U.S. patent application number 15/562671 was filed with the patent office on 2018-10-18 for plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack.
This patent application is currently assigned to Dyax Corp.. The applicant listed for this patent is Dyax Corp., SYNVINA C.V.. Invention is credited to Burt Adelman, Yung Chyung, Daniel J. Sexton.
Application Number | 20180298110 15/562671 |
Document ID | / |
Family ID | 57005262 |
Filed Date | 2018-10-18 |
United States Patent
Application |
20180298110 |
Kind Code |
A1 |
Chyung; Yung ; et
al. |
October 18, 2018 |
PLASMA KALLIKREIN INHIBITORS AND USES THEREOF FOR PREVENTING
HEREDITARY ANGIOEDEMA ATTACK
Abstract
Provided herein are plasma kallikrein antibodies binding to
active plasma kallikrein and methods of using such antibodies in
preventing hereditary angioedema attack or reducing the rate of
hereditary angioedema attack.
Inventors: |
Chyung; Yung; (Lexington,
MA) ; Adelman; Burt; (Concord, MA) ; Sexton;
Daniel J.; (Melrose, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Dyax Corp.
SYNVINA C.V. |
Burlington
Amsterdam |
MA |
US
NL |
|
|
Assignee: |
Dyax Corp.
Burlington
MA
|
Family ID: |
57005262 |
Appl. No.: |
15/562671 |
Filed: |
March 30, 2016 |
PCT Filed: |
March 30, 2016 |
PCT NO: |
PCT/US16/24921 |
371 Date: |
September 28, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62140289 |
Mar 30, 2015 |
|
|
|
62140277 |
Mar 30, 2015 |
|
|
|
62214293 |
Sep 4, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 7/10 20180101; C07K
2317/76 20130101; C07K 2317/21 20130101; C07K 16/40 20130101; A61K
2039/505 20130101; A61K 2039/54 20130101; C07K 2317/565 20130101;
C07K 2317/94 20130101; A61K 2039/545 20130101 |
International
Class: |
C07K 16/40 20060101
C07K016/40; A61P 7/10 20060101 A61P007/10 |
Claims
1.-41. (canceled)
42. An aqueous formulation comprising sodium phosphate, citric
acid, histidine, sodium chloride, polysorbate 80, and an antibody
that binds to the same epitope as DX-2930 or competes against
DX-2930 for binding to active plasma kallikrein.
43. The aqueous formulation of claim 42, which has a pH of 6.0.
44. The aqueous formulation of claim 42, which comprises: about 30
mM of the sodium phosphate; about 50 mM of the histidine; about 90
mM of the sodium chloride; and about 0.1% of the polysorbate
80.
45. The aqueous formulation of claim 42, wherein the antibody
comprises the same heavy chain and light chain complementary
determining regions (CDRs) as DX-2930.
46. The aqueous formulation of claim 42, wherein the antibody
comprises the same heavy chain variable domain and light chain
variable domain as DX-2930.
47. The aqueous formulation of claim 42, wherein the antibody is a
full length antibody or an antigen-binding fragment thereof.
48. The aqueous formulation of claim 47, wherein the antibody is an
IgG molecule.
49. The aqueous formulation of claim 48, wherein the antibody is an
IgG1 molecule.
50. The formulation of claim 47, wherein the antibody is
DX-2930.
51. A method of preventing hereditary angioedema (HAE) attack or
reducing the rate of HAE attack, the method comprising
administering to a subject in need thereof the aqueous formulation
of claim 42.
52. The method of claim 51, wherein the subject is a human patient
having type I or type II HAE.
53. The method of claim 51, wherein the subject is a human patient
experiencing at least two HAE attacks per year prior to the
treatment.
54. The method of claim 53, wherein the human patient had at least
one HAE attack within 6 months prior to the first
administration.
55. The method of claim 53, wherein the human patient had at least
2 HAE attacks within 3 months prior to the first
administration.
56. The method of claim 55, wherein the human patient had at least
9 HAE attacks within 3 months prior to the first
administration.
57. The method of claim 51, wherein the aqueous formulation is
administered to the subject once every two to four weeks.
58. The method of claim 57, wherein the aqueous formulation is
administered to the subject every two weeks.
59. The method of claim 57, wherein the aqueous formulation is
administered to the subject every four weeks.
60. The method of claim 51, wherein the aqueous formulation is
administered subcutaneously.
61. The method of claim 51, wherein the aqueous formulation
comprises a dose of the antibody that is 100 to 300 mg.
62. The method of claim 61, wherein the dose of the antibody is 300
mg.
Description
RELATED APPLICATIONS
[0001] This application is a national stage filing under 35 U.S.C.
.sctn. 371 of international application number PCT/US2016/024921,
filed Mar. 30, 2016, which was published under PCT Article 21(2) in
English and claims the benefit under 35 U.S.C. .sctn. 119(e) of
U.S. provisional application No. 62/140,277, filed Mar. 30, 2015,
U.S. provisional application No. 62/214,293, filed Sep. 24, 2015
and U.S. provisional application No. 62/140,289, filed Mar. 30,
2015, the contents of each of which are herein incorporated by
reference in its entirety.
BACKGROUND
[0002] Plasma kallikrein is a serine protease component of the
contact system and a potential drug target for different
inflammatory, cardiovascular, infectious (sepsis) and oncology
diseases (Sainz I. M. et al., Thromb Haemost 98, 77-83, 2007). The
contact system is activated by either factor XIIa upon exposure to
foreign or negatively charged surfaces or on endothelial cell
surfaces by prolylcarboxypeptidases (Sainz I. M. et al., Thromb
Haemost 98, 77-83, 2007). Activation of the plasma kallikrein
amplifies intrinsic coagulation via its feedback activation of
factor XII and enhances inflammation via the production of the
proinflammatory nonapeptide bradykinin. As the primary kininogenase
in the circulation, plasma kallikrein is largely responsible for
the generation of bradykinin in the vasculature. A genetic
deficiency in the C1-inhibitor protein (C1-INH), the major natural
inhibitor of plasma kallikrein, leads to hereditary angioedema
(HAE). Patients with HAE suffer from acute attacks of painful edema
often precipitated by unknown triggers (Zuraw B. L. et al., N Engl
J Med 359, 1027-1036, 2008).
SUMMARY
[0003] The present disclosure is, in part, based on the results
derived from clinical studies showing that doses of DX-2930, an
antibody binding to the active form of human plasma kallikrein,
(e.g., 30 mg, 100 mg, 300 mg or 400 mg administered every two
weeks) showed unexpected effectiveness in preventing HAE attack or
reducing the rate of HAE attack in human patients. Further, DX-2930
treatment did not show evidence of dose-limiting toxicity when
administered to humans. Overall, the results obtained from the
instant study were unexpected since DX-2930 is the first completely
specific plasma kallikrein inhibitor that has shown high efficacy
in HAE treatment. This demonstrates that plasma kallikrein is
central to disease pathogenesis.
[0004] Accordingly, one aspect of the present disclosure features a
method of preventing HAE attack or reducing the rate of HAE attack
(e.g., type I, II, or III HAE), the method comprising administering
to a subject in need thereof an antibody binding to the active form
of human plasma kallikrein (e.g., DX-2930) in an effective amount
(e.g., about 30 mg-400 mg, about 100 mg-400 mg, about 100 mg-300
mg, or about 300 mg-400 mg). In some embodiments, the antibody is
administered every two to four weeks for at least two times. In
some embodiments, the antibody is administered at 300 mg or 400 mg
every 2 weeks to four weeks (e.g., every two weeks or every four
weeks).
[0005] In any one of the methods described herein, the antibody can
be administered by subcutaneous administration. In some
embodiments, the subject is a human patient experiencing at least
two HAE attack per year (e.g., at least one HAE attack within 6
month prior to the first administration, at least 2 HAE attacks
within 3 months prior to the first administration, or at least 9
HAE attacks within 3 months prior to the first administration). The
HAE can be type I HAE or type II HAE. For example, the method
described herein is for prophylactic treatment of HAE.
[0006] The antibody used in any of the methods described herein may
be an antibody (e.g., a full-length antibody or an antigen-binding
fragment) that binds the same epitope as DX-2930 or competes
against DX-2930 for binding to active human plasma kallikrein. In
some embodiments, the antibody comprises the same heavy chain and
light chain CDRs. In one example, the antibody is DX-2930. Any of
the antibody as described herein (e.g., DX-2930) may be formulated
in a pharmaceutical composition, which comprises a pharmaceutically
acceptable carrier. In some examples, the pharmaceutical
composition comprises sodium phosphate, citric acid, histidine,
sodium chloride, and Tween 80. In one example, the antibody (e.g.,
DX-2930) is formulated in 30 mM sodium phosphate, 8.6 mM citric
acid, 50 mM histidine, 90 mM sodium chloride, and 0.01% Tween 80,
pH 6.0.
[0007] In yet other aspects, the present disclosure features a
method of treating HAE (e.g., type I, II, or III), the method
comprising administering to a subject in need thereof an antibody
binding to the active form of human plasma kallikrein (e.g.,
DX-2930) in an effective amount (e.g., 100-400 mg, 100-300 mg, 150
mg or 300 mg), wherein the DX-2930 antibody is administered in a
dosage regimen having a loading period (e.g., first administered
every week such as for at least one week), a maintenance period
(e.g., subsequently administered every two to four weeks), and
optionally a follow-on period.
[0008] In some embodiments, the antibody is administered to the
subject at 100 to 300 mg (e.g., 150 mg or 300 mg) during the
loading period. The loading period may be two weeks. The antibody
may be administered at day 0, day 7, and day 14 at, e.g., 150 mg or
300 mg.
[0009] Alternatively or in addition, the antibody is administered
to the subject at 100 to 300 mg (e.g., 150 mg or 300 mg) during the
maintenance period. The maintenance period may last for 10 weeks.
The antibody can be administered at day 28, day 42, day 56, day 70
and day 84.
[0010] In any of the methods described herein, the method may
further comprise administering to the subject the antibody after
the maintenance period once every two to four weeks (e.g., every
two weeks or every four weeks). In some examples, the antibody is
administered at 100 to 400 mg (e.g., 100 mg to 300 mg, for example,
150 mg or 300 mg).
[0011] In some embodiments of any one of the methods described
herein, the antibody can be administered by subcutaneous
administration. In some embodiments, the subject is a human patient
suffering from, suspected of having, or at risk for HAE attack. For
example, the method described herein is for prophylactic treatment
of HAE. The subject may be a human patient who experienced at least
2 attacks per year (e.g., at least one attack per 4 weeks) prior to
the treatment. In some embodiments, the antibody is administered
for preventing HAE attack or for reducing the rate of HAE
attack.
[0012] In some embodiments, the antibody (e.g., DX-2930) is first
administered every week for one, two or three weeks and
subsequently administered every two, three or four weeks. In some
embodiments, the antibody (e.g., DX-2930) is subsequently
administered every two weeks for ten weeks. In some embodiments,
the subject has at least one attack every four weeks prior to the
first administration.
[0013] The antibody to be used in any of the methods described
herein may be an antibody that binds the same epitope as DX-2930 or
competes against DX-2930 for binding to active human plasma
kallikrein. In some embodiments, the antibody comprises the same
heavy chain and light chain CDRs. In one example, the antibody is
DX-2930.
[0014] Also within the scope of the present disclosure are (a)
pharmaceutical compositions for use in treating HAE (e.g.,
preventing HAE attack or reducing the rate of HAE attack), the
pharmaceutical composition comprising any of the anti-kallikrein
antibodies described herein and a pharmaceutically acceptable
carrier, wherein the pharmaceutical composition is administered to
a subject following any of the treatment regimens described herein;
and (b) use of the pharmaceutical composition for manufacturing a
medicament for the treatment of HAE. Use of the antibodies for the
intended purposes could be performed under the treating regimens as
described herein.
[0015] The details of one or more embodiments of the invention are
set forth in the description below. Other features or advantages of
the present invention will be apparent from the following drawings
and detailed description of several embodiments, and also from the
appended claims.
BRIEF DESCRIPTION OF DRAWINGS
[0016] FIG. 1 shows DX-2930 plasma drug levels following
subcutaneous dosing in HAE patients in the phase 1b study.
[0017] FIG. 2 shows fluorogenic activity assay of HAE patient
samples from the phase 1b study.
[0018] FIG. 3 is a Western blot analysis of SCAT169 plasma from HAE
patients from the phase 1b study.
[0019] FIG. 4 is a Western blot analysis of citrated plasma from
HAE patients from the phase 1b study.
[0020] FIG. 5 is a Western blot analysis of citrated plasma
activated ex vivo with FXIIa from HAE patients from the phase 1b
study.
[0021] FIG. 6 shows the primary efficacy assessment period for
patients in different dosing cohorts. A.: 300 mg cohort. B.: 400 mg
cohort. Red bars show the interval assessed for efficacy.
[0022] FIG. 7 shows the reduction in HAE attack rate in patients
treated with 300 mg, 400 mg, combined (300 and 400 mg) or placebo.
Baseline was defined as historical HAE attacks over last 3 months
prior to dosing. The data includes patients with a baseline rate of
.gtoreq.2 attacks in the last 3 months. Day 8 to 50 attack rates
were unadjusted for baseline rates. Percent reduction in HAE attack
rate over placebo and p-value were calculated based upon Mixed
Model Repeated Measurements with Analysis of Variance (baseline
attack rate as covariate) and assuming Poisson distribution.
[0023] FIG. 8 shows the incidence of HAE attacks in placebo-treated
subjects. The X-axis shows the study day number.
[0024] FIG. 9 shows the mean DX-2930 concentration and HAE attack
incidence following 30 mg dosage.
[0025] FIG. 10 shows the mean DX-2930 concentration and HAE attack
incidence following 100 mg dosage.
[0026] FIG. 11 shows the mean DX-2930 concentration and HAE attack
incidence following 300 mg dosage.
[0027] FIG. 12 shows the mean DX-2930 concentration and HAE attack
incidence following 400 mg dosage. Excludes one patient who
received only one dose (in order to derive the mean pharmacokinetic
curve).
[0028] FIG. 13 shows DX-2930 concentration and HAE attacks in
patients with historical attack rate .gtoreq.9 attacks/3 months.
A.: a placebo patient. B.: a patient treated with 300 mg. and
C.-F.: patients treated with 400 mg.
[0029] FIG. 14 shows an exemplary dosing regimen comprising a
loading period and a maintenance period, which may be followed by
an extended treatment period or a washout period.
DETAILED DESCRIPTION
Definitions
[0030] For convenience, before further description of the present
invention, certain terms employed in the specification, examples
and appended claims are defined here. Other terms are defined as
they appear in the specification.
[0031] The singular forms "a", "an", and "the" include plural
references unless the context clearly dictates otherwise.
[0032] The term "antibody" refers to a protein that includes at
least one immunoglobulin variable domain (variable region) or
immunoglobulin variable domain (variable region) sequence. For
example, an antibody can include a heavy (H) chain variable region
(abbreviated herein as VH or HV), and a light (L) chain variable
region (abbreviated herein as VL or LV). In another example, an
antibody includes two heavy (H) chain variable regions and two
light (L) chain variable regions. The term "antibody" encompasses
antigen-binding fragments of antibodies (e.g., single chain
antibodies, Fab and sFab fragments, F(ab').sub.2, Fd fragments, Fv
fragments, scFv, and domain antibodies (dAb) fragments (de Wildt et
al., Eur J Immunol. 1996; 26(3):629-39)) as well as complete
antibodies. An antibody can have the structural features of IgA,
IgG, IgE, IgD, IgM (as well as subtypes thereof). Antibodies may be
from any source, but primate (human and non-human primate) and
primatized are preferred.
[0033] The VH and VL regions can be further subdivided into regions
of hypervariability, termed "complementarity determining regions"
("CDRs"), interspersed with regions that are more conserved, termed
"framework regions" ("FRs"). The extent of the framework region and
CDRs have been defined (see, Kabat, E. A., et al. (1991) Sequences
of Proteins of Immunological Interest, Fifth Edition, U.S.
Department of Health and Human Services, NIH Publication No.
91-3242, and Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917).
Kabat definitions are used herein. Each VH and VL is typically
composed of three CDRs and four FRs, arranged from amino-terminus
to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2,
FR3, CDR3, FR4.
[0034] As used herein, an "immunoglobulin variable domain sequence"
refers to an amino acid sequence which can form the structure of an
immunoglobulin variable domain such that one or more CDR regions
are positioned in a conformation suitable for an antigen binding
site. For example, the sequence may include all or part of the
amino acid sequence of a naturally-occurring variable domain. For
example, the sequence may omit one, two or more N- or C-terminal
amino acids, internal amino acids, may include one or more
insertions or additional terminal amino acids, or may include other
alterations. In one embodiment, a polypeptide that includes
immunoglobulin variable domain sequence can associate with another
immunoglobulin variable domain sequence to form an antigen binding
site, e.g., a structure that preferentially interacts with plasma
kallikrein.
[0035] The V.sub.H or V.sub.L chain of the antibody can further
include all or part of a heavy or light chain constant region, to
thereby form a heavy or light immunoglobulin chain, respectively.
In one embodiment, the antibody is a tetramer of two heavy
immunoglobulin chains and two light immunoglobulin chains, wherein
the heavy and light immunoglobulin chains are inter-connected by,
e.g., disulfide bonds. In IgGs, the heavy chain constant region
includes three immunoglobulin domains, CH1, CH2 and CH3. The light
chain constant region includes a CL domain. The variable region of
the heavy and light chains contains a binding domain that interacts
with an antigen. The constant regions of the antibodies typically
mediate the binding of the antibody to host tissues or factors,
including various cells of the immune system (e.g., effector cells)
and the first component (C1q) of the classical complement system.
The light chains of the immunoglobulin may be of types kappa or
lambda. In one embodiment, the antibody is glycosylated. An
antibody can be functional for antibody-dependent cytotoxicity
and/or complement-mediated cytotoxicity.
[0036] One or more regions of an antibody can be human or
effectively human. For example, one or more of the variable regions
can be human or effectively human. For example, one or more of the
CDRs can be human, e.g., HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC
CDR2, and/or LC CDR3. Each of the light chain (LC) and/or heavy
chain (HC) CDRs can be human. HC CDR3 can be human. One or more of
the framework regions can be human, e.g., FR1, FR2, FR3, and/or FR4
of the HC and/or LC. For example, the Fc region can be human. In
one embodiment, all the framework regions are human, e.g., derived
from a human somatic cell, e.g., a hematopoietic cell that produces
immunoglobulins or a non-hematopoietic cell. In one embodiment, the
human sequences are germline sequences, e.g., encoded by a germline
nucleic acid. In one embodiment, the framework (FR) residues of a
selected Fab can be converted to the amino-acid type of the
corresponding residue in the most similar primate germline gene,
especially the human germline gene. One or more of the constant
regions can be human or effectively human. For example, at least
70, 75, 80, 85, 90, 92, 95, 98, or 100% of an immunoglobulin
variable domain, the constant region, the constant domains (CH1,
CH2, CH3, and/or CL1), or the entire antibody can be human or
effectively human.
[0037] All or part of an antibody can be encoded by an
immunoglobulin gene or a segment thereof. Exemplary human
immunoglobulin genes include the kappa, lambda, alpha (IgA1 and
IgA2), gamma (IgG1, IgG2, IgG3, IgG4), delta, epsilon and mu
constant region genes, as well as the many immunoglobulin variable
region genes. Full-length immunoglobulin "light chains" (about 25
KDa or about 214 amino acids) are encoded by a variable region gene
at the NH2-terminus (about 110 amino acids) and a kappa or lambda
constant region gene at the COOH-terminus. Full-length
immunoglobulin "heavy chains" (about 50 KDa or about 446 amino
acids), are similarly encoded by a variable region gene (about 116
amino acids) and one of the other aforementioned constant region
genes, e.g., gamma (encoding about 330 amino acids). The length of
human HC varies considerably because HC CDR3 varies from about 3
amino-acid residues to over 35 amino-acid residues.
[0038] The term "antigen-binding fragment" of a full length
antibody refers to one or more fragments of a full-length antibody
that retain the ability to specifically bind to a target of
interest. Examples of binding fragments encompassed within the term
"antigen-binding fragment" of a full length antibody and that
retain functionality include (i) a Fab fragment, a monovalent
fragment consisting of the VL, VH, CL and CH1 domains; (ii) a
F(ab')2 fragment, a bivalent fragment including two Fab fragments
linked by a disulfide bridge at the hinge region; (iii) a Fd
fragment consisting of the VH and CH1 domains; (iv) a Fv fragment
consisting of the VL and VH domains of a single arm of an antibody,
(v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which
consists of a VH domain; and (vi) an isolated complementarity
determining region (CDR). Furthermore, although the two domains of
the Fv fragment, VL and VH, are coded for by separate genes, they
can be joined, using recombinant methods, by a synthetic linker
that enables them to be made as a single protein chain in which the
VL and VH regions pair to form monovalent molecules known as single
chain Fv (scFv). See, e.g., U.S. Pat. Nos. 5,260,203, 4,946,778,
and 4,881,175; Bird et al. (1988) Science 242:423-426; and Huston
et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883.
[0039] Antibody fragments can be obtained using any appropriate
technique including conventional techniques known to those with
skill in the art. The term "monospecific antibody" refers to an
antibody that displays a single binding specificity and affinity
for a particular target, e.g., epitope. This term includes a
"monoclonal antibody" or "monoclonal antibody composition," which
as used herein refers to a preparation of antibodies or fragments
thereof of single molecular composition, irrespective of how the
antibody was generated.
[0040] Antibodies are "germlined" by reverting one or more
non-germline amino acids in framework regions to corresponding
germline amino acids of the antibody, so long as binding properties
are substantially retained.
[0041] The inhibition constant (Ki) provides a measure of inhibitor
potency; it is the concentration of inhibitor required to reduce
enzyme activity by half and is not dependent on enzyme or substrate
concentrations. The apparent Ki (Ki,app) is obtained at different
substrate concentrations by measuring the inhibitory effect of
different concentrations of inhibitor (e.g., inhibitory binding
protein) on the extent of the reaction (e.g., enzyme activity);
fitting the change in pseudo-first order rate constant as a
function of inhibitor concentration to the Morrison equation
(Equation 1) yields an estimate of the apparent Ki value. The Ki is
obtained from the y-intercept extracted from a linear regression
analysis of a plot of Ki,app versus substrate concentration.
v = v o - v o ( ( K i , app + I + E ) - ( K i , app + I + E ) 2 - 4
I E 2 E ) Equation 1 ##EQU00001##
[0042] Where v=measured velocity; v0=velocity in the absence of
inhibitor; Ki,app=apparent inhibition constant; I=total inhibitor
concentration; and E=total enzyme concentration.
[0043] As used herein, "binding affinity" refers to the apparent
association constant or KA. The KA is the reciprocal of the
dissociation constant (KD). A binding antibody may, for example,
have a binding affinity of at least 105, 106, 107, 108, 109, 1010
and 1011 M-1 for a particular target molecule, e.g., plasma
kallikrein. Higher affinity binding of a binding antibody to a
first target relative to a second target can be indicated by a
higher KA (or a smaller numerical value KD) for binding the first
target than the KA (or numerical value KD) for binding the second
target. In such cases, the binding antibody has specificity for the
first target (e.g., a protein in a first conformation or mimic
thereof) relative to the second target (e.g., the same protein in a
second conformation or mimic thereof; or a second protein).
Differences in binding affinity (e.g., for specificity or other
comparisons) can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50,
70, 80, 91, 100, 500, 1000, 10,000 or 105 fold.
[0044] Binding affinity can be determined by a variety of methods
including equilibrium dialysis, equilibrium binding, gel
filtration, ELISA, surface plasmon resonance, or spectroscopy
(e.g., using a fluorescence assay). Exemplary conditions for
evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4,
150 mM NaCl, 0.005% (v/v) Surfactant P20). These techniques can be
used to measure the concentration of bound and free binding protein
as a function of binding protein (or target) concentration. The
concentration of bound binding protein ([Bound]) is related to the
concentration of free binding protein ([Free]) and the
concentration of binding sites for the binding protein on the
target where (N) is the number of binding sites per target molecule
by the following equation:
[Bound]=N[Free]/((1/KA)+[Free]).
[0045] It is not always necessary to make an exact determination of
KA, though, since sometimes it is sufficient to obtain a
quantitative measurement of affinity, e.g., determined using a
method such as ELISA or FACS analysis, is proportional to KA, and
thus can be used for comparisons, such as determining whether a
higher affinity is, e.g., 2 fold higher, to obtain a qualitative
measurement of affinity, or to obtain an inference of affinity,
e.g., by activity in a functional assay, e.g., an in vitro or in
vivo assay.
[0046] The term "binding antibody" (or "binding protein" used
interchangeably herein) refers to an antibody that can interact
with a target molecule. This term is used interchangeably with
"ligand." A "plasma kallikrein binding antibody" refers to an
antibody that can interact with (e.g., bind) plasma kallikrein, and
includes, in particular, antibodies that preferentially or
specifically interact with and/or inhibit plasma kallikrein. An
antibody inhibits plasma kallikrein if it causes a decrease in the
activity of plasma kallikrein as compared to the activity of plasma
kallikrein in the absence of the antibody and under the same
conditions.
[0047] A "conservative amino acid substitution" is one in which the
amino acid residue is replaced with an amino acid residue having a
similar side chain. Families of amino acid residues having similar
side chains have been defined in the art. These families include
amino acids with basic side chains (e.g., lysine, arginine,
histidine), acidic side chains (e.g., aspartic acid, glutamic
acid), uncharged polar side chains (e.g., glycine, asparagine,
glutamine, serine, threonine, tyrosine, cysteine), nonpolar side
chains (e.g., alanine, valine, leucine, isoleucine, proline,
phenylalanine, methionine, tryptophan), beta-branched side chains
(e.g., threonine, valine, isoleucine) and aromatic side chains
(e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0048] It is possible for one or more framework and/or CDR amino
acid residues of a binding protein to include one or more mutations
(e.g., substitutions (e.g., conservative substitutions or
substitutions of non-essential amino acids), insertions, or
deletions) relative to a binding protein described herein. A plasma
kallikrein binding protein may have mutations (e.g., substitutions
(e.g., conservative substitutions or substitutions of non-essential
amino acids), insertions, or deletions) (e.g., at least one, two,
three, or four, and/or less than 15, 12, 10, 9, 8, 7, 6, 5, 4, 3,
or 2 mutations) relative to a binding protein described herein,
e.g., mutations which do not have a substantial effect on protein
function. The mutations can be present in framework regions, CDRs,
and/or constant regions. In some embodiments, the mutations are
present in a framework region. In some embodiments, the mutations
are present in a CDR. In some embodiments, the mutations are
present in a constant region. Whether or not a particular
substitution will be tolerated, i.e., will not adversely affect
biological properties, such as binding activity, can be predicted,
e.g., by evaluating whether the mutation is conservative or by the
method of Bowie, et al. (1990) Science 247:1306-1310.
[0049] An "effectively human" immunoglobulin variable region is an
immunoglobulin variable region that includes a sufficient number of
human framework amino acid positions such that the immunoglobulin
variable region does not elicit an immunogenic response in a normal
human. An "effectively human" antibody is an antibody that includes
a sufficient number of human amino acid positions such that the
antibody does not elicit an immunogenic response in a normal
human.
[0050] An "epitope" refers to the site on a target compound that is
bound by a binding protein (e.g., an antibody such as a Fab or full
length antibody). In the case where the target compound is a
protein, the site can be entirely composed of amino acid
components, entirely composed of chemical modifications of amino
acids of the protein (e.g., glycosyl moieties), or composed of
combinations thereof. Overlapping epitopes include at least one
common amino acid residue, glycosyl group, phosphate group, sulfate
group, or other molecular feature.
[0051] A first binding antibody "binds to the same epitope" as a
second binding antibody if the first binding antibody binds to the
same site on a target compound that the second binding antibody
binds, or binds to a site that overlaps (e.g., 50%, 60%, 70%, 80%,
90/%, or 100% overlap, e.g., in terms of amino acid sequence or
other molecular feature (e.g., glycosyl group, phosphate group, or
sulfate group)) with the site that the second binding antibody
binds.
[0052] A first binding antibody "competes for binding" with a
second binding antibody if the binding of the first binding
antibody to its epitope decreases (e.g., by 10%, 20%, 30%, 40%,
50%, 60%, 70%, 80%, 90%, 100%, or more) the amount of the second
binding antibody that binds to its epitope. The competition can be
direct (e.g., the first binding antibody binds to an epitope that
is the same as, or overlaps with, the epitope bound by the second
binding antibody), or indirect (e.g., the binding of the first
binding antibody to its epitope causes a steric change in the
target compound that decreases the ability of the second binding
antibody to bind to its epitope).
[0053] Calculations of "homology" or "sequence identity" between
two sequences (the terms are used interchangeably herein) are
performed as follows. The sequences are aligned for optimal
comparison purposes (e.g., gaps can be introduced in one or both of
a first and a second amino acid or nucleic acid sequence for
optimal alignment and non-homologous sequences can be disregarded
for comparison purposes). The optimal alignment is determined as
the best score using the GAP program in the GCG software package
with a Blossum 62 scoring matrix with a gap penalty of 12, a gap
extend penalty of 4, and a frameshift gap penalty of 5. The amino
acid residues or nucleotides at corresponding amino acid positions
or nucleotide positions are then compared. When a position in the
first sequence is occupied by the same amino acid residue or
nucleotide as the corresponding position in the second sequence,
then the molecules are identical at that position (as used herein
amino acid or nucleic acid "identity" is equivalent to amino acid
or nucleic acid "homology"). The percent identity between the two
sequences is a function of the number of identical positions shared
by the sequences.
[0054] In a preferred embodiment, the length of a reference
sequence aligned for comparison purposes is at least 30%,
preferably at least 40%, more preferably at least 50%, even more
preferably at least 60%, and even more preferably at least 70%,
80%, 90%, 92%, 95%, 97%, 98%, or 100% of the length of the
reference sequence. For example, the reference sequence may be the
length of the immunoglobulin variable domain sequence.
[0055] A "humanized" immunoglobulin variable region is an
immunoglobulin variable region that is modified to include a
sufficient number of human framework amino acid positions such that
the immunoglobulin variable region does not elicit an immunogenic
response in a normal human. Descriptions of "humanized"
immunoglobulins include, for example, U.S. Pat. No. 6,407,213 and
U.S. Pat. No. 5,693,762.
[0056] An "isolated" antibody refers to an antibody that is removed
from at least 90% of at least one component of a natural sample
from which the isolated antibody can be obtained. Antibodies can be
"of at least" a certain degree of purity if the species or
population of species of interest is at least 5, 10, 25, 50, 75,
80, 90, 92, 95, 98, or 99% pure on a weight-weight basis.
[0057] A "patient," "subject" or "host" (these terms are used
interchangeably) to be treated by the subject method may mean
either a human or non-human animal.
[0058] The terms "prekallikrein" and "preplasma kallikrein" are
used interchangeably herein and refer to the zymogen form of active
plasma kallikrein, which is also known as prekallikrein.
[0059] As used herein, the term "substantially identical" (or
"substantially homologous") is used herein to refer to a first
amino acid or nucleic acid sequence that contains a sufficient
number of identical or equivalent (e.g., with a similar side chain,
e.g., conserved amino acid substitutions) amino acid residues or
nucleotides to a second amino acid or nucleic acid sequence such
that the first and second amino acid or nucleic acid sequences have
(or encode proteins having) similar activities, e.g., a binding
activity, a binding preference, or a biological activity. In the
case of antibodies, the second antibody has the same specificity
and has at least 50%, at least 25%, or at least 10% of the affinity
relative to the same antigen.
[0060] Sequences similar or homologous (e.g., at least about 85%
sequence identity) to the sequences disclosed herein are also part
of this application. In some embodiments, the sequence identity can
be about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or
higher. In some embodiments, a plasma kallikrein binding antibody
can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99% or higher sequence identity to an antibody described herein. In
some embodiments, a plasma kallikrein binding antibody can have
about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or
higher sequence identity in the HC and/or LC framework regions
(e.g., HC and/or LC FR 1, 2, 3, and/or 4) to an antibody described
herein (e.g., DX-2930). In some embodiments, a plasma kallikrein
binding antibody can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99% or higher sequence identity in the HC and/or LC
CDRs (e.g., HC and/or LC CDR1, 2, and/or 3) to an antibody
described herein (e.g., DX-2930). In some embodiments, a plasma
kallikrein binding antibody can have about 85%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity in the
constant region (e.g., CH1, CH2, CH3, and/or CL1) to an antibody
described herein (e.g., DX-2930).
[0061] In addition, substantial identity exists when the nucleic
acid segments hybridize under selective hybridization conditions
(e.g., highly stringent hybridization conditions), to the
complement of the strand. The nucleic acids may be present in whole
cells, in a cell lysate, or in a partially purified or
substantially pure form.
[0062] Statistical significance can be determined by any art known
method. Exemplary statistical tests include: the Students T-test,
Mann Whitney U non-parametric test, and Wilcoxon non-parametric
statistical test. Some statistically significant relationships have
a P value of less than 0.05 or 0.02. Particular binding proteins
may show a difference, e.g., in specificity or binding that are
statistically significant (e.g., P value<0.05 or 0.02). The
terms "induce", "inhibit", "potentiate", "elevate", "increase",
"decrease" or the like, e.g., which denote distinguishable
qualitative or quantitative differences between two states, may
refer to a difference, e.g., a statistically significant
difference, between the two states.
[0063] A "therapeutically effective dosage" preferably modulates a
measurable parameter, e.g., plasma kallikrein activity, by a
statistically significant degree or at least about 20%, more
preferably by at least about 40%, even more preferably by at least
about 60%, and still more preferably by at least about 80% relative
to untreated subjects. The ability of a compound to modulate a
measurable parameter, e.g., a disease-associated parameter, can be
evaluated in an animal model system predictive of efficacy in human
disorders and conditions. Alternatively, this property of a
composition can be evaluated by examining the ability of the
compound to modulate a parameter in vitro.
[0064] The term "treating" as used herein refers to the application
or administration of a composition including one or more active
agents to a subject, who has an allergic disease, a symptom of the
allergic disease, or a predisposition toward the allergic disease,
with the purpose to cure, heal, alleviate, relieve, alter, remedy,
ameliorate, improve, or affect the disease, the symptoms of the
disease, or the predisposition toward the disease. "Prophylactic
treatment," also known as "preventive treatment," refers to a
treatment that aims at protecting a person from, or reducing the
risk for a disease to which he or she has been, or may be,
exposed.
[0065] The term "preventing" a disease in a subject refers to
subjecting the subject to a pharmaceutical treatment, e.g., the
administration of a drug, such that at least one symptom of the
disease is prevented, that is, administered prior to clinical
manifestation of the unwanted condition (e.g., disease or other
unwanted state of the host animal) so that it protects the host
against developing the unwanted condition. "Preventing" a disease
may also be referred to as "prophylaxis" or "prophylactic
treatment."
[0066] A "prophylactically effective amount" refers to an amount
effective, at dosages and for periods of time necessary, to achieve
the desired prophylactic result. Typically, because a prophylactic
dose is used in subjects prior to or at an earlier stage of
disease, the prophylactically effective amount will be less than
the therapeutically effective amount.
Antibodies Specific to Plasma Kallikrein
[0067] Plasma kallikrein binding antibodies for use in the methods
described herein can be full-length (e.g., an IgG (e.g., an IgG1,
IgG2, IgG3, IgG4), IgM, IgA (e.g., IgA1, IgA2), IgD, and IgE) or
can include only an antigen-binding fragment (e.g., a Fab, F(ab')2
or scFv fragment. The binding antibody can include two heavy chain
immunoglobulins and two light chain immunoglobulins, or can be a
single chain antibody. Plasma kallikrein binding antibodies can be
recombinant proteins such as humanized, CDR grafted, chimeric,
deimmunized, or in vitro generated antibodies, and may optionally
include constant regions derived from human germline immunoglobulin
sequences. In one embodiment, the plasma kallikrein binding
antibody is a monoclonal antibody.
[0068] In one aspect, the disclosure features an antibody (e.g., an
isolated antibody) that binds to plasma kallikrein (e.g., human
plasma kallikrein and/or murine kallikrein) and includes at least
one immunoglobulin variable region. For example, the antibody
includes a heavy chain (HC) immunoglobulin variable domain sequence
and/or a light chain (LC) immunoglobulin variable domain sequence.
In one embodiment, the antibody binds to and inhibits plasma
kallikrein, e.g., human plasma kallikrein and/or murine
kallikrein.
[0069] The antibody can include one or more of the following
characteristics: (a) a human CDR or human framework region; (b) the
HC immunoglobulin variable domain sequence comprises one or more
(e.g., 1, 2, or 3) CDRs that are at least 85, 88, 89, 90, 91, 92,
93, 94, 95, 96, 97, 98, 99, or 100% identical to a CDR of a HC
variable domain described herein; (c) the LC immunoglobulin
variable domain sequence comprises one or more (e.g., 1, 2, or 3)
CDRs that are at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
98, 99, or 100% identical to a CDR of a LC variable domain
described herein; (d) the LC immunoglobulin variable domain
sequence is at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
98, 99, or 100% identical to a LC variable domain described herein
(e.g., overall or in framework regions or CDRs); (e) the HC
immunoglobulin variable domain sequence is at least 85, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical to a HC
variable domain described herein (e.g., overall or in framework
regions or CDRs); (f) the antibody binds an epitope bound by an
antibody described herein, or competes for binding with an antibody
described herein; (g) a primate CDR or primate framework region;
(h) the HC immunoglobulin variable domain sequence comprises a CDR1
that differs by at least one amino acid but by no more than 2 or 3
amino acids from the CDR1 of a HC variable domain described herein;
(i) the HC immunoglobulin variable domain sequence comprises a CDR2
that differs by at least one amino acid but by no more than 2, 3,
4, 5, 6, 7, or 8 amino acids from the CDR2 of a HC variable domain
described herein; (j) the HC immunoglobulin variable domain
sequence comprises a CDR3 that differs by at least one amino acid
but by no more than 2, 3, 4, 5, or 6 amino acids from the CDR3 of a
HC variable domain described herein; (k) the LC immunoglobulin
variable domain sequence comprises a CDR1 that differs by at least
one amino acid but by no more than 2, 3, 4, or 5 amino acids from
the CDR1 of a LC variable domain described herein; (l) the LC
immunoglobulin variable domain sequence comprises a CDR2 that
differs by at least one amino acid but by no more than 2, 3, or 4
amino acids from the CDR2 of a LC variable domain described herein;
(m) the LC immunoglobulin variable domain sequence comprises a CDR3
that differs by at least one amino acid but by no more than 2, 3,
4, or 5 amino acids from the CDR3 of a LC variable domain described
herein; (n) the LC immunoglobulin variable domain sequence differs
by at least one amino acid but by no more than 2, 3, 4, 5, 6, 7, 8,
9, or 10 amino acids from a LC variable domain described herein
(e.g., overall or in framework regions or CDRs); and (o) the HC
immunoglobulin variable domain sequence differs by at least one
amino acid but by no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino
acids from a HC variable domain described herein (e.g., overall or
in framework regions or CDRs).
[0070] The plasma kallikrein binding protein may be an isolated
antibody (e.g., at least 70, 80, 90, 95, or 99% free of other
proteins). In some embodiments, the plasma kallikrein binding
antibody, or composition thereof, is isolated from antibody
cleavage fragments (e.g., DX-2930) that are inactive or partially
active (e.g., bind plasma kallikrein with a Ki, app of 5000 nM or
greater) compared to the plasma kallikrein binding antibody. For
example, the plasma kallikrein binding antibody is at least 70%
free of such antibody cleavage fragments; in other embodiments the
binding antibody is at least 80%, at least 90%, at least 95%, at
least 99% or even 100% free from antibody cleavage fragments that
are inactive or partially active.
[0071] The plasma kallikrein binding antibody may additionally
inhibit plasma kallikrein, e.g., human plasma kallikrein.
[0072] In some embodiments, the plasma kallikrein binding antibody
does not bind prekallikrein (e.g., human prekallikrein and/or
murine prekallikrein), but binds to the active form of plasma
kallikrein (e.g., human plasma kallikrein and/or murine
kallikrein).
[0073] In certain embodiments, the antibody binds at or near the
active site of the catalytic domain of plasma kallikrein, or a
fragment thereof, or binds an epitope that overlaps with the active
site of plasma kallikrein.
[0074] In some aspects, the antibody binds the same epitope or
competes for binding with an antibody described herein.
[0075] The antibody can bind to plasma kallikrein, e.g., human
plasma kallikrein, with a binding affinity of at least 10.sup.5,
106, 10.sup.7, 106, 10.sup.9, 10.sup.10 and 10.sup.11 M.sup.-1. In
one embodiment, the antibody binds to human plasma kallikrein with
a K.sub.off slower than 1.times.10.sup.-3, 5.times.10.sup.-4
s.sup.-1, or 1.times.10.sup.-4 s.sup.-1. In one embodiment, the
antibody binds to human plasma kallikrein with a K.sub.on faster
than 1.times.10.sup.2, 1.times.10.sup.3, or 5.times.10.sup.3
M.sup.-1s.sup.-1. In one embodiment, the antibody binds to plasma
kallikrein, but does not bind to tissue kallikrein and/or plasma
prekallikrein (e.g., the antibody binds to tissue kallikrein and/or
plasma prekallikrein less effectively (e.g., 5-, 10-, 50-, 100-, or
1000-fold less or not at all, e.g., as compared to a negative
control) than it binds to plasma kallikrein.
[0076] In one embodiment, the antibody inhibits human plasma
kallikrein activity, e.g., with a Ki of less than 10.sup.-5,
10.sup.-6, 10.sup.-7, 10.sup.-8, 10.sup.-9, and 10.sup.-10 M. The
antibody can have, for example, an IC.sub.50 of less than 100 nM,
10 nM, 1, 0.5, or 0.2 nM. For example, the antibody may modulate
plasma kallikrein activity, as well as the production of Factor
XIIa (e.g., from Factor XII) and/or bradykinin (e.g., from
high-molecular-weight kininogen (HMWK)). The antibody may inhibit
plasma kallikrein activity, and/or the production of Factor XIIa
(e.g., from Factor XII) and/or bradykinin (e.g., from
high-molecular-weight kininogen (HMWK)). The affinity of the
antibody for human plasma kallikrein can be characterized by a KD
of less than 100 nm, less than 10 nM, less than 5 nM, less than 1
nM, less than 0.5 nM. In one embodiment, the antibody inhibits
plasma kallikrein, but does not inhibit tissue kallikrein (e.g.,
the antibody inhibits tissue kallikrein less effectively (e.g., 5-,
10-, 50-, 100-, or 1000-fold less or not at all, e.g., as compared
to a negative control) than it inhibits plasma kallikrein.
[0077] In some embodiments, the antibody has an apparent inhibition
constant (K.sub.i,app) of less than 1000, 500, 100, 5, 1, 0.5 or
0.2 nM.
[0078] Plasma kallikrein binding antibodies may have their HC and
LC variable domain sequences included in a single polypeptide
(e.g., scFv), or on different polypeptides (e.g., IgG or Fab).
[0079] In one embodiment, the HC and LC variable domain sequences
are components of the same polypeptide chain. In another, the HC
and LC variable domain sequences are components of different
polypeptide chains. For example, the antibody is an IgG, e.g.,
IgG1, IgG2, IgG3, or IgG4. The antibody can be a soluble Fab. In
other implementations the antibody includes a Fab2', scFv,
minibody, scFv::Fc fusion, Fab::HSA fusion, HSA::Fab fusion,
Fab::HSA::Fab fusion, or other molecule that comprises the antigen
combining site of one of the binding proteins herein. The VH and VL
regions of these Fabs can be provided as IgG, Fab, Fab2, Fab2',
scFv, PEGylated Fab, PEGylated scFv, PEGylated Fab2,
VH::CH1::HSA+LC, HSA::VH::CH1+LC, LC::HSA+VH::CH1, HSA::LC+VH::CH1,
or other appropriate construction.
[0080] In one embodiment, the antibody is a human or humanized
antibody or is non-immunogenic in a human. For example, the
antibody includes one or more human antibody framework regions,
e.g., all human framework regions, or framework regions at least
85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to
human framework regions. In one embodiment, the antibody includes a
human Fc domain, or an Fc domain that is at least 95, 96, 97, 98,
or 99% identical to a human Fc domain.
[0081] In one embodiment, the antibody is a primate or primatized
antibody or is non-immunogenic in a human. For example, the
antibody includes one or more primate antibody framework regions,
e.g., all primate framework regions, or framework regions at least
85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to
primate framework regions. In one embodiment, the antibody includes
a primate Fc domain, or an Fc domain that is at least 95, 96, 97,
98, or 99% identical to a primate Fc domain. "Primate" includes
humans (Homo sapiens), chimpanzees (Pan troglodytes and Pan
paniscus (bonobos)), gorillas (Gorilla gorilla), gibons, monkeys,
lemurs, aye-ayes (Daubentonia madagascariensis), and tarsiers.
[0082] In some embodiments, the affinity of the primate antibody
for human plasma kallikrein is characterized by a K.sub.D of less
than 1000, 500, 100, 10, 5, 1, 0.5 nM, e.g., less than 10 nM, less
than 1 nM, or less than 0.5 nM.
[0083] In certain embodiments, the antibody includes no sequences
from mice or rabbits (e.g., is not a murine or rabbit
antibody).
[0084] In some embodiments, the antibody used in the methods
described herein may be DX-2930 as described herein or a functional
variant thereof, or an antibody that binds the same epitope as
DX-2930 or competes against DX-2930 for binding to active plasma
kallikrein.
[0085] In one example, a functional variant of DX-2930 comprises
the same complementary determining regions (CDRs) as DX-2930, as
determined by the same method. In another example, the functional
variants of DX-2930 may contain one or more mutations (e.g.,
conservative substitutions) in the FRs of either the V.sub.H or the
V.sub.L as compared to those in the V.sub.H and V.sub.L of DX-2930.
Preferably, such mutations do not occur at residues which are
predicted to interact with one or more of the CDRs, which can be
determined by routine technology. In other embodiments, the
functional variants described herein contain one or more mutations
(e.g., 1, 2, or 3) within one or more of the CDR regions of
DX-2930. Preferably, such functional variants retain the same
regions/residues responsible for antigen-binding as the parent. In
yet other embodiments, a functional variant of DX-2930 may comprise
a V.sub.H chain that comprises an amino acid sequence at least 85%
(e.g., 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to that
of the V.sub.H of DX-2930 and/or a V.sub.L chain that has an amino
acid sequence at least 85% (e.g., 90%, 92%, 94%, 95%, 96%, 97%,
98%, or 99%) identical to that of the V.sub.L of DX-2930. These
variants are capable of binding to the active form of plasma
kallikrein and preferably do not bind to prekallikrein.
[0086] The "percent identity" of two amino acid sequences is
determined using the algorithm of Karlin and Altschul Proc. Natl.
Acad. Sci. USA 87:2264-68, 1990, modified as in Karlin and Altschul
Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is
incorporated into the NBLAST and XBLAST programs (version 2.0) of
Altschul, et al. J. Mol. Biol. 215:403-10, 1990. BLAST protein
searches can be performed with the XBLAST program, score=50,
wordlength=3 to obtain amino acid sequences homologous to the
protein molecules of interest. Where gaps exist between two
sequences, Gapped BLAST can be utilized as described in Altschul et
al., Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing
BLAST and Gapped BLAST programs, the default parameters of the
respective programs (e.g., XBLAST and NBLAST) can be used.
[0087] In some embodiments, the antibody used in the methods and
compositions described herein may be the DX-2930 antibody. The
heavy and light chain full and variable sequences for DX-2930 are
provided below, with signal sequences in italics.
[0088] The CDRs are boldfaced and underlined (based on the Kabat
numbering scheme).
TABLE-US-00001 DX-2930 Heavy Chain Amino Acid Sequence (451 amino
acids, 49439.02 Da) (SEQ ID NO: 1)
MGWSCILFLVATATGAHSEVQLLESGGGLVQPGGSLRLSCAASGFT
FSHYIMMWVRQAPGKGLEWVSGIYSSGGITVYADSVKGRFTISRDN
SKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLNKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHICP
SNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR
EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSTTLYSKLTVDKSRWQQGNVESCSVMHEALHNHY TQKSLSLSPG DX-2930
Light Chain Amino Acid Sequence (213 amino acids, 23419.08 Da) (SEQ
ID NO: 2) MGWSCILFLVATATGAHSDIQMTQSPSTLSASVGDRVTITCRASQS
ISSWLAWYQQKPGKAPKLLIYKASTLESGVPSRFSGSGSGTEFTLT
ISSLQPDDFATYYCQQYNTYWTFGQGTKVEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE C DX-2930 Heavy
Chain Variable Domain Amino Acid Sequence (SEQ ID NO: 3)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLE
WVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA
VYYCAYRRIGVPRRDEFDIWGQGTMVTVSS DX-2930 Light Chain Variable Domain
Amino Acid Sequence (SEQ ID NO: 4)
DIQMNSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLL
IYKASTLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNT YWTFGQGTKVEIK
TABLE-US-00002 TABLE 1 CDRs for DX-2930. CDR Amino acid sequence
Heavy chain CDR1 HYIMM (SEQ ID NO: 5) Heavy chain CDR2
GIYSSGGITVYADSVKG (SEQ ID NO: 6) Heavy chain CDR3 RRIGVPRRDEFDI
(SEQ ID NO: 7) Light chain CDR1 RASQSISSWLA (SEQ ID NO: 8) Light
chain CDR2 KASTLES (SEQ ID NO: 9) Light chain CDR3 QQYNTYWT (SEQ ID
NO: 10)
Antibody Preparation
[0089] An antibody as described herein (e.g., DX-2930) can be made
by any method known in the art. See, for example, Harlow and Lane,
(1988) Antibodies: A Laboratory Manual, Cold Spring Harbor
Laboratory, New York and Greenfield, (2013) Antibodies: A
Laboratory Manual, Second edition, Cold Spring Harbor Laboratory
Press.
[0090] The sequence encoding the antibody of interest, e.g.,
DX-2930, may be maintained in vector in a host cell and the host
cell can then be expanded and frozen for future use. In an
alternative, the polynucleotide sequence may be used for genetic
manipulation to "humanize" the antibody or to improve the affinity
(affinity maturation), or other characteristics of the antibody.
For example, the constant region may be engineered to more resemble
human constant regions to avoid immune response if the antibody is
used in clinical trials and treatments in humans. It may be
desirable to genetically manipulate the antibody sequence to obtain
greater affinity to the target antigen and greater efficacy in
inhibiting the activity of PKal. It will be apparent to one of
skill in the art that one or more polynucleotide changes can be
made to the antibody and still maintain its binding specificity to
the target antigen.
[0091] In other embodiments, fully human antibodies can be obtained
by using commercially available mice that have been engineered to
express specific human immunoglobulin proteins. Transgenic animals
that are designed to produce a more desirable (e.g., fully human
antibodies) or more robust immune response may also be used for
generation of humanized or human antibodies. Examples of such
technology are Xenomouse.RTM. from Amgen, Inc. (Fremont, Calif.)
and HuMAb-Mouse.RTM. and TC Mouse.TM. from Medarex, Inc.
(Princeton, N.J.). In another alternative, antibodies may be made
recombinantly by phage display or yeast technology. See, for
example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743; and
6,265,150; and Winter et al., (1994) Annu. Rev. Immunol.
12:433-455. Alternatively, the phage display technology (McCafferty
et al., (1990) Nature 348:552-553) can be used to produce human
antibodies and antibody fragments in vitro, from immunoglobulin
variable (V) domain gene repertoires from unimmunized donors.
[0092] Antigen-binding fragments of an intact antibody (full-length
antibody) can be prepared via routine methods. For example, F(ab')2
fragments can be produced by pepsin digestion of an antibody
molecule, and Fab fragments that can be generated by reducing the
disulfide bridges of F(ab')2 fragments.
[0093] Genetically engineered antibodies, such as humanized
antibodies, chimeric antibodies, single-chain antibodies, and
bi-specific antibodies, can be produced via, e.g., conventional
recombinant technology. In one example, DNA encoding a monoclonal
antibodies specific to a target antigen can be readily isolated or
synthesized. The DNA may be placed into one or more expression
vectors, which are then transfected into host cells such as E. coli
cells, simian COS cells, Chinese hamster ovary (CHO) cells, or
myeloma cells that do not otherwise produce immunoglobulin protein,
to obtain the synthesis of monoclonal antibodies in the recombinant
host cells. See, e.g., PCT Publication No. WO 87/04462. The DNA can
then be modified, for example, by substituting the coding sequence
for human heavy and light chain constant domains in place of the
homologous murine sequences, Morrison et al., (1984) Proc. Nat.
Acad. Sci. 81:6851, or by covalently joining to the immunoglobulin
coding sequence all or part of the coding sequence for a
non-immunoglobulin polypeptide. In that manner, genetically
engineered antibodies, such as "chimeric" or "hybrid" antibodies;
can be prepared that have the binding specificity of a target
antigen.
[0094] Techniques developed for the production of "chimeric
antibodies" are well known in the art. See, e.g., Morrison et al.
(1984) Proc. Natl. Acad. Sci. USA 81, 6851; Neuberger et al. (1984)
Nature 312, 604; and Takeda et al. (1984) Nature 314:452.
[0095] Methods for constructing humanized antibodies are also well
known in the art. See, e.g., Queen et al., Proc. Natl. Acad. Sci.
USA, 86:10029-10033 (1989). In one example, variable regions of VH
and VL of a parent non-human antibody are subjected to
three-dimensional molecular modeling analysis following methods
known in the art. Next, framework amino acid residues predicted to
be important for the formation of the correct CDR structures are
identified using the same molecular modeling analysis. In parallel,
human VH and VL chains having amino acid sequences that are
homologous to those of the parent non-human antibody are identified
from any antibody gene database using the parent VH and VL
sequences as search queries. Human VH and VL acceptor genes are
then selected.
[0096] The CDR regions within the selected human acceptor genes can
be replaced with the CDR regions from the parent non-human antibody
or functional variants thereof. When necessary, residues within the
framework regions of the parent chain that are predicted to be
important in interacting with the CDR regions (see above
description) can be used to substitute for the corresponding
residues in the human acceptor genes.
[0097] A single-chain antibody can be prepared via recombinant
technology by linking a nucleotide sequence coding for a heavy
chain variable region and a nucleotide sequence coding for a light
chain variable region. Preferably, a flexible linker is
incorporated between the two variable regions. Alternatively,
techniques described for the production of single chain antibodies
(U.S. Pat. Nos. 4,946,778 and 4,704,692) can be adapted to produce
a phage or yeast scFv library and scFv clones specific to a PKal
can be identified from the library following routine procedures.
Positive clones can be subjected to further screening to identify
those that inhibits PKal activity.
[0098] Some antibodies, e.g., Fabs, can be produced in bacterial
cells, e.g., E. coli cells (see e.g., Nadkarni, A. et al., 2007
Protein Expr Purif 52(1):219-29). For example, if the Fab is
encoded by sequences in a phage display vector that includes a
suppressible stop codon between the display entity and a
bacteriophage protein (or fragment thereof), the vector nucleic
acid can be transferred into a bacterial cell that cannot suppress
a stop codon. In this case, the Fab is not fused to the gene III
protein and is secreted into the periplasm and/or media.
[0099] Antibodies can also be produced in eukaryotic cells. In one
embodiment, the antibodies (e.g., scFv's) are expressed in a yeast
cell such as Pichia (see, e.g., Powers et al., 2001, J. Immunol.
Methods. 251:123-35; Schoonooghe S. et al., 2009 BMC Biotechnol.
9:70; Abdel-Salam, H A. et al., 2001 Appl Microbiol Biotechnol
56(1-2):157-64; Takahashi K. et al., 2000 Biosci Biotechnol Biochem
64(10):2138-44; Edqvist, J. et al., 1991 J Biotechnol
20(3):291-300), Hanseula, or Saccharomyces. One of skill in the art
can optimize antibody production in yeast by optimizing, for
example, oxygen conditions (see e.g., Baumann K., et al. 2010 BMC
Syst. Biol. 4:141), osmolarity (see e.g., Dragosits, M. et al.,
2010 BMC Genomics 11:207), temperature (see e.g., Dragosits, M. et
al., 2009 J Proteome Res. 8(3):1380-92), fermentation conditions
(see e.g., Ning, D. et al. 2005 J. Biochem. and Mol. Biol. 38(3):
294-299), strain of yeast (see e.g., Kozyr, A V et al. 2004 Mol
Biol (Mosk) 38(6):1067-75; Horwitz, A H. et al., 1988 Proc Natl
Acad Sci USA 85(22):8678-82; Bowdish, K. et al. 1991 J Biol Chem
266(18):11901-8), overexpression of proteins to enhance antibody
production (see e.g., Gasser, B. et al., 2006 Biotechol. Bioeng.
94(2):353-61), level of acidity of the culture (see e.g., Kobayashi
H., et al., 1997 FEMS Microbiol Lett 152(2):235-42), concentrations
of substrates and/or ions (see e.g., Ko J H. et al., 2996 Appl
Biochem Biotechnol 60(1):41-8). In addition, yeast systems can be
used to produce antibodies with an extended half-life (see e.g.,
Smith, B J. et al. 2001 Bioconjug Chem 12(5):750-756),
[0100] In one preferred embodiment, antibodies are produced in
mammalian cells. Preferred mammalian host cells for expressing the
clone antibodies or antigen-binding fragments thereof include
Chinese Hamster Ovary (CHO cells) (including dhfr-CHO cells,
described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA
77:4216-4220, used with a DHFR selectable marker, e.g., as
described in Kaufman and Sharp, 1982, Mol. Biol. 159:601 621),
lymphocytic cell lines, e.g., NS0 myeloma cells and SP2 cells, COS
cells, HEK293T cells (J. Immunol. Methods (2004) 289(1-2):65-80),
and a cell from a transgenic animal, e.g., a transgenic mammal. For
example, the cell is a mammary epithelial cell.
[0101] In some embodiments, plasma kallikrein binding antibodies
are produced in a plant or cell-free based system (see e.g.,
Galeffi, P., et al., 2006 J Transl Med 4:39).
[0102] In addition to the nucleic acid sequence encoding the
diversified immunoglobulin domain, the recombinant expression
vectors may carry additional sequences, such as sequences that
regulate replication of the vector in host cells (e.g., origins of
replication) and selectable marker genes. The selectable marker
gene facilitates selection of host cells into which the vector has
been introduced (see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and
5,179,017). For example, typically the selectable marker gene
confers resistance to drugs, such as G418, hygromycin or
methotrexate, on a host cell into which the vector has been
introduced. Preferred selectable marker genes include the
dihydrofolate reductase (DHFR) gene (for use in dhfr host cells
with methotrexate selection/amplification) and the neo gene (for
G418 selection).
[0103] In an exemplary system for recombinant expression of an
antibody, or antigen-binding portion thereof, a recombinant
expression vector encoding both the antibody heavy chain and the
antibody light chain is introduced into dhfr CHO cells by calcium
phosphate-mediated transfection. Within the recombinant expression
vector, the antibody heavy and light chain genes are each
operatively linked to enhancer/promoter regulatory elements (e.g.,
derived from SV40, CMV, adenovirus and the like, such as a CMV
enhancer/AdMLP promoter regulatory element or an SV40
enhancer/AdMLP promoter regulatory element) to drive high levels of
transcription of the genes. The recombinant expression vector also
carries a DHFR gene, which allows for selection of CHO cells that
have been transfected with the vector using methotrexate
selection/amplification. The selected transformant host cells are
cultured to allow for expression of the antibody heavy and light
chains and intact antibody is recovered from the culture medium.
Standard molecular biology techniques are used to prepare the
recombinant expression vector, transfect the host cells, select for
transformants, culture the host cells and recover the antibody from
the culture medium. For example, some antibodies can be isolated by
affinity chromatography with a Protein A or Protein G coupled
matrix.
[0104] For antibodies that include an Fc domain, the antibody
production system may produce antibodies in which the Fc region is
glycosylated. For example, the Fc domain of IgG molecules is
glycosylated at asparagine 297 in the CH2 domain. This asparagine
is the site for modification with biantennary-type
oligosaccharides. It has been demonstrated that this glycosylation
is required for effector functions mediated by Fcg receptors and
complement C1q (Burton and Woof, 1992, Adv. Immunol. 51:1-84;
Jefferis et al., 1998, Immunol. Rev. 163:59-76). In one embodiment,
the Fc domain is produced in a mammalian expression system that
appropriately glycosylates the residue corresponding to asparagine
297. The Fc domain can also include other eukaryotic
post-translational modifications.
[0105] Antibodies can also be produced by a transgenic animal. For
example, U.S. Pat. No. 5,849,992 describes a method of expressing
an antibody in the mammary gland of a transgenic mammal. A
transgene is constructed that includes a milk-specific promoter and
nucleic acids encoding the antibody of interest and a signal
sequence for secretion. The milk produced by females of such
transgenic mammals includes, secreted-therein, the antibody of
interest. The antibody can be purified from the milk, or for some
applications, used directly.
Pharmaceutical Compositions
[0106] An antibody as described herein (e.g., DX-2930) can be
present in a composition, e.g., a pharmaceutically acceptable
composition or pharmaceutical composition. The antibody as
described herein (e.g., DX-2930) can be formulated together with a
pharmaceutically acceptable carrier. In some embodiments, 30 mg-400
mg of DX-2930 antibody are present in a composition, optionally
with a pharmaceutically acceptable carrier, e.g., a
pharmaceutically acceptable composition or pharmaceutical
composition. In some embodiments, 30 mg, 100 mg, 150 mg, 300 mg, or
400 mg of DX-2930 antibody are present in a composition optionally
with a pharmaceutically acceptable carrier, e.g., a
pharmaceutically acceptable composition or pharmaceutical
composition.
[0107] A pharmaceutically acceptable carrier includes any and all
solvents, dispersion media, coatings, antibacterial and antifungal
agents, isotonic and absorption delaying agents, and the like that
are physiologically compatible. Preferably, the carrier is suitable
for subcutaneous, intravenous, intramuscular, parenteral, spinal,
or epidermal administration (e.g., by injection or infusion),
although carriers suitable for inhalation and intranasal
administration are also contemplated. In some embodiments, the
pharmaceutically acceptable carrier is one or more of sodium
phosphate, citric acid, histidine, sodium chloride, and Tween 80.
In some embodiments, the pharmaceutically acceptable carrier is
sodium phosphate, citric acid, histidine, sodium chloride, and
Tween 80. In some embodiments, the antibody, such as DX-2930, is
formulated in 30 mM sodium phosphate, 8.6 mM citric acid, 50 mM
histidine, 90 mM sodium chloride, 0.01% Tween 80, pH 6.0. In some
embodiments, the composition comprises or consists of 100 mg
DX-2930 per 1 mL solution of 30 mM sodium phosphate, 8.6 mM citric
acid, 50 mM histidine, 90 mM sodium chloride, 0.01% Tween 80.
[0108] A pharmaceutically acceptable salt is a salt that retains
the desired biological activity of the compound and does not impart
any undesired toxicological effects (see e.g., Berge, S. M., et
al., 1977, J. Pharm. Sci. 66:1-19). Examples of such salts include
acid addition salts and base addition salts. Acid addition salts
include those derived from nontoxic inorganic acids, such as
hydrochloric, nitric, phosphoric, sulfuric, hydrobromic,
hydroiodic, phosphorous, and the like, as well as from nontoxic
organic acids such as aliphatic mono- and dicarboxylic acids,
phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic
acids, aliphatic and aromatic sulfonic acids, and the like. Base
addition salts include those derived from alkaline earth metals,
such as sodium, potassium, magnesium, calcium, and the like, as
well as from nontoxic organic amines, such as
N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine,
choline, diethanolamine, ethylenediamine, procaine, and the
like.
[0109] The compositions may be in a variety of forms. These
include, for example, liquid, semi-solid and solid dosage forms,
such as liquid solutions (e.g., injectable and infusible
solutions), dispersions or suspensions, tablets, pills, powders,
liposomes and suppositories. The form can depend on the intended
mode of administration and therapeutic application. Many
compositions are in the form of injectable or infusible solutions,
such as compositions similar to those used for administration of
humans with antibodies. An exemplary mode of administration is
parenteral (e.g., intravenous, subcutaneous, intraperitoneal,
intramuscular). In one embodiment, the plasma kallikrein binding
protein is administered by intravenous infusion or injection. In
another preferred embodiment, the plasma kallikrein binding protein
is administered by intramuscular or subcutaneous injection. In
another preferred embodiment, the plasma kallikrein binding protein
is administered by intraperitoneal injection.
[0110] The phrases "parenteral administration" and "administered
parenterally" as used herein means modes of administration other
than enteral and topical administration, usually by injection, and
includes, without limitation, intravenous, intramuscular,
intraarterial, intrathecal, intracapsular, intraorbital,
intracardiac, intradermal, intraperitoneal, transtracheal,
subcutaneous, subcuticular, intraarticular, subcapsular,
subarachnoid, intraspinal, epidural and intrasternal injection and
infusion.
[0111] The composition can be formulated as a solution,
microemulsion, dispersion, liposome, or other ordered structure
suitable to high drug concentration. Sterile injectable solutions
can be prepared by incorporating the binding protein in the
required amount in an appropriate solvent with one or a combination
of ingredients enumerated above, as required, followed by filtered
sterilization. Generally, dispersions are prepared by incorporating
the active compound into a sterile vehicle that contains a basic
dispersion medium and the required other ingredients from those
enumerated above. In the case of sterile powders for the
preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum drying and freeze-drying that yields a
powder of the active ingredient plus any additional desired
ingredient from a previously sterile-filtered solution thereof. The
proper fluidity of a solution can be maintained, for example, by
the use of a coating such as lecithin, by the maintenance of the
required particle size in the case of dispersion and by the use of
surfactants. Prolonged absorption of injectable compositions can be
brought about by including in the composition an agent that delays
absorption, for example, monostearate salts and gelatin.
[0112] An antibody as described herein (e.g., DX-2930) can be
administered by a variety of methods, including intravenous
injection or infusion. For example, for some therapeutic
applications, the antibody can be administered by intravenous
infusion at a rate of less than 30, 20, 10, 5, or 1 mg/min to reach
a dose of about 1 to 100 mg/m.sup.2 or 7 to 25 mg/m.sup.2. The
route and/or mode of administration will vary depending upon the
desired results. In certain embodiments, the active compound may be
prepared with a carrier that will protect the compound against
rapid release, such as a controlled release formulation, including
implants, and microencapsulated delivery systems. Biodegradable,
biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Many methods for the preparation of such
formulations are available. See, e.g., Sustained and Controlled
Release Drug Delivery Systems, J. R. Robinson, ed., 1978, Marcel
Dekker, Inc., New York.
[0113] Pharmaceutical compositions can be administered with medical
devices. For example, in one embodiment, a pharmaceutical
composition disclosed herein can be administered with a device,
e.g., a needleless hypodermic injection device, a pump, or
implant.
[0114] In certain embodiments, an antibody as described herein
(e.g., DX-2930) can be formulated to ensure proper distribution in
vivo. For example, the blood-brain barrier (BBB) excludes many
highly hydrophilic compounds. To ensure that the therapeutic
compounds disclosed herein cross the BBB (if desired), they can be
formulated, for example, in liposomes. For methods of manufacturing
liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and
5,399,331. The liposomes may comprise one or more moieties that are
selectively transported into specific cells or organs, thus enhance
targeted drug delivery (see, e.g., V. V. Ranade, 1989, J. Clin.
Pharmacol. 29:685).
[0115] Dosage regimens are adjusted to provide the optimum desired
response (e.g., a therapeutic response). For example, a single
bolus may be administered, several divided doses may be
administered over time or the dose may be proportionally reduced or
increased as indicated by the exigencies of the therapeutic
situation. It is especially advantageous to formulate parenteral
compositions in dosage unit form for ease of administration and
uniformity of dosage. Dosage unit form as used herein refers to
physically discrete units suited as unitary dosages for the
subjects to be treated; each unit contains a predetermined quantity
of active compound calculated to produce the desired therapeutic
effect in association with the required pharmaceutical carrier. The
specification for the dosage unit forms can be dictated by and
directly dependent on (a) the unique characteristics of the active
compound and the particular therapeutic effect to be achieved, and
(b) the limitations inherent in the art of compounding such an
active compound for the treatment of sensitivity in
individuals.
[0116] An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of an antibody as described
herein (e.g., DX-2930) is 30 mg to 400 mg, or any integer in
between, for example, 100-400 mg, 100-300 mg, or 300-400 mg. In
some embodiments, the therapeutically or prophylactically effective
amount is 30 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or
400 mg.
[0117] In some embodiments, the therapeutically or prophylactically
effective amount of an antibody described herein (e.g., DX-2930) is
30 mg, 100 mg, 150 mg, 300 mg, or 400 mg. In some embodiments, the
therapeutically or prophylactically effective amount is 150 mg. In
some embodiments, the therapeutically or prophylactically effective
amount is 300 mg. In some embodiments, the therapeutically or
prophylactically effective amount is 400 mg.
[0118] In some embodiments, the therapeutically or prophylactically
effective amount is administered at least two times, at least three
times, at least four times, at least five times, at least six
times, at least seven times, at least eight times, at least nine
times, at least ten times, or more. In some embodiments, the
therapeutically or prophylactically effective amount is
administered every other week (i.e., every two weeks). In some
embodiments, the therapeutically or prophylactically effective
amount is 300 mg or 400 mg and the amount is administered every two
weeks. In some embodiments, the therapeutically or prophylactically
effective amount is 300 mg and this amount of the antibody is
administered every two weeks. In some embodiments, the
therapeutically or prophylactically effective amount is 400 mg and
this amount of the antibody is administered every two weeks.
[0119] In some embodiments, treatment of any of the anti-pKal
antibody such as DX-2930 involves a treatment regimen comprising at
least a loading period and a maintenance period. In some
embodiments, the therapeutically or prophylactically effective
amount of the antibody for the loading period is 100 to 300 mg
(e.g., 150 mg or 300 mg) per each administration. During this
period, the antibody may be administered every week (e.g., every
week for one, two or three weeks). In one example, the loading
period is 2 weeks and the antibody is administered at day 0, day 7,
and day 14.
[0120] Alternatively or in addition, the therapeutically or
prophylactically effective amount for the maintenance period is
about 100 to 300 mg (e.g., 150 mg or 300 mg) per each
administration. During this period, the antibody can be
administered every other week (i.e., every two weeks), every three
weeks, or every four weeks (e.g., every two weeks for ten weeks,
resulting in delivery of 5 doses total). In one example, the
maintenance period may last for 10 weeks and the antibody is
administered at day 28, day 42, day 56, day 70, and day 84.
[0121] In some embodiments, the anti-pKal antibody such as DX-2930
is administered at 150 mg or 300 mg and the amount is first
administered every week for a suitable period (e.g., every week for
one, two or three weeks) and subsequently administered every two to
four weeks (e.g., every two, three or four weeks) for a suitable
period.
[0122] In any of the methods described herein, the treatment
regimen may further comprise a follow-up period after the
maintenance period. In the follow-up period, the antibody such as
DX-2930 may be administered every 2-4 weeks at 100-300 mg, for
example 300 mg. In some instances, the dosage may increase to 400
mg in one or more of the loading period, the maintenance period,
and the follow-up period.
[0123] The pharmaceutical compositions disclosed herein may include
a "therapeutically effective amount" or a "prophylactically
effective amount" of an antibody as described herein (e.g.,
DX-2930).
Kits
[0124] An antibody as described herein (e.g., DX-2930) can be
provided in a kit, e.g., as a component of a kit. For example, the
kit includes (a) a DX-2930 antibody, e.g., a composition (e.g., a
pharmaceutical composition) that includes the antibody, and,
optionally (b) informational material. The informational material
can be descriptive, instructional, marketing or other material that
relates to a method described herein and/or the use of an antibody
as described herein (e.g., DX-2930), e.g., for a method described
herein. In some embodiments, the kit comprises one or more doses of
DX-2930. In some embodiments, the one or more doses are 30 mg, 100
mg, 150 mg, 300 mg or 400 mg.
[0125] The informational material of the kit is not limited in its
form. In one embodiment, the informational material can include
information about production of the compound, molecular weight of
the compound, concentration, date of expiration, batch or
production site information, and so forth. In one embodiment, the
informational material relates to using the antibody to treat,
prevent, or diagnosis of disorders and conditions, e.g., a plasma
kallikrein associated disease or condition.
[0126] In one embodiment, the informational material can include
instructions to administer n antibody as described herein (e.g.,
DX-2930) in a suitable manner to perform the methods described
herein, e.g., in a suitable dose, dosage form, mode of
administration or dosing schedule (e.g., a dose, dosage form,
dosing schedule or mode of administration described herein). In
another embodiment, the informational material can include
instructions to administer an antibody as described herein (e.g.,
DX-2930) to a suitable subject, e.g., a human, e.g., a human
having, or at risk for, a plasma kallikrein associated disease or
condition. For example, the material can include instructions to
administer an antibody as described herein (e.g., DX-2930) to a
patient with a disorder or condition described herein, e.g., a
plasma kallikrein associated disease, e.g., according to a dosing
schedule described herein. The informational material of the kits
is not limited in its form. In many cases, the informational
material, e.g., instructions, is provided in print but may also be
in other formats, such as computer readable material.
[0127] An antibody as described herein (e.g., DX-2930) can be
provided in any form, e.g., liquid, dried or lyophilized form. It
is preferred that an antibody be substantially pure and/or sterile.
When an antibody is provided in a liquid solution, the liquid
solution preferably is an aqueous solution, with a sterile aqueous
solution being preferred. When an antibody is provided as a dried
form, reconstitution generally is by the addition of a suitable
solvent. The solvent, e.g., sterile water or buffer, can optionally
be provided in the kit.
[0128] The kit can include one or more containers for the
composition containing an antibody as described herein (e.g.,
DX-2930). In some embodiments, the kit contains separate
containers, dividers or compartments for the composition and
informational material. For example, the composition can be
contained in a bottle, vial, or syringe, and the informational
material can be contained in association with the container. In
other embodiments, the separate elements of the kit are contained
within a single, undivided container. For example, the composition
is contained in a bottle, vial or syringe that has attached thereto
the informational material in the form of a label. In some
embodiments, the kit includes a plurality (e.g., a pack) of
individual containers, each containing one or more unit dosage
forms (e.g., a dosage form described herein) of an antibody as
described herein (e.g., DX-2930). For example, the kit includes a
plurality of syringes, ampules, foil packets, or blister packs,
each containing a single unit dose of an antibody as described
herein (e.g., DX-2930). The containers of the kits can be air
tight, waterproof (e.g., impermeable to changes in moisture or
evaporation), and/or light-tight.
[0129] The kit optionally includes a device suitable for
administration of the composition, e.g., a syringe, or any such
delivery device. In one embodiment, the device is an implantable
device that dispenses metered doses of the antibody. The disclosure
also features a method of providing a kit, e.g., by combining
components described herein.
Treatment
[0130] In some aspects, the disclosure provides the use of an
antibody as described herein (e.g., DX-2930) in treating HAE.
Hereditary Angioedema
[0131] Hereditary angioedema (HAE) is also known as "Quincke
edema," C1 esterase inhibitor deficiency, C1 inhibitor deficiency,
and hereditary angioneurotic edema (HANE). HAE is characterized by
recurrent episodes of severe swelling (angioedema), which can
affect, e.g., the limbs, face, genitals, gastrointestinal tract,
and airway. Symptoms of HAE include, e.g., swelling in the arms,
legs, lips, eyes, tongue, and/or throat; airway blockage that can
involve throat swelling and sudden hoarseness; repeat episodes of
abdominal cramping without obvious cause; and/or swelling of the
intestines, which can be severe and can lead to abdominal cramping,
vomiting, dehydration, diarrhea, pain, and/or shock. About
one-third of individuals with this HAE develop a non-itchy rash
called erythema marginatum during an attack.
[0132] Swelling of the airway can be life threatening and causes
death in some patients. Mortality rates are estimated at 15-33%.
HAE leads to about 15,000-30,000 emergency department visits per
year.
[0133] Trauma or stress, e.g., dental procedures, sickness (e.g.,
viral illnesses such as colds and the flu), menstruation, and
surgery can trigger an attack of angioedema. To prevent acute
attacks of HAE, patients can attempt to avoid specific stimuli that
have previously caused attacks. However, in many cases, an attack
occurs without a known trigger. Typically, HAE symptoms first
appear in childhood and worsen during puberty. On average,
untreated individuals have an attack every 1 to 2 weeks, and most
episodes last for about 3 to 4 days
(ghr.nlm.nih.gov/condition/hereditary-angioedema). The frequency
and duration of attacks vary greatly among people with hereditary
angioedema, even among people in the same family.
[0134] There are three types of HAE, known as types I, II, and II,
all of which can be treated by the methods described herein. It is
estimated that HAE affects 1 in 50,000 people, that type I accounts
for about 85 percent of cases, type II accounts for about 15
percent of cases, and type III is very rare. Patients having type I
or type II HAE are typically deficient in C1-INH. Such patients
either have a defective C1-INH gene and thus do not produce C1-INH,
or produce atypical C1-INH proteins. Type III is the most newly
described form and was originally thought to occur only in women,
but families with affected males have been identified. Type III HAE
is believed to be unassociated with C1-INH. Patients having type
III HAE may have normal C1-INH proteins.
[0135] HAE is inherited in an autosomal dominant pattern, such that
an affected person can inherit the mutation from one affected
parent. New mutations in the gene can also occur, and thus HAE can
also occur in people with no history of the disorder in their
family. It is estimated that 20-25% of cases result from a new
spontaneous mutation.
[0136] Mutations in the SERPING1 gene cause hereditary angioedema
type I and type II. The SERPING1 gene provides instructions for
making the C1 inhibitor protein, which is important for controlling
inflammation. C1 inhibitor blocks the activity of certain proteins
that promote inflammation. Mutations that cause hereditary
angioedema type I lead to reduced levels of C1 inhibitor in the
blood. In contrast, mutations that cause type II result in the
production of a C1 inhibitor that functions abnormally. Without the
proper levels of functional C1 inhibitor, excessive amounts of
bradykinin are generated. Bradykinin promotes inflammation by
increasing the leakage of fluid through the walls of blood vessels
into body tissues. Excessive accumulation of fluids in body tissues
causes the episodes of swelling seen in individuals with hereditary
angioedema type I and type II.
[0137] Mutations in the F12 gene are associated with some cases of
hereditary angioedema type III. The F12 gene provides instructions
for making coagulation factor XII. In addition to playing a
critical role in blood clotting (coagulation), factor XII is also
an important stimulator of inflammation and is involved in the
production of bradykinin. Certain mutations in the F12 gene result
in the production of factor XII with increased activity. As a
result, more bradykinin is generated and blood vessel walls become
more leaky, which leads to episodes of swelling. The cause of other
cases of hereditary angioedema type III remains unknown. Mutations
in one or more as-yet unidentified genes may be responsible for the
disorder in these cases.
[0138] HAE can present similarly to other forms of angioedema
resulting from allergies or other medical conditions, but it
differs significantly in cause and treatment. When hereditary
angioedema is misdiagnosed as an allergy, it is most commonly
treated with antihistamines, steroids, and/or epinephrine, which
are typically ineffective in HAE, although epinephrine can be used
for life-threatening reactions. Misdiagnoses have also resulted in
unnecessary exploratory surgery for patients with abdominal
swelling, and in some HAE patients abdominal pain has been
incorrectly diagnosed as psychosomatic.
[0139] C1 inhibitor therapies, as well as other therapies for HAE,
are described in Kaplan, A. P., J Allergy Clin Immunol, 2010,
126(5):918-925.
[0140] Acute treatment of HAE attacks is provided to halt
progression of the edema as quickly as possible. C1 inhibitor
concentrate from donor blood, which is administered intravenously,
is one acute treatment; however, this treatment is not available in
many countries. In emergency situations where C1 inhibitor
concentrate is not available, fresh frozen plasma (FFP) can be used
as an alternative, as it also contains C1 inhibitor.
[0141] Purified C1 inhibitor, derived from human blood, has been
used in Europe since 1979. Several C1 inhibitor treatments are now
available in the U.S. and two C1 inhibitor products are now
available in Canada. Berinert P (CSL Behring), which is
pasteurized, was approved by the F.D.A. in 2009 for acute attacks.
Cinryze (ViroPharma), which is nanofiltered, was approved by the
F.D.A. in 2008 for prophylaxis. Rhucin (Pharming) is a recombinant
C1 inhibitor under development that does not carry the risk of
infectious disease transmission due to human blood-borne
pathogens.
[0142] Treatment of an acute HAE attack also can include
medications for pain relief and/or IV fluids.
[0143] Other treatment modalities can stimulate the synthesis of C1
inhibitor, or reduce C1 inhibitor consumption. Androgen
medications, such as danazol, can reduce the frequency and severity
of attacks by stimulating production of C1 inhibitor.
[0144] Helicobacter pylori can trigger abdominal attacks.
Antibiotics to treat h. pylori will decrease abdominal attacks.
[0145] Newer treatments attack the contact cascade. Ecallantide
(KALBITOR.RTM., DX-88, Dyax) inhibits plasma kallikrein and has
been approved in the U.S. Icatibant (FIRAZYR.RTM., Shire) inhibits
the bradykinin B2 receptor, and has been approved in Europe and the
U.S.
[0146] Diagnosis of HAE can rely on, e.g., family history and/or
blood tests. Laboratory findings associated with HAE types I, II,
and III are described, e.g., in Kaplan, A. P., J Allergy Clin
Immunol, 2010, 126(5):918-925. In type I HAE, the level of C1
inhibitor is decreased, as is the level of C4, whereas C1q level is
normal. In type II HAE, the level of C1 inhibitor is normal or
increased; however, C1 inhibitor function is abnormal. C4 level is
decreased and C1q level is normal. In type III, the levels of C1
inhibitor, C4, and C1q can all be normal.
[0147] Symptoms of HAE can be assessed, for example, using
questionnaires, e.g., questionnaires that are completed by
patients, clinicians, or family members. Such questionnaires are
known in the art and include, for example, visual analog scales.
See, e.g., McMillan, C. V. et al. Patient. 2012; 5(2):113-26.
Treating HAE with Anti-PKal Antibodies
[0148] The disclosure provides methods of treating (e.g.,
ameliorating, stabilizing, or eliminating one or more symptoms) of
hereditary angioedema (HAE) by administering an antibody described
herein (e.g., a therapeutically effective amount of an antibody
described herein) to a subject having or suspected of having HAE,
e.g., according to a dosing schedule described herein. Additionally
provided are methods of treating HAE by administering an antibody
described herein (e.g., a therapeutically effective amount of an
antibody described herein), e.g., according to a dosing schedule
described herein, or in combination with a second therapy, e.g.,
with one other agent, e.g., described herein. The disclosure also
provides methods of preventing HAE or a symptom thereof by
administering an antibody described herein (e.g., a
prophylactically effective amount of an antibody described herein)
to a subject at risk of developing HAE (e.g., a subject having a
family member with HAE or a genetic predisposition thereto), e.g.,
according to a dosing schedule described herein. In some examples,
the subject may be a human patient who has no HAE symptoms at the
time of the treatment.
[0149] Treating includes administering an amount effective to
alleviate, relieve, alter, remedy, ameliorate, improve or affect
the disorder, the symptoms of the disorder or the predisposition
toward the disorder. The treatment may also delay onset, e.g.,
prevent onset, or prevent deterioration of a disease or
condition.
[0150] Methods of administering DX-2930 antibodies are also
described in "Pharmaceutical Compositions." Suitable dosages of the
antibody used can depend on the age and weight of the subject and
the particular drug used. The antibody can be used as competitive
agents to inhibit, reduce an undesirable interaction, e.g., between
plasma kallikrein and its substrate (e.g., Factor XII or HMWK). The
dose of the antibody can be the amount sufficient to block 90%,
95%, 99%, or 99.9% of the activity of plasma kallikrein in the
patient, especially at the site of disease. This may require 30 mg,
100 mg, 300 mg, or 400 mg, e.g., administered every two weeks.
[0151] In one embodiment, the antibodies are used to inhibit an
activity (e.g., inhibit at least one activity of plasma kallikrein,
e.g., reduce Factor XIIa and/or bradykinin production) of plasma
kallikrein, e.g., in vivo. The binding proteins can be used by
themselves or conjugated to an agent, e.g., a cytotoxic drug,
cytotoxin enzyme, or radioisotope.
[0152] The antibodies can be used directly in vivo to eliminate
antigen-expressing cells via natural complement-dependent
cytotoxicity (CDC) or antibody dependent cellular cytotoxicity
(ADCC). The antibodies described herein can include complement
binding effector domain, such as the Fc portions from IgG1, -2, or
-3 or corresponding portions of IgM which bind complement. In one
embodiment, a population of target cells is ex vivo treated with an
antibody described herein and appropriate effector cells. The
treatment can be supplemented by the addition of complement or
serum containing complement. Further, phagocytosis of target cells
coated with an antibody described herein can be improved by binding
of complement proteins. In another embodiment target, cells coated
with the antibody which includes a complement binding effector
domain are lysed by complement.
[0153] Methods of administering DX-2930 antibodies are described in
"Pharmaceutical Compositions." Suitable dosages of the molecules
used will depend on the age and weight of the subject and the
particular drug used. The antibodies can be used as competitive
agents to inhibit or reduce an undesirable interaction, e.g.,
between a natural or pathological agent and the plasma
kallikrein.
[0154] A therapeutically effective amount of an antibody as
described herein, can be administered to a subject having,
suspected of having, or at risk for HAE, thereby treating (e.g.,
ameliorating or improving a symptom or feature of a disorder,
slowing, stabilizing and/or halting disease progression) the
disorder.
[0155] The antibody described herein can be administered in a
therapeutically effective amount. A therapeutically effective
amount of an antibody is the amount which is effective, upon single
or multiple dose administration to a subject, in treating a
subject, e.g., curing, alleviating, relieving or improving at least
one symptom of a disorder in a subject to a degree beyond that
expected in the absence of such treatment.
[0156] Dosage regimens can be adjusted to provide the optimum
desired response (e.g., a therapeutic response). For example, a
single bolus may be administered, several divided doses may be
administered over time or the dose may be proportionally reduced or
increased as indicated by the exigencies of the therapeutic
situation. It is especially advantageous to formulate parenteral
compositions in dosage unit form for ease of administration and
uniformity of dosage. Dosage unit form as used herein refers to
physically discrete units suited as unitary dosages for the
subjects to be treated; each unit contains a predetermined quantity
of active compound calculated to produce the desired therapeutic
effect in association with the required pharmaceutical carrier.
[0157] In some embodiments, the DX-2930 antibody is administered by
multiple doses such as once every 2 weeks, once every 3 weeks, once
every four weeks, once every 6 weeks, once every 8 weeks or less
frequent. Each of the multiple doses can be 30 mg, 100 mg, 150 mg,
300 mg, 350 mg. or 400 mg. In some instances, a patient may be
given multiple doses once every 2 weeks, for a suitable period of
time. In some embodiments, DX-2930 can be administered at 300 mg or
400 mg every two weeks. In other embodiments, DX-2930 can be
administered at 300 mg or 400 mg every four weeks. In yet other
embodiments, DX-2930 can be administered at 150 mg every four
weeks. In any of the methods described herein, a subject treated by
DX-2930 for multiple doses as described herein may be followed up
with a maintenance treatment.
[0158] In any of the methods described herein, a subject may be
treated by DX-2930 for multiple doses in a loading period and then
followed up with a maintenance period. In the loading period, the
subject may be treated with DX-2930 at about 100 mg to about 400 mg
(e.g., 100-300 mg or 150-300 mg, for example, 100 mg, 150 mg, 200
mg, 300 mg, or 400 mg) once every 2-4 weeks (for example, every 2
weeks, every 3 weeks, or every 4 weeks) for a suitable period. In
the loading period, the subject may be treated with DX-2930 at
about 100 mg to about 300 mg (e.g., 100-300 mg or 150-300 mg, for
example, 100 mg, 150 mg, 200 mg, or 300 mg) once every 2-4 weeks
(for example, every 2 weeks, every 3 weeks, or every 4 weeks) for a
suitable period.
[0159] In some embodiments, the patient can be monitored for side
effects (e.g., elevation of creatine phosphatase levels) and/or
inhibition levels of pKal by the antibody (e.g., serum or plasma
concentration of the antibody or the pKal activity level) before
and after the treatment or during the course of treatment. If
adverse effect is observed, the dose of the antibody might be
reduced or the treatment might be terminated. If the inhibition
level is below a minimum therapeutic level, further doses of the
antibody might be administered to the patient.
[0160] In some embodiments, the plasma or serum concentration of
the antibody (e.g., DX-2930) may be measured during the course of
the treatment (e.g., after the initial dosage) for assessing the
efficacy of the treatment. If the plasma or serum concentration of
the antibody is lower than about 80 nM, a follow-up dosage may be
needed, which may be the same or higher than the initial dosage.
The plasma or serum concentration of the antibody may be measured
by determining the protein level of the antibody in a plasma or
serum sample obtained from the subject, e.g., by an immune assay or
MS assay. The plasma or serum concentration of the antibody may
also be measured by determining the inhibitory level of pKal in a
plasma or serum sample obtained from a subject treated with the
antibody. Such assays may include the synthetic substrate assay or
the Western blot assay for measuring cleaved kininogen as described
herein.
[0161] Alternatively or in addition, the plasma or serum level of
creatine kinase can be monitored during the course of the
treatment. If the plasma or serum level of creatine kinase is found
to elevate during the treatment, the dosage of the antibody may be
reduced or the treatment may be terminated.
[0162] In some embodiments, an optimal dosage (e.g., optimal
prophylactic dosage or optimal therapeutic dosage) of the antibody
(e.g., DX-2930) may be determined as follows. The antibody is given
to a subject in need of the treatment at an initial dose. The
plasma concentration of the antibody in the subject is measured. If
the plasma concentration is lower than 80 nM, the dose of the
antibody is increased in a subsequent administration. A dosage of
the antibody that maintains the antibody plasma concentration above
about 80 nM can be chosen as the optimal dosage for the subject.
The creatine phosphokinase level of the subject can be monitored
during the course of treatment and the optimal dosage for that
subject can be further adjusted based on the creatine phosphokinase
level, e.g., the dosage of the antibody might be reduced is
elevation of creatine phosphokinase is observed during treatment.
In some embodiments, the antibody such as DX-2930 is administered
to reduce the level of cleaved kininogen to levels comparable to
healthy subjects.
[0163] In some embodiments, any of the antibodies disclosed herein,
such as DX-2930 and its functional variants, may be used to prevent
HAE attack or reduce the rate of HAE attack in human patients
having history of HAE attack. In some examples, the human patients
experienced at least two HAE attacks per year and optionally at
least one within the 6 months prior to the treatment. In other
examples, the human patients experienced at least two HAE attacks
within 3 months prior to the treatment. In other examples, the
human patients had at least 9 HAE attacks within 3 months prior to
the treatment and optionally at least 25 attacks (e.g., 36 attacks)
within 12 months prior to the treatment.
Combination Therapies
[0164] An antibody as described herein (e.g., DX-2930) can be
administered in combination with one or more of the other therapies
for treating a disease or condition associated with plasma
kallikrein activity, e.g., a disease or condition described herein.
For example, an antibody as described herein (e.g., DX-2930) can be
used therapeutically or prophylactically with surgery, another
anti-plasma kallikrein Fab or IgG (e.g., another Fab or IgG
described herein), another plasma kallikrein inhibitor, a peptide
inhibitor, or small molecule inhibitor. Examples of plasma
kallikrein inhibitors that can be used in combination therapy with
a plasma kallikrein binding antibodies described herein include
plasma kallikrein inhibitors described in, e.g., WO 95/21601 or WO
2003/103475.
[0165] One or more plasma kallikrein inhibitors can be used in
combination with an antibody as described herein (e.g., DX-2930).
For example, the combination can result in a lower dose of the
inhibitor being needed, such that side effects are reduced.
[0166] An antibody as described herein (e.g., DX-2930) can be
administered in combination with one or more current therapies for
treating HAE. For example, DX-2930 antibody can be co-used with a
second anti-HAE therapeutic agent such as ecallantide, a C1
esterase inhibitor (e.g., CINRYZE.TM.), aprotinin (TRASYLOL.RTM.),
and/or a bradykinin B2 receptor inhibitor (e.g., icatibant
(FIRAZYR.RTM.)).
[0167] The term "combination" refers to the use of the two or more
agents or therapies to treat the same patient, wherein the use or
action of the agents or therapies overlaps in time. The agents or
therapies can be administered at the same time (e.g., as a single
formulation that is administered to a patient or as two separate
formulations administered concurrently) or sequentially in any
order. Sequential administrations are administrations that are
given at different times. The time between administration of the
one agent and another agent can be minutes, hours, days, or weeks.
The use of a plasma kallikrein binding antibody described herein
can also be used to reduce the dosage of another therapy, e.g., to
reduce the side effects associated with another agent that is being
administered. Accordingly, a combination can include administering
a second agent at a dosage at least 10, 20, 30, or 50% lower than
would be used in the absence of the plasma kallikrein binding
antibody.
[0168] A combination therapy can include administering an agent
that reduces the side effects of other therapies. The agent can be
an agent that reduces the side effects of a plasma kallikrein
associated disease treatment.
[0169] Without further elaboration, it is believed that one skilled
in the art can, based on the above description, utilize the present
invention to its fullest extent. The following specific embodiments
are, therefore, to be construed as merely illustrative, and not
limitative of the remainder of the disclosure in any way
whatsoever. All publications cited herein are incorporated by
reference for the purposes or subject matter referenced herein.
EXAMPLES
Example 1: A Phase 1b, Double-Blind, Multiple Ascending Dose Study
to Assess Safety, Tolerability and Pharmacokinetics of DX-2930 in
Hereditary Angioedema Subjects
[0170] A phase 1b trial was conducted to assess safety and
tolerability of multiple subcutaneous administrations of DX-2930 at
different dose levels in hereditary angioedema (HAE) subjects. HAE
patients included in the study included those with documented
diagnosis of HAE (Type I or Type II) based upon all of the
following: documented clinical history consistent with HAE
(subcutaneous or mucosal, nonpruritic swelling episodes without
accompanying urticaria), C1 inhibitor (C1-INH) antigen or
functional level <40% of the normal level (Subjects with antigen
or functional C1-INH level 40-50% of the normal level were enrolled
if they also had a C4 level below the normal range and a family
history consistent with HAE Type I or II), age at reported onset of
first angioedema symptoms .ltoreq.30 years or a family history
consistent with HAE Type I or II, and experiencing .gtoreq.2 HAE
attacks per year, with at least 1 attack in the past 6 months
reported by the subject. HAE patients enrolled were randomized in a
2:1 ratio of active drug to placebo and administered subcutaneous
doses of DX-2930 at 30 mg (n=4), 100 mg (n=4), 300 mg (n=5), and
400 mg (n=l 1) or placebo (n=13) in two doses separated by 14 days.
One patient in the 400 mg group received only one dose and then was
unavailable for the second dose and was replaced. The replacement
patient was also unable to complete the study for reasons not
related to the study, resulting a total of 10 patients completing
the 400 mg dose and being included in the assessment. Plasma was
collected at time points following administration out to day 120
(15 weeks), except in the group that received the 400 mg dose,
where data was available up to day 50. Analyses included safety,
pharmacokinetics, pharmacodynamics (biomarkers), and efficacy. The
drug group and the placebo group were baled in terms of age, race,
ethnicity, and BMI, although there were slightly more females
present in the DX-2930 (67%) vs placebo (54%) groups.
Pharmacokinetics of DX-2930
[0171] DX-2930 drug levels were measured in plasma by a validated
immunoassay that used an anti-idiotypic antibody against DX-2930
(M293-D02). From the plot of mean plasma drug levels for each dose
group versus days following DX-2930 administration, it was evident
that drug levels were dose dependent and exhibited a prolonged
half-life, typical of a human monoclonal antibody. Key
pharmacokinetic observations are summarized in Table 2 and FIG. 1.
First, C.sub.max drug levels increased with increasing dose, as
expected. In addition, the T.sub.max following the second dose was
about 20 days and the half-life was approximately 14 days. These
parameters were consistent with values obtained in a phase 1a study
in healthy volunteers and supported either once or twice a month
dosing.
TABLE-US-00003 TABLE 2 Pharmacokinetic observations Doses C.sub.max
(ng/ml) T.sub.max (days) t.sup.1/2 (days) 30 mg 3895.0 (2159.8)
17.9 (1.1) 14.2 (0.8) 100 mg 7890.0(2058.4) 18.0 (0.5) 14.6 (3.4)
300 mg 27460.0 (14542.5) 18.2 (1.5) 13.8 (3.3) 400 mg 45322.2
(8704.6) 17.7 (1.0) 15.0 (2.4)
Values presented are the mean values for the evaluated patients
with the standard deviation in parentheses.
Pharmacodynamic Activity of DX-2930: Fluorogenic Activity Assay
[0172] Two different biomarker assays were used to investigate the
pharmacodynamic (PD) activity of DX-2930 in HAE patient plasma. The
first PD assay is referred to as the Fluorogenic Activity assay,
and it provides a measure of the bioactivity of DX-2930 in citrated
plasma obtained from treated patients at the same time points
following dosing as used to determine the pharmacokinetic
properties of DX-2930. This assay measured the amount of active
plasma kallikrein that is generated in diluted plasma after
activation of the contact pathway. Specifically, dilute plasma was
spiked with active Factor XIIa (FXIIa) which propagates the
enzymatic cascade of the contact pathway, after 2 minutes the FXIIa
inhibitor Corn Trypsin Inhibitor was added to stop the reaction,
and the amount of active plasma kallikrein present in the sample
was measured by its ability to hydrolyze a pro-fluorescent
synthetic peptide substrate. The presence of increasing levels of
DX-2930 in the plasma of treated healthy volunteers (phase 1a
study) or HAE patients (phase 1b study) was associated with a dose
dependent reduction in the observed plasma kallikrein enzymatic
rate (FIG. 2). The percent inhibition observed at each time point
was calculated relative to the amount of plasma kallikrein activity
in the pre-dose samples for each patient. The observed bioactivity
in FIG. 2 was well correlated with the pharmacokinetic properties
of DX-2930 in FIG. 1. Marked inhibition was observed in the 300 and
400 mg doses following dosing. Intermediate inhibition was observed
in the 100 mg dose and no apparent inhibition was evident in the 30
mg dose.
Pharmacodynamic Activity of DX-2930: Western Blot Assay
[0173] HAE patients are deficient in C1-Inhibitor, the endogenous
inhibitor of plasma kallikrein. As a result, these patients have
elevated active plasma kallikrein, which converts its 1-chain high
molecular weight kininogen substrate to 2-chain and bradykinin, the
key mediator of pain and edema in HAE. DX-2930 is a highly potent
inhibitor of active plasma kallikrein that blocks 2-chain and
bradykinin generation.
[0174] A Western blot assay was developed to measure the relative
amounts of 1-chain and 2-chain high molecular weight kininogen in
plasma in different plasma anti-coagulants and treatment
conditions. FIG. 3 shows the %2-chain that was observed in HAE
patient plasma collected in the presence of protease inhibitors
(SCAT169 plasma). The presence of SCAT169 plasma prevented the
activation of the contact system and subsequent 2-chain generation
that can occur during blood collection and processing to plasma.
Hence, this level of 2-chain was expected to closely match that of
endogenous levels in HAE patients in the phase 1b trial (27%) and
in healthy volunteers (12%). DX-2930 treated HAE patients exhibited
lower 2-chain levels as measured in samples collected either 8 or
22 days after dosing.
[0175] In FIG. 4, pre-dose citrated plasma obtained from the HAE
patients in the phase 1b trial contained approximately 52% 2-chain.
In contrast, citrated plasma samples from healthy volunteers
obtained in a phase 1a study contained approximately 8% 2-chain.
Mean 2-chain levels in plasma of phase 1b subjects collected on
days 8 and 22 were also investigated and are shown in FIG. 4. The
statistically significant reduction in 2-chain levels in the 300
and 400 mg dose groups versus pre-dose levels demonstrated
pharmacodynamic activity of DX-2930.
[0176] FIG. 5 shows that citrated plasma from DX-2930 dosed HAE
patients exhibited less 2-chain following ex vivo activation with
coagulation factor XIIa (FXIIa). The 300 and 400 mg dose groups
reduced the amount of 2-chain to a level below that observed in
healthy volunteers. This ex vivo activation may be considered an in
vitro model of a severe HAE attack.
[0177] Both of these PD biomarker assays supported dose selection
that would achieve drug levels obtained at the 300 and 400 mg dose
groups.
Safety
[0178] A summary of adverse events is shown in Table 3 below. There
was no imbalance in treatment emergent adverse events (TEAEs) that
would indicated a safety concern of DX-2930. Most common AEs were
HAE attacks, injection site pain, and headache. There were 3 severe
TEAEs (injection site pain lasting 1 min, worsening headache
lasting 1 minute and night sweats). No safety signals were
identified for clinical laboratory abnormalities or changes from
baseline, vital signs or physical examinations, or abnormalities or
changes in electrocardiogram (ECG). These results suggest that
DX-2930 appears to be well tolerated in HAE patients at doses up to
400 mg.
TABLE-US-00004 TABLE 3 Summary of treatment adverse events All
DX-2930 DX-2930 DX-2930 DX-2930 DX-2930 30 mg 100 mg 300 mg 400 mg
treated Placebo (N = 4) (N = 4) (N = 5) (N = 11) (N = 24 (N = 13)
TEAEs* 1 3 2 8 14 (58%) 10 (77%) Deaths or 0 0 0 0 0 0 subject
discontinuations Serious adverse 0 0 0 0 0 1 (8%) events Severe
TEAEs 1 0 2 2 5 (21%) 5 (39%) Related 1 2 0 4 7 (29%) 5 (39%)
TEAEs** *TEAE: Treatment Emergent Adverse Events, An AE is
treatment emergent if the onset time is after administration of
study drug through the Day 120 post dose final follow-up visit, or
in the event that onset time precedes study drug administration,
the AE increases in severity during the 120 day post dose follow-up
period. **Treatment-related AEs: Relatedness of AEs to study drug
was assessed by a blinded investigator.
Immunogenicity
[0179] 5 patients were anti-drug antibody positive (2 of the 5 had
intermittent, fluctuating results). However, no positive samples
were neutralizing, there was no clinical evidence of
hypersensitivity, and no apparent effects on pharmacokinetics or
biomarkers.
Efficacy Assessment
[0180] A prospective primary efficacy analysis was performed, which
focused on the 300 and 400 mg doses of DX-2930, individually and
combined, compared to placebo. A six week primary assessment period
(Day 8 to Day 50) was used (FIGS. 6A and 6B), as PK modeling from
phase 1a suggested notable drug exposure during this time interval.
The primary analysis focused upon subjects with a minimum baseline
history of at least 2 attacks in the past 3 months. Most of the
subjects fulfilled the minimum required baseline history of at
least 2 attacks in the past 3 months. Of the 13 placebo subjects,
11 met this requirement. Of the 16 subjects treated with 300 or 400
mg DX-2930, 15 met this requirement. The baseline HAE attack rates
in the placebo, 300 mg, and 400 mg groups were 0.39, 0.33, and 0.55
attacks per week, respectively. The baseline rate in the combined
300 and 400 mg group was 0.49 attacks per week.
[0181] The primary approach was an intent-to-treat (ITT) analysis.
A model of repeated measurements was used, with an analysis of
variance (ANOVA) employing baseline attack rates as a covariate.
The read-out was expressed as a percent reduction in HAE attacks by
DX-2930 in comparison to the placebo attack rates, and p values
were calculated.
[0182] Results of the efficacy assessment are shown in Table 4 and
5 and in FIG. 7, which both show a reduction in HAE attack rate
with the 300 and 400 mg doses of DX-2930, individually and
combined, compared to the placebo. In particular, 13 of the 15
DX-2930 subjects treated with 300 or 400 mg were attack-free for
the duration of the study, whereas for the placebo group, only 3 of
the 11 subjects were attack-free.
TABLE-US-00005 TABLE 4 Reduction in HAE attack rate from day 8 to
50 DX-2930 DX-2930 DX-2930 Combined 300 mg 400 mg 300 and 400 mg (N
= 4) (N = 11) (N = 15) % Reduction vs placebo 100 88 91 P-value vs
placebo* <0.0001 0.005 0.0012 Note: Only subjects who have a
baseline attack rate of at least 2 attacks in the last 3 months
were included. *Mixed Model Repeated Measurements with Analysis of
Variance (baseline attack frequency as covariate) and assuming
Poisson distribution.
TABLE-US-00006 TABLE 5 Proportion of subjects who were attack-free
DX-2930 DX-2930 DX-2930 Combined 300 mg 400 mg 300 and 400 mg
Placebo (N = 4) (N = 11) (N = 15) (N = 11) Aftack-free 4/4 (100%)
9/11 (82%) 13/15 (87%) 3/11 (27%) subjects (Day 8 to p = 0.026 p =
0.030 p = 0.004 50)
[0183] Among the placebo subjects, there were a total of 24 attacks
during the primary efficacy assessment period. Of these 24 attacks,
the primary attack location was abdominal in 13 and laryngeal in 1
of them. 10 of the attacks were severe and 6 were moderate. Acute
treatment for the attacks was received in 22 of the 24 attacks.
[0184] Among subjects treated with 300 or 400 mg DX-2930, one
subject treated with 400 mg had a single HAE attack. This attack
was peripheral, mild, lasted 8 hours, and did not require any acute
treatment. The other 400 mg DX-2930-treated subject experiencing
attacks had two peripheral attacks. One attack was moderate and the
other was severe; both attacks were treated with acute therapy. A
summary of the characteristics of the HAE attacks is shown in Table
6.
TABLE-US-00007 TABLE 6 Characteristics of HAE attacks (Day 8 to 50)
DX-2930 DX-2930 300 mg 400 mg Placebo (N = 4) (N = 11) (N = 11)
Attacks 0 3 24 Primary Attack Location Peripheral 0 3 10 Abdominal
0 0 13 Laryngeal 0 0 1 Attack Severity Mild 0 1 8 Moderate 0 1 6
Severe 0 1 10 Acute attacks requiring 0 2 22 treatment
[0185] Next, a modified intent-to-treat (mITT) post-hoc analysis
was undertaken. The ITT population was used except 2 subjects were
excluded (one subject that did not receive 2 administrations and 1
subject that did not have HAE type 1 or type 2). Results of the
modified analysis are shown in Table 7. In this modified
intent-to-treat analysis, from Day 8 to Day 50 in comparison to
placebo, the 300 mg DX-2930 group had a 100% reduction in attacks
with a p value of less than 0.0001. The 400 mg DX-2930 group had a
95% reduction in attacks with a p value of 0.0022. The combined 300
and 400 mg DX-2930 group had a 97% reduction in HAE attacks, with a
p value of 0.0007.
TABLE-US-00008 TABLE 7 Primary efficacy analysis (Day 8 to 50)
(modified intent-to-treat analysis) DX-2930 DX-2930 DX-2930
Combined 300 mg 400 mg 300 and 400 mg (N = 4) (N = 9) (N = 13) %
Reduction vs placebo 100 95 97 P-value vs placebo* <0.0001
0.0022 0.0007 Note: Only subjects who have a baseline attack rate
of at least 2 attacks in the last 3 months are included. MITT
population excludes 2 subjects, one subject without type I or II
HAE and one subject who received only 1 administration of DX-2930.
*Mixed Model Repeated Measurements with Analysis of Variance
(baseline attack frequency as covariate) and assuming Poisson
distribution.
[0186] The incidence of HAE attacks in relation to drug exposure
over time was also evaluated. Without wishing to be bound by
theory, the hypothesis was that higher drug levels should be
correlated with prevention of HAE attacks, meaning (a) that before
dosing as well as in the few days after dosing, attacks should be
observed, (b) that as drug levels accumulate, attacks should become
rare or even absent, and (c) that as the drug levels decline,
attacks should re-emerge. The results of this evaluation are shown
in FIGS. 8-13.
[0187] In the placebo group high incidence of attacks was evident
(FIG. 8). These events were distributed throughout the entire
duration of the study without any particular pattern.
[0188] In the 30 and 100 mg DX-2930 groups, no attacks occurred
from Day 8 to Day 50 (FIGS. 9 and 10). However, the baseline attack
rates for these groups were relatively lower and the
pharmacodynamic effect for the 30 mg group was not appreciably
different from that for placebo. In the 300 mg DX-2930 group, there
were attacks that occurred prior to dosing. As drug levels rose,
the subjects became attack-free and as drug levels declined,
attacks re-emerged (FIG. 11). A similar pattern was also observed
in the 400 mg DX-2930 group (FIG. 12). Attack incidence
substantially decreased during a period of notable drug exposure,
particularly within the Day 8 to Day 50 time interval. This period
was bracketed by attacks occurring during times of lower drug
exposure, either prior to drug accumulation or as drug levels
waned. These results show that there is a clear association between
DX-2930 drug exposure and prevention of HAE attacks.
[0189] To further assess the efficacy of DX-2930, the therapeutic
effects of DX-2930 were also observed in HAE patients with high
baseline attack rates were explored. Subjects with at least 9
attacks in the past 3 months prior to dosing were identified and
evaluated. There were 6 such subjects-1 treated with placebo, 1
treated with 300 mg DX-2930, and 4 treated with 400 mg DX-2930.
[0190] In the placebo subject, attacks occurred throughout the
observation period at a high rate (FIG. 13, panel A). In contrast,
the subject treated with 300 mg DX-2930 was attack-free when drug
levels were high. (FIG. 13, panel B).
[0191] In the four subjects with high baseline attack rates who
were treated with 400 mg DX-2930, all four of these subjects were
attack-free during the Day 8 to Day 50 time interval (FIG. 13,
panels C-F). This included one subject with a very high baseline
rate of 36 attacks in the past 3 months. The pattern of attacks in
these DX-2930-treated subjects was consistent with that seen in the
300 and 400 mg groups overall. These individuals did not experience
any attacks when drug levels were high. Attacks only occurred when
drug levels were low, either prior to meaningful drug accumulation
or after drug levels declined.
[0192] From these data, it was observed that the therapeutic effect
of DX-2930 was also evident in HAE patients with high baseline
attack rates.
[0193] In summary, this study shows (a) that there were no apparent
safety signals for DX-2930, (b) that the PK profile was consistent
overall with a monoclonal antibody and supported a regimen of
dosing once every 2 weeks or even less frequently, (c) that
pharmacodynamic data demonstrated that DX-2930 normalizes the
aberrant instability of HAE plasma, at least in the context of the
kininogen biomarker assays, and (d) that a highly statistically
significant finding of HAE attack prevention by DX-2930 was
observed. Specifically, in comparison to placebo, there were 100%
and 88% reduction in attacks by the 300 and 400 mg DX-2930
treatment groups respectively. This clinical effect was logically
associated with drug exposure over time and was also observed in
the subset of patients with high baseline attack rates.
[0194] These data demonstrate proof of concept for DX-2930 in
long-term prophylaxis against HAE attacks.
Example 2: Pharmacodynamic Effect of DX-2930 on Plasma Kallikrein
in Hereditary Angioedema Patients
[0195] Attacks of hereditary angioedema (HAE) result from
uncontrolled contact system activation which generates a burst of
plasma kallikrein (pKal) that cleaves high-molecular-weight
kininogen (HMWK) to produce 2-chain HMWK and the edema-inducing
peptide, bradykinin. DX-2930 is a human monoclonal antibody
inhibitor of pKal in development for the prevention of HAE attacks.
The pharmacodynamic bioactivity of DX-2930 was assessed in subjects
with HAE.
[0196] As described in Example 1 above, the phase 1b multi-center,
double-blind study, randomized subjects with Type 1 or 2 HAE to
receive 2 subcutaneous doses of DX-2930 in dose groups of 30, 100,
300 or 400 mg (n=4, 4, 5, 11) or placebo (n=13). Blood samples were
obtained prior to and following administration of study drug (Days
1, 8, 22, 64, 92, 120). The ability of DX-2930 to inhibit pKal in
basal and FXIIA-activated citrated plasma was assessed using
Western blot for 2-chain HMWK.
[0197] The results obtained from this study showed that mean
2-chain HMWK levels were significantly reduced and essentially
normalized in the 300 and 400 mg dose groups on Days 8 and 22, and
on Days 8, 22 and 50, respectively, when compared to placebo
treated subjects. Treatment with 300 or 400 mg DX-2930 also
attenuated the burst in 2-chain generation to levels at or below
that observed in healthy individuals in FXIIA-activated samples.
Levels of 2-chain HMWK did not differ from pre-dose plasma samples
in either activated or inactivated samples collected on Days 64, 92
or 120 following DX-2930, which correspond to periods of low drug
exposure.
[0198] In sum, this study indicates that DX-2930 inhibits pKal in a
dose and time-dependent manner in HAE patients.
Example 3: Relationship Between Drug Exposure and Clinical Response
Observed in the Phase 1b Study of DX-2930 in Subjects with
Hereditary Angioedema
[0199] DX-2930 is a human monoclonal antibody inhibitor of plasma
kallikrein in development for the prevention of hereditary
angioedema (HAE) attacks. Data from the phase 1b study of DX-2930
in HAE subjects as described in Example 1 above was analyzed to
characterize the relationship between drug exposure and clinical
response.
[0200] This phase 1b multi-center, double-blind study, randomized
subjects with Type I or 2 HAE to receive 2 subcutaneous doses of
DX-2930 in dose groups of 30, 100, 300 or 400 mg (n=4, 4, 5, 11) or
placebo (n=13). In this post-hoc analysis, the incidence of HAE
attacks was evaluated in relation to drug exposure over time. In
addition, a post-hoc modified intent-to-treat efficacy analysis
(MITT) was conducted to assess clinical effect in the context of
subjects receiving the full dose regimen of DX-2930.
[0201] Placebo-treated subjects reported HAE attacks throughout the
study (9 subjects, 65 HAE attacks). In the 300 and 400 mg dose
groups, HAE attacks were reported prior to or just after initial
dosing. When drug levels were high (Day 8 to 50), all but I subject
was attack-free. As drug levels waned, attacks re-emerged. In the
MITT efficacy analysis, from Day 8 to 50 in comparison to placebo,
the 300 and 400 mg DX-2930 groups had a 100% (P<0.0001) and 95%
(P=0.0022) reduction in attacks, respectively.
[0202] Thus, this study indicates that HAE attacks were
substantially decreased or were eliminated during periods of
notable drug exposure consistent with the suggestion that higher
drug levels should correlate with HAE attack prevention.
Example 4: Modeling and Analyses to Identify Potential Dosing
Regimens of DX-2930 for the Long-Term Prophylaxis of Hereditary
Angioedema
[0203] DX-2930 is a human monoclonal antibody inhibitor of plasma
kallikrein in development for the prevention of hereditary
angioedema (HAE) attacks. Data from the Phase 1 studies of DX-2930
as described in Example 1 above were modeled and analyzed to
identify potential dosing regimens.
[0204] Pharmacokinetic, pharmacodynamic and efficacy data from the
Phase 1 clinical studies were examined. The incidence of HAE
attacks was evaluated in relation to plasma drug concentrations to
estimate steady-state trough drug levels necessary to prevent
attacks.
[0205] Dosing regimens of 300 mg DX-2930 every 2 (q2) or 4 (q4)
weeks, and 150 mg q4 weeks are being considered for the pivotal
efficacy study. Pharmacokinetic modeling predicts steady-state
trough plasma concentrations of 27,000, 9,500, and 4,750 ng/mL,
respectively. In the Phase 1b study, at 27,000 ng/mL (corresponding
to approximate drug levels at Day 22 for 300 mg DX-2930), 2-chain
high-molecular-weight kininogen was suppressed to a level
approximating that observed in healthy subjects. Three-hundred mg
q2 is therefore predicted to normalize the instability of HAE
plasma at steady state. As successful HAE prophylaxis may not
require such a high level of pharmacodynamic effect, an analysis of
clinical effect in relation to plasma drug concentrations was also
conducted. In the Phase 1b study following DX-2930 treatment, 24/25
attacks (96%), 21/25 (84%), and 18/25 attacks (72%) occurred below
plasma concentrations of 27,000, 9,500, and 4,750 ng/mL,
respectively, suggesting a meaningful range of clinical response is
associated with this range of drug exposure.
[0206] In this analysis, potential dosing regimens of DX-2930 were
identified for further clinical investigation in the pivotal
efficacy study.
Example 5: Hereditary Angioedema is Associated with Neuropathic
Pain, Systemic Lupus Erythematosis and Systemic Mastocytosis in an
Analysis of a Health Analytics Claims Database
[0207] The plasma kallikrein kinin system (KKS) has been associated
with a variety of diseases in addition to being a key mediator of
hereditary angioedema (HAE). It was explored in this study whether
HAE patients were predisposed to develop such KKS associated
diseases: abdominal aortic aneurysm, anaphylaxis, cardiac
vasoplegia syndrome, Crohn's disease, diabetic macular edema,
idiopathic anaphylaxis, neuropathic pain, psoriasis, psoriatic
arthritis, retinopathy, rheumatoid arthritis, systemic lupus
erythematosus (SLE), system mastocytosis, systemic vasculitis,
thrombotic cerebrovascular accident, and ulcerative colitis.
[0208] The Truven MarketScan Database containing individual-level
claims data from medical payers and Medicare supplemental plans for
80 million lives in the U.S. from January 2010 through July 2014
was utilized in this study. Within this dataset, an HAE population
(n=1063) and 2 control populations: an angioedema population
(n=138,851) and the general population (n=79,971,098) exclusive of
HAE patients were defined using a combination of ICD-9 and
prescription drug codes. Claims for comorbid diseases were
identified and compared across the populations with calculated odds
ratios and 95% confidence intervals (CI).
[0209] As shown in the Table 8 below, in the HAE population, SLE
was observed 2.3 times more often (OR 2.30, 95% CI: 1.47-3.59) than
the angioedema control population. Neuropathic pain was observed
1.45 times (OR 1.45, 95% CI: 1.01-2.09) and systemic mastocytosis
4.79 times (OR 4.79, 95% CI: 1.51-15.18) more often than the
angioedema control population.
TABLE-US-00009 TABLE 8 Association between HAE and Other
KSS-related Diseases HAE Angioedema Population Control Odds Ratio N
= N = (95% Associated Disease 1063 % 138,851 % Cl) Abnormal aortic
6 0.56 583 0.42 1.35 (0.60, 3.02) aneurysm (AAA) Anaphylaxis 86
8.09 15,293 11.01 0.72 (0.57, 0.89) Cardiac vasoplegia 2 0.19 88
0.06 2.97 (0.73, 12.09) syndrome Crohn's disease 6 0.56 848 0.61
0.92 (0.41, 2.07) Diabetic macular 2 0.19 140 0.10 1.87 (0.46,
7.55) edema Idiopathic 59 5.55 8,442 6.08 0.91 (0.70, 1.18)
anaphylaxis Neuropathic pain 30 2.82 2,726 1.96 1.45 (1.01, 2.09)
Psoriasis 14 1.32 2,182 1.57 0.84 (0.49, 1.42) Psoriatic arthritis
4 0.38 382 0.28 1.37 (0.51, 3.67) Retinopathy 2 0.19 85 0.06 3.08
(0.76, 12.52) Rheumatoid arthritis 30 2.82 3,093 2.23 1.27 (0.89,
1.84) Systemic lupus 20 1.88 1,148 0.83 2.30 (1.47, 3.59)
erythematosus Systemic 3 0.28 82 0.06 4.79 (1.51, 15.18)
mastocytosis Systemic vasculitis 2 0.19 189 0.14 1.38 (0.34, 5.58)
Thrombo 2 0.19 375 0.27 0.70 (0.17, 2.80) cerebrovasc accident
(CVA) Ulcerative colitis 9 0.85 902 0.65 1.31 (0.68, 2.53)
[0210] In sum, an analysis of a large longitudinal claims database
revealed that comorbid diseases of SLE, neuropathic pain and
systemic mastocytosis had a greater representation in HAE patients
than other types of angioedema, suggesting that activity of the KKS
may be contributing to the manifestations of these diseases.
[0211] Accordingly, patients having or at risk for HAE may be
predisposed to KKS-associated diseases, including neuropathic pain,
systemic lupus erythrematosus, and systemic mastocytosis. Thus,
treatment with a pKal inhibitor, such as DX-2930 may reduce the
risk for the development of such a KKS-associated disease.
Example 6: A Double-Blind Study Including a Load Period and a
Maintenance Period
[0212] A randomized, double-blind, placebo-controlled, parallel arm
study is carried out. Patients are selected for having HAE type I
or II patients with at least 1 attack per 4 weeks. A run-in period
is used to evaluate baseline HAE attack rate. The patients are
subjected to a 1:1:1 randomization into 3 different treatment arms
(300 mg DX-2930, 150 mg DX-2930, or placebo) which are administered
by subcutaneous injection. The study is designed with a load period
and a maintenance period (FIG. 14). Subjects are treated on Days 0,
7, and 14 during the loading period, followed by dosing every 2
weeks during the maintenance period (Days 28, 42, 56, 70, and
84).
Other Embodiments
[0213] All of the features disclosed in this specification may be
combined in any combination. Each feature disclosed in this
specification may be replaced by an alternative feature serving the
same, equivalent, or similar purpose. Thus, unless expressly stated
otherwise, each feature disclosed is only an example of a generic
series of equivalent or similar features.
[0214] From the above description, one skilled in the art can
easily ascertain the essential characteristics of the present
invention, and without departing from the spirit and scope thereof,
can make various changes and modifications of the invention to
adapt it to various usages and conditions. Thus, other embodiments
are also within the claims.
EQUIVALENTS
[0215] While several inventive embodiments have been described and
illustrated herein, those of ordinary skill in the art will readily
envision a variety of other means and/or structures for performing
the function and/or obtaining the results and/or one or more of the
advantages described herein, and each of such variations and/or
modifications is deemed to be within the scope of the inventive
embodiments described herein. More generally, those skilled in the
art will readily appreciate that all parameters, dimensions,
materials, and configurations described herein are meant to be
exemplary and that the actual parameters, dimensions, materials,
and/or configurations will depend upon the specific application or
applications for which the inventive teachings is/are used. Those
skilled in the art will recognize, or be able to ascertain using no
more than routine experimentation, many equivalents to the specific
inventive embodiments described herein. It is, therefore, to be
understood that the foregoing embodiments are presented by way of
examples only and that, within the scope of the appended claims and
equivalents thereto, inventive embodiments may be practiced
otherwise than as specifically described and claimed. Inventive
embodiments of the present disclosure are directed to each
individual feature, system, article, material, kit, and/or method
described herein. In addition, any combination of two or more such
features, systems, articles, materials, kits, and/or methods, if
such features, systems, articles, materials, kits, and/or methods
are not mutually inconsistent, is included within the inventive
scope of the present disclosure.
[0216] All definitions, as defined and used herein, should be
understood to control over dictionary definitions, definitions in
documents incorporated by reference, and/or ordinary meanings of
the defined terms.
[0217] The indefinite articles "a" and "an," as used herein in the
specification and in the claims, unless clearly indicated to the
contrary, should be understood to mean "at least one."
[0218] The phrase "and/or," as used herein in the specification and
in the claims, should be understood to mean "either or both" of the
elements so conjoined, i.e., elements that are conjunctively
present in some cases and disjunctively present in other cases.
Multiple elements listed with "and/or" should be construed in the
same fashion, i.e., "one or more" of the elements so conjoined.
Other elements may optionally be present other than the elements
specifically identified by the "and/or" clause, whether related or
unrelated to those elements specifically identified. Thus, as a
non-limiting example, a reference to "A and/or B", when used in
conjunction with open-ended language such as "comprising" can
refer, in one embodiment, to A only (optionally including elements
other than B); in another embodiment, to B only (optionally
including elements other than A); in yet another embodiment, to
both A and B (optionally including other elements); etc.
[0219] As used herein in the specification and in the claims, "or"
should be understood to have the same meaning as "and/or" as
defined above. For example, when separating items in a list, "or"
or "and/or" shall be interpreted as being inclusive, i.e., the
inclusion of at least one, but also including more than one, of a
number or list of elements, and, optionally, additional unlisted
items. Only terms clearly indicated to the contrary, such as "only
one of" or "exactly one of," or, when used in the claims,
"consisting of," will refer to the inclusion of exactly one element
of a number or list of elements. In general, the term "or" as used
herein shall only be interpreted as indicating exclusive
alternatives (i.e. "one or the other but not both") when preceded
by terms of exclusivity, such as "either," "one of," "only one of,"
or "exactly one of." "Consisting essentially of," when used in the
claims, shall have its ordinary meaning as used in the field of
patent law.
[0220] As used herein in the specification and in the claims, the
phrase "at least one," in reference to a list of one or more
elements, should be understood to mean at least one element
selected from any one or more of the elements in the list of
elements, but not necessarily including at least one of each and
every element specifically listed within the list of elements and
not excluding any combinations of elements in the list of elements.
This definition also allows that elements may optionally be present
other than the elements specifically identified within the list of
elements to which the phrase "at least one" refers, whether related
or unrelated to those elements specifically identified. Thus, as a
non-limiting example, "at least one of A and B" (or, equivalently,
"at least one of A or B," or, equivalently "at least one of A
and/or B") can refer, in one embodiment, to at least one,
optionally including more than one, A, with no B present (and
optionally including elements other than B); in another embodiment,
to at least one, optionally including more than one, B, with no A
present (and optionally including elements other than A); in yet
another embodiment, to at least one, optionally including more than
one, A, and at least one, optionally including more than one, B
(and optionally including other elements); etc.
[0221] It should also be understood that, unless clearly indicated
to the contrary, in any methods claimed herein that include more
than one step or act, the order of the steps or acts of the method
is not necessarily limited to the order in which the steps or acts
of the method are recited.
[0222] In the claims, as well as in the specification above, all
transitional phrases such as "comprising," "including," "carrying,"
"having," "containing," "involving," "holding," "composed of," and
the like are to be understood to be open-ended, i.e., to mean
including but not limited to. Only the transitional phrases
"consisting of" and "consisting essentially of" shall be closed or
semi-closed transitional phrases, respectively, as set forth in the
United States Patent Office Manual of Patent Examining Procedures,
Section 2111.03.
Sequence CWU 1
1
101469PRTArtificial SequenceSynthetic Polypeptide 1Met Gly Trp Ser
Cys Ile Leu Phe Leu Val Ala Thr Ala Thr Gly Ala 1 5 10 15 His Ser
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro 20 25 30
Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser 35
40 45 His Tyr Ile Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu 50 55 60 Trp Val Ser Gly Ile Tyr Ser Ser Gly Gly Ile Thr Val
Tyr Ala Asp 65 70 75 80 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ser Lys Asn Thr 85 90 95 Leu Tyr Leu Gln Met Asn Ser Leu Arg
Ala Glu Asp Thr Ala Val Tyr 100 105 110 Tyr Cys Ala Tyr Arg Arg Ile
Gly Val Pro Arg Arg Asp Glu Phe Asp 115 120 125 Ile Trp Gly Gln Gly
Thr Met Val Thr Val Ser Ser Ala Ser Thr Lys 130 135 140 Gly Pro Ser
Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly 145 150 155 160
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro 165
170 175 Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His
Thr 180 185 190 Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val 195 200 205 Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln
Thr Tyr Ile Cys Asn 210 215 220 Val Asn His Lys Pro Ser Asn Thr Lys
Val Asp Lys Arg Val Glu Pro 225 230 235 240 Lys Ser Cys Asp Lys Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu 245 250 255 Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 260 265 270 Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 275 280 285
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly 290
295 300 Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn 305 310 315 320 Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp 325 330 335 Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro 340 345 350 Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu 355 360 365 Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Glu Glu Met Thr Lys Asn 370 375 380 Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 385 390 395 400 Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 405 410
415 Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
420 425 430 Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys 435 440 445 Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu 450 455 460 Ser Leu Ser Pro Gly 465
2231PRTArtificial SequenceSynthetic Polypeptide 2Met Gly Trp Ser
Cys Ile Leu Phe Leu Val Ala Thr Ala Thr Gly Ala 1 5 10 15 His Ser
Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser 20 25 30
Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser 35
40 45 Ser Trp Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu 50 55 60 Leu Ile Tyr Lys Ala Ser Thr Leu Glu Ser Gly Val Pro
Ser Arg Phe 65 70 75 80 Ser Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu
Thr Ile Ser Ser Leu 85 90 95 Gln Pro Asp Asp Phe Ala Thr Tyr Tyr
Cys Gln Gln Tyr Asn Thr Tyr 100 105 110 Trp Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg Thr Val Ala 115 120 125 Ala Pro Ser Val Phe
Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser 130 135 140 Gly Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu 145 150 155 160
Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser 165
170 175 Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser
Leu 180 185 190 Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys
His Lys Val 195 200 205 Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser
Ser Pro Val Thr Lys 210 215 220 Ser Phe Asn Arg Gly Glu Cys 225 230
3122PRTArtificial SequenceSynthetic Polypeptide 3Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser His Tyr 20 25 30
Ile Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Gly Ile Tyr Ser Ser Gly Gly Ile Thr Val Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Tyr Arg Arg Ile Gly Val Pro Arg
Arg Asp Glu Phe Asp Ile Trp 100 105 110 Gly Gln Gly Thr Met Val Thr
Val Ser Ser 115 120 4106PRTArtificial SequenceSynthetic Polypeptide
4Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly 1
5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser
Trp 20 25 30 Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile 35 40 45 Tyr Lys Ala Ser Thr Leu Glu Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu
Thr Ile Ser Ser Leu Gln Pro 65 70 75 80 Asp Asp Phe Ala Thr Tyr Tyr
Cys Gln Gln Tyr Asn Thr Tyr Trp Thr 85 90 95 Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys 100 105 55PRTArtificial SequenceSynthetic
Polypeptide 5His Tyr Ile Met Met 1 5 617PRTArtificial
SequenceSynthetic Polypeptide 6Gly Ile Tyr Ser Ser Gly Gly Ile Thr
Val Tyr Ala Asp Ser Val Lys 1 5 10 15 Gly 713PRTArtificial
SequenceSynthetic Polypeptide 7Arg Arg Ile Gly Val Pro Arg Arg Asp
Glu Phe Asp Ile 1 5 10 811PRTArtificial SequenceSynthetic
Polypeptide 8Arg Ala Ser Gln Ser Ile Ser Ser Trp Leu Ala 1 5 10
97PRTArtificial SequenceSynthetic Polypeptide 9Lys Ala Ser Thr Leu
Glu Ser 1 5 108PRTArtificial SequenceSynthetic Polypeptide 10Gln
Gln Tyr Asn Thr Tyr Trp Thr 1 5
* * * * *