
[0180] Control Peptides:
[0181] Flag: DYKDDDDKGG (SEQ ID No:13), 78 spots; HA: YPYDVPDYAG
(SEQ ID No:14), 78 spots (each array copy)
[0182] Peptide Chip Identifier:
[0183] 000264_01 (10/90, Ala2Asp linker)
[0184] Staining Conditions:
[0185] Standard buffer: PBS, pH 7.4+0.05%; Tween 20
[0186] Blocking buffer: Rockland blocking buffer MB-070
[0187] Incubation buffer: Standard buffer with 10% Rockland
blocking buffer MB-070
[0188] Primary sample: Monoclonal mouse antibody GDF-15 (1
.mu.g/.mu.l): Staining in incubation buffer for 16 h at 4.degree.
C. at a dilution of 1:100 and slight shaking at 500 rpm
[0189] Secondary antibody: Goat anti-mouse IgG (H+L) IRDye680,
staining in incubation buffer with a dilution of 1:5000 for 30 min
at room temperature (RT)
[0190] Control antibodies: Monoclonal anti-HA (12CA5)-LL-Atto 680
(1:1000), monoclonal anti-FLAG(M2)-FluoProbes752 (1:1000); staining
in incubation buffer for 1 h at RT
[0191] Scanner:
[0192] Odyssey Imaging System, LI-COR Biosciences
[0193] Settings: offset: 1 mm; resolution: 21 .mu.m; intensity
green/red: 7/7
[0194] Results:
[0195] After 30 min pre-swelling in standard buffer and 30 min in
blocking buffer, the peptide array with 10, 12 and 15mer
B7H3-derived linear peptides was incubated with secondary goat
anti-mouse IgG (H+L) IRDye680 antibody only at a dilution of 1:5000
for 1 h at room temperature to analyze background interactions of
the secondary antibody. The PEPperCHIP.RTM. was washed 2.times.1
min with standard buffer, rinsed with dist. water and dried in a
stream of air. Read-out was done with Odyssey Imaging System at a
resolution of 21 .mu.m and green/red intensities of 7/7: We
observed a weak interaction of arginine-rich peptides
(ELHLRPQAARGRR (SEQ ID No:15), LHLRPQAARGRRR (SEQ ID No:16),
HLRPQAARGRRRA (SEQ ID No:17), LRPQAARGRRRAR (SEQ ID No:18),
RPQAARGRRRARA (SEQ ID No:19), PQAARGRRRARAR (SEQ ID No:20) and
QAARGRRRARARN (SEQ ID No:21)) that are known as frequent binders,
and with the basic peptide MHAQIKTSLHRLK (SEQ ID No:22) due to
ionic interactions with the charged antibody dye.
[0196] After pre-swelling for 10 min in standard buffer, the
peptide microarray was incubated overnight at 4.degree. C. with
monoclonal mouse antibody GDF-15 at a dilution of 1:100. Repeated
washing in standard buffer (2.times.1 min) was followed by
incubation for 30 min with the secondary antibody at a dilution of
1:5000 at room temperature. After 2.times.10 sec. washing in
standard buffer and short rinsing with dist. water, the
PEPperCHIP.RTM. was dried in a stream of air. Read-out was done
with Odyssey Imaging System at a resolution of 21 .mu.m and
green/red intensities of 7/7 before and after staining of control
peptides by anti-HA and anti-FLAG(M2) antibodies.
[0197] It was shown that none of the linear 13mer peptides derived
from GDF-15 interacted with monoclonal mouse antibody GDF-15 even
at overregulated intensities. Staining of Flag and HA control
peptides that frame the array, however, gave rise to good and
homogeneous spot intensities.
SUMMARY
[0198] The Epitope Mapping of monoclonal mouse GDF-15 antibody
against GDF-15 did not reveal any linear epitope with the 13mer
peptides derived from the antigen. According to this finding it is
very likely that monoclonal mouse antibody GDF-recognizes a
conformational or a discontinuous epitope with low affinity of
partial epitopes. Due to the obvious absence of any GDF-15 signal
above the background staining of the secondary antibody only,
quantification of spot intensities with PepSlide.RTM. Analyzer and
subsequent peptide annotation were omitted.
Example 6: Structural Identification of Peptide Ligand Epitopes by
Mass Spectrometric Epitope Excision and Epitope Extraction
[0199] The epitope of recombinant human GDF-15 which binds to the
antibody B1-23 was identified by means of the epitope excision
method and epitope extraction method (Suckau et al. Proc Natl Acad
Sci USA. 1990 December; 87(24): 9848-9852; R. Stefanescu et al.,
Eur. J. Mass Spectrom. 13, 69-75 (2007)).
[0200] For preparation of the antibody column, the antibody B1-23
was added to NHS-activated 6-aminohexanoic acid coupled sepharose.
The sepharose-coupled antibody B1-23 was then loaded into a 0.8 ml
microcolumn and washed with blocking and washing buffers.
[0201] Epitope Extraction Experiment:
[0202] Recombinant human GDF-15 was digested with trypsin for 2 h
at 37.degree. C. (in solution), resulting in different peptides,
according to the trypsin cleavage sites in the protein. After
complete digestion, the peptides were loaded on the affinity column
containing the immobilized antibody B1-23. Unbound as well as
potentially bound peptides of GDF-15 were used for mass
spectrometry analysis. An identification of peptides by means of
mass spectrometry was not possible. This was a further indicator
that the binding region of GDF-15 in the immune complex B1-23
comprises a discontinuous or conformational epitope. In case of a
continuous linear epitope, the digested peptides should bind its
interaction partner, unless there was a trypsin cleavage site in
the epitope peptide. A discontinuous or conformational epitope
could be confirmed by the epitope excision method described in the
following part.
[0203] Epitope Excision Experiment:
[0204] The immobilized antibody B1-23 on the affinity column was
then incubated with recombinant GDF-15 for 2 h. The formed immune
complex on the affinity column was then incubated with trypsin for
2 h at 37.degree. C. The cleavage resulted in different peptides
derived from the recombinant GDF-15. The immobilized antibody
itself is proteolytically stable. The resulting peptides of the
digested GDF-15 protein, which were shielded by the antibody and
thus protected from proteolytic cleavage, were eluted under acidic
conditions (TFA, pH2), collected and identified by mass
spectrometry.
[0205] The epitope excision method using MS/MS identification
resulted in the following peptides:
TABLE-US-00030 Position in Peptide sequence Mass Ion/Charge
EVQVTMCIGACPSQFR 40-55 1769.91 590.50(3+) (SEQ ID No: 25)
TDTGVSLQTYDDLLAKDCHCI 94-114 2310.96 771:33(3+) (SEQ ID No: 26)
[0206] The part of human GDF-15, which binds the antibody B1-23,
comprises a discontinuous or conformational epitope. Mass
spectrometry identified 2 peptides in the GDF-15 protein, which are
responsible for the formation of the immune complex. These peptides
are restricted to the positions 40-(EVQVTMCIGACPSQFR) and 94-114
(TDTGVSLQTYDDLLAKDCHCI) in the GDF-15 amino acid sequence. Thus,
these two peptides comprise an epitope of the GDF-15 protein that
binds to the antibody B1-23.
G) INDUSTRIAL APPLICABILITY
[0207] The antibodies, antigen-binding portions thereof,
pharmaceutical compositions and kits according to the present
invention may be industrially manufactured and sold as products for
the claimed methods and uses (e.g. for treating cancer), in
accordance with known standards for the manufacture of
pharmaceutical products. Accordingly, the present invention is
industrially applicable.
REFERENCES
[0208] Arbabi Ghahroudi M et al.: "Selection and identification of
single domain antibody fragments from camel heavy-chain
antibodies." FEES Lett. 1997 Sep. 15; 414(3):521-6. [0209] Ausubel
et al.: "Current Protocols in Molecular Biology." Greene Publishing
Associates and Wiley Interscience; New York 1992. [0210] Bauskin A
R et al.: "The propeptide mediates formation of stromal stores of
PROMIC-1: role in determining prostate cancer outcome." Cancer Res.
2005 Mar. 15; 65(6):2330-6. [0211] Brown D A et al.: "Macrophage
inhibitory cytokine 1: a new prognostic marker in prostate cancer."
Clin Cancer Res. 2009 Nov. 1; 15(21):6658-64. [0212] Chothia C et
al.: Conformations of immunoglobulin hypervariable regions. Nature.
1989 Dec. 21-28; 342(6252):877-83. [0213] Clackson T et al.:
"Making antibody fragments using-phage display libraries." Nature.
1991 Aug. 15; 352(6336):624-8. [0214] Giudicelli V et al.:
IMGT/V-QUEST, an integrated software program for immunoglobulin and
T cell receptor V-J and V-D-J rearrangement analysis. Nucleic Acids
Res. 2004 Jul. 1; 32 (Web Server issue):W435-40. [0215] Harlow and
Lane: "Antibodies: A Laboratory Manual" Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y. 1988. [0216] Holliger P
et al.: ""Diabodies": small bivalent and bispecific antibody
fragments." Proc Natl Acad Sci USA. 1993 Jul. 15; 90(14):6444-8.
[0217] Holt L J et al.: "Domain antibodies: proteins for therapy."
Trends Biotechnol. 2003 November; 21(11):484-90. [0218] Huang C Y
et al.: "Molecular alterations in prostate carcinomas that
associate with in vivo exposure to chemotherapy: identification of
a cytoprotective mechanism involving growth differentiation factor
15." Clin Cancer Res. 2007 Oct. 1; 13(19):5825-33. [0219] Johnen E
et al.: "Tumor-induced anorexia and weight loss are mediated by the
TGF-beta superfamily cytokine MIC-1." Nat Med. 2007 November;
13(11):1333-40. [0220] Jones P T et al.: "Replacing the
complementarity-determining regions in a human antibody with those
from a mouse." Nature. 1986 May 29-Jun. 4; 321(6069):522-5. [0221]
Kabat et al.: Sequences of proteins of immunological interest, U.S.
Dept. of Health and Human Services, Public Health Service, National
Institutes of Health, Bethesda, Md. 1983. [0222] Kohler G and
Milstein C: "Continuous cultures of fused cells secreting antibody
of predefined specificity." Nature. 1975 Aug. 7; 256(5517):495-7.
[0223] Marks J D et al.: "By-passing immunization. Human antibodies
from V-gene libraries displayed on phage." J Mol Biol. 1991 Dec. 5;
222(3):581-97. [0224] Mimeault M and Batra S K: "Divergent
molecular mechanisms underlying the pleiotropic functions of
macrophage inhibitory cytokine-1 in cancer." J Cell Physiol. 2010
September; 224(3):626-35. [0225] Paul, W. E. (Ed.): "Fundamental
Immunology" 2nd Ed. Raven Press, Ltd., New York 1989. [0226]
Remington's Pharmaceutical Sciences, Ed. A R Gennaro, 20th edition,
2000, Williams & Wilkins, PA, USA. [0227] Riechmann L et al.:
"Reshaping human antibodies for therapy." Nature. 1988 Mar. 24;
332(6162):323-7. [0228] Roth P et al.: "GDF-15 contributes to
proliferation and immune escape of malignant gliomas." Clin Cancer
Res. 2010 Aug. 1; 16(15):3851-9. [0229] Saerens D et al.:
"Single-domain antibodies as building blocks for novel
therapeutics." Curr Opin Pharmacol. 2008 October; 8(5):600-8. Epub
2008 Aug. 22. [0230] Sambrook et al.: "Molecular Cloning: A
Laboratory Manual.", 2nd Ed., Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, N.Y. 1989. [0231] Siegel D L: "Recombinant
monoclonal antibody technology." Transfus Clin Biol. 2002 January;
9(1):15-22. [0232] Stefanescu R. et al., Eur. J. Mass Spectrom. 13,
69-75 (2007) [0233] Suckau et al. Proc Natl Acad Sci USA. 1990
December; 87(24): 9848-9852. [0234] Weinberg R. et al.: The Biology
of Cancer. Garland Science: New York 2006. 850p. [0235] WO
2005/099746 [0236] WO 2009/021293
PREFERRED EMBODIMENTS
[0236] [0237] 1. A monoclonal antibody capable of binding to human
GDF-15, or an antigen-binding portion thereof, wherein the heavy
chain variable domain comprises a CDR3 region comprising the amino
acid sequence of SEQ ID NO: 5 or an amino acid sequence at least
90% identical thereto, and wherein the light chain variable domain
comprises a CDR3 region comprising the amino acid sequence of SEQ
ID NO: 7 or an amino acid sequence at least 85% identical thereto.
[0238] 2. The monoclonal antibody or antigen-binding portion
thereof according to item 1, wherein the heavy chain variable
domain comprises a CDR3 region comprising the amino acid sequence
of SEQ ID NO: 5, or wherein the light chain variable domain
comprises a CDR3 region comprising the amino acid sequence of SEQ
ID NO: 7. [0239] 3. The monoclonal antibody or antigen-binding
portion thereof according to item 1 or 2, wherein the heavy chain
variable domain comprises a CDR3 region comprising the amino acid
sequence of SEQ ID NO: 5, and wherein the light chain variable
domain comprises a CDR3 region comprising the amino acid sequence
of SEQ ID NO: 7. [0240] 4. The monoclonal antibody or
antigen-binding portion thereof according to any one of items 1 to
3, wherein the heavy chain variable domain comprises a region
comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region and
comprising the amino acid sequence of SEQ ID NO: 1 or a sequence
95% identical thereto, and wherein the light chain variable domain
comprises a region comprising an FR1, a CDR1, an FR2, a CDR2 and an
FR3 region and comprising the amino acid sequence of SEQ ID NO: 2
or a sequence 95% identical thereto. [0241] 5. The monoclonal
antibody or antigen-binding portion thereof according to any one of
items 1 to 4, wherein the heavy chain variable domain comprises a
region comprising an FR1, a CDR1, an FR2, a CDR2 and an FR3 region
and comprising the amino acid sequence of SEQ ID NO: 1 or a
sequence 98% identical thereto, and wherein the light chain
variable domain comprises a region comprising an FR1, a CDR1, an
FR2, a CDR2 and an FR3 region and comprising the amino acid
sequence of SEQ ID NO: 2 or a sequence 98% identical thereto.
[0242] 6. The monoclonal antibody or antigen-binding portion
thereof according to any one of items 1 to 5, wherein the antibody
or antigen-binding portion thereof has an equilibrium dissociation
constant for human GDF-15 that is equal to or less than 20 nM,
preferably less than 10 nM, more preferably less than 5 nM and most
preferably between 0.1 nM and 2 nM. [0243] 7. The monoclonal
antibody or antigen-binding portion thereof according to any one of
items 1 to 6, wherein the antibody or antigen-binding portion
thereof binds to the same human GDF-15 epitope as the antibody to
human GDF-15 obtainable from the cell line B1-23 deposited with the
Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ)
under the accession No. DSM ACC3142. [0244] 8. The monoclonal
antibody or antigen-binding portion thereof according to any one of
items 1 to 7, wherein the antibody is the antibody to human GDF-15
obtainable from the cell line B1-23 deposited with the Deutsche
Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ) under the
accession No. DSM ACC3142 or an antigen-binding portion thereof.
[0245] 9. The monoclonal antibody or antigen-binding portion
thereof of any one of items 1-8, wherein the antibody is capable of
inhibiting cancer growth in a mammal, preferably a human patient.
[0246] 10. The monoclonal antibody or antigen-binding portion
thereof of any one of items 1-9, wherein the human GDF-15 is
recombinant human GDF-15 having the amino acid sequence represented
by SEQ ID No: 8. [0247] 11. The monoclonal antibody or
antigen-binding portion thereof of any one of items 1-10, wherein
the binding is binding to a conformational or discontinuous epitope
on human GDF-15. [0248] 12. The monoclonal antibody or
antigen-binding portion thereof of item 11, wherein the binding to
a conformational or discontinuous epitope on human GDF-15 is
binding to a conformational or discontinuous epitope comprised by
the amino acid sequences of SEQ ID No: 25 and SEQ ID No: 26. [0249]
13. A monoclonal antibody capable of binding to human GDF-15, or an
antigen-binding portion thereof, wherein the binding is binding to
a conformational or discontinuous epitope on human GDF-15 comprised
by the amino acid sequences of SEQ ID No: 25 and SEQ ID No: 26.
[0250] 14. The monoclonal antibody or antigen-binding portion
thereof of item 13, wherein the antibody or antigen-binding portion
thereof is an antibody or antigen-binding portion thereof as
defined in any one of items 1-10. [0251] 15. A pharmaceutical
composition comprising the antibody or antigen-binding portion
thereof according to any one of items 1 to 14. [0252] 16. An
antibody or antigen-binding portion thereof according to any one of
items 1 to 14 or a pharmaceutical composition according to item 15
for use in a method for treating cancer in a mammal, the method
comprising administering the antibody or antigen-binding portion
thereof or the pharmaceutical composition to said mammal. [0253]
17. The antibody or antigen-binding portion thereof or the
pharmaceutical composition according to item 16 for the use
according to item 16, wherein the mammal is human patient. [0254]
18. The antibody or antigen-binding portion thereof or the
pharmaceutical composition according to item 17 for the use
according to item 17, wherein the human patient has elevated GDF-15
levels in blood serum before administration. [0255] 19. The
antibody or antigen-binding portion thereof or the pharmaceutical
composition according to any one of items 16 to 18 for the use
according to any one of items 16 to 18, wherein the antibody or
antigen-binding portion thereof is [0256] A) the sole ingredient
pharmaceutically active against cancer used in the method, or
[0257] B) used in combination with one or more further ingredients
pharmaceutically active against cancer. [0258] 20. The antibody or
antigen-binding portion thereof or the pharmaceutical composition
according to any one of items 16 to 19 for the use according to any
one of items 16 to 19, wherein the cancer is selected from the
group consisting of brain cancers including glioma, cancers of the
nervous system, melanoma, lung cancer, lip and oral cavity cancer,
hepatic carcinoma, leukemia, Hodgkin lymphoma, Non-Hodgkin
lymphoma, bladder cancer, cervix uteri cancer, corpus uteri cancer,
testis cancer, thyroid cancer, kidney cancer, gallbladder cancer,
multiple myeloma, nasopharynx cancer, larynx cancer, pharynx
cancer, esophagus cancer, gastrointestinal tumors including stomach
and colorectal cancer, pancreatic cancer, prostate cancer, ovarian
cancer and breast cancer, preferably from the group consisting of
melanoma, prostate cancer, breast cancer, brain cancers including
glioma, colorectal cancer, stomach cancer, esophagus cancer and
ovarian cancer, and most preferably is melanoma. [0259] 21. The
antibody or antigen-binding portion thereof or the pharmaceutical
composition according to any one of items 17 to 20 for the use
according to any one of items 17 to 20, wherein prior to
administration, the tumor or tumors formed by the cancer have
higher human GDF-15 levels compared to a control sample of the same
patient obtained from a non-cancerous part of the tissue which is
the tissue of origin of the cancer, preferably 1.2-fold higher
levels, more preferably 1.5-fold higher levels, still more
preferably 2-fold higher levels and most preferably 5-fold higher
levels. [0260] 22. itemitemThe antibody or antigen-binding portion
thereof or the pharmaceutical composition according to any one of
items 16 to 21 for the use according to any one of items 16 to 21,
wherein the method comprises inhibiting cancer growth. [0261] 23.
The antibody or antigen-binding portion thereof or the
pharmaceutical composition according to any one of items 17 to 22
for the use according to any one of items 17 to 22, wherein the
method comprises the induction of killing of cancer cells by NK
cells and CD8+ T cells in the human patient. [0262] 24. A kit
comprising the pharmaceutical composition of item 15. [0263] 25.
The kit of item 24 for a use according to any one of items 16 to
23. [0264] 26. An expression vector comprising a nucleotide
sequence encoding the antibody or antigen-binding portion thereof
according to any of items 1-14. [0265] 27. A cell line capable of
producing an antibody or antigen-binding portion thereof according
to any one of items 1 to 14. [0266] 28. The cell line according to
item 27, wherein the cell line is the cell line B1-23 deposited
with the Deutsche Sammlung fur Mikroorganismen and Zellkulturen
GmbH (DMSZ) under the accession No. DSM ACC3142. [0267] 29. The
cell line according to item 27, wherein the cell line contains an
expression vector according to item 26.
Sequence CWU 1
1
26197PRTMus musculus 1Gln Val Lys Leu Gln Gln Ser Gly Pro Gly Ile
Leu Gln Ser Ser Gln 1 5 10 15 Thr Leu Ser Leu Thr Cys Ser Phe Ser
Gly Phe Ser Leu Ser Thr Ser 20 25 30 Gly Met Gly Val Ser Trp Ile
Arg Gln Pro Ser Gly Lys Gly Leu Glu 35 40 45 Trp Leu Ala His Ile
Tyr Trp Asp Asp Asp Lys Arg Tyr Asn Pro Thr 50 55 60 Leu Lys Ser
Arg Leu Thr Ile Ser Lys Asp Pro Ser Arg Asn Gln Val 65 70 75 80 Phe
Leu Lys Ile Thr Ser Val Asp Thr Ala Asp Thr Ala Thr Tyr Tyr 85 90
95 Cys 288PRTMus musculus 2Asp Ile Val Leu Thr Gln Ser Pro Lys Phe
Met Ser Thr Ser Val Gly 1 5 10 15 Asp Arg Val Ser Val Thr Cys Lys
Ala Ser Gln Asn Val Gly Thr Asn 20 25 30 Val Ala Trp Phe Leu Gln
Lys Pro Gly Gln Ser Pro Lys Ala Leu Ile 35 40 45 Tyr Ser Ala Ser
Tyr Arg Tyr Ser Gly Val Pro Asp Arg Phe Thr Gly 50 55 60 Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Val Gln Ser 65 70 75 80
Glu Asp Leu Ala Glu Tyr Phe Cys 85 310PRTMus musculus 3Gly Phe Ser
Leu Ser Thr Ser Gly Met Gly 1 5 10 47PRTMus musculus 4Ile Tyr Trp
Asp Asp Asp Lys 1 5 510PRTMus musculus 5Ala Arg Ser Ser Tyr Gly Ala
Met Asp Tyr 1 5 10 66PRTMus musculus 6Gln Asn Val Gly Thr Asn 1 5
79PRTMus musculus 7Gln Gln Tyr Asn Asn Phe Pro Tyr Thr 1 5
8114PRTArtificial Sequencerecombinant mature human GDF-15 protein
8Gly Ser Ala Arg Asn Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys 1
5 10 15 Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp
Ala 20 25 30 Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met
Cys Ile Gly 35 40 45 Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met
His Ala Gln Ile Lys 50 55 60 Thr Ser Leu His Arg Leu Lys Pro Asp
Thr Val Pro Ala Pro Cys Cys 65 70 75 80 Val Pro Ala Ser Tyr Asn Pro
Met Val Leu Ile Gln Lys Thr Asp Thr 85 90 95 Gly Val Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His 100 105 110 Cys Ile
9308PRTHomo sapiens 9Met Pro Gly Gln Glu Leu Arg Thr Val Asn Gly
Ser Gln Met Leu Leu 1 5 10 15 Val Leu Leu Val Leu Ser Trp Leu Pro
His Gly Gly Ala Leu Ser Leu 20 25 30 Ala Glu Ala Ser Arg Ala Ser
Phe Pro Gly Pro Ser Glu Leu His Ser 35 40 45 Glu Asp Ser Arg Phe
Arg Glu Leu Arg Lys Arg Tyr Glu Asp Leu Leu 50 55 60 Thr Arg Leu
Arg Ala Asn Gln Ser Trp Glu Asp Ser Asn Thr Asp Leu 65 70 75 80 Val
Pro Ala Pro Ala Val Arg Ile Leu Thr Pro Glu Val Arg Leu Gly 85 90
95 Ser Gly Gly His Leu His Leu Arg Ile Ser Arg Ala Ala Leu Pro Glu
100 105 110 Gly Leu Pro Glu Ala Ser Arg Leu His Arg Ala Leu Phe Arg
Leu Ser 115 120 125 Pro Thr Ala Ser Arg Ser Trp Asp Val Thr Arg Pro
Leu Arg Arg Gln 130 135 140 Leu Ser Leu Ala Arg Pro Gln Ala Pro Ala
Leu His Leu Arg Leu Ser 145 150 155 160 Pro Pro Pro Ser Gln Ser Asp
Gln Leu Leu Ala Glu Ser Ser Ser Ala 165 170 175 Arg Pro Gln Leu Glu
Leu His Leu Arg Pro Gln Ala Ala Arg Gly Arg 180 185 190 Arg Arg Ala
Arg Ala Arg Asn Gly Asp His Cys Pro Leu Gly Pro Gly 195 200 205 Arg
Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly 210 215
220 Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys
225 230 235 240 Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met
His Ala Gln 245 250 255 Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp
Thr Val Pro Ala Pro 260 265 270 Cys Cys Val Pro Ala Ser Tyr Asn Pro
Met Val Leu Ile Gln Lys Thr 275 280 285 Asp Thr Gly Val Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp 290 295 300 Cys His Cys Ile 305
10322PRTArtificial Sequencehuman GDF-15 precursor protein +
N-terminal and C-terminal GSGS linker 10Gly Ser Gly Ser Gly Ser Gly
Met Pro Gly Gln Glu Leu Arg Thr Val 1 5 10 15 Asn Gly Ser Gln Met
Leu Leu Val Leu Leu Val Leu Ser Trp Leu Pro 20 25 30 His Gly Gly
Ala Leu Ser Leu Ala Glu Ala Ser Arg Ala Ser Phe Pro 35 40 45 Gly
Pro Ser Glu Leu His Ser Glu Asp Ser Arg Phe Arg Glu Leu Arg 50 55
60 Lys Arg Tyr Glu Asp Leu Leu Thr Arg Leu Arg Ala Asn Gln Ser Trp
65 70 75 80 Glu Asp Ser Asn Thr Asp Leu Val Pro Ala Pro Ala Val Arg
Ile Leu 85 90 95 Thr Pro Glu Val Arg Leu Gly Ser Gly Gly His Leu
His Leu Arg Ile 100 105 110 Ser Arg Ala Ala Leu Pro Glu Gly Leu Pro
Glu Ala Ser Arg Leu His 115 120 125 Arg Ala Leu Phe Arg Leu Ser Pro
Thr Ala Ser Arg Ser Trp Asp Val 130 135 140 Thr Arg Pro Leu Arg Arg
Gln Leu Ser Leu Ala Arg Pro Gln Ala Pro 145 150 155 160 Ala Leu His
Leu Arg Leu Ser Pro Pro Pro Ser Gln Ser Asp Gln Leu 165 170 175 Leu
Ala Glu Ser Ser Ser Ala Arg Pro Gln Leu Glu Leu His Leu Arg 180 185
190 Pro Gln Ala Ala Arg Gly Arg Arg Arg Ala Arg Ala Arg Asn Gly Asp
195 200 205 His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr
Val Arg 210 215 220 Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val
Leu Ser Pro Arg 225 230 235 240 Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg 245 250 255 Ala Ala Asn Met His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 260 265 270 Pro Asp Thr Val Pro
Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 275 280 285 Met Val Leu
Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 290 295 300 Asp
Asp Leu Leu Ala Lys Asp Cys His Cys Ile Gly Ser Gly Ser Gly 305 310
315 320 Ser Gly 1110PRTArtificial SequenceFlag peptide 11Asp Tyr
Lys Asp Asp Asp Asp Lys Gly Gly 1 5 10 1210PRTArtificial SequenceHA
peptide 12Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Gly 1 5 10
1313PRTArtificial Sequencepeptide derived from human GDF-15 13Glu
Leu His Leu Arg Pro Gln Ala Ala Arg Gly Arg Arg 1 5 10
1413PRTArtificial Sequencepeptide derived from human GDF-15 14Leu
His Leu Arg Pro Gln Ala Ala Arg Gly Arg Arg Arg 1 5 10
1513PRTArtificial Sequencepeptide derived from human GDF-15 15His
Leu Arg Pro Gln Ala Ala Arg Gly Arg Arg Arg Ala 1 5 10
1613PRTArtificial Sequencepeptide derived from human GDF-15 16Leu
Arg Pro Gln Ala Ala Arg Gly Arg Arg Arg Ala Arg 1 5 10
1713PRTArtificial Sequencepeptide derived from human GDF-15 17Arg
Pro Gln Ala Ala Arg Gly Arg Arg Arg Ala Arg Ala 1 5 10
1813PRTArtificial Sequencepeptide derived from human GDF-15 18Pro
Gln Ala Ala Arg Gly Arg Arg Arg Ala Arg Ala Arg 1 5 10
1913PRTArtificial Sequencepeptide derived from human GDF-15 19Gln
Ala Ala Arg Gly Arg Arg Arg Ala Arg Ala Arg Asn 1 5 10
2013PRTArtificial Sequencepeptide derived from human GDF-15 20Met
His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys 1 5 10 21291DNAMus
musculus 21caagtgaagc tgcagcagtc aggccctggg atattgcagt cctcccagac
cctcagtctg 60acttgttctt tctctgggtt ttcactgagt acttctggta tgggtgtgag
ctggattcgt 120cagccttcag gaaagggtct ggagtggctg gcacacattt
actgggatga tgacaagcgc 180tataacccaa ccctgaagag ccggctcaca
atctccaagg atccctccag aaaccaggta 240ttcctcaaga tcaccagtgt
ggacactgca gatactgcca catactactg t 29122264DNAMus musculus
22gacattgtgc tcacccagtc tccaaaattc atgtccacat cagtaggaga cagggtcagc
60gtcacctgca aggccagtca gaatgtgggt actaatgtgg cctggtttct acagaaacca
120gggcaatctc ctaaagcact tatttactcg gcatcctacc ggtacagtgg
agtccctgat 180cgcttcacag gcagtggatc tgggacagat ttcactctca
ccatcagcaa cgtgcagtct 240gaagacttgg cagagtattt ctgt 2642330DNAMus
musculus 23gctcgaagtt cctacggggc aatggactac 302427DNAMus musculus
24cagcaatata acaactttcc gtacacg 272516PRTHomo sapiens 25Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg 1 5 10 15
2621PRTHomo sapiens 26Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp
Asp Leu Leu Ala Lys 1 5 10 15 Asp Cys His Cys Ile 20
* * * * *