U.S. patent application number 15/920229 was filed with the patent office on 2018-09-20 for hydrophilic self-immolative linkers and conjugates thereof.
The applicant listed for this patent is AbGenomics International Inc., BioAlliance C.V.. Invention is credited to Yu-Chi HSIEH, Chiu-Chen HUANG, Rong-Hwa LIN, Shih-Yao LIN.
Application Number | 20180264131 15/920229 |
Document ID | / |
Family ID | 50979293 |
Filed Date | 2018-09-20 |
United States Patent
Application |
20180264131 |
Kind Code |
A1 |
LIN; Rong-Hwa ; et
al. |
September 20, 2018 |
HYDROPHILIC SELF-IMMOLATIVE LINKERS AND CONJUGATES THEREOF
Abstract
The present disclosure provides compounds with a hydrophilic
self-immolative linker, which is cleavable under appropriate
conditions and incorporates a hydrophilic group to provide better
solubility of the compound. The compounds of the present disclosure
comprise a drug moiety, a targeting moiety capable of targeting a
selected cell population, and a linker which contains an acyl unit,
an optional spacer unit for providing distance between the drug
moiety and the targeting moiety, a peptide linker which can be
cleavable under appropriate conditions, a hydrophilic
self-immolative linker, and an optional second self-immolative
spacer or cyclization self-elimination linker.
Inventors: |
LIN; Rong-Hwa; (Palo Alto,
CA) ; LIN; Shih-Yao; (Taipei, TW) ; HSIEH;
Yu-Chi; (New Taipei City, TW) ; HUANG; Chiu-Chen;
(Taipei, TW) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
BioAlliance C.V.
AbGenomics International Inc. |
Alkmaar
Dover |
|
NL
DE |
|
|
Family ID: |
50979293 |
Appl. No.: |
15/920229 |
Filed: |
March 13, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14654486 |
Jun 19, 2015 |
9943610 |
|
|
PCT/US2013/077306 |
Dec 20, 2013 |
|
|
|
15920229 |
|
|
|
|
61785027 |
Mar 14, 2013 |
|
|
|
61745448 |
Dec 21, 2012 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 35/00 20180101;
A61K 47/65 20170801; A61P 15/00 20180101; A61K 31/404 20130101;
A61P 11/00 20180101; C07D 295/192 20130101; A61K 38/06 20130101;
A61K 47/60 20170801; A61K 47/6889 20170801; A61K 31/407 20130101;
A61K 47/6851 20170801; A61K 47/6863 20170801; A61P 1/18 20180101;
A61K 47/6817 20170801; A61K 47/6803 20170801; A61P 1/04 20180101;
C07D 241/36 20130101; C07K 7/02 20130101 |
International
Class: |
A61K 47/68 20170101
A61K047/68; C07K 7/02 20060101 C07K007/02; C07D 295/192 20060101
C07D295/192; C07D 241/36 20060101 C07D241/36; A61K 38/06 20060101
A61K038/06; A61K 31/407 20060101 A61K031/407; A61K 47/60 20170101
A61K047/60; A61K 47/65 20170101 A61K047/65; A61K 31/404 20060101
A61K031/404 |
Claims
1-50. (canceled)
51: A method of killing a cell, comprising administering to the
cell an amount of a compound, or a salt or solvate or stereoisomer
thereof, sufficient to kill the cell, wherein the compound is of
the formula (IIa): ##STR00083## wherein: p is 1 to 20; D is a drug
moiety; T is a targeting moiety; R.sup.1 is hydrogen, unsubstituted
or substituted C.sub.1-3 alkyl, or unsubstituted or substituted
heterocyclyl; L.sup.1 is a bond, a second self-immolative linker,
or a cyclization self-elimination linker; L.sup.2 is a bond or a
second self-immolative linker; wherein if L.sup.1 is a second
self-immolative linker or a cyclization self-elimination linker,
then L.sup.2 is a bond; wherein if L.sup.2 is a second
self-immolative linker, then L.sup.1 is a bond; L.sup.3 is a
peptide linker; L.sup.4 is a bond or a spacer; and A is an acyl
unit.
52: The method of claim 51, wherein the cell is a cancer cell.
53: The method of claim 52, wherein the cancer cell is lymphoma
cell, blastoma cell, melanoma cell, sarcoma cell, gastrointestinal
cancer cell, a gastric cancer cell, pancreatic cancer cell,
colorectal cancer cell, lung cancer cell, esophageal cancer cell,
gallbladder cancer cell, head and neck cancer cell, liver cancer
cell, endometrial carcinoma cell, uterine carcinoma cell, salivary
gland carcinoma cell, breast cancer cell, cervical cancer cell,
bladder cancer cell, prostate cancer cell, kidney cancer cell or
ovarian cancer cell.
54: A method of treating cancer in an individual in need thereof
comprising administering to the individual an effective amount of a
compound, or a salt or solvate or stereoisomer thereof, wherein the
compound is of the formula (IIa): ##STR00084## wherein: p is 1 to
20; D is a drug moiety; T is a targeting moiety; R.sup.1 is
hydrogen, unsubstituted or substituted C.sub.1-3 alkyl, or
unsubstituted or substituted heterocyclyl; L.sup.1 is a bond, a
second self-immolative linker, or a cyclization self-elimination
linker; L.sup.2 is a bond or a second self-immolative linker;
wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
wherein if L.sup.2 is a second self-immolative linker, then L.sup.1
is a bond; L.sup.3 is a peptide linker, L.sup.4 is a bond or a
spacer; and A is an acyl unit.
55: The method of claim 54, wherein the cancer is lymphoma,
blastoma, melanoma, sarcoma, gastrointestinal cancer, gastric
cancer, pancreatic cancer, colorectal cancer, lung cancer,
esophageal cancer, gallbladder cancer, head and neck cancer, liver
cancer, endometrial carcinoma, uterine carcinoma, salivary gland
carcinoma, breast cancer, cervical cancer, bladder cancer, prostate
cancer, kidney cancer or ovarian cancer.
56-72. (canceled)
73: The method of claim 54, wherein L.sup.1 is a bond.
74: The method of claim 54, wherein L.sup.1 is a second
self-immolative linker or a cyclization self-elimination
linker.
75: The method of claim 74, wherein L.sup.1 is selected from the
group consisting of ##STR00085##
76: The method of claim 54, wherein L.sup.2 is a bond.
77: The method of claim 73, wherein L.sup.2 is a second
self-immolative linker.
78: The method of claim 54, wherein L.sup.3 is a peptide linker of
1 to 10 amino acid residues.
79: The method of claim 54, wherein L.sup.3 is a peptide linker
comprising an amino acid residue selected from lysine, D-lysine,
citrulline, arginine, proline, histidine, ornithine, glutamine,
valine, isoleucine, phenylalanine, methionine, asparagine, proline,
alanine, leucine, tryptophan, and tyrosine.
80: The method of claim 79, wherein L.sup.3 is a dipeptide unit
selected from valine-citrulline, proline-lysine,
methionine-D-lysine, asparagine-D-lysine, isoleucine-proline,
phenylalanine-lysine, and valine-lysine.
81: The method of claim 80, wherein L.sup.3 is
valine-citrulline.
82: The method of claim 54, wherein L.sup.4 is a bond.
83: The method of claim 54, wherein L.sup.4 is a spacer.
84: The method of claim 83, wherein the spacer is polyalkylene
glycol, alkylene, alkenylene, alkynylene, or polyamine.
85: The method of claim 83, wherein L.sup.4 is L.sup.4a-C(O),
L.sup.4a-C(O)--NH, L.sup.4a-S(O).sub.2, or L.sup.4a-S(O).sub.2--NH,
wherein each L.sup.4a is independently polyalkylene glycol,
alkylene, alkenylene, alkynylene, or polyamine.
86: The method of claim 83, wherein L.sup.4 is L.sup.4a-C(O),
wherein L.sup.4a is polyalkylene glycol, alkylene, alkenylene,
alkynylene, or polyamine.
87: The method of claim 83, wherein L.sup.4 is L.sup.4a-C(O),
wherein L.sup.4a is a polyalkylene glycol.
88: The method of claim 83, wherein L.sup.4 is L.sup.4a-C(O),
wherein L.sup.4a is a polyethylene glycol.
89: The method of claim 83, wherein the spacer is of the formula
--CH.sub.2--(CH.sub.2--O--CH.sub.2).sub.m--CH.sub.2--C(O)--,
wherein m is an integer from 0 to 30.
90: The method of claim 54, wherein A is selected from the group
consisting of ##STR00086## wherein each Q.sup.2 is NH or O, and
each q is independently an integer from 1 to 10.
91: The method of claim 90, wherein A is selected from the group
consisting of ##STR00087## wherein each Q.sup.2 is independently NH
or O and each q is independently an integer from 1 to 10.
92: The method of claim 54, wherein T is an antibody.
93: The method of claim 54, wherein T is: (a) an antibody
comprising a heavy chain variable region comprising three CDRs from
SEQ ID NO: 1 and a light chain variable region comprising three
CDRs from SEQ ID NO: 2; or (b) an antibody comprising a heavy chain
variable region comprising three CDRs from SEQ ID NO: 3 and a light
chain variable region comprising three CDRs from SEQ ID NO: 4.
94: The method of claim 92, wherein one or more amino acid residues
of the heavy chain of the antibody is replaced with a cysteine
residue.
95: The method of claim 92, wherein one or more amino acid residues
of the light chain is replaced with a cysteine residue.
96: The method of claim 92, wherein one or more amino acid residues
of the heavy chain and the light chain is replaced with a cysteine
residue.
97: The method of claim 94, wherein the one or more amino acid
residues of the heavy chain of the antibody comprises an amino acid
residue at position 157, 169 or 442 using EU numbering.
98: The method of claim 92, wherein D is linked to T by way of a
cysteine residue.
99: The method of claim 54, wherein D is an amino-containing drug
moiety, wherein the drug is connected to L.sup.1 or X through the
amino group.
100: The method of claim 99, wherein D is duocarmycin, dolastatin,
tubulysin, doxorubicin (DOX), paclitaxel, or mitomycin C (MMC), or
an amino derivative thereof.
101: The method of claim 99, wherein D is an amino derivative of
duocarmycin selected from the group consisting of ##STR00088##
102: The method of claim 99, wherein D is: ##STR00089##
103: The method of claim 54, wherein -A-L.sup.4-L.sup.3-L.sup.2- is
##STR00090##
104: The method of claim 54, wherein the ##STR00091## moiety is:
##STR00092## ##STR00093##
105: The method of claim 54, wherein the compound is formulated as
a pharmaceutical composition comprising the compound or a salt or
solvate or stereoisomer thereof, and a pharmaceutically acceptable
carrier.
106: The method of claim 54, wherein the compound is of the formula
(IIIa): ##STR00094## wherein p is 1, 2, 3 or 4; and T is an
antibody comprising a heavy chain variable region comprising amino
acids 1-118 of SEQ ID NO: 1 and a light chain variable region
comprising amino acids 1-113 of SEQ ID NO. 2.
107: The method of claim 54, wherein the compound is of the formula
(IVa): ##STR00095## wherein p is 1, 2, 3 or 4; and wherein T is an
antibody comprising a heavy chain variable region comprising amino
acids 1-118 of SEQ ID NO: 1 and a light chain variable region
comprising amino acids 1-113 of SEQ ID NO. 2.
108: The method of claim 54, wherein the compound is of the formula
(Va): ##STR00096## wherein p is 1, 2, 3 or 4; and wherein T is an
antibody comprising a heavy chain variable region comprising amino
acids 1-118 of SEQ ID NO: 1 and a light chain variable region
comprising amino acids 1-113 of SEQ ID NO. 2.
109: The method of claim 54, wherein the compound is of the formula
(IIIa): ##STR00097## wherein p is 1, 2, 3 or 4; and T is an
antibody comprising a heavy chain amino acid sequence of SEQ ID NO:
1 and a light chain amino acid sequence of SEQ ID NO:2 (h5F1Ca.
1).
110: The method of claim 54, wherein the compound is of the formula
(IVa): ##STR00098## wherein p is 1, 2, 3 or 4; and T is an antibody
comprising a heavy chain amino acid sequence of SEQ ID NO: 1 and a
light chain amino acid sequence of SEQ ID NO:2 (h5F1Ca. 1).
111: The method of claim 54, wherein the compound is of the formula
(Va): ##STR00099## wherein p is 1, 2, 3 or 4; and T is an antibody
comprising a heavy chain amino acid sequence of SEQ ID NO: 1 and a
light chain amino acid sequence of SEQ ID NO:2 (h5F1Ca. 1).
112: The method of claim 110, wherein the cancer is pancreatic
cancer, gastric cancer or colorectal cancer.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. patent application
Ser. No. 14/654,486, which adopts the international filing date of
Dec. 20, 2013, which is a National Phase application under 35
U.S.C. .sctn. 371 of International Application No.
PCT/US2013/077306, filed Dec. 20, 2013, which claims the priority
benefit of U.S. Provisional Application No. 61/745,448, filed Dec.
21, 2012 and U.S. Provisional Application No. 61/785,027, filed
Mar. 14, 2013, the disclosures of which are incorporated by
reference in their entireties.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0002] The content of the following submission on ASCII text file
is incorporated herein by reference in its entirety: a computer
readable form (CRF) of the Sequence Listing (file name:
606592000810SeqList.txt, date recorded: Mar. 27, 2018, size: 12
KB).
FIELD OF INVENTION
[0003] The invention is in the field of pharmaceuticals, and
provides drug conjugates for the delivery of drugs to cell
populations, where the prodrugs are metabolized and activated by
endogenous enzymes to provide active drugs.
BACKGROUND
[0004] Antibody-drug conjugates (ADCs) are a class of therapeutics
that combines the specificity of monoclonal antibodies (mAbs) with
the potency of cytotoxic molecules. ADCs take advantage of
characteristics of both components and significantly expand the
therapeutic index of cytotoxic molecules by minimizing systemic
exposure and associated toxicity while at the same time maximizing
delivery of the cytotoxic agents to the target lesion, thus
increasing treatment efficacy. Brentuximab Vedotin (SGN-35), an
anti-CD30 antibody conjugated with cytotoxic agent MMAE, is already
approved to treat CD30-positive relapsing lymphoma.
[0005] Target antigen selection, internalization of ADCs by tumor
cells, and potency of cytotoxic drugs are parameters for ADC
development (Carter 2008, Teicher 2009). In additional, the design
of chemical linkers to covalently bind these building blocks to
form an ADC also plays a role in the development of the ADCs (Ducry
2010). For example, the linker should be stable in the bloodstream
to limit the damage to healthy tissue. Decomposition or decay of
ADCs can release the cytotoxic drug before its delivery to the
target sites. However, once the ADCs reach the target sites, they
have to release the cytotoxic drug efficiently in its active form.
The balance between plasma stability and efficient drug release at
the target cell has yet to be found, which can depend on the linker
design.
[0006] At least three types of linkers are applied in ADC design,
namely, chemically-labile linkers, enzyme-labile linkers, and
non-cleavable linkers (Ducry 2010). For chemically labile linkers,
such as hydrazone linker for Mylotarg and disulfide-bearing
4-mercaptopentanoate linker for DM1/DM4, selective cleavage of the
linker and payload release for ADC is based upon the differential
properties of the linker between the plasma and some cytoplasmic
compartment. Linkers are relative stable in the blood's neutral pH
environment but can get cleaved once the ADC enters the lower pH
environment inside the cell. An in vivo trial demonstrated that
chemically-labile linkers often suffer from limited plasma
stability.
[0007] Enzyme-labile linkers take an alternative approach--the
differential activities of proteases inside and outside of the
cells-to achieve control of the drug release. Proteases normally
are not active outside cells due to the unfavorable pH conditions
and the presence of serum protease inhibitors. A drug can be
conjugated to antibody via peptide bond. The drug can be
specifically cleaved from the antibody by the action of lysosomal
proteases present inside the cells, and at elevated levels in
certain tumor types (Koblinsk et al). Compared to ADC with
chemically-labile linker, enzyme-labile linkers can achieve better
control of the drug release. However, the increased associated
hydrophobicity of some enzyme-labile linkers can lead to
aggregation of ADC, particularly with strongly hydrophobic
drugs.
[0008] A third class of linkers is non-cleavable linkers. The
release of the drug is believed to occur via the internalization of
the ADC followed by the degradation of the antibody component in
the lysosome, resulting in the release of the drug which is still
attached to the linker. These non-cleavable linkers are stable in
serum, but compared to enzyme-labile linkers, no bystander effect
can result due to the fact that the released drugs are charged and
are not able to diffuse into neighboring cells. Also, since
internalization of the ADC is a factor for the release of the drug,
the efficacy is antigen-(and thus antibody-) dependent.
[0009] Linker technology affects ADC potency, specificity, and
safety. There is a need for linkers for ADCs which can provide
serum stability as well as increased solubility, allowing efficient
conjugation and intracellular delivery of hydrophobic drugs.
SUMMARY
[0010] The compounds of the present disclosure comprise a drug
moiety, a targeting moiety capable of targeting a selected cell
population, and a linker which contains an acyl unit, an optional
spacer unit for providing distance between the drug moiety and the
targeting moiety, a peptide linker which can be cleavable under
appropriate conditions, a hydrophilic self-immolative linker, and
an optional second self-immolative spacer or cyclization
self-elimination linker.
[0011] The present disclosure provides a compound of Formula
(I):
##STR00001## [0012] or a salt or solvate or stereoisomer thereof;
[0013] wherein: [0014] D is drug moiety; [0015] T is a targeting
moiety; [0016] X is a hydrophilic self-immolative linker; [0017]
L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker; [0018] L.sup.2 is a bond or a
second self-immolative linker; [0019] wherein if L.sup.1 is a
second self-immolative linker or a cyclization self-elimination
linker, then L.sup.2 is a bond; [0020] wherein if L.sup.2 is a
second self-immolative linker, then L.sup.1 is a bond; [0021]
L.sup.3 is a peptide linker; [0022] L.sup.4 is bond or a spacer;
and [0023] A is an acyl unit.
[0024] In some embodiments, provided is a compound of Formula
(Ia):
##STR00002##
[0025] or a salt or solvate or stereoisomer thereof, wherein D, T,
X, L.sup.1, L.sup.2, L.sup.3, L.sup.4 and A are as defined for
Formula (I), and p is 1 to 20. In some embodiments, p is 1 to 8. In
some embodiments, p is 1 to 6. In some embodiments, p is 1 to 4. In
some embodiments, p is 2 to 4. In some embodiments, p is 1, 2, 3 or
4.
[0026] The present disclosure also provides a compound of Formula
(II):
##STR00003## [0027] or a salt or solvate or stereoisomer thereof;
[0028] wherein: [0029] D is drug moiety; [0030] T is a targeting
moiety; [0031] R.sup.1 is hydrogen, unsubstituted or substituted
C.sub.1-3 alkyl, or unsubstituted or substituted heterocyclyl;
[0032] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker; [0033] L.sup.2 is a bond, a
second self-immolative linker; [0034] wherein if L.sup.1 is a
second self-immolative linker or a cyclization self-elimination
linker, then L.sup.2 is a bond; [0035] wherein if L.sup.2 is a
second self-immolative linker, then L.sup.1 is a bond; [0036]
L.sup.3 is a peptide linker; [0037] L.sup.4 is bond or a spacer;
and [0038] A is an acyl unit.
[0039] In some embodiments, provided is a compound of Formula
(IIa):
##STR00004##
[0040] or a salt or solvate or stereoisomer thereof; wherein D, T,
L.sup.1, L.sup.2, L.sup.3, L.sup.4 and A are as defined for Formula
(II), and p is 1 to 20. In some embodiments, p is 1 to 8. In some
embodiments, p is 1 to 6. In some embodiments, p is 1 to 4. In some
embodiments, p is 2 to 4. In some embodiments, p is 1, 2, 3 or
4.
[0041] The present disclosure also provides a compound of Formula
(III):
##STR00005##
[0042] or a salt or solvate or stereoisomer thereof;
[0043] wherein T is a targeting moiety.
[0044] In some embodiments, provided is a compound of Formula
(IIIa):
##STR00006##
[0045] or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety and p is 1 to 20. In some embodiments, p is 1 to
8. In some embodiments, p is 1 to 6. In some embodiments, p is 1 to
4. In some embodiments, p is 2 to 4. In some embodiments, p is 1,
2, 3 or 4.
[0046] The present disclosure provides a compound of Formula
(IV):
##STR00007##
[0047] or a salt or solvate or stereoisomer thereof;
[0048] wherein T is a targeting moiety.
[0049] In some embodiments, provided is a compound of Formula
(IVa):
##STR00008##
[0050] or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety and p is 1 to 20. In some embodiments, p is 1 to
8. In some embodiments, p is 1 to 6. In some embodiments, p is 1 to
4. In some embodiments, p is 2 to 4. In some embodiments, p is 1,
2, 3 or 4.
[0051] The present disclosure provides a compound of Formula
(V):
##STR00009##
[0052] or a salt or solvate or stereoisomer thereof;
[0053] wherein T is a targeting moiety.
[0054] In some embodiments, provided is a compound of Formula
(Va):
##STR00010##
[0055] of a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety and p is 1 to 20. In some embodiments, p is 1 to
8. In some embodiments, p is 1 to 6. In some embodiments p is 1 to
4. In some embodiments, p is 2 to 4. In some embodiments, p is 1,
2, 3 or 4.
[0056] The present disclosure provides a compound of Formula
(VI):
##STR00011##
[0057] or a salt or solvate thereof.
[0058] The present disclosure provides a compound of Formula
(VII):
##STR00012##
[0059] or a salt or solvate thereof.
[0060] The present disclosure provides a compound of Formula
(VIII):
##STR00013##
[0061] The present disclosure provides a compound of Formula
(XII):
##STR00014##
[0062] or a salt or solvate or stereoisomer thereof; wherein R is
NO.sub.2 or NH.sub.2.
[0063] In certain embodiments, the compound of Formulae (I)-(XII)
is a compound selected from those species described or exemplified
in the detailed description herein.
[0064] In certain embodiments of the compound of Formulae (I)-(V)
or (Ia)-(Va), T is an antibody targeting molecule. In some
embodiments, T is antibody h5F1Ca. 1 or c5D7. In further
embodiments, one or more amino acid residues of the heavy chain
and/or the light chain of the antibody are replaced with cysteine
residues (e.g., engineered to comprise cysteine residue at a
position not present in the parent antibody). In some embodiments,
one or more amino acid residues of the Fc region of the antibody
are replaced with a cysteine residue. In some embodiments, one or
more amino acid residues of the Fc region of the antibody are at
positions 157, 169 and/or 442 using EU numbering. In some
embodiments of the compound of Formulae (I)-(V) or (Ia)-(Va), D is
linked to T by way of the added (e.g. engineered) cysteine
residue.
[0065] In a further aspect, the present disclosure provides a
pharmaceutical composition comprising at least one compound of
Formulae (I)-(V) or (Ia)-(Va) or a pharmaceutically acceptable salt
thereof. Pharmaceutical compositions according to the embodiments
may further comprise a pharmaceutically acceptable excipient. The
present disclosure also provides a compound of Formulae (I)-(V) or
(Ia)-(Va) or a pharmaceutically acceptable salt thereof for use as
a medicament.
[0066] In another aspect, the present disclosure provides a method
of killing a cell, comprising administering to the cell an amount
of the compound of Formulae (I)-(V) or (Ia)-(Va) sufficient to kill
the cell.
[0067] In another aspect, the present disclosure provides a method
of treating cancer in an individual in need thereof comprising
administering to the individual an effective amount of a compound
of Formulae (I)-(V) or (Ia)-(Va).
[0068] Additional embodiments, features, and advantages of the
invention will be apparent from the following detailed description
and through practice of the invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0069] FIGS. 1A and 1B show reversed-phase HPLC characterization of
certain ADCs of the present embodiments. FIG. 1A shows the
chromatogram for h5F1Ca. 1/Tap-18H. FIG. 1B shows the chromatogram
for h5F1Ca. 1/MMAE.
[0070] FIG. 2 shows in vivo anti-tumor activity by h5F1Ca. 1/Tap18H
against gastric cancer SNU-16.
[0071] FIG. 3 shows in vivo anti-tumor activity of h5F1Ca.
1-conjugated ADC against gastric cancer SNU-16.
[0072] FIG. 4 shows in vivo anti-tumor activity of c5D7-conjugated
ADC against colorectal cancer DLD-1.
[0073] FIG. 5 shows an NMR spectrum of Tap-18H.
[0074] FIG. 6 shows an NMR spectrum of Tap-18Hr1.
[0075] FIG. 7 shows an NMR spectrum of Tap-18Hr2.
DEFINITIONS
[0076] The following terms have the following meanings unless
otherwise indicated. Any undefined terms have their art recognized
meanings.
[0077] "Alkyl" refers to monovalent saturated aliphatic hydrocarbyl
groups having from 1 to 10 carbon atoms and preferably 1 to 6
carbon atoms. This term includes, by way of example, linear and
branched hydrocarbyl groups such as methyl (CH.sub.3-), ethyl
(CH.sub.3CH.sub.2--), n-propyl (CH.sub.3CH.sub.2CH.sub.2--),
isopropyl ((CH.sub.3).sub.2CH--), n-butyl
(CH.sub.3CH.sub.2CH.sub.2CH.sub.2--), isobutyl
((CH.sub.3).sub.2CHCH.sub.2--), sec-butyl
((CH.sub.3)(CH.sub.3CH.sub.2)CH--), t-butyl ((CH.sub.3).sub.3C--),
n-pentyl (CH.sub.3CH.sub.2CH.sub.2CH.sub.2CH.sub.2--), neopentyl
((CH.sub.3).sub.3CCH.sub.2--), and n-hexyl
(CH.sub.3(CH.sub.2).sub.5--).
[0078] "Alkylene" refers to divalent aliphatic hydrocarbylene
groups preferably having from 1 to 10 and more preferably 1 to 3
carbon atoms that are either straight-chained or branched. This
term includes, by way of example, methylene (--CH.sub.2--),
ethylene (--CH.sub.2CH.sub.2--), n-propylene
(--CH.sub.2CH.sub.2CH.sub.2--), iso-propylene
(--CH.sub.2CH(CH.sub.3)--),
(--C(CH.sub.3).sub.2CH.sub.2CH.sub.2--),
(--C(CH.sub.3).sub.2CH.sub.2C(O)--),
(--C(CH.sub.3).sub.2CH.sub.2C(O)NH--), (--CH(CH.sub.3)CH.sub.2--),
and the like.
[0079] "Alkenyl" refers to straight chain or branched hydrocarbyl
groups having from 2 to 10 carbon atoms and preferably 2 to 4
carbon atoms and having at least 1 and preferably from 1 to 2 sites
of double bond unsaturation. This term includes, by way of example,
bi-vinyl, allyl, and but-3-en-1-yl. Included within this term are
the cis and trans isomers or mixtures of these isomers.
[0080] "Alkenylene" refers to straight chain or branched
hydrocarbylene groups having from 2 to 10 carbon atoms and
preferably 2 to 4 carbon atoms and having at least 1 and preferably
from 1 to 2 sites of double bond unsaturation. This term includes,
by way of example, bi-vinyl, allyl, and but-3-en-1-yl. Included
within this term are the cis and trans isomers or mixtures of these
isomers.
[0081] "Alkynyl" refers to straight or branched hydrocarbyl groups
having from 2 to 6 carbon atoms and preferably 2 to 3 carbon atoms
and having at least 1 and preferably from 1 to 2 sites of triple
bond unsaturation. Examples of such alkynyl groups include
acetylenyl (--C.ident.CH), and propargyl
(--CH.sub.2C.ident.CH).
[0082] "Alkynylene" refers to straight or branched hydrocarbylene
groups having from 2 to 6 carbon atoms and preferably 2 to 3 carbon
atoms and having at least 1 and preferably from 1 to 2 sites of
triple bond unsaturation. Examples of such alkynyl groups include
acetylenyl (--C.ident.CH), and propargyl
(--CH.sub.2C.ident.CH).
[0083] "Amino" refers to the group --NH.sub.2.
[0084] "Substituted amino" refers to the group --NRR where each R
is independently selected from the group consisting of hydrogen,
alkyl, substituted alkyl, cycloalkyl, substituted cycloalkyl,
alkenyl, substituted alkenyl, cycloalkenyl, substituted
cycloalkenyl, alkynyl, substituted alkynyl, aryl, heteroaryl, and
heterocyclyl provided that at least one R is not hydrogen.
[0085] "Aryl" refers to a monovalent aromatic carbocyclic group of
from 6 to 18 carbon atoms having a single ring (such as is present
in a phenyl group) or a ring system having multiple condensed rings
(examples of such aromatic ring systems include naphthyl, anthryl
and indanyl) which condensed rings may or may not be aromatic,
provided that the point of attachment is through an atom of an
aromatic ring. This term includes, by way of example, phenyl and
naphthyl. Unless otherwise constrained by the definition for the
aryl substituent, such aryl groups can optionally be substituted
with from 1 to 5 substituents, or from 1 to 3 substituents,
selected from acyloxy, hydroxy, thiol, acyl, alkyl, alkoxy,
alkenyl, alkynyl, cycloalkyl, cycloalkenyl, substituted alkyl,
substituted alkoxy, substituted alkenyl, substituted alkynyl,
substituted cycloalkyl, substituted cycloalkenyl, amino,
substituted amino, aminoacyl, acylamino, alkaryl, aryl, aryloxy,
azido, carboxyl, carboxyl ester, cyano, halogen, nitro, heteroaryl,
heteroaryloxy, heterocyclyl, heterocyclooxy, aminoacyloxy,
oxyacylamino, thioalkoxy, substituted thioalkoxy, thioaryloxy,
thioheteroaryloxy, sulfonylamino, --SO-alkyl, --SO-substituted
alkyl, --SO-aryl, --SO-heteroaryl, --SO.sub.2-alkyl,
--SO.sub.2-substituted alkyl, --SO.sub.2-aryl,
--SO.sub.2-heteroaryl and trihalomethyl.
[0086] "Cycloalkyl" refers to cyclic alkyl groups of from 3 to 10
carbon atoms having single or multiple cyclic rings including
fused, bridged, and spiro ring systems. Examples of suitable
cycloalkyl groups include, for instance, adamantyl, cyclopropyl,
cyclobutyl, cyclopentyl, cyclooctyl and the like. Such cycloalkyl
groups include, by way of example, single ring structures such as
cyclopropyl, cyclobutyl, cyclopentyl, cyclooctyl, and the like, or
multiple ring structures such as adamantanyl, and the like.
[0087] "Heteroaryl" refers to an aromatic group of from 1 to 15
carbon atoms, such as from 1 to 10 carbon atoms and 1 to 10
heteroatoms selected from the group consisting of oxygen, nitrogen,
and sulfur within the ring. Such heteroaryl groups can have a
single ring (such as, pyridinyl, imidazolyl or furyl) or multiple
condensed rings in a ring system (for example as in groups such as,
indolizinyl, quinolinyl, benzofuran, benzimidazolyl or
benzothienyl), wherein at least one ring within the ring system is
aromatic and at least one ring within the ring system is aromatic,
provided that the point of attachment is through an atom of an
aromatic ring. In certain embodiments, the nitrogen and/or sulfur
ring atom(s) of the heteroaryl group are optionally oxidized to
provide for the N-oxide (N.fwdarw.O), sulfinyl, or sulfonyl
moieties. This term includes, by way of example, pyridinyl,
pyrrolyl, indolyl, thiophenyl, and furanyl. Unless otherwise
constrained by the definition for the heteroaryl substituent, such
heteroaryl groups can be optionally substituted with 1 to 5
substituents, or from 1 to 3 substituents, selected from acyloxy,
hydroxy, thiol, acyl, alkyl, alkoxy, alkenyl, alkynyl, cycloalkyl,
cycloalkenyl, substituted alkyl, substituted alkoxy, substituted
alkenyl, substituted alkynyl, substituted cycloalkyl, substituted
cycloalkenyl, amino, substituted amino, aminoacyl, acylamino,
alkaryl, aryl, aryloxy, azido, carboxyl, carboxyl ester, cyano,
halogen, nitro, heteroaryl, heteroaryloxy, heterocyclyl,
heterocyclooxy, aminoacyloxy, oxyacylamino, thioalkoxy, substituted
thioalkoxy, thioaryloxy, thioheteroaryloxy, sulfonylamino,
--SO-alkyl, --SO-substituted alkyl, --SO-aryl, --SO-heteroaryl,
--SO.sub.2-alkyl, --SO.sub.2-substituted alkyl, --SO.sub.2-aryl and
--SO.sub.2-heteroaryl, and trihalomethyl.
[0088] Examples of heteroaryls include, but are not limited to,
pyrrole, imidazole, pyrazole, pyridine, pyrazine, pyrimidine,
pyridazine, indolizine, isoindole, indole, purine, isoquinoline,
quinoline, phthalazine, naphthylpyridine, quinoxaline, quinazoline,
cinnoline, pteridine, carbazole, carboline, phenanthridine,
acridine, phenanthroline, isothiazole, phenazine, isoxazole,
phenoxazine, phenothiazine, piperidine, piperazine, phthalimide,
4,5,6,7-tetrahydrobenzo[b]thiophene, thiazole, thiophene,
benzo[b]thiophene, and the like.
[0089] "Heterocycle," "heterocyclic," "heterocycloalkyl" or
"heterocyclyl" refers to a saturated or partially unsaturated group
having a single ring or multiple condensed rings, including fused,
bridged, or spiro ring systems, and having from 3 to 20 ring atoms,
including 1 to 10 hetero atoms. These ring atoms are selected from
the group consisting of carbon, nitrogen, sulfur, or oxygen,
wherein, in fused ring systems, one or more of the rings can be
cycloalkyl, aryl, or heteroaryl, provided that the point of
attachment is through the non-aromatic ring. In certain
embodiments, the nitrogen and/or sulfur atom(s) of the heterocyclic
group are optionally oxidized to provide for N-oxide, --S(O)--, or
--SO.sub.2-- moieties.
[0090] Examples of heterocycles include, but are not limited to,
azetidine, dihydroindole, indazole, quinolizine, imidazolidine,
imidazoline, piperidine, piperazine, indoline,
1,2,3,4-tetrahydroisoquinoline, thiazolidine, morpholinyl,
thiomorpholinyl (also referred to as thiamorpholinyl),
1,1-dioxothiomorpholinyl, piperidinyl, pyrrolidine,
tetrahydrofuranyl, and the like.
[0091] Where a heteroaryl or heterocyclyl group is "substituted,"
unless otherwise constrained by the definition for the heteroaryl
or heterocyclic substituent, such heteroaryl or heterocyclic groups
can be substituted with 1 to 5, or from 1 to 3 substituents,
selected from alkyl, substituted alkyl, alkoxy, substituted alkoxy,
cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted
cycloalkenyl, acyl, acylamino, acyloxy, amino, substituted amino,
aminoacyl, aminoacyloxy, azido, cyano, halogen, hydroxyl, oxo,
thioketo, carboxyl, carboxyl ester, thioaryloxy, thioheteroaryloxy,
thioheterocyclooxy, thiol, thioalkoxy, substituted thioalkoxy,
aryl, aryloxy, heteroaryl, heteroaryloxy, heterocyclyl,
heterocyclooxy, hydroxyamino, alkoxyamino, nitro, sulfonylamino,
--SO-alkyl, --SO-substituted alkyl, --SO-aryl, --SO-heteroaryl,
--SO-heterocyclyl, --SO.sub.2-alkyl, --SO.sub.2-substituted alkyl,
--SO.sub.2-aryl, --SO.sub.2-heteroaryl, and
--SO.sub.2-heterocyclyl.
[0092] "Polyalkylene glycol" refers to straight or branched
polyalkylene glycol polymers such as polyethylene glycol,
polypropylene glycol, and polybutylene glycol. A polyalkylene
glycol subunit is a single polyalkylene glycol unit. For example,
an example of a polyethylene glycol subunit would be an ethylene
glycol, --O--CH.sub.2--CH.sub.2--O--, or propylene glycol,
--O--CH.sub.2--CH.sub.2--CH.sub.2--O--, capped with a hydrogen at
the chain termination point. Other examples of poly(alkylene
glycol) include, but are not limited to, PEG, PEG derivatives such
as methoxypoly(ethylene glycol) (mPEG), poly(ethylene oxide), PPG,
poly(tetramethylene glycol), poly(ethylene oxide-co-propylene
oxide), or copolymers and combinations thereof.
[0093] "Polyamine" refers to polymers having an amine functionality
in the monomer unit, either incorporated into the backbone, as in
polyalkyleneimines, or in a pendant group as in polyvinyl
amines.
[0094] In addition to the disclosure herein, the term
"substituted," when used to modify a specified group or radical,
can also mean that one or more hydrogen atoms of the specified
group or radical are each, independently of one another, replaced
with the same or different substituent groups as defined below.
[0095] In addition to the groups disclosed with respect to the
individual terms herein, substituent groups for substituting for
one or more hydrogens (any two hydrogens on a single carbon can be
replaced with .dbd.O, .dbd.NR.sup.70, .dbd.N--OR.sup.70,
.dbd.N.sub.2 or .dbd.S) on saturated carbon atoms in the specified
group or radical are, unless otherwise specified, --R.sup.60, halo,
.dbd.O, --OR.sup.70, --SR.sup.70, --NR.sup.80R.sup.80,
trihalomethyl, --CN, --OCN, --SCN, --NO, --NO.sub.2, .dbd.N.sub.2,
--N.sub.3, --S(O)R.sup.70, --SO.sub.2R.sup.70,
--SO.sub.2O.sup.-M.sup.+, --SO.sub.2OR.sup.70, --OSO.sub.2R.sup.70,
--OSO.sub.2O.sup.-M.sup.+, --OSO.sub.2OR.sup.70,
--P(O)(O.sup.-).sub.2(M.sup.+).sub.2,
--P(O)(OR.sup.70)O.sup.-M.sup.+, --P(O)(OR.sup.70) 2,
--C(O)R.sup.70, --C(S)R.sup.70, --C(NR.sup.70)R.sup.70,
--C(O)O.sup.-M.sup.+, --C(O)OR.sup.70, --C(S)OR.sup.70,
--C(O)NR.sup.80R.sup.80, --C(NR.sup.70)NR.sup.80R.sup.80,
--OC(O)R.sup.70, --OC(S)R.sup.70, --OC(O)O.sup.-M.sup.+,
--OC(O)OR.sup.70, --OC(S)OR.sup.70, --NR.sup.70C(O)R.sup.70,
--NR.sup.70C(S)R.sup.70, --NR.sup.70CO.sub.2.sup.-M.sup.+,
--NR.sup.70CO.sub.2R.sup.70, --NR.sup.70C(S)OR.sup.70,
--NR.sup.70C(O)NR.sup.80R.sup.80, --NR.sup.70C(NR.sup.70)R.sup.70
and --NR.sup.70C(NR.sup.70)NR.sup.80R.sup.80, where R.sup.60 is
selected from the group consisting of optionally substituted alkyl,
cycloalkyl, heterocycloalkyl, heterocycloalkylalkyl,
cycloalkylalkyl, aryl, arylalkyl, heteroaryl and heteroarylalkyl,
each R.sup.70 is independently hydrogen or R.sup.60; each R.sup.80
is independently R.sup.70 or alternatively, two R.sup.80's, taken
together with the nitrogen atom to which they are bonded, form a
3-, 4-, 5-, 6-, or 7-membered heterocycloalkyl which may optionally
include from 1 to 4 of the same or different additional heteroatoms
selected from the group consisting of O, N and S, of which N may
have --H, C.sub.1-C.sub.4 alkyl, --C(O)C.sub.1-4alkyl,
--CO.sub.2C.sub.1-4alkyl, or --SO.sub.2C.sub.1-4alkyl substitution;
and each M.sup.+ is a counter ion with a net single positive
charge. Each M.sup.+ may independently be, for example, an alkali
ion, such as K.sup.+, Na.sup.+, Li.sup.+; an ammonium ion, such as
.sup.+N(R.sup.60).sub.4; or an alkaline earth ion, such as
[Ca.sup.2+].sub.0.5, [Mg.sup.2+].sub.0.5, or [Ba.sup.2+].sub.0.5
("subscript 0.5 means that one of the counter ions for such
divalent alkali earth ions can be an ionized form of a compound of
the embodiments and the other a typical counter ion such as
chloride, or two ionized compounds disclosed herein can serve as
counter ions for such divalent alkali earth ions, or a doubly
ionized compound of the embodiments can serve as the counter ion
for such divalent alkali earth ions).
[0096] In addition to the disclosure herein, substituent groups for
hydrogens on unsaturated carbon atoms in "substituted" alkene,
alkyne, aryl and heteroaryl groups are, unless otherwise specified,
--R.sup.60, halo, --O.sup.-M.sup.+, --OR.sup.70, --SR.sup.70,
--S.sup.-M.sup.+, --NR.sup.80R.sup.80, trihalomethyl, --CF.sub.3,
--CN, --OCN, --SCN, --NO, --NO.sub.2, --N.sub.3, --S(O)R.sup.70,
--SO.sub.2R.sup.70, --SO.sub.3.sup.-M.sup.+, --SO.sub.3R.sup.70,
--OSO.sub.2R.sup.70, --OSO.sub.3.sup.-M.sup.+, --OSO.sub.3R.sup.70,
--PO.sub.3.sup.-2(M.sup.+).sub.2, --P(O)(OR.sup.70)O.sup.-M.sup.+,
--P(O)(OR.sup.70).sub.2, --C(O)R.sup.70, --C(S)R.sup.70,
--C(NR.sup.70)R.sup.70, --CO.sub.2.sup.-M.sup.+,
--CO.sub.2R.sup.70, --C(S)OR.sup.70, --C(O)NR.sup.80R.sup.80,
--C(NR.sup.70)NR.sup.80R.sup.80, --OC(O)R.sup.70, --OC(S)R.sup.70,
--OCO.sub.2.sup.-M.sup.+, --OCO.sub.2R.sup.70, --OC(S)OR.sup.70,
--NR.sup.70C(O)R.sup.70, --NR.sup.70C(S)R.sup.70,
--NR.sup.70CO.sub.2.sup.-M.sup.+, --NR.sup.70CO.sub.2R.sup.70,
--NR.sup.70C(S)OR.sup.70, --NR.sup.70C(O)NR.sup.80R.sup.80,
--NR.sup.70C(NR.sup.70)R.sup.70 and
--NR.sup.70C(NR.sup.70)NR.sup.80R.sup.80, where R.sup.60, R.sup.70,
R.sup.80 and M.sup.+ are as previously defined, provided that in
case of substituted alkene or alkyne, the substituents are not
--O-M.sup.+, --OR.sup.70, --SR.sup.70, or --S.sup.-M.sup.+.
[0097] In addition to the substituent groups disclosed with respect
to the individual terms herein, substituent groups for hydrogens on
nitrogen atoms in "substituted" heterocycloalkyl and cycloalkyl
groups are, unless otherwise specified, --R.sup.60,
--O.sup.-M.sup.+, --OR.sup.70, --SR.sup.70, --S.sup.-M.sup.+,
--NR.sup.80R.sup.80 trihalomethyl, --CF.sub.3, --CN, --NO,
--NO.sub.2, --S(O)R.sup.70, --S(O).sub.2R.sup.70,
--S(O).sub.2O.sup.-M.sup.+, --S(O).sub.2OR.sup.70,
--OS(O).sub.2R.sup.70, --OS(O).sub.2O.sup.-M.sup.+,
--OS(O).sub.2OR.sup.70, --P(O)(O.sup.-).sub.2(M.sup.+).sub.2,
--P(O)(OR.sup.70)O.sup.-M.sup.+, --P(O)(OR.sup.70)(OR.sup.70),
--C(O)R.sup.70, --C(S)R.sup.70, --C(NR.sup.70)R.sup.70,
--C(O)OR.sup.70, --C(S)OR.sup.70, --C(O)NR.sup.80R.sup.80,
--C(NR.sup.70)NR.sup.80R.sup.80, --OC(O)R.sup.70, --OC(S)R.sup.70,
--OC(O)OR.sup.70, --OC(S)OR.sup.70, --NR.sup.70C(O)R.sup.70,
--NR.sup.70C(S)R.sup.70, --NR.sup.70C(O)OR.sup.70,
--NR.sup.70C(S)OR.sup.70, --NR.sup.70C(O)NR.sup.80R.sup.80,
--NR.sup.70C(NR.sup.70)R.sup.70 and
--NR.sup.70C(NR.sup.70)NR.sup.80R.sup.80, where R.sup.60, R.sup.70,
R.sup.80, and M.sup.+ are as previously defined.
[0098] In addition to the disclosure herein, in a certain
embodiment, a group that is substituted has 1, 2, 3, or 4
substituents, 1, 2, or 3 substituents, 1 or 2 substituents, or 1
substituent.
[0099] It is understood that in all substituted groups defined
above, polymers arrived at by defining substituents with further
substituents to themselves (e.g., substituted aryl having a
substituted aryl group as a substituent which is itself substituted
with a substituted aryl group, which is further substituted by a
substituted aryl group, etc.) are not intended for inclusion
herein. In such cases, the maximum number of such substitutions is
three. For example, serial substitutions of substituted aryl groups
specifically contemplated herein are limited to substituted
aryl-(substituted aryl)-substituted aryl.
[0100] Unless indicated otherwise, the nomenclature of substituents
that are not explicitly defined herein are arrived at by naming the
terminal portion of the functionality followed by the adjacent
functionality toward the point of attachment. For example, the
substituent "arylalkyloxycarbonyl" refers to the group
(aryl)-(alkyl)-O--C(O)--.
[0101] As to any of the groups disclosed herein which contain one
or more substituents, it is understood, of course, that such groups
do not contain any substitution or substitution patterns which are
sterically impractical and/or synthetically non-feasible. In
addition, the subject compounds include all stereochemical isomers
arising from the substitution of these compounds.
[0102] The term "pharmaceutically acceptable salt" means a salt
which is acceptable for administration to a patient, such as a
mammal (salts with counterions having acceptable mammalian safety
for a given dosage regime). Such salts can be derived from
pharmaceutically acceptable inorganic or organic bases and from
pharmaceutically acceptable inorganic or organic acids.
"Pharmaceutically acceptable salt" refers to pharmaceutically
acceptable salts of a compound, which salts are derived from a
variety of organic and inorganic counter ions well known in the art
and include, by way of example only, sodium, potassium, calcium,
magnesium, ammonium, tetraalkylammonium, and the like; and when the
molecule contains a basic functionality, salts of organic or
inorganic acids, such as hydrochloride, hydrobromide, formate,
tartrate, besylate, mesylate, acetate, maleate, oxalate, and the
like.
[0103] The term "salt thereof" means a compound formed when a
proton of an acid is replaced by a cation, such as a metal cation
or an organic cation and the like. Where applicable, the salt is a
pharmaceutically acceptable salt, although this is not required for
salts of intermediate compounds that are not intended for
administration to a patient. By way of example, salts of the
present compounds include those wherein the compound is protonated
by an inorganic or organic acid to form a cation, with the
conjugate base of the inorganic or organic acid as the anionic
component of the salt.
[0104] "Solvate" refers to a complex formed by combination of
solvent molecules with molecules or ions of the solute. The solvent
can be an organic compound, an inorganic compound, or a mixture of
both. Some examples of solvents include, but are not limited to,
methanol, N,N-dimethylformamide, tetrahydrofuran,
dimethylsulfoxide, and water. When the solvent is water, the
solvate formed is a hydrate.
[0105] "Stereoisomer" and "stereoisomers" refer to compounds that
have same atomic connectivity but different atomic arrangement in
space. Stereoisomers include cis-trans isomers, E and Z isomers,
enantiomers, and diastereomers.
[0106] "Tautomer" refers to alternate forms of a molecule that
differ only in electronic bonding of atoms and/or in the position
of a proton, such as enol-keto and imine-enamine tautomers, or the
tautomeric forms of heteroaryl groups containing a
--N.dbd.C(H)--NH-- ring atom arrangement, such as pyrazoles,
imidazoles, benzimidazoles, triazoles, and tetrazoles. A person of
ordinary skill in the art would recognize that other tautomeric
ring atom arrangements are possible.
[0107] It will be appreciated that the term "or a salt or solvate
or stereoisomer thereof" is intended to include all permutations of
salts, solvates and stereoisomers, such as a solvate of a
pharmaceutically acceptable salt of a stereoisomer of subject
compound.
[0108] As used herein, an "effective dosage" or "effective amount"
of drug, compound, conjugate, drug conjugate, antibody drug
conjugate, or pharmaceutical composition is an amount sufficient to
effect beneficial or desired results. For prophylactic use,
beneficial or desired results include results such as eliminating
or reducing the risk, lessening the severity, or delaying the onset
of the disease, including biochemical, histological and/or
behavioral symptoms of the disease, its complications and
intermediate pathological phenotypes presenting during development
of the disease. For therapeutic use, beneficial or desired results
include clinical results such as decreasing one or more symptoms
resulting from the disease, increasing the quality of life of those
suffering from the disease, decreasing the dose of other
medications required to treat the disease, enhancing effect of
another medication such as via targeting, delaying the progression
of the disease, and/or prolonging survival. In the case of cancer
or tumor, an effective amount of the drug may have the effect in
reducing the number of cancer cells; reducing the tumor size;
inhibiting (i.e., slow to some extent and preferably stop) cancer
cell infiltration into peripheral organs; inhibit (i.e., slow to
some extent and preferably stop) tumor metastasis; inhibiting, to
some extent, tumor growth; and/or relieving to some extent one or
more of the symptoms associated with the disorder. An effective
dosage can be administered in one or more administrations. For
purposes of the present disclosure, an effective dosage of drug,
compound, or pharmaceutical composition is an amount sufficient to
accomplish prophylactic or therapeutic treatment either directly or
indirectly. As is understood in the clinical context, an effective
dosage of a drug, compound, or pharmaceutical composition may or
may not be achieved in conjunction with another drug, compound, or
pharmaceutical composition. Thus, an "effective dosage" may be
considered in the context of administering one or more therapeutic
agents, and a single agent may be considered to be given in an
effective amount if, in conjunction with one or more other agents,
a desirable result may be or is achieved.
[0109] As used herein, "in conjunction with" refers to
administration of one treatment modality in addition to another
treatment modality. As such, "in conjunction with" refers to
administration of one treatment modality before, during or after
administration of the other treatment modality to the
individual.
[0110] As used herein, "treatment" or "treating" is an approach for
obtaining beneficial or desired results including and preferably
clinical results. For purposes of the present disclosure,
beneficial or desired clinical results include, but are not limited
to, one or more of the following: reducing the proliferation of (or
destroying) cancerous cells, decreasing symptoms resulting from the
disease, increasing the quality of life of those suffering from the
disease, decreasing the dose of other medications required to treat
the disease, delaying the progression of the disease, and/or
prolonging survival of individuals.
[0111] As used herein, "delaying development of a disease" means to
defer, hinder, slow, retard, stabilize, and/or postpone development
of the disease (such as cancer). This delay can be of varying
lengths of time, depending on the history of the disease and/or
individual being treated. As is evident to one skilled in the art,
a sufficient or significant delay can, in effect, encompass
prevention, in that the individual does not develop the disease.
For example, a late stage cancer, such as development of
metastasis, may be delayed.
[0112] An "individual" or a "subject" is a mammal, more preferably
a human. Mammals also include, but are not limited to, farm
animals, sport animals, pets (such as cats, dogs, horses),
primates, mice and rats.
[0113] As used herein, the term "specifically recognizes" or
"specifically binds" refers to measurable and reproducible
interactions such as attraction or binding between a target and an
antibody (or a molecule or a moiety), that is determinative of the
presence of the target in the presence of a heterogeneous
population of molecules including biological molecules. For
example, an antibody that specifically or preferentially binds to
an epitope is an antibody that binds this epitope with greater
affinity, avidity, more readily, and/or with greater duration than
it binds to other epitopes of the target or non-target epitopes. It
is also understood that, for example, an antibody (or moiety or
epitope) that specifically or preferentially binds to a first
target may or may not specifically or preferentially bind to a
second target. As such, "specific binding" or "preferential
binding" does not necessarily require (although it can include)
exclusive binding. An antibody that specifically binds to a target
may have an association constant of at least about 10.sup.3
M.sup.-1 or 10.sup.4 M.sup.-1, sometimes about 10.sup.5 M.sup.-1 or
10.sup.6 M.sup.-1, in other instances about 10.sup.6 M.sup.-1 or
10.sup.7M.sup.-1, about 10.sup.8 M.sup.-1 to 10.sup.9 M.sup.-1, or
about 10.sup.10 M.sup.-1 to 10.sup.11 M.sup.-1 or higher. A variety
of immunoassay formats can be used to select antibodies
specifically immunoreactive with a particular protein. For example,
solid-phase ELISA immunoassays are routinely used to select
monoclonal antibodies specifically immunoreactive with a protein.
See, e.g., Harlow and Lane (1988) Antibodies, A Laboratory Manual,
Cold Spring Harbor Publications, New York, for a description of
immunoassay formats and conditions that can be used to determine
specific immunoreactivity.
[0114] As used herein, the terms "cancer," "tumor," "cancerous,"
and "malignant" refer to or describe the physiological condition in
mammals that is typically characterized by unregulated cell growth.
Examples of cancer include but are not limited to, carcinoma,
including adenocarcinoma, lymphoma, blastoma, melanoma, and
sarcoma. More particular examples of such cancers include squamous
cell cancer, small-cell lung cancer, non-small cell lung cancer,
lung adenocarcinoma, lung squamous cell carcinoma, gastrointestinal
cancer, Hodgkin's and non-Hodgkin's lymphoma, pancreatic cancer,
glioblastoma, cervical cancer, glioma, ovarian cancer, liver cancer
such as hepatic carcinoma and hepatoma, bladder cancer, breast
cancer, colon cancer, colorectal cancer, endometrial or uterine
carcinoma, salivary gland carcinoma, kidney cancer such as renal
cell carcinoma and Wilms' tumors, basal cell carcinoma, melanoma,
mesothelioma, prostate cancer, thyroid cancer, testicular cancer,
esophageal cancer, gallbladder cancer, and various types of head
and neck cancer.
[0115] As used herein and in the appended claims, the singular
forms "a," "an," and "the" include plural reference unless the
context clearly indicates otherwise. For example, reference to an
"antibody" is a reference to from one to many antibodies, such as
molar amounts, and includes equivalents thereof known to those
skilled in the art, and so forth.
[0116] Reference to "about" a value or parameter herein includes
(and describes) embodiments that are directed to that value or
parameter per se. For example, description referring to "about X"
includes description of "X."
[0117] It is understood that aspect and variations of the invention
described herein include "consisting" and/or "consisting
essentially of" aspects and variations.
[0118] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention belongs. Although
any methods and materials similar or equivalent to those described
herein can also be used in the practice or testing of the present
invention, the preferred methods and materials are now described.
All publications mentioned herein are incorporated herein by
reference to disclose and describe the methods and/or materials in
connection with which the publications are cited.
[0119] Except as otherwise noted, the methods and techniques of the
present embodiments are generally performed according to
conventional methods well known in the art and as described in
various general and more specific references that are cited and
discussed throughout the present specification. See, e.g., Loudon,
Organic Chemistry, 4.sup.th edition, New York: Oxford University
Press, 2002, pp. 360-361, 1084-1085; Smith and March, March's
Advanced Organic Chemistry: Reactions, Mechanisms, and Structure,
5.sup.th edition, Wiley-Interscience, 2001.
[0120] The nomenclature used herein to name the subject compounds
is illustrated in the Examples herein. This nomenclature has
generally been derived using the commercially-available AutoNom
software (MDL, San Leandro, Calif.).
[0121] It is appreciated that certain features of the invention,
which are, for clarity, described in the context of separate
embodiments, may also be provided in combination in a single
embodiment. Conversely, various features of the invention, which
are, for brevity, described in the context of a single embodiment,
may also be provided separately or in any suitable subcombination.
All combinations of the embodiments pertaining to the chemical
groups represented by the variables are specifically embraced by
the present invention and are disclosed herein just as if each and
every combination was individually and explicitly disclosed, to the
extent that such combinations embrace compounds that are stable
compounds (i.e., compounds that can be isolated, characterized, and
tested for biological activity). In addition, all subcombinations
of the chemical groups listed in the embodiments describing such
variables are also specifically embraced by the present invention
and are disclosed herein just as if each and every such
sub-combination of chemical groups was individually and explicitly
disclosed herein.
DETAILED DESCRIPTION
[0122] The present disclosure provides compounds with a hydrophilic
self-immolative linker, which may be cleavable under appropriate
conditions and incorporates a hydrophilic group to provide better
solubility of the compound. The hydrophilic self immolative linker
may provide increased solubility of drug conjugates for cytotoxic
drugs which are often hydrophobic. Other advantages of using a
hydrophilic self-immolative linker in a drug conjugate include
increased stability of the drug conjugate and decreased aggregation
of the drug conjugate.
[0123] The present disclosure provides drug conjugates may have
superior serum stability. For example, in contrast to drug
conjugates wherein a hydroxyl group of a drug is linked to a spacer
via a labile carbonate linkage that is susceptible to rapid
hydrolysis in aqueous buffer or human serum, the drug conjugates of
the present embodiments utilizing a benzyloxycarbonyl linkage may
be relatively more stable under the same conditions, and may
selectively undergo fragmentation to release the drug upon
treatment with protease, e.g., cathepsin B. Serum stability is a
desirable property for drug conjugates where it is desired to
administer inactive drug to the patient's serum, have that inactive
drug concentrate at a target by way of the ligand, and then have
that drug conjugate converted to an active form only in the
vicinity of the target.
[0124] The present disclosure provides drug conjugates which may
have decreased aggregation. Increased associated hydrophobicity of
some enzyme-labile linkers may lead to aggregation of drug
conjugates, particularly with strongly hydrophobic drugs. With
incorporation of a hydrophilic group into the linker, there may be
decreased aggregation of the drug conjugate.
[0125] The compounds of the present disclosure comprise a drug
moiety, a targeting moiety capable of targeting a selected cell
population, and a linker which contains an acyl unit, an optional
spacer unit for providing distance between the drug moiety and the
targeting moiety, a peptide linker which can be cleavable under
appropriate conditions, a hydrophilic self-immolative linker, and
an optional second self-immolative spacer or cyclization
self-elimination linker. Each of the features is discussed
below.
[0126] The present disclosure provides a compound of Formula
(I):
##STR00015## [0127] or a salt or solvate or stereoisomer thereof;
[0128] wherein: [0129] D is drug moiety; [0130] T is a targeting
moiety; [0131] X is a hydrophilic self-immolative linker; [0132]
L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker; [0133] L.sup.2 is a bond or a
second self-immolative linker; [0134] wherein if L.sup.1 is a
second self-immolative linker or a cyclization self-elimination
linker, then L.sup.2 is a bond; [0135] wherein if L.sup.2 is a
second self-immolative linker, then L.sup.1 is a bond; [0136]
L.sup.3 is a peptide linker; [0137] L.sup.4 is bond or a spacer;
and [0138] A is an acyl unit.
[0139] In some embodiments, the targeting moiety has one or more
attachment sites for linking to the drug moiety. For example, a
targeting moiety T can have multiple sites for linking to a
linker-drug moiety (e.g., A-L.sup.4-L.sup.3-L-X-L.sup.1-D). Thus,
also provided is a compound of Formula (Ia):
##STR00016##
[0140] or a salt or solvate or stereoisomer thereof, wherein D, T,
X, L.sup.1, L.sup.2, L.sup.3, L.sup.4 and A are as defined for
Formula (I), and p is 1 to 20. In some embodiments, p is 1 to 8. In
some embodiments, p is 1 to 6. In some embodiments, p is 1 to 4. In
some embodiments, p is 2 to 4. In some embodiments, p is 1, 2, 3 or
4. In some embodiments, p is 2. In some embodiments, p is 3. In
some embodiments, p is 4.
Peptide Linker
[0141] In Formula (I), L.sup.3 is a peptide linker. In certain
embodiments, L.sup.3 is a peptide linker of 1 to 10 amino acid
residues. In certain embodiments, L.sup.3 is a peptide linker of 2
to 4 amino acid residues. In certain instances, L.sup.3 is a
dipeptide linker.
[0142] An amino acid residue can be a naturally-occurring or
non-natural amino acid residue. The terms "natural amino acid" and
"naturally-occurring amino acid" refer to Ala, Asp, Cys, Glu, Phe,
Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Gln, Arg, Ser, Thr, Val,
Trp, and Tyr. "Non-natural amino acids" (i.e., amino acids do not
occur naturally) include, by way of non-limiting example,
homoserine, homoarginine, citrulline, phenylglycine, taurine,
iodotyrosine, seleno-cysteine, norleucine ("Nle"), norvaline
("Nva"), beta-alanine, L- or D-naphthalanine, omithine ("Orn"), and
the like.
[0143] Amino acids also include the D-forms of natural and
non-natural amino acids. "D-" designates an amino acid having the
"D" (dextrorotary) configuration, as opposed to the configuration
in the naturally occurring ("L-") amino acids. Where no specific
configuration is indicated, one skilled in the art would understand
the amino acid to be an L-amino acid. The amino acids can, however,
also be in racemic mixtures of the D- and L-configuration. Natural
and non-natural amino acids can be purchased commercially (Sigma
Chemical Co.; Advanced Chemtech) or synthesized using methods known
in the art. Amino acid substitutions may be made on the basis of
similarity in polarity, charge, solubility, hydrophobicity,
hydrophilicity, and/or the amphipathic nature of the residues as
long as their biological activity is retained.
[0144] The amino acid residue sequence can be specifically tailored
so that it will be selectively enzymatically cleaved from the
resulting peptidyl derivative drug-conjugate by one or more of the
tumor-associated proteases.
[0145] In certain embodiments, L.sup.3 is a peptide linker
comprising at least one lysine or arginine residue.
[0146] In certain embodiments, L.sup.3 is a peptide linker
comprising an amino acid residue selected from lysine, D-lysine,
citrulline, arginine, proline, histidine, omithine and
glutamine.
[0147] In certain embodiments, L.sup.3 is a peptide linker
comprising an amino acid residue selected from valine, isoleucine,
phenylalanine, methionine, asparagine, proline, alanine, leucine,
tryptophan, and tyrosine.
[0148] In certain embodiments, L.sup.3 is a dipeptide linker
selected from valine-citrulline, proline-lysine,
methionine-D-lysine, asparagine-D-lysine, isoleucine-proline,
phenylalanine-lysine, and valine-lysine. In certain embodiments,
L.sup.3 is valine-citrulline.
[0149] Numerous specific peptide linker molecules suitable for use
in the present disclosure can be designed and optimized in their
selectivity for enzymatic cleavage by a particular tumor-associated
protease. Certain peptide linkers for use in the present disclosure
are those which are optimized toward the proteases, cathepsin B and
D.
Hydrophilic Self-Immolative Linker
[0150] In Formula (I), X is a hydrophilic self-immolative
linker.
[0151] The compound of the present disclosure employs a hydrophilic
self-immolative spacer moiety which spaces and covalently links
together the drug moiety and the targeting moiety and incorporates
a hydrophilic group, which provides better solubility of the
compound. Increased associated hydrophobicity of some enzyme-labile
linkers can lead to aggregation of drug conjugates, particularly
with strongly hydrophobic drugs. With incorporation of a
hydrophilic group into the linker, there may be a decreased
aggregation of the drug conjugate.
[0152] A self-immolative spacer may be defined as a bifunctional
chemical moiety which is capable of covalently linking together two
spaced chemical moieties into a normally stable tripartite
molecule, can release one of the spaced chemical moieties from the
tripartite molecule by means of enzymatic cleavage; and following
enzymatic cleavage, can spontaneously cleave from the remainder of
the molecule to release the other of the spaced chemical
moieties.
[0153] In certain embodiments, X is a benzyloxycarbonyl group. In
certain embodiments, X is
##STR00017##
wherein R.sup.1 is hydrogen, unsubstituted or substituted C.sub.1-3
alkyl, or unsubstituted or substituted heterocyclyl.
[0154] In such instance, the present disclosure provides a compound
of Formula (II):
##STR00018## [0155] or a salt or solvate or stereoisomer thereof;
[0156] wherein: [0157] D is drug moiety; [0158] T is a targeting
moiety; [0159] R.sup.1 is hydrogen, unsubstituted or substituted
C.sub.1-3 alkyl, or unsubstituted or substituted heterocyclyl;
[0160] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker; [0161] L.sup.2 is a bond, a
second self-immolative linker; [0162] wherein if L.sup.1 is a
second self-immolative linker or a cyclization self-elimination
linker, then L.sup.2 is a bond; [0163] wherein if L.sup.2 is a
second self-immolative linker, then L.sup.1 is a bond; [0164]
L.sup.3 is a peptide linker; [0165] L.sup.4 is bond or a spacer;
and [0166] A is an acyl unit.
[0167] In some embodiments, provided is a compound of Formula
(IIa):
##STR00019##
[0168] or a salt or solvate or stereoisomer thereof; wherein D, T,
L.sup.1, L.sup.2, L.sup.3, L.sup.4 and A are as defined for Formula
(II), and p is 1 to 20. In some embodiments, p is 1 to 8. In some
embodiments, p is 1 to 6. In some embodiments, p is 1 to 4. In some
embodiments, p is 2 to 4. In some embodiments, p is 1, 2, 3 or 4.
In some embodiments, p is 2. In some embodiments, p is 3. In some
embodiments, p is 4.
[0169] In certain embodiments of Formula (II) or (IIa), R.sup.1 is
hydrogen. In certain instances, R.sup.1 is methyl.
[0170] The release of the drug moiety is based on the
self-elimination reaction of aminobenzyloxycarbonyl group. For
illustration purposes, a reaction scheme with an
aminobenzyloxycarbonyl group with a drug and peptide attached is
shown below.
##STR00020##
[0171] Referring to Scheme 1, upon cleavage from a peptide, an
aminobenzyloxycarbonyl is formed and is able to undergo a
spontaneous 1,6 elimination to form a cyclohexa-2,5-dienimine
derivative and carbon dioxide and release the drug.
Optional Second Self-Immolative Linker or Cyclization
Self-Elimination Linker
[0172] A second self-immolative linker or cyclization
self-elimination linker provides an additional linker for allowance
of fine-tuning the cleavage of the compound to release the drug
moiety.
[0173] In Formula (I) or (Ia), L.sup.1 is a bond, a second
self-immolative linker, or a cyclization self-elimination linker;
L.sup.2 is a bond or a second self-immolative linker; wherein if
L.sup.1 is a second self-immolative linker or a cyclization
self-elimination linker, then L.sup.2 is a bond; and wherein if
L.sup.2 is a second self-immolative linker, then L.sup.1 is a bond.
Thus, there is an optional second self-immolative linker or a
cyclization self-elimination linker adjacent the hydrophilic
self-immolative linker.
[0174] In certain embodiments, L.sup.1 is a bond and L.sup.2 is a
bond. In certain embodiments, L.sup.1 is a second self-immolative
linker or a cyclization self-elimination linker and L.sup.2 is a
bond. In certain embodiments, L.sup.1 is a bond and L.sup.2 is a
second self-immolative linker.
[0175] In Formula (I) or (Ia), in certain embodiments, L.sup.1 is a
bond. In certain embodiments, L.sup.1 is a second self-immolative
spacer or a cyclization self-elimination linker, which separates
the hydrophilic self-immolative linker and the drug moiety. In
certain embodiments, L.sup.1 is an aminobenzyloxycarbonyl
linker.
[0176] In certain embodiments, L.sup.1 is selected from:
##STR00021##
wherein n is 1 or 2.
[0177] In certain instances, the second self-immolative linker or
cyclization self-elimination linker provides design potential for a
wider variety of moieties that can be used. For example, in Formula
(II) or (IIa), a carbamate linkage (--O--C(O)--N(H)--) linkage
between the hydrophilic self-immolative linker and the drug moiety
would provide a stable drug conjugate and would readily cleave to
provide a free drug moiety. The hydrophilic self-immolative linker
will typically terminate with an oxycarbonyl group (--O--C(O)--).
If the drug moiety has an amino-reactive group that may be used to
react to form a carbamate group, then the second self-immolative
unit or cyclization self-elimination linker is not necessary;
although it may still be employed. However, if the drug does not
contain an amino group, but instead contains some other reactive
functional group, then such drugs may still be incorporated into an
aminobenzyloxycarbonyl-containing compound of the present
embodiments by including a second, intermediate self-immolative
spacer or cyclization self-elimination linker between the drug
moiety and the aminobenzyloxycarbonyl group.
[0178] The cyclization self-elimination linkers of L.sup.1 below
provide linkage of hydroxyl-containing or thiol-containing drug
moieties to the aminobenzyloxycarbonyl group of the hydrophilic
self-immolative linker:
##STR00022##
[0179] The cyclization self-elimination linkers in the compounds of
the embodiments provide for cleavage of the compound to release the
drug moiety. The elimination mechanism of the adjacent hydrophilic
self-immolative linker would reveal an amino group of L.sup.1. The
amino group can then react with the carbamate group or
thiocarbamate linkage of L.sup.1 and the drug moiety in a
cyclization reaction to release the hydroxyl-containing or
thiol-containing drug moiety.
[0180] In Formula (I) or (Ia), in certain embodiments, L.sup.2 is a
bond. In certain embodiments, L.sup.2 is a second self-immolative
spacer which separates the hydrophilic self-immolative linker and
the peptide linker. In certain embodiments, L.sup.2 is an
aminobenzyloxycarbonyl linker.
[0181] In certain embodiments, L.sup.2 is selected from
##STR00023##
wherein n is 1 or 2.
Optional Spacer
[0182] In Formula (I) or (Ia), L.sup.4 is a bond or a spacer. In
certain embodiments, L.sup.4 is a bond. In certain embodiments,
L.sup.4 is a spacer, which can provide distance between the drug
moiety and the targeting moiety.
[0183] In certain embodiments, a spacer is selected from alkyl,
substituted alkyl, alkenyl, substituted alkenyl, alkynyl,
substituted alkynyl, aryl, substituted aryl, cycloalkyl,
substituted cycloalkyl, heteroaryl, substituted heteroaryl,
heterocyclic, substituted heterocyclic, and heteroatoms, and
combinations thereof. The spacer can be homogenous or heterogeneous
in its atom content (e.g., spacers containing only carbon atoms or
spacers containing carbon atoms as well as one or more heteroatoms
present on the spacer. Preferably, the spacer contains 1 to 50
carbon atoms and 0 to 30 heteroatoms selected from oxygen, nitrogen
and sulfur. The spacer may also be chiral or achiral, linear,
branched or cyclic.
[0184] In certain embodiments, L.sup.4 is a spacer selected from
polyalkylene glycol, alkylene, alkenylene, alkynylene, and
polyamine. Examples of alkenylene include, but is not limited to,
vinylene (--CH.dbd.CH--), allylene (--CH.sub.2C.dbd.C--), and
but-3-en-1-ylene (--CH.sub.2 CH.sub.2C.dbd.CH--). Examples of
alkenylene include, but is not limited to, acetylenylene
(--C.ident.C--), and propargylene (--CH.sub.2C.ident.C--).
[0185] In certain embodiments, L.sup.4 is a spacer that comprises a
functional group that can provide linkage to the terminal end of
the peptide linkage. Functional groups, such as C(O), C(O)--NH,
S(O).sub.2, and S(O).sub.2--NH, can provide linkage to the terminal
end of the peptide linkage. In certain instances, L.sup.4 is
L.sup.4a-C(O), L.sup.4a-C(O)--NH, L.sup.4a-S(O).sub.2,
L.sup.4a-S(O).sub.2--NH, wherein L.sup.4a is selected from
polyalkylene glycol, alkylene, alkenylene, alkynylene, and
polyamine. In certain instances, L.sup.4 is L.sup.4a-C(O), wherein
L.sup.4a is selected from polyalkylene glycol, alkylene,
alkenylene, alkynylene, and polyamine.
[0186] In certain embodiments, L.sup.4 is L.sup.4a-C(O), wherein
L.sup.4a is a polyalkylene glycol. In certain embodiments, L.sup.4
is L.sup.4a-C(O), wherein L.sup.4a is a polyethylene glycol. In
certain embodiments, the spacer is of the formula
--CH.sub.2--(CH.sub.2--O--CH.sub.2).sub.m--CH.sub.2--C(O)--,
wherein m is an integer from 0 to 30.
[0187] In certain embodiments, L.sup.4 is L.sup.4a-C(O), wherein
L.sup.4a is alkylene. In certain embodiments, L.sup.4 is
L.sup.4a-C(O), wherein L.sup.4a is C.sub.1-10alkylene,
C.sub.1-6alkylene, or C.sub.1-6alkylene. In certain embodiments,
L.sup.4 is L.sup.4a-C(O), wherein L.sup.4a is C.sub.4alkylene,
C.sub.5alkylene, or C.sub.6alkylene. In certain embodiments,
L.sup.4 is L.sup.4a-C(O), wherein L.sup.4a is C.sub.5alkylene.
Acyl Unit
[0188] In Formula (I) or (Ia), A is an acyl unit. In certain
embodiments, the acyl unit "A" comprises a sulfur atom and is
linked to the targeting moiety via a sulfur atom derived from the
targeting moiety. In such instance, a dithio bond is formed between
the acyl unit and the targeting moiety.
[0189] In certain embodiments, A is selected from
##STR00024##
wherein Q.sup.2 is NH or O and each q is independently an integer
from 1 to 10.
[0190] In certain embodiments, A is
##STR00025##
wherein Q.sup.2 is NH or O and q is an integer from 1 to 10. In
certain instance, q is a number from 2 to 5, such as 2, 3, 4, or
5.
[0191] In certain embodiments, A is
##STR00026##
wherein Q.sup.2 is NH or O and q is an integer from 1 to 10. In
certain instance, q is a number from 2 to 5, such as 2, 3, 4, or
5.
[0192] In certain embodiments, A is selected from
##STR00027##
wherein Q.sup.2 is NH or O.
Drug Moiety
[0193] The drug conjugates of the present embodiments are effective
for the usual purposes for which the corresponding drugs are
effective, and have superior efficacy because of the ability,
inherent in the targeting moiety, to transport the drug to the
desired cell where it is of particular benefit.
[0194] The preferred drugs for use in the present embodiments are
cytotoxic drugs, such as those which are used for cancer therapy.
Such drugs include, in general, DNA damaging agents,
anti-metabolites, natural products and their analogs. Certain
classes of cytotoxic agents include, for example, the enzyme
inhibitors such as dihydrofolate reductase inhibitors, thymidylate
synthase inhibitors, DNA intercalators, DNA cleavers, topoisomerase
inhibitors, the anthracycline family of drugs, the vinca drugs, the
mitomycins, the bleomycins, the cytotoxic nucleosides, the
pteridine family of drugs, diynenes, the podophyllotoxins,
differentiation inducers, and taxols. Certain useful members of
those classes include, for example, methotrexate, methopterin,
dichloromethotrexate, 5-fluorouracil, 6-mercaptopurine, cytosine
arabinoside, melphalan, leurosine, leurosideine, actinomycin,
daunorubicin, doxorubicin, mitomycin C, mitomycin A, carminomycin,
aminopterin, tallysomycin, podophyllotoxin and podophyllotoxin
derivatives such as etoposide or etoposide phosphate, vinblastine,
vincristine, vindesine, taxol, taxotere retinoic acid, butyric
acid, N.sup.8-acetyl spermidine, camptothecin, and their analogues.
Other drugs include dolastatin and duocarmycin.
[0195] One skilled in the art may make chemical modifications to
the desired compound in order to make reactions of that compound
more convenient for purposes of preparing conjugates of the
invention.
[0196] In certain embodiments, D is a drug moiety having a
chemically reactive functional group by means of which the drug is
bonded to L.sup.1 or X. In certain instances, the functional group
is selected from a primary amine, a secondary amine, hydroxyl, and
sulfhydryl. In certain instances, the functional group is a primary
amine or a secondary amine. In certain instances, the functional
group is hydroxyl. In certain instances, the functional group is
sulfhydryl.
[0197] As discussed above, the hydrophilic self-immolative linker
will typically terminate with an oxycarbonyl group (--O--C(O)--).
Thus, an amino-containing drug moiety would readily react with the
oxycarbonyl group to form a carbamate group. In certain
embodiments, D is an amino-containing drug moiety, wherein the drug
is connected to L.sup.1 or X through the amino group.
[0198] However, if the drug moiety does not contain an amino group,
the second self-immolative linker or cyclization self-elimination
linker of L.sup.1 can provide design potential for a wider variety
of moieties that can be used. In certain embodiments, D is a
hydroxyl-containing or sulfhydryl-containing drug moiety, wherein
the drug is connected to L.sup.1 through the hydroxyl or sulfhydryl
group.
[0199] Representative amino-containing drugs include mitomycin-C,
mitomycin-A, daunorubicin, doxorubicin, aminopterin, actinomycin,
bleomycin, 9-amino camptothecin, N.sup.8-acetyl spermidine,
1-(2-chloroethyl)-1,2-dimethanesulfonyl hydrazide, tallysomycin,
cytarabine, dolastatin and derivatives thereof. Amino-containing
drugs also include amino derivatives of drugs that do not naturally
contain an amino group. In certain embodiments, D is duocarmycin,
dolastatin, tubulysin, doxorubicin (DOX), paclitaxel, or mitomycin
C (MMC), or amino derivatives thereof.
[0200] Representative hydroxyl-containing drugs include etoposide,
camptothecin, taxol, esperamicin, 1,8-dihydroxy-bicyclo[7.3.1]
trideca-4-9-diene-2,6-diyne-13-one, (U.S. Pat. No. 5,198,560),
podophyllotoxin, anguidine, vincristine, vinblastine,
morpholine-doxorubicin, n-(5,5-diacetoxy-pentyl) doxorubicin,
duocarmycin, and derivatives thereof.
[0201] Representative sulfhydryl-containing drugs include
esperamicin and 6-mercaptopurine, and derivatives thereof.
[0202] A certain group of cytotoxic agents for use as drugs in the
present embodiments include drugs of the following formulae:
##STR00028##
Targeting Moiety
[0203] A targeting moiety as described in the present disclosure
refers to a moiety or molecule that specifically binds, complexes
with, reacts with, or associates with a given cell population. For
example, a targeting moiety may specifically bind, complex with,
react with, or associate with a receptive moiety or receptor
associated with a given cell population (e.g., a given cell
population sought to be therapeutically treated or otherwise
biologically modified). In a conjugate described herein, a
targeting moiety described herein is linked via a linker to a drug
moiety in the conjugate. In some embodiments, the targeting moiety
is capable of delivering a drug moiety (e.g., a drug moiety used
for therapeutic purpose) to a particular target cell population
which the targeting moiety binds, complexes with, reacts with, or
associates with.
[0204] The targeting moiety may include, for example, large
molecular weight proteins such as, for example, antibodies, smaller
molecular weight proteins, polypeptide or peptide, and non-peptidyl
moiety. A protein, polypeptide, or peptide moiety described herein
may include, for example, transferrin, serum albumin, epidermal
growth factors ("EGF"), bombesin, gastrin, gastrin-releasing
peptide, platelet-derived growth factor, IL-2, IL-6, tumor growth
factors ("TGF"), such as TGF-.alpha., and TGF-.beta., vaccinia
growth factor ("VGF"), insulin and insulin-like growth factors I
and II. Non-peptidyl moiety may include, for example,
carbohydrates, lectins, and apoprotein from low density
lipoprotein. A protein, an antibody, a polypeptide, or a peptide in
certain embodiments may refer to its unmodified form, a form that
has been modified for being used in a conjugate described herein
such as being used to bond to a linker, or a moiety that is in a
conjugate described herein.
[0205] In some embodiments, the targeting moiety is an antibody (or
an antibody moiety or an antibody targeting moiety). In some
embodiments, the targeting moiety comprises an antibody. In some
embodiments, the targeting moiety comprises sulfhydryl (--SH) group
(e.g., a free reactive sulfhydryl (--SH) group) or can be modified
to contain such a sulfhydryl group. In some embodiments, the
targeting moiety comprises an antibody with a sulfhydryl group
(e.g., a free reactive sulfhydryl group). In some embodiments, the
targeting moiety comprises a free thiol group such as an antibody
with a free thiol group or can be modified to contain such a thio
group. In some embodiments, the targeting moiety comprising a
sulfhydryl group or thiol group bonds to a linker via the sulfur
atom in the sulfhydryl group.
[0206] In some embodiments, the targeting moiety (e.g., an antibody
targeting moiety) has one or more attachment sites for linking to
the drug moiety. For example, a targeting moiety T (e.g., an
antibody) can have multiple sites (e.g., multiple sulfhydryl
groups) for linking to a linker-drug moiety (e.g.,
A-L.sup.4-L.sup.3-L.sup.2-X-L.sup.1-D where A is suitable for
bonding to a sulfhydryl group of the targeting antibody). In some
embodiments, the targeting moiety can have 1 to 20 sites of
attachment. In some embodiments, the targeting moiety can have 1 to
20, 1 to 10, 1 to 8, 1 to 6, 1 to 4, 2 to 8, 2 to 4, or 2 to 4
sites of attachment. In some embodiments, the targeting moiety has
1, 2, 3, 4, 5, 6, 7, or 8 sites of attachment. In some embodiments,
the targeting moiety has 2 sites of attachment. In some
embodiments, the targeting moiety has 1 site of attachment. In some
embodiments, the targeting moiety has 4 sites of attachment. In
some instances, certain potential sites of attachment may not be
accessible for bonding to a drug moiety. Thus, the number of
attachment sites in a targeting moiety T may results in a drug
conjugate that has fewer number of drug moieties attached than the
number of potential sites of attachment. In some embodiments, one
or more of the sites of attachment may be accessible for bonding a
drug moiety. For example, an antibody targeting moiety can have one
or two sulfhydryl groups on each chain of the antibody accessible
for bonding to drug moiety via a linker.
[0207] In some embodiments, the targeting moiety is an antibody or
an antibody targeting moiety. An antibody described herein refers
to an immunoglobulin molecule capable of specific binding to a
target, such as a carbohydrate, polynucleotide, lipid, polypeptide,
etc., through at least one antigen recognition site, located in the
variable region of the immunoglobulin molecule. As used herein, the
term "antibody" encompasses not only intact polyclonal or
monoclonal antibodies, but also antigen-binding fragments thereof
(such as Fab, Fab', F(ab').sub.2, Fv), single chain (ScFv), mutants
thereof, fusion proteins comprising an antibody portion, and any
other modified configuration of the immunoglobulin molecule that
comprises an antigen recognition site. An antibody includes an
antibody of any class, such as IgG, IgA, or IgM (or sub-class
thereof), and the antibody need not be of any particular class.
Depending on the antibody amino acid sequence of the constant
domain of its heavy chains, immunoglobulins can be assigned to
different classes. There are five major classes of immunoglobulins:
IgA, IgD, IgE, IgG, and IgM, and several of these may be further
divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4,
IgA1 and IgA2. The heavy-chain constant domains that correspond to
the different classes of immunoglobulins are called alpha, delta,
epsilon, gamma, and mu, respectively. The subunit structures and
three-dimensional configurations of different classes of
immunoglobulins are well known.
[0208] An antibody included or used in a targeting moiety described
herein (or an antibody targeting moiety) can encompass monoclonal
antibodies, polyclonal antibodies, antibody fragments (e.g., Fab,
Fab', F(ab').sub.2, Fv, Fc, etc.), chimeric antibodies, humanized
antibodies, human antibodies (e.g., fully human antibodies), single
chain (ScFv), bispecific antibodies, multispecific antibodies,
mutants thereof, fusion proteins comprising an antibody portion,
and any other modified configuration of the immunoglobulin molecule
that comprises an antigen recognition site of the required
specificity. The antibodies may be murine, rat, camel, human, or
any other origin (including humanized antibodies). In some
embodiments, an antibody used in a targeting moiety described
herein (or an antibody targeting moiety) is any one of the
following: bispecific antibody, multispecific, single-chain,
bifunctional, and chimeric and humanized molecules having affinity
for a polypeptide conferred by at least one hypervariable region
(HVR) or complementarity determining region (CDR) of the antibody.
Antibodies used in the present disclosure also include single
domain antibodies which are either the variable domain of an
antibody heavy chain or the variable domain of an antibody light
chain. Holt et al., Trends Biotechnol. 21:484-490, 2003. Methods of
making domain antibodies comprising either the variable domain of
an antibody heavy chain or the variable domain of an antibody light
chain, containing three of the six naturally occurring HVRs or CDRs
from an antibody, are also known in the art. See, e.g.,
Muyldermans, Rev. Mol. Biotechnol. 74:277-302, 2001.
[0209] In some embodiments, an antibody included or used in a
targeting moiety described herein (or an antibody targeting moiety)
is a monoclonal antibody. As used herein, a monoclonal antibody
refers to an antibody of substantially homogeneous antibodies,
i.e., the individual antibodies comprising the population are
identical except for possible naturally-occurring mutations that
may be present in minor amounts. Furthermore, in contrast to
polyclonal antibody preparations, which typically include different
antibodies directed against different determinants (epitopes),
monoclonal antibody is not a mixture of discrete antibodies. The
modifier "monoclonal" indicates the character of the antibody as
being obtained from a substantially homogeneous population of
antibodies, and is not to be construed as requiring production of
the antibody by any particular method. For example, the monoclonal
antibodies used in the present disclosure may be made by the
hybridoma method first described by Kohler and Milstein, 1975,
Nature, 256:495, or may be made by recombinant DNA methods such as
described in U.S. Pat. No. 4,816,567. The monoclonal antibodies may
also be isolated from phage libraries generated using the
techniques described in McCafferty et al., 1990, Nature,
348:552-554, for example.
[0210] In some embodiments, an antibody included or used in a
targeting moiety described herein (or an antibody targeting moiety)
is a chimeric antibody. As used herein, a chimeric antibody refers
to an antibody having a variable region or part of variable region
from a first species and a constant region from a second species.
An intact chimeric antibody comprises two copies of a chimeric
light chain and two copies of a chimeric heavy chain. The
production of chimeric antibodies is known in the art (Cabilly et
al. (1984), Proc. Natl. Acad. Sci. USA, 81:3273-3277; Harlow and
Lane (1988), Antibodies: a Laboratory Manual, Cold Spring Harbor
Laboratory). Typically, in these chimeric antibodies, the variable
region of both light and heavy chains mimics the variable regions
of antibodies derived from one species of mammals, while the
constant portions are homologous to the sequences in antibodies
derived from another. One clear advantage to such chimeric forms is
that, for example, the variable regions can conveniently be derived
from presently known sources using readily available hybridomas or
B cells from non-human host organisms in combination with constant
regions derived from, for example, human cell preparations. While
the variable region has the advantage of ease of preparation, and
the specificity is not affected by its source, the constant region
being human is less likely to elicit an immune response from a
human subject when the antibodies are injected than would the
constant region from a non-human source. However, the definition is
not limited to this particular example.
[0211] In some embodiments, an antibody included or used in a
targeting moiety described herein (or an antibody targeting moiety)
is a humanized antibody. As used herein, humanized antibodies refer
to forms of non-human (e.g. murine) antibodies that are specific
chimeric immunoglobulins, immunoglobulin chains, or fragments
thereof (such as Fv, Fab, Fab', F(ab').sub.2 or other
antigen-binding subsequences of antibodies) that contain minimal
sequence derived from non-human immunoglobulin. For the most part,
humanized antibodies are human immunoglobulins (recipient antibody)
in which residues from a HVR or CDR of the recipient are replaced
by residues from a HVR or CDR of a non-human species (donor
antibody) such as mouse, rat, or rabbit having the desired
specificity, affinity, and capacity. In some instances, Fv
framework region (FR) residues of the human immunoglobulin are
replaced by corresponding non-human residues. Furthermore, the
humanized antibody may comprise residues that are found neither in
the recipient antibody nor in the imported HVR or CDR or framework
sequences, but are included to further refine and optimize antibody
performance. In general, the humanized antibody will comprise
substantially all of at least one, and typically two, variable
domains, in which all or substantially all of the HVR or CDR
regions correspond to those of a non-human immunoglobulin and all
or substantially all of the FR regions are those of a human
immunoglobulin consensus sequence. The humanized antibody optimally
also will comprise at least a portion of an immunoglobulin constant
region or domain (Fc), typically that of a human immunoglobulin.
Antibodies may have Fc regions modified as described in WO
99/58572. Other forms of humanized antibodies have one or more HVRs
or CDRs (one, two, three, four, five, six) which are altered with
respect to the original antibody, which are also termed one or more
HVRs or CDRs "derived from" one or more HVRs or CDRs from the
original antibody.
[0212] In some embodiments, an antibody included or used in a
targeting moiety described herein (or an antibody targeting moiety)
is a human antibody. As used herein, a human antibody means an
antibody having an amino acid sequence corresponding to that of an
antibody produced by a human and/or has been made using any of the
techniques for making human antibodies known in the art. A human
antibody used herein includes antibodies comprising at least one
human heavy chain polypeptide or at least one human light chain
polypeptide. One such example is an antibody comprising murine
light chain and human heavy chain polypeptides. Human antibodies
can be produced using various techniques known in the art. In one
embodiment, the human antibody is selected from a phage library,
where that phage library expresses human antibodies (Vaughan et
al., 1996, Nature Biotechnology, 14:309-314; Sheets et al., 1998,
PNAS, (USA) 95:6157-6162; Hoogenboom and Winter, 1991, J. Mol.
Biol., 227:381; Marks et al., 1991, J. Mol. Biol., 222:581). Human
antibodies can also be made by introducing human immunoglobulin
loci into transgenic animals, e.g., mice in which the endogenous
immunoglobulin genes have been partially or completely inactivated.
This approach is described in U.S. Pat. Nos. 5,545,807; 5,545,806;
5,569,825; 5,625,126; 5,633,425; and 5,661,016. Alternatively, the
human antibody may be prepared by immortalizing human B lymphocytes
that produce an antibody directed against a target antigen (such B
lymphocytes may be recovered from an individual or may have been
immunized in vitro). See, e.g., Cole et al., Monoclonal Antibodies
and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al.,
1991, J. Immunol., 147 (1):86-95; and U.S. Pat. No. 5,750,373.
[0213] In some embodiments, an antibody included or used in a
targeting moiety described herein (or an antibody targeting moiety)
specifically binds to an antigen on a cancer cell such as a
nonhematopoietic cancer cell (e.g., colorectal, pancreatic, or
gastric cancer cell). In some embodiments, the antibody
specifically binds to a carbohydrate-containing epitope on CD43,
for example, an antibody described in U.S. Pat. No. 7,674,605, U.S.
Pat. No. 7,982,017, PCT/US2007/013587 (Publication No. WO
2007/146172), or PCT/US2008/087515 (Publication No. WO
2009/079649), the contents of each of which are incorporated herein
by reference. In some embodiments, the antibody is h5F1Ca. 1
antibody.
[0214] Table 1 below shows the amino acid sequence of humanized
5F1Ca. 1 (h5F1Ca. 1) heavy and light chain.
TABLE-US-00001 TABLE 1(A) h5F1Ca.1 heavy chain amino acid sequence
(SEQ ID NO: 1) (Kabat CDRs in some embodiments are underlined; the
sequence in constant region is italicized) (SEQ ID NO: 1) 1
QVQLVQSGAEVKKPGASVKMSCKASGYTFTSYVMHWIRQAPGQGLEWIGYINPYNGGTQY 61
NEKFKGRATLTSDTSASTAYMELSSLRSEDTAVYYCARRTFPYYFDYWGQGTLLTVSSAS 121
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL 181
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS 241
VFLFPPKPEDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST 301
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT 361
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ 421
GNVFSCSVMHEALHNHYTQKSLSLSPGK
TABLE-US-00002 TABLE 1(B) h5F1Ca.1 light chain amino acid sequence
(SEQ ID NO: 2) (Kabat CDRs in some embodiments are underlined; the
sequence in constant region is italicized) (SEQ ID NO: 2) 1
DVVMTQTPLSLPVTLGEPASISCRSSQSILHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF 61
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHAPLTFGGGTKLEIKRTVAAPSV 121
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 181
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[0215] In some embodiments, the antibody is antibody h5F1Ca. 1 or
an antibody derived from antibody h5F1Ca. 1. The heavy chain and
light chain sequences of hSF1Ca. 1 are set forth in SEQ ID NO: 1
and SEQ ID NO:2, respectively. In some embodiments, the antibody
comprises one, two, or three HVRs (or CDRs) from a light chain
and/or a heavy chain of the antibody h5F1Ca. 1 (or an antibody
derived from antibody h5F1Ca. 1). In some embodiments, the antibody
comprises a fragment or a region of the antibody h5F1Ca. 1. In one
embodiment, the fragment is a light chain of the antibody h5F1Ca.
1. In another embodiment, the fragment is a heavy chain of the
antibody h5F1Ca. 1. In yet another embodiment, the fragment
comprises one or more variable regions from a light chain and/or a
heavy chain of the antibody h5F1Ca. 1 (or an antibody derived from
h5F1Ca. 1). In yet another embodiment, the fragment comprises one,
two, or three HVRs (or CDRs) from a light chain and/or a heavy
chain of the antibody h5F1Ca. 1 (or an antibody derived from
h5F1Ca. 1). In some embodiments, the one or more HVRs (or CDRs)
derived from antibody h5F1Ca. 1 are at least about 85%, at least
about 86%, at least about 87%, at least about 88%, at least about
89%, at least about 90%, at least about 91%, at least about 92%, at
least about 93%, at least about 94%, at least about 95%, at least
about 96%, at least about 97%, at least about 98%, or at least
about 99% identical to at least one, at least two, at least three,
at least four, at least five, or at least six HVRs (or CDRs) of
h5F1Ca. 1. In some embodiments, the antibody comprises a heavy
chain variable region comprising one, two or three HVRs (or CDRs)
from SEQ ID NO: 1 and/or a light chain variable region comprising
one, two or three HVRs (or CDRs) from SEQ ID NO:2. In some
embodiments, the antibody comprises a heavy chain variable region
comprising the three HVRs (or CDRs) from SEQ ID NO:1 and/or a light
chain variable region comprising the three HVRs (or CDRs) from SEQ
ID NO:2. In some embodiments, the antibody comprises a heavy chain
variable region comprising amino acids 1-118 of SEQ ID NO: 1 and/or
a light chain variable region comprising amino acids 1-113 of SEQ
ID NO: 2. In some embodiments, the antibody is chimeric antibody.
In some embodiments, the antibody is humanized antibody.
[0216] In some embodiments, an antibody included or used in a
targeting moiety described herein (or an antibody targeting moiety)
specifically binds to a transferrin receptor (such as human
transferrin receptor) expressed by nonhematopoietic cancer cells
(e.g., lung, ovarian, breast, prostate, liver, endometrial,
colorectal, pancreatic, or gastric cancer cell). The antibody may
specifically bind to a modification (such as a carbohydrate) on a
transferrin receptor expressed by nonhematopoietic cancer cells. In
some embodiments, the antibody specifically binds to a carbohydrate
on a transferrin receptor expressed by nonhematopoietic cancer
cells. In some embodiments, the antibody specifically binds to a
carbohydrate-containing epitope on a transferrin receptor, for
example, an antibody described in U.S. Provisional Patent
Application No. 61/584,125, filed Jan. 6, 2012, or in PCT Patent
Application No. PCT/US2013/020263 (published as WO 2013/103800),
the contents of which are incorporated by reference in their
entirety. In some embodiments, the antibody is chimeric 5D7-54.17
antibody (c5D7), 5D7-54.17, or an antibody derived from 5D7-54.17
antibody (e.g., as described in U.S. Provisional Patent Application
No. 61/584,125). In some embodiments, the antibody is c5D7
antibody.
[0217] Table 2 below shows the amino acid sequences of the heavy
chain sequence and light chain sequence of c5D7 antibody.
TABLE-US-00003 TABLE 2(A) c5D7 Heavy chain sequence (SEQ ID NO: 3)
(Kabat CDRs in some embodiments are underlined; the sequence in
constant region is italicized) (SEQ ID NO: 3) 1
EVQLQQSGPEVVKPGASMKMSCKTSGYKFTGYYMDWVKQSLGASFEWIGRVIPSNGDTRY 61
NQKFEGKATLTVDRSSSTAYMELNSLTSEDSAVYYCARKPLSGNAADYWGQGTSVTVSTA 121
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG 181
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP 241
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 301
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL 361
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ 421
QGNVESCSVMHEALHNHYTQKSLSLSPGK
TABLE-US-00004 TABLE 2(B) c5D7 Light chain sequence (SEQ ID NO: 4)
(Kabat CDRs in some embodiments are underlined; the sequence in
constant region is italicized) (SEQ ID NO: 4) 1
ETTVTQSPASLSVATGEKVTIRCITSTDIDDDMNWYQQKPGEPPKLLISDGNTLRPGVPS 61
RFSSSGYGTDFVFTIENTLSEDITDYYCMQSDNMPFTFGSGTKLEIKRTVAAPSVFIFPP 121
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSEDSTYSLSSTLT 181
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[0218] In some embodiments, the antibody is c5D7 antibody or an
antibody derived from c5D7 antibody. The heavy chain and light
chain sequences of c5D7 antibody are set forth in SEQ ID NO:3 and
SEQ ID NO:4, respectively (see Table 2). In some embodiments, the
antibody comprises one, two, or three HVRs (or CDRs) from a light
chain and/or a heavy chain of the c5D7 antibody (or an antibody
derived from c5D7 antibody). In some embodiments, the antibody
comprises a fragment or a region of the antibody c5D7 antibody. In
one embodiment, the fragment is a light chain of the c5D7 antibody.
In another embodiment, the fragment is a heavy chain of the c5D7
antibody. In yet another embodiment, the fragment comprises one or
more variable regions from a light chain and/or a heavy chain of
the c5D7 antibody (or an antibody derived from c5D7 antibody). In
yet another embodiment, the fragment comprises one, two, or three
HVRs (or CDRs) from a light chain and/or a heavy chain of the c5D7
antibody (or an antibody derived from c5D7). In some embodiments,
the one or more HVRs (or CDRs) derived from c5D7 antibody are at
least about 85%, at least about 86%, at least about 87%, at least
about 88%, at least about 89%, at least about 90%, at least about
91%, at least about 92%, at least about 93%, at least about 94%, at
least about 95%, at least about 96%, at least about 97%, at least
about 98%, or at least about 99% identical to at least one, at
least two, at least three, at least four, at least five, or at
least six HVRs (or CDRs) of c5D7 antibody. In some embodiments, the
antibody comprises a heavy chain variable region comprising one,
two or three HVRs (or CDRs) from SEQ ID NO:3 and/or a light chain
variable region comprising one, two or three HVRs (or CDRs) from
SEQ ID NO:4. In some embodiments, the antibody comprises a heavy
chain variable region comprising the three HVRs (or CDRs) from SEQ
ID NO:3 and/or a light chain variable region comprising the three
HVRs (or CDRs) from SEQ ID NO:4. In some embodiments, the antibody
comprises a heavy chain variable region comprising amino acids
1-119 of SEQ ID NO: 3 and/or a light chain variable region
comprising amino acids 1-108 of SEQ ID NO: 4. In some embodiments,
the antibody is chimeric antibody. In some embodiments, the
antibody is humanized antibody.
[0219] As used herein, "percent (%) amino acid sequence identity"
and "homology" with respect to a sequence refers to the percentage
of amino acid residues in a candidate sequence that are identical
with the amino acid residues in the specific sequence, after
aligning the sequences and introducing gaps, if necessary, to
achieve the maximum percent sequence identity, and not considering
any conservative substitutions as part of the sequence identity.
Alignment for purposes of determining percent amino acid sequence
identity can be achieved in various ways that are within the skill
in the art, for instance, using publicly available computer
software such as BLAST, BLAST-2, ALIGN or MEGALIGN.TM. (DNASTAR)
software. Those skilled in the art can determine appropriate
parameters for measuring alignment, including any algorithms needed
to achieve maximal alignment over the full length of the sequences
being compared.
[0220] In some embodiments, a CDR described herein is Kabat CDR,
Chothia CDR, or contact CDR. In some embodiments, the CDR is a
Kabat CDR. In some embodiments, the CDR is a Chothia CDR. In other
embodiments, the CDR is a combination of a Kabat and a Chothia CDR
(also termed "combined CDR" or "extended CDR"). In other words, for
any given embodiment containing more than one CDR, the CDRs may be
any of Kabat, Chothia, and/or combined. Methods of determining CDRs
are known in the field.
[0221] A variable region of an antibody refers to the variable
region of the antibody light chain or the variable region of the
antibody heavy chain, either alone or in combination. Generally,
the variable region(s) mediate antigen binding and define
specificity of a particular antibody for its particular antigen.
The variable regions may have relatively invariant stretches called
framework regions (FRs) (e.g., FR of 15-30 amino acids) separated
by shorter regions of extreme variability called "hypervariable
regions" ("HVR") (e.g., HVRs that are each 9-12 amino acids long).
In some embodiments, the variable domains of native heavy and light
chains each comprise four FRs, largely adopting a beta-sheet
configuration, connected by three hypervariable regions, which form
loops connecting, and in some cases forming part of, the beta-sheet
structure. The hypervariable regions in each chain may be held
together in close proximity by the FRs and, with the hypervariable
regions from the other chain, contribute to the formation of the
antigen-binding site of antibodies (see Kabat et al., Sequences of
Proteins of Immunological Interest. 5th Ed. Public Health Service,
National Institutes of Health, Bethesda, Md. (1991)). The constant
domains may not be involved directly in binding an antibody to an
antigen, but may exhibit various effector functions, such as
participation of the antibody in antibody dependent cellular
cytotoxicity (ADCC). A constant region of an antibody refers to the
constant region of the antibody light chain or the constant region
of the antibody heavy chain, either alone or in combination. A
constant region of an antibody generally provides structural
stability and other biological functions such as antibody chain
association, secretion, transplacental mobility, and complement
binding, but is not involved with binding to the antigen. The amino
acid sequence and corresponding exon sequences in the genes of the
constant region will be dependent upon the species from which it is
derived; however, variations in the amino acid sequence leading to
allotypes will be relatively limited for particular constant
regions within a species. The variable region of each chain is
joined to the constant region by a linking polypeptide sequence.
The linkage sequence is coded by a "J" sequence in the light chain
gene, and a combination of a "D" sequence and a "J" sequence in the
heavy chain gene.
[0222] The term "hypervariable region" ("HVR") when used herein
refers to the amino acid residues of an antibody which are
responsible for antigen-binding. The hypervariable region generally
comprises amino acid residues from a "complementarity determining
region" or "CDR" (e.g. around about residues 24-34 (L1), 50-56 (L2)
and 89-97 (L3) in the VL, and around about 31-35B (H1), 50-65 (H2)
and 95-102 (H3) in the VH (in one embodiment, H1 is around about
31-35); Kabat et al., Sequences of Proteins of Immunological
Interest. 5th Ed. Public Health Service, National Institutes of
Health, Bethesda, Md. (1991)) and/or those residues from a
"hypervariable loop" (e.g. residues 26-32 (L1), 50-52 (L2) and
91-96 (L3) in the VL, and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in
the VH; Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). There
are multiple ways for determining CDRs, for example, an approach
based on cross-species sequence variability (i.e., Kabat et al.
Sequences of Proteins of Immunological Interest, (5th ed., 1991,
National Institutes of Health, Bethesda Md.)); and an approach
based on crystallographic studies of antigen-antibody complexes
(Al-lazikani et al. (1997) J. Mol. Biol. 273:927-948)). The HVRs
that are Kabat complementarity-determining regions (CDRs) are based
on sequence variability and are the most commonly used (Kabat et
al., supra). Chothia refers instead to the location of the
structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917
(1987)). The AbM HVRs represent a compromise between the Kabat CDRs
and Chothia structural loops, and are used by Oxford Molecular's
AbM antibody-modeling software. The "contact" HVRs are based on an
analysis of the available complex crystal structures. As used
herein, a CDR may be a CDR defined by any of the approaches or by a
combination of any two or three of the approaches. The CDR may be
Kabat CDR, Chothia CDR, or contact CDR. The residues from each of
these HVRs are noted below.
TABLE-US-00005 Loop Kabat AbM Chothia Contact L1 L24-L34 L24-L34
L26-L32 L30-L36 L2 L50-L56 L50-L56 L50-L52 L46-L55 L3 L89-L97
L89-L97 L91-L96 L89-L96 H1 H31-H35B H26-H35B H26-H32 H30-H35B
(Kabat numbering) H1 H31-H35 H26-H35 H26-H32 H30-H35 (Chothia
numbering) H2 H50-H65 H50-H58 H53-H55 H47-H58 H3 H95-H102 H95-H102
H96-H101 H93-H101
[0223] HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34
(L1), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and
26-35 (H1), 50-65 or 49-65 (a preferred embodiment) (H2), and
93-102, 94-102, or 95-102 (H3) in the VH. The variable-domain
residues are numbered according to Kabat et al., supra, for each of
these extended-HVR definitions.
[0224] In some embodiments, the antibody is a cysteine engineered
antibody comprising a free cysteine amino acid in the heavy chain
or light chain. Engineering of a free cysteine amino acid in the
antibody may provide a reactive electrophilic functionality that
may further enable antibody conjugate compounds such as
antibody-drug conjugate (ADC) compounds with drug molecules at
specific sites (i.e., site-specific conjugation). Examples of
cysteine engineered antibodies and means to generate cysteine
engineered antibodies are provided by Junutula, J R et al., (2008)
Nat. Biotech. 26(8):925-932; Lyons, A et al., (1990) Prot.
Engineering 3(8):703-708; and Stimmel, J B et al., (2000) J. Biol.
Chem. 275(39):30445-30450. In some embodiments, the antibody is
engineered to substitute amino acid residues (e.g., naturally
occurring amino acids) on the heavy chain or light chain with one
or more cysteine residues provided that the reactive thiol groups
of the cysteine residues have little or no impact of antibody
folding or assembly and do not significantly alter antigen binding.
In some embodiments, the cysteine residues are evaluated for the
reactivity of the newly introduced, engineered cysteine thiol
groups. The thiol reactivity value is a relative, numerical term in
the range of 0 to 1.0 and can be measured for any cysteine
engineered antibody. In some embodiments, the thiol reactivity
values of cysteine engineered antibodies of the invention are any
one of about 0.6 to 1.0; 0.7 to 1.0; or 0.8 to 1.0. Cysteine
engineered antibodies for site-specific conjugation of provided by
WO 2006/034488, WO 2010/141902, WO 2013/093809, WO 2008/038024, WO
2008/070593, WO 2009/092011, WO 2011/005481 and WO 2011/156328.
[0225] A cysteine engineered antibody may be prepared by
mutagenizing a nucleic acid sequence of a parent antibody by
replacing one or more amino acid residues by cysteine to encode the
cysteine engineered antibody; expressing the cysteine engineered
antibody; and isolating the cysteine engineered antibody. In some
embodiments, the cysteine engineered antibody is an antibody
fragment; for example, a Fab, Fab', F(ab')2, Fv, or a single chain
(ScFv) antibody. In some embodiments, the antibody is engineered to
include one or more cysteine substitutions of amino acid residues
S157, T169 and S442 (EU numbering). In some embodiments of the
invention, an h5F1Ca. 1, c5D7 antibody or an antibody derived from
h5F1Ca. 1 or c5D7 antibody is engineered to comprise one or more
free cysteine residues.
[0226] In some embodiments, one or more amino acid residues at any
one or more of the following positions of the IgG heavy chain is
replaced with a cysteine residue: 40, 43, 84, 88, 103, 112, 113,
114, 115, 131, 132, 133, 134, 135, 136, 137, 138, 139, 161, 168,
172, 234, 235, 237, 239, 246, 249, 265, 267, 269, 270, 276, 278,
282, 283, 284, 287, 289, 292, 293, 297, 298, 299, 300, 302, 303,
312, 314, 315, 318, 320, 324, 326, 327, 330, 332, 333, 334, 335,
336, 337, 339, 345, 347, 354, 355, 356, 358, 359, 360, 361, 362,
370, 373, 376, 378, 380, 382, 383, 384, 386, 388, 398, 390, 392,
393, 400, 401, 404, 411, 413, 414, 416, 418, 419, 421, 422, 428,
431, 432, 437, 438, 439, 440, 442, 443, and 444; numbering
according to the EU index of Kabat et al. (1991, NIH Publication
91-3242, National Technical Information Service, Springfield, Va.,
hereinafter "Kabat").
[0227] In some embodiments, one, two, three, four, five, six,
seven, eight, nine, or ten or more amino acid residues at any
combination of the following positions of the IgG heavy chain is
replaced with a cysteine residue: 40, 43, 84, 88, 103, 112, 113,
114, 115, 131, 132, 133, 134, 135, 136, 137, 138, 139, 161, 168,
172, 234, 235, 237, 239, 246, 249, 265, 267, 269, 270, 276, 278,
282, 283, 284, 287, 289, 292, 293, 297, 298, 299, 300, 302, 303,
312, 314, 315, 318, 320, 324, 326, 327, 330, 332, 333, 334, 335,
336, 337, 339, 345, 347, 354, 355, 356, 358, 359, 360, 361, 362,
370, 373, 376, 378, 380, 382, 383, 384, 386, 388, 398, 390, 392,
393, 400, 401, 404, 411, 413, 414, 416, 418, 419, 421, 422, 428,
431, 432, 437, 438, 439, 440, 442, 443, and 444; numbering
according to the EU index of Kabat.
[0228] In some embodiments, one or more amino acid residues at any
one or more of the following positions of the IgG lambda light
chain is replaced with a cysteine residue: 7, 15, 20, 22, 25, 43,
110, 111, 125, 144, 149, 155, 158, 161, 168, 185, 188, 189, 191,
197, 205, 206, 207, 208 and 210, according to the EU index of
Kabat.
[0229] In some embodiments, one, two, three, four, five, six,
seven, eight, nine, or ten or more amino acid residues at any
combination of the following positions of the IgG lambda light
chain is replaced with a cysteine residue: 7, 15, 20, 22, 25, 43,
110, 111, 125, 144, 149, 155, 158, 161, 168, 185, 188, 189, 191,
197, 205, 206, 207, 208 and 210, according to the EU index of
Kabat.
[0230] In some embodiments, one or more amino acid residues at any
one or more of the following positions of the IgG kappa light chain
is replaced with a cysteine residue: 7, 15, 20, 22, 25, 43, 110,
111, 144, 168, 183, and 210, according to the numbering of
Kabat.
[0231] In some embodiments, one, two, three, four, five, six,
seven, eight, nine, or ten or more amino acid residues at any
combination of the following positions of the IgG kappa light chain
is replaced with a cysteine residue: 7, 15, 20, 22, 25, 43, 110,
111, 144, 168, 183, and 210, according to the numbering of
Kabat.
[0232] In some embodiments, the antibody is isolated. An isolated
antibody refers to an antibody which has been identified and
separated and/or recovered from a component of its natural
environment. In some embodiments, the antibody is substantially
pure. The term "substantially pure" may refer to material which is
at least 50% pure (i.e., free from contaminants), more preferably
at least 90% pure, more preferably at least 95% pure, more
preferably at least 98% pure, more preferably at least 99% pure. In
some embodiments, the antibody is a monoclonal antibody. In some
embodiments, the antibody is a humanized antibody. In some
embodiments, the antibody is a chimeric antibody. In some
embodiments, the antibody is a human antibody. In some embodiments,
the antibody is IgG (such as IgG.sub.1, IgG.sub.2, or IgG.sub.4).
In some embodiments, the antibody is human IgG such as human
IgG.sub.1.
[0233] The antibodies described herein may further include analogs
and derivatives that are either modified, i.e., by the covalent
attachment of any type of molecule as long as such covalent
attachment permits the antibody to retain its antigen binding
immunospecificity. For example, the derivatives and analogs of the
antibodies include those that have been further modified, e.g., by
glycosylation, acetylation, pegylation, phosphylation, amidation,
derivatization by known protecting/blocking groups, proteolytic
cleavage, linkage to a cellular ligand or other protein, etc.
Chemical modifications can be carried out by known techniques,
including, but not limited to specific chemical cleavage,
acetylation, formulation, etc. Additionally, the analog or
derivative can contain one or more unnatural amino acids.
[0234] In some embodiments, the antibody targeting moiety T in
compounds of formulae (I)-(V), or a salt or solvate or stereoisomer
thereof, is an antibody partially conjugated with a drug moiety,
such that it may be further linked to additional drug moieties.
Thus, in some embodiments, it is intended that a compound of the
formula (I) or a salt or solvate or stereoisomer thereof embraces a
compound of the formula (Ia) or a salt or solvate or stereoisomer
thereof. Likewise, a compound of the formula (II) or a salt or
solvate or stereoisomer thereof is intended to embrace a compound
of the formula (IIa) or a salt or solvate or stereoisomer thereof;
a compound of the formula (III) or a salt or solvate or
stereoisomer thereof is intended to embrace a compound of the
formula (IIIa) or a salt or solvate or stereoisomer thereof, a
compound of the formula (IV) or a salt or solvate or stereoisomer
thereof is intended to embrace a compound of the formula (IVa) or a
salt or solvate or stereoisomer thereof; and a compound of the
formula (V) or a salt or solvate or stereoisomer thereof is
intended to embrace a compound of the formula (Va) or a salt or
solvate or stereoisomer thereof.
[0235] The antibodies described herein may include antibodies
immunospecific for a cancer cell antigen or an antibody for
treatment of cancer. Methods of making antibodies immunospecific
for a cancer cell antigen are known in the art. The antibodies may
include any of the following: anti-HER2 antibody such as a
humanized anti-HER2 monoclonal antibody (e.g., HERCEPTIN
(Trastuzumab; Genentech, CA)), anti-CD20 antibody such as a
chimeric anti-CD20 monoclonal antibody (e.g., RITUXAN (rituximab;
Genentech)), OvaRex (AltaRex Corporation, MA), Panorex (Glaxo
Wellcome, NC), BEC2 (ImClone Systems Inc., NY), IMC-C225 (ImClone
Systems Inc., NY), Vitaxin (MedImmune, Inc., MD), Campath I/H
(Leukosite, MA), Smart MI95 (Protein Design Labs, Inc., CA),
LymphoCide (Immunomedics, Inc., NJ), Smart ID10 (Protein Design
Labs, Inc., CA), Oncolym (Techniclone, Inc., CA), anti-CD2 antibody
such as humanized anti-CD2 mAb (e.g., Allomune (BioTransplant,
CA)), anti-VEGF antibody such as humanized anti-VEGF antibody
(e.g., bevacizumab (Genentech, Inc., CA)), CEAcide (Immunomedics,
NJ), anti-KDR antibody such as an anti-KDR chimeric antibody (e.g.,
IMC-1C11 (ImClone Systems, NJ)), anti-EGFR antibody such as
anti-EGFR chimeric antibody (e.g., Cetuximab (ImClone, NJ)), BR96
mAb (Trail, P. A. et al., Science 1993, 261, 212-215), BR64 (Trail,
P A et al., Cancer Research 1997, 57, 100-105), anti-CD30 antibody,
and mAbs against the CD 40 antigen such as S2C6 mAb. The antibodies
may further include antibodies against any of the following
antigens: CA125, CA15-3, CA19-9, L6, Lewis Y, Lewis X, alpha
fetoprotein, CA 242, carbonic anhydrase IX (CAIX/CA9), CA6, cripto,
mesothelin, .alpha.v-integrin, LIV-1 (also known as SLC39A6 or
ZIP6), SLC44A4 (AGS-5), Guanylyl cyclase C (GCC), ENPP3, FOLR1,
EGFRvIII, MUC16, endothelian receptor ETB (ETBR), NaPi2b
(sodium-dependent phosphate transport protein 2b, also known as
SLC34A2), prostate-specific membrane antige (PSMA), 5T4, STEAP1,
Nectin-4, GPNMB, epithelial cell adhesion molecule (EpCAM), EphA2,
folate receptor alpha (FRA), CanAg, human non-muscular myosin heavy
chain type A (nmMHCA), SLITRK6, T cell immunoglobulin and mucin
domain 1 (TIM-1, also known as HAVCR1), Tissue Factor (TF),
placental alkaline phosphatase, prostate specific antigen,
prostatic acid phosphatase, epidermal growth factor, MAGE-1,
MAGE-2, MAGE-3, MAGE-4, anti-transferrin receptor, p97, MUC1-KLH,
CEA, gp100, MART1, PSA, IL-2 receptor, CD20, CD52, CD33, CD22,
CD138 (Syndecan-1), CD79b, CD74, CD70, CD56, CD37, CD19,
Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5,
also known as CD66e), epithelial glycoprotein-1 (EGP-1, also known
as TROP2, TACSTD2, GA733-1, M1S1), human chorionic gonadotropin,
CD38, CD40, mucin, P21, MPG and Neu oncogene product.
[0236] The antibodies described herein may further include
antibodies that can bind to both a receptor or a receptor complex
expressed on an activated lymphocyte. The receptor or receptor
complex can comprise an immunoglobulin gene superfamily member, a
TNF receptor superfamily member, an integrin, a cytokine receptor,
a chemokine receptor, a major histocompatibility protein, a lectin,
or a complement control protein. Non-limiting examples of suitable
immunoglobulin superfamily members are CD2, CD3, CD4, CD8, CD19,
CD22, CD28, CD79, CD90, CD152/CTLA-4, PD-1, and ICOS. Non-limiting
examples of suitable TNF receptor superfamily members are CD27,
CD40, CD95/Fas, CD134/OX40, CD137/4-1BB, TNF-R1, TNFR-2, RANK,
TACI, BCMA, osteoprotegerin, Apo2/TRAIL-R1, TRAIL-R2, TRAIL-R3,
TRAIL-R4, and APO-3. Non-limiting examples of suitable integrins
are CD11a, CD11b, CD11 c, CD18, CD29, CD41, CD49a, CD49b, CD49c,
CD49d, CD49e, CD49f, CD103, and CD104. Non-limiting examples of
suitable lectins are C-type, S-type, and I-type lectin. The
antibodies described herein may further include antibodies that are
immunospecific for a viral or a microbial antigen. A viral antigen
may include any of the following: a viral peptide, polypeptide
protein (e.g., HIV gp120, HIV nef, RSV F glycoprotein, influenza
virus neuramimidase, influenza virus hemagglutinin, HTLV tax,
herpes simplex virus glycoprotein (e.g., gB, gC, gD, and gE) and
hepatitis B surface antigen) that is capable of eliciting an immune
response. A microbial antigen may include any of the following: a
microbial peptide, polypeptide, protein, saccharide,
polysaccharide, or lipid molecule (e.g., a bacterial, fungi,
pathogenic protozoa, or yeast polypeptide including, e.g., LPS and
capsular polysaccharide 5/8) that is capable of eliciting an immune
response.
[0237] Methods of making a targeting moiety (e.g., an antibody, a
polypeptide, a peptide, or non-peptidyl moiety) are known in the
art, such as the methods described in U.S. Pat. No. 7,674,605, U.S.
Pat. No. 7,982,017, PCT/US2007/013587 (Publication No. WO
2007/146172), or PCT/US2008/087515 (Publication No. WO
2009/079649).
Representative Linkers
[0238] In certain instances, the "-A-L.sup.4-L.sup.3-L.sup.2-" or
"-A-L.sup.4-L.sup.3-" portion in the compound of Formula (I), (Ia),
(II) or (IIa) is:
##STR00029##
[0239] In certain instances, the "-A-L.sup.4-L.sup.3-L.sup.2-" or
"-A-L.sup.4-L.sup.3-" portion in the compound of Formula (I), (Ia),
(II) or (IIa) is:
##STR00030##
[0240] In certain instances, the "-A-L.sup.4-L.sup.3-L.sup.2-" or
"-A-L.sup.4-L.sup.3-" portion in the compound of Formula (I), (Ia),
(II) or (IIa) is:
##STR00031##
[0241] In certain instances, the
"-A-L.sup.4-L.sup.3-L.sup.2-X-L.sup.1-D" portion in the compound of
Formula (I), (Ia), (II) or (IIa) is:
##STR00032##
[0242] In such instance, the present disclosure provides a compound
of Formula (III):
##STR00033##
or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety. In certain instances, in Formula (III), T is an
antibody. In certain embodiments, the antibody is h5F1Ca. 1 or
c5D7.
[0243] In some embodiments, provided is a compound of Formula
(IIIa):
##STR00034##
[0244] or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety and p is 1 to 20. In some embodiments, p is 1 to
8. In some embodiments, p is 1 to 6. In some embodiments, p is 1 to
4. In some embodiments, p is 2 to 4. In some embodiments, p is 1,
2, 3 or 4. In some embodiments, p is 2. In some embodiments, p is
3. In some embodiments, p is 4. In certain instances, in Formula
(IIIa), T is an antibody, optionally where one or more amino acid
residues of the heavy chain and/or the light chain of the antibody
are replaced with cysteine residues. In certain embodiments, the
antibody is h5F1Ca. 1 or c5D7, or h5F1Ca. 1 where one or more amino
acid residues of the heavy chain and/or the light chain of the
antibody are replaced with cysteine residues, or c5D7 where one or
more amino acid residues of the heavy chain and/or the light chain
of the antibody are replaced with cysteine residues.
[0245] In certain embodiments, the present disclosure provides
intermediates for synthesis of compounds of Formula (I). The
present disclosure provides a compound of Formula (VI):
##STR00035##
[0246] or a salt or solvate thereof
[0247] The present disclosure provides a compound of Formula
(IX):
##STR00036##
or a salt or solvate thereof.
[0248] In certain instances, the
"-A-L.sup.4-L.sup.3-L.sup.2-X-L.sup.1-D" portion in the compound of
Formula (I), (Ia), (II) or (IIa) is:
##STR00037##
[0249] In such instance, the present disclosure provides a compound
of Formula (IV):
##STR00038##
or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety. In certain instances, in Formula (IV), T is an
antibody. In certain embodiments, the antibody is h5F1Ca. 1 or
c5D7.
[0250] In some embodiments, provided is a compound of Formula
(IVa):
##STR00039##
[0251] or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety and p is 1 to 20. In some embodiments, p is 1 to
8. In some embodiments, p is 1 to 6. In some embodiments, p is 1 to
4. In some embodiments, p is 2 to 4. In some embodiments, p is 1,
2, 3 or 4. In some embodiments, p is 2. In some embodiments, p is
3. In some embodiments, p is 4. In certain instances, in Formula
(IVa), T is an antibody, optionally where one or more amino acid
residues of the heavy chain and/or the light chain of the antibody
are replaced with cysteine residues. In certain embodiments, the
antibody is h5F1Ca. 1 or c5D7, or h5F1Ca. 1 where one or more amino
acid residues of the heavy chain and/or the light chain of the
antibody are replaced with cysteine residues, or c5D7 where one or
more amino acid residues of the heavy chain and/or the light chain
of the antibody are replaced with cysteine residues.
[0252] In certain embodiments, the present disclosure provides
intermediates for synthesis of compounds of Formula (I) or (Ia).
The present disclosure provides a compound of Formula (VII):
##STR00040##
[0253] or a salt or solvate thereof.
[0254] The present disclosure provides a compound of Formula
(X):
##STR00041##
[0255] or a salt or solvate thereof.
[0256] In certain instances, the
"-A-L.sup.4-L.sup.3-L.sup.2-X-L.sup.1-D" portion in the compound of
Formula (I), (Ia), (II) or (IIa) is:
##STR00042##
[0257] In such instance, the present disclosure provides a compound
of Formula (V):
##STR00043##
or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety. In certain instances, in Formula (V), T is an
antibody. In certain embodiments, the antibody is h5F1Ca. 1 or
c5D7.
[0258] In some embodiments, provided is a compound of Formula
(Va):
##STR00044##
[0259] or a salt or solvate or stereoisomer thereof; wherein T is a
targeting moiety and p is 1 to 20. In some embodiments, p is 1 to
8. In some embodiments, p is 1 to 6. In some embodiments, p is 1 to
4. In some embodiments, p is 2 to 4. In some embodiments, p is 1,
2, 3 or 4. In some embodiments, p is 2. In some embodiments, p is
3. In some embodiments, p is 4. In certain instances, in Formula
(Va), T is an antibody, optionally where one or more amino acid
residues of the heavy chain and/or the light chain of the antibody
are replaced with cysteine residues. In certain embodiments, the
antibody is h5F1Ca. 1 or c5D7, or h5F1Ca. 1 where one or more amino
acid residues of the heavy chain and/or the light chain of the
antibody are replaced with cysteine residues, or c5D7 where one or
more amino acid residues of the heavy chain and/or the light chain
of the antibody are replaced with cysteine residues.
[0260] In certain embodiments, the present disclosure provides
intermediates for synthesis of compounds of Formula (I). The
present disclosure provides a compound of Formula (VIII):
##STR00045##
[0261] or a salt or solvate thereof.
[0262] The present disclosure provides a compound of Formula
(XI):
##STR00046##
or a salt or solvate thereof.
[0263] The present disclosure provides a compound of Formula
(XII):
##STR00047##
[0264] or a salt or solvate or stereoisomer thereof; wherein R is
NO.sub.2 or NH.sub.2.
[0265] The compounds of Formulae (I)-(V) or (Ia)-(Va) may be
prepared and/or formulated as pharmaceutically acceptable salts.
Pharmaceutically acceptable salts are non-toxic salts of a free
base form of a compound that possesses the desired pharmacological
activity of the free base. These salts may be derived from
inorganic or organic acids. Non-limiting examples of
pharmaceutically acceptable salts include sulfates, pyrosulfates,
bisulfates, sulfites, bisulfites, phosphates,
monohydrogen-phosphates, dihydrogenphosphates, metaphosphates,
pyrophosphates, chlorides, bromides, iodides, acetates,
propionates, decanoates, caprylates, acrylates, formates,
isobutyrates, caproates, heptanoates, propiolates, oxalates,
malonates, succinates, suberates, sebacates, fumarates, maleates,
butyne-1,4-dioates, hexyne-1,6-dioates, benzoates, chlorobenzoates,
methylbenzoates, dinitrobenzoates, hydroxybenzoates,
methoxybenzoates, phthalates, sulfonates, methylsulfonates,
propylsulfonates, besylates, xylenesulfonates,
naphthalene-1-sulfonates, naphthalene-2-sulfonates, phenylacetates,
phenylpropionates, phenylbutyrates, citrates, lactates,
.gamma.-hydroxybutyrates, glycolates, tartrates, and mandelates.
Lists of other suitable pharmaceutically acceptable salts are found
in Remington's Pharmaceutical Sciences, 17th Edition, Mack
Publishing Company, Easton, Pa., 1985.
[0266] For a compound of any one of Formulae (I)-(V) or (Ia)-(Va)
that contains a basic nitrogen, a pharmaceutically acceptable salt
may be prepared by any suitable method available in the art, for
example, treatment of the free base with an inorganic acid, such as
hydrochloric acid, hydrobromic acid, sulfuric acid, sulfamic acid,
nitric acid, boric acid, phosphoric acid, and the like, or with an
organic acid, such as acetic acid, phenylacetic acid, propionic
acid, stearic acid, lactic acid, ascorbic acid, maleic acid,
hydroxymaleic acid, isethionic acid, succinic acid, valeric acid,
fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic
acid, salicylic acid, oleic acid, palmitic acid, lauric acid, a
pyranosidyl acid, such as glucuronic acid or galacturonic acid, an
alpha-hydroxy acid, such as mandelic acid, citric acid, or tartaric
acid, an amino acid, such as aspartic acid or glutamic acid, an
aromatic acid, such as benzoic acid, 2-acetoxybenzoic acid,
naphthoic acid, or cinnamic acid, a sulfonic acid, such as
laurylsulfonic acid, p-toluenesulfonic acid, methanesulfonic acid,
or ethanesulfonic acid, or any compatible mixture of acids such as
those given as examples herein, and any other acid and mixture
thereof that are regarded as equivalents or acceptable substitutes
in light of the ordinary level of skill in this technology.
[0267] Also provided are compositions comprising one or more
compounds of the formulae (I)-(V) or (Ia)-(Va), or a salt or
solvate or stereoisomers thereof. In the compounds of the formulae
(I)-(V) or (Ia)-(Va), or a salt or solvate or stereoisomers
thereof, the targeting moiety can have one or more sites of
attachment for linking to the drug moiety. Depending on the
accessibility of the attachment sites in the targeting moiety and
the relative concentration of the drug moiety in forming the
conjugate, a portion of the attachment sites may not be bonded to a
drug moiety in the conjugate formed. A mixture of compounds having
various number of drug moieties at each targeting moiety may form.
Thus a composition is also provided, comprising one or more
compounds of the formulae (Ia)-(Va), or a salt or solvate or
stereoisomers thereof. For example, for a targeting molecule having
4 sites of attachment, the composition may comprise one or more
compounds selected from a compound of formula (Ia) where p is 1, a
compound of formula (Ia) where p is 2, a compound of formula (Ia)
where p is 3, and a compound of formula (Ia) where p is 4. The
relative amounts of compounds in the composition may be adjusted to
achieve a desirable ratio between the drug moiety and the targeting
moiety. In some of embodiments, the composition comprises
predominantly one or two of the compounds.
[0268] The "drug-antibody ratio" (DAR) in a compound or composition
of the invention is defined as the molar ratio between the drug
moieties in the compound or composition and the antibodies in the
compound or composition. Where an antibody has more than one site
of attachment, more than one drug moiety may be linked to each
antibody. In some instances, a mixture is obtained comprising more
than one antibody-drug conjugate (ADC) molecules. The drug-antibody
ratios of the antibody-drug conjugates can be measured by
analytical methods know in the art, for example, methods as
described in Jeffrey, et al., Bioconjug. Chem. 24(7):1256-1263
(2013); and Sun et al., Bioconjug. Chem. 16(5):1282-1290 (2005). In
some embodiments, the composition comprising one or more ADCs of
detailed herein has an average DAR of about 0.5 to about 6, about 1
to about 5, about 1 to about 4, about 1.5 to about 3.5, or about 2
to about 4. In some preferred embodiments, the composition has an
average DAR of about 1.5 to about 3.5 or about 2 to about 3, or
about 2, or about 3. In some other preferred embodiments, the
composition has an average DAR of about 2.5+10%. In some
embodiments, the targeting antibody contains cysteine engineered
sites of attachment and the composition has an average DAR of about
2.0.
Pharmaceutical Compositions
[0269] For treatment purposes, a pharmaceutical composition of the
embodiments comprises at least one compound of Formulae (I)-(V) or
(Ia)-(Va), or a pharmaceutically acceptable salt thereof. The
pharmaceutical compositions may further comprise one or more
pharmaceutically-acceptable excipients or
pharmaceutically-acceptable carrier. A pharmaceutically-acceptable
excipient is a substance that is non-toxic and otherwise
biologically suitable for administration to a subject. Such
excipients facilitate administration of the compounds described
herein and are compatible with the active ingredient. Examples of
pharmaceutically-acceptable excipients include stabilizers,
lubricants, surfactants, diluents, anti-oxidants, binders, coloring
agents, bulking agents, emulsifiers, or taste-modifying agents. In
preferred embodiments, pharmaceutical compositions according to the
embodiments are sterile compositions. Pharmaceutical compositions
may be prepared using compounding techniques known or that become
available to those skilled in the art.
[0270] Sterile compositions are also contemplated by the
embodiments, including compositions that are in accord with
national and local regulations governing such compositions.
[0271] The pharmaceutical compositions and compounds described
herein may be formulated as solutions, emulsions, suspensions,
dispersions, or inclusion complexes such as cyclodextrins in
suitable pharmaceutical solvents or carriers, or as pills, tablets,
lozenges, suppositories, sachets, dragees, granules, powders,
powders for reconstitution, or capsules along with solid carriers
according to conventional methods known in the art for preparation
of various dosage forms. Pharmaceutical compositions of the
embodiments may be administered by a suitable route of delivery,
such as oral, parenteral, rectal, nasal, topical, or ocular routes,
or by inhalation. Preferably, the compositions are formulated for
intravenous or oral administration.
[0272] For oral administration, the compounds the embodiments may
be provided in a solid form, such as a tablet or capsule, or as a
solution, emulsion, or suspension. To prepare the oral
compositions, the compounds of the embodiments may be formulated to
yield a dosage of, e.g., from about 0.01 to about 50 mg/kg daily,
or from about 0.05 to about 20 mg/kg daily, or from about 0.1 to
about 10 mg/kg daily. Oral tablets may include the active
ingredient(s) mixed with compatible pharmaceutically acceptable
excipients such as diluents, disintegrating agents, binding agents,
lubricating agents, sweetening agents, flavoring agents, coloring
agents and preservative agents. Suitable inert fillers include
sodium and calcium carbonate, sodium and calcium phosphate,
lactose, starch, sugar, glucose, methyl cellulose, magnesium
stearate, mannitol, sorbitol, and the like. Exemplary liquid oral
excipients include ethanol, glycerol, water, and the like. Starch,
polyvinyl-pyrrolidone (PVP), sodium starch glycolate,
microcrystalline cellulose, and alginic acid are exemplary
disintegrating agents. Binding agents may include starch and
gelatin. The lubricating agent, if present, may be magnesium
stearate, stearic acid, or talc. If desired, the tablets may be
coated with a material such as glyceryl monostearate or glyceryl
distearate to delay absorption in the gastrointestinal tract, or
may be coated with an enteric coating.
[0273] Capsules for oral administration include hard and soft
gelatin capsules. To prepare hard gelatin capsules, active
ingredient(s) may be mixed with a solid, semi-solid, or liquid
diluent. Soft gelatin capsules may be prepared by mixing the active
ingredient with water, an oil such as peanut oil or olive oil,
liquid paraffin, a mixture of mono and di-glycerides of short chain
fatty acids, polyethylene glycol 400, or propylene glycol.
[0274] Liquids for oral administration may be in the form of
suspensions, solutions, emulsions, or syrups, or may be lyophilized
or presented as a dry product for reconstitution with water or
other suitable vehicle before use. Such liquid compositions may
optionally contain: pharmaceutically-acceptable excipients such as
suspending agents (for example, sorbitol, methyl cellulose, sodium
alginate, gelatin, hydroxyethylcellulose, carboxymethylcellulose,
aluminum stearate gel and the like); non-aqueous vehicles, e.g.,
oil (for example, almond oil or fractionated coconut oil),
propylene glycol, ethyl alcohol, or water; preservatives (for
example, methyl or propyl p-hydroxybenzoate or sorbic acid);
wetting agents such as lecithin; and, if desired, flavoring or
coloring agents.
[0275] The compositions of the embodiments may be formulated for
rectal administration as a suppository. For parenteral use,
including intravenous, intramuscular, intraperitoneal, intranasal,
or subcutaneous routes, the agents of the embodiments may be
provided in sterile aqueous solutions or suspensions, buffered to
an appropriate pH and isotonicity or in parenterally acceptable
oil. Suitable aqueous vehicles include Ringer's solution and
isotonic sodium chloride. Such forms may be presented in unit-dose
form such as ampoules or disposable injection devices, in
multi-dose forms such as vials from which the appropriate dose may
be withdrawn, or in a solid form or pre-concentrate that can be
used to prepare an injectable formulation. Illustrative infusion
doses range from about 1 to 1000 .mu.g/kg/minute of agent admixed
with a pharmaceutical carrier over a period ranging from several
minutes to several days.
[0276] For nasal, inhaled, or oral administration, the
pharmaceutical compositions of the embodiments may be administered
using, for example, a spray formulation also containing a suitable
carrier.
[0277] For topical applications, the compounds of the embodiments
are preferably formulated as creams or ointments or a similar
vehicle suitable for topical administration. For topical
administration, the inventive compounds may be mixed with a
pharmaceutical carrier at a concentration of about 0.1% to about
10% of drug to vehicle. Another mode of administering the agents of
the embodiments may utilize a patch formulation to effect
transdermal delivery.
[0278] The present disclosure provides a method of killing a cell,
comprising administering to the cell an amount of the compound of
Formulae (I)-(V) or (Ia)-(Va) sufficient to kill the cell. In
certain embodiments, the cell is a cancer cell. In certain
embodiments, the cancer cell is a gastric cancer cell, pancreatic
cancer cell, colorectal cancer cell, lung cancer cell or ovarian
cancer cell.
[0279] In another aspect, the present disclosure provides a method
of treating cancer in an individual in need thereof comprising
administering to the individual an effective amount of a compound
of Formulae (I)-(V) or (Ia)-(Va). In certain embodiments, the
cancer cell is a gastric cancer cell, pancreatic cancer cell,
colorectal cancer cell, lung cancer cell or ovarian cancer
cell.
Kits
[0280] The present disclosure provides a pharmaceutical pack or kit
comprising one or more containers comprising a compound of Formulae
(I)-(V) or (Ia)-(Va) useful for the treatment or prevention of
cancer. The kit can further comprise instructions for use in the
treatment of cancer.
[0281] The present disclosure also provides a pharmaceutical pack
or kit comprising one or more containers comprising one or more of
the ingredients of the pharmaceutical compositions of the present
embodiments. Optionally associated with such container(s) can be a
notice in the form prescribed by a governmental agency regulating
the manufacture, use or sale of pharmaceuticals or biological
products, which notice reflects approval by the agency of
manufacture, use or sale for human administration.
Synthesis of Drug Conjugates
[0282] The embodiments are also directed to processes and
intermediates useful for preparing subject compounds or a salt or
solvate or stereoisomer thereof.
[0283] Many general references providing commonly known chemical
synthetic schemes and conditions useful for synthesizing the
disclosed compounds are available (see, e.g., Smith and March,
March's Advanced Organic Chemistry: Reactions, Mechanisms, and
Structure, Fifth Edition, Wiley-Interscience, 2001.)
[0284] Compounds as described herein can be purified by any of the
means known in the art, including chromatographic means, such as
high performance liquid chromatography (HPLC), preparative thin
layer chromatography, flash column chromatography and ion exchange
chromatography. Any suitable stationary phase can be used,
including normal and reversed phases as well as ionic resins. Most
typically the disclosed compounds are purified via silica gel
and/or alumina chromatography. See, e.g., Introduction to Modern
Liquid Chromatography, 2nd ed., ed. L. R. Snyder and J. J.
Kirkland, John Wiley and Sons, 1979; and Thin Layer Chromatography,
E. Stahl (ed.), Springer-Verlag, New York, 1969.
[0285] During any of the processes for preparation of the subject
compounds, it may be necessary and/or desirable to protect
sensitive or reactive groups on any of the molecules concerned.
This may be achieved by means of conventional protecting groups as
described in standard works, such as T. W. Greene and P. G. M.
Wuts, "Protective Groups in Organic Synthesis," 4.sup.th ed.,
Wiley, New York 2006. The protecting groups may be removed at a
convenient subsequent stage using methods known from the art.
[0286] Exemplary chemical entities useful in methods of the
embodiments will now be described by reference to illustrative
synthetic schemes for their general preparation herein and the
specific examples that follow. Artisans will recognize that, to
obtain the various compounds herein, starting materials may be
suitably selected so that the ultimately desired substituents will
be carried through the reaction scheme with or without protection
as appropriate to yield the desired product. Alternatively, it may
be necessary or desirable to employ, in the place of the ultimately
desired substituent, a suitable group that may be carried through
the reaction scheme and replaced as appropriate with the desired
substituent. Furthermore, one of skill in the art will recognize
that the transformations shown in the schemes below may be
performed in any order that is compatible with the functionality of
the particular pendant groups. Each of the reactions depicted in
the general schemes is preferably run at a temperature from about
0.degree. C. to the reflux temperature of the organic solvent used.
Unless otherwise specified, the variables are as defined above in
reference to Formula (I).
[0287] The conjugates of the present embodiments may be constructed
by attaching the drug moiety to the antibody through a linker
comprising a hydrophilic self-immolative spacer.
[0288] Representative syntheses for the linker portion of compounds
of Formula (I) are described in schemes below, and the particular
examples that follow.
##STR00048##
[0289] Synthesis of Compound C from 4-nitrobenzaldehyde is shown
below in Scheme 2. 4-Nitrophenylglycolic acid is converted to the
corresponding acid chloride using a chlorinating reagent, such as
SOCl.sub.2, PCl.sub.3, or PCl.sub.5. The acid chloride is then
reacted with 1-methylpiperazine to give the ketoamide intermediate.
Alternatively, the 4-nitrophenylglycolic acid can be coupled to the
1-methylpiperazine with use of coupling agent, such as EDCI. The
ketoamide intermediate contains a keto group, which is then reduced
with a reducing reagent, such as DIBAL-H, BH.sub.3,
LiAlH.sub.4--AlCl.sub.3, LiAlH.sub.4--BF.sub.3-Et.sub.2O, or sodium
borohydride, to produce Compound C.
##STR00049##
[0290] Referring to Scheme 3, the nitro group of Compound C is
reduced to yield an aniline group in Compound I by catalytic
hydrogenation with catalysts, such as palladium, nickel, or
platinum. Examples of suitable hydrogenation catalysts include Pd/C
and Raney nickel.
##STR00050##
[0291] Referring to Scheme 4, Compound I provides the hydrophilic
self-immolative linker portion in the compounds of the present
embodiments. The amino group of Compound I can react with the
Compound W through standard peptide coupling conditions to produce
Compound X. Reagents such as EDCI/HOBt, HOBt, PyBOP, HATU or BEM
(Carpino, L. A. J. Am. Chem. Soc. 1993, 115, 4397. Carpino, L. A.;
El-Faham, A. J. Am. Chem. Soc. 1995, 117, 5401. Li, P.; Xu, J. C.
J. Pept. Res. 2001, 58, 129.) in the presence of a base such as
DIEA or other bases familiar to one skilled in the art and in an
appropriate solvent can be used.
[0292] With continued reference to Scheme 4, the hydroxyl group of
Compound X is converted to an activated carbonate using
4-nitrophenyl chloroformate. With Compound Y, reaction with a drug
with an amino group can produce Compound Z. If the drug does not
contain an amino group, a second, intermediate self-immolative
spacer or a cyclization self-elimination linker can be situated
between the drug moiety and the aminobenzyloxycarbonyl group, as
discussed above.
[0293] In certain embodiments, referring to Scheme 5 below, the
-L.sup.3-L.sup.2- portion of the linker is attached to Compound I.
Then the -A-L.sup.4- portion is attached.
##STR00051##
[0294] A process for preparing the compound of the present
embodiments includes preparing a solution of the antibody in a
buffer and treating with a solution of reducing agent, such as
TCEP. The amount of free thiols is determined. When the amount of
free thiols reaches a predetermined amount, the partially reduced
antibody is alkylated with the linker-drug portion.
[0295] In some embodiments, provided is a process for making a
compound of formula (I) or (Ia):
##STR00052##
[0296] or a salt or solvate or stereoisomer thereof; wherein D, T,
X, L.sup.1, L.sup.2, L.sup.3, L.sup.4, A and p, where applicable,
are as defined for Formula (I) or (Ia), comprising reacting a
compound comprising a targeting moiety T with a compound of
formula: A-L.sup.4-L.sup.3-L.sup.2-X-L.sup.1-D. In some
embodiments, provided is a compound produced by the process.
Further provided is a composition comprising one or more compounds
produced by the process.
[0297] In some embodiments, provided is a process for making a
compound of formula (II) or (IIa):
##STR00053##
[0298] or a salt or solvate or stereoisomer thereof; wherein D, T,
L.sup.1, L.sup.2, L.sup.3, L.sup.4, A and p, where applicable, are
as defined for Formula (II) or (IIa), comprising reacting an
antibody bearing one or more free thiols (or sulfhydryl groups)
with Compound Z:
##STR00054##
[0299] or a salt or solvate or stereoisomer thereof. In some
embodiments, the antibody bearing one or more free thiols (or
sulfhydryl groups) is h5F1Ca. 1 or c5D7. In some embodiments, the
antibody bearing one or more free thiols (or sulfhydryl groups) is
h5F1Ca. 1 where one or more amino acid residues of the heavy chain
and/or the light chain of the antibody are replaced with cysteine
residues, or c5D7 where one or more amino acid residues of the
heavy chain and/or the light chain of the antibody are replaced
with cysteine residues. In some embodiments, the process further
comprises a method for preparing Compound Z as detailed herein. In
some embodiments, the process further comprises a method for
preparing one or more of the synthetic intermediates leading to
Compound Z (e.g., Compound Y and Compound X) as detailed herein. In
some embodiments, provided is a compound produced by any of the
processes detailed herein. Further provided is a composition
comprising one or more compounds produced by any of the processes
detailed herein.
[0300] In some embodiments, a process is provided for making a
compound of formula (II):
##STR00055##
[0301] or a salt or solvate or stereoisomer thereof;
[0302] wherein:
[0303] D is drug moiety;
[0304] T is an antibody;
[0305] R.sup.1 is hydrogen, unsubstituted or substituted C.sub.1-3
alkyl, or unsubstituted or substituted heterocyclyl;
[0306] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0307] L.sup.2 is a bond or a second self-immolative linker; [0308]
wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond; [0309]
wherein if L.sup.2 is a second self-immolative linker, then L.sup.1
is a bond;
[0310] L.sup.3 is a peptide linker;
[0311] L.sup.4 is bond or a spacer; and
[0312] A is an acyl unit;
comprising reacting an antibody with Compound Z:
##STR00056##
[0313] or a salt or solvate or stereoisomer thereof.
[0314] In some embodiments, a process is provided for making a
compound of formula (II):
##STR00057##
[0315] or a salt or solvate or stereoisomer thereof;
[0316] wherein:
[0317] p is 1 to 20;
[0318] D is drug moiety;
[0319] T is an antibody;
[0320] R.sup.1 is hydrogen, unsubstituted or substituted C.sub.1-3
alkyl, or unsubstituted or substituted heterocyclyl;
[0321] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0322] L.sup.2 is a bond or a second self-immolative linker; [0323]
wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond; [0324]
wherein if L.sup.2 is a second self-immolative linker, then L.sup.1
is a bond;
[0325] L.sup.3 is a peptide linker;
[0326] L.sup.4 is bond or a spacer; and
[0327] A is an acyl unit;
comprising reacting an antibody with Compound Z:
##STR00058##
[0328] or a salt or solvate or stereoisomer thereof.
[0329] Further provided is a compound produced by any of the
processes of making compounds and/or methods of preparing compounds
as detailed herein. Also provided is a composition (e.g., a
pharmaceutical composition) comprising one or more of the compounds
produced by any of the processes of making compounds and/or methods
of preparing compounds as detailed herein.
[0330] The present disclosure provides for the process for the
preparation of the compounds and intermediates in Schemes 4 and 5.
The compounds represented in Schemes 4 and 5 are meant to have full
valences or properly capped with optional protecting groups or
leaving groups when appropriate. For example, as shown in the
scheme "Synthesis of Compound TAP-18H," L.sup.3-L.sup.2 can be
##STR00059##
[0331] The present disclosure provides for a method of preparing
Compound X:
##STR00060##
[0332] or a salt or solvate or stereoisomer thereof;
[0333] wherein:
[0334] L.sup.2 is a bond or a second self-immolative linker;
[0335] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0336] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0337] L.sup.3 is a peptide linker;
[0338] L.sup.4 is bond or a spacer; and
[0339] A is an acyl unit; and
[0340] R.sup.1 is NO.sub.2 or NH.sub.2;
[0341] comprising: reacting Compound W: A-L.sup.4-L.sup.3-L.sup.2,
and Compound I:
##STR00061##
[0342] The present disclosure provides for a method of preparing
Compound Z:
##STR00062##
[0343] or a salt or solvate or stereoisomer thereof;
[0344] wherein:
[0345] D is drug moiety;
[0346] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0347] L.sup.2 is a bond or a second self-immolative linker;
[0348] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0349] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0350] L.sup.3 is a peptide linker;
[0351] L.sup.4 is bond or a spacer; and
[0352] A is an acyl unit; and
[0353] R.sup.1 is NO.sub.2 or NH.sub.2;
[0354] comprising: reacting Compound X:
##STR00063##
and p-nitrophenylchloroformate to form Compound Y:
##STR00064##
[0355] reacting Compound Y with a compound comprising
L.sup.1-D.
[0356] The present disclosure provides for a method of preparing
Compound X.sup.1:
##STR00065##
[0357] or a salt or solvate or stereoisomer thereof;
[0358] wherein:
[0359] L.sup.2 is a bond or a second self-immolative linker;
[0360] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0361] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0362] L.sup.3 is a peptide linker; and
[0363] R.sup.1 is NO.sub.2 or NH.sub.2;
[0364] comprising: reacting Compound W.sup.1: L.sup.3-L.sup.2, and
Compound I:
##STR00066##
[0365] The present disclosure provides for A method of preparing
Compound Y.sup.1:
##STR00067##
[0366] or a salt or solvate or stereoisomer thereof;
[0367] wherein:
[0368] D is drug moiety;
[0369] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0370] L.sup.2 is a bond or a second self-immolative linker;
[0371] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0372] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0373] L.sup.3 is a peptide linker; and
[0374] R.sup.1 is NO.sub.2 or NH.sub.2;
[0375] comprising: reacting Compound X.sup.1:
##STR00068##
and a compound comprising L.sup.1-D.
[0376] The present disclosure provides for a method of preparing
Compound Z:
##STR00069##
[0377] or a salt or solvate or stereoisomer thereof;
[0378] wherein:
[0379] D is drug moiety;
[0380] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0381] L.sup.2 is a bond or a second self-immolative linker;
[0382] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0383] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0384] L.sup.3 is a peptide linker;
[0385] L.sup.4 is bond or a spacer;
[0386] A is an acyl unit; and
[0387] R.sup.1 is NO.sub.2 or NH.sub.2;
[0388] comprising: reacting Compound Y.sup.1:
##STR00070##
and a compound comprising A-L.sup.4.
[0389] The present disclosure provides for a compound of
formula:
##STR00071##
[0390] or a salt or solvate or stereoisomer thereof;
[0391] wherein:
[0392] L.sup.2 is a bond or a second self-immolative linker;
[0393] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0394] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0395] L.sup.3 is a peptide linker;
[0396] L.sup.4 is bond or a spacer; and
[0397] A is an acyl unit; and
[0398] R.sup.1 is NO.sub.2 or NH.sub.2.
[0399] The present disclosure provides for a compound of
formula:
##STR00072##
[0400] or a salt or solvate or stereoisomer thereof;
[0401] wherein:
[0402] D is drug moiety;
[0403] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0404] L.sup.2 is a bond or a second self-immolative linker;
[0405] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0406] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0407] L.sup.3 is a peptide linker;
[0408] L.sup.4 is bond or a spacer; and
[0409] A is an acyl unit; and
[0410] R.sup.1 is NO.sub.2 or NH.sub.2.
[0411] The present disclosure provides for a compound of
formula:
##STR00073##
[0412] or a salt or solvate or stereoisomer thereof;
[0413] wherein:
[0414] L.sup.2 is a bond or a second self-immolative linker;
[0415] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0416] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0417] L.sup.3 is a peptide linker; and
[0418] R.sup.1 is NO.sub.2 or NH.sub.2.
[0419] The present disclosure provides for a compound of
formula:
##STR00074##
[0420] or a salt or solvate or stereoisomer thereof;
[0421] wherein:
[0422] D is drug moiety;
[0423] L.sup.1 is a bond, a second self-immolative linker, or a
cyclization self-elimination linker;
[0424] L.sup.2 is a bond or a second self-immolative linker;
[0425] wherein if L.sup.1 is a second self-immolative linker or a
cyclization self-elimination linker, then L.sup.2 is a bond;
[0426] wherein if L.sup.2 is a second self-immolative linker, then
L.sup.1 is a bond;
[0427] L.sup.3 is a peptide linker; and
[0428] R.sup.1 is NO.sub.2 or NH.sub.2.
[0429] The following examples are offered to illustrate but not to
limit the invention.
Example 1
Materials and Methods
[0430] Humanization of 5F1 Antibody
[0431] Complementarity-determining region (CDR) grafting was used
to generate the variable region of humanized 5F1Ca. 1 (h5F1Ca. 1).
Briefly, the CDRs of murine 5F1 variable regions were incorporated
into the framework of human variable regions (the acceptor
antibodies) by recombinant DNA technology. Selection of human
framework acceptors were done by BLASTP searches against the entire
non-redundant Genebank database. The VH of human antibody CAA79298
(Genebank no. CAA79298), which was 67.8% identical to the murine
5F1 heavy chain variable region, and the VL of human antibody
ABI74084 (Genebank no. ABI74084), which was 80.4% identical to the
murine 5F1 light chain variable region, were used as the acceptor
antibodies. Some residues of the acceptor antibodies were mutated
to the murine counterpart residues to avoid conformation changes of
the variable regions. The final amino acid sequence of h5F1Ca. 1
heavy and light chain are shown in Table 1.
[0432] The VH and VL fragments were then inserted into
pcDNA5-FRT-hIgG1.kappa. vector via NheI site and AvrII site for
heavy chain and light chain, respectively. The completely assembled
plasmid h5F1Ca. 1/pcDNA5-FRT-hIgG1, containing both the heavy chain
and light chain genes of h5F1Ca. 1, was used to express h5F1Ca. 1
antibody.
[0433] Synthesis of Linker-Drug
[0434] Synthesis of Compound Tap-18H is shown below in the scheme.
Synthesis of intermediate Compounds M and O are also shown below in
the schemes.
[0435] Synthesis of Compound TAP-18H
##STR00075## ##STR00076## ##STR00077##
[0436] Synthesis of M
##STR00078##
[0437] Synthesis of O
##STR00079##
[0438] Referring to the scheme of synthesis of Compound Tap-18H,
commercially available 4-nitrophenylglycolic acid was condensed
with N-methylpiperazine using either PCl.sub.5, or EDCI and
IPr.sub.2Et in DMF, or 2-chloro-4,6-dimethoxy-1,3,5-triazine in
CH.sub.2Cl.sub.2 and N-methylmorpholine as coupling agent to
produce the desired ketoamide. In a typical procedure, a solution
of 2-chloro-4,6-dimethoxy-1,3,5-triazine (5 mmol) in
CH.sub.2Cl.sub.2 (20 ml), N-methylmorpholine (15 mmol) was added at
0-5.degree. C. under continuous stirring. A white suspension was
formed after 30-40 minutes and to this mixture
4-nitrophenylglycolic acid in CH.sub.2Cl.sub.2 (10 ml) was added,
resulting in the formation of a clear solution. After stirring the
mixture for 1 hour, N-methylpiperazine (5 mmol) was added at room
temperature. After completion of the reaction (TLC, 10 minutes),
the mixture was washed with 10% aqueous NaHCO.sub.3 solution
(2.times.10 ml) followed by H.sub.2O (3.times.10 ml). The organic
layer was dried over anhydrous sodium sulfate and removal of the
solvent under reduced pressure furnished a crude product which was
further purified by recrystallization or column chromatography
(pet. ether:ethyl acetate=8:2).
[0439] The ketoamide compound was further reduced by 0.5 equivalent
amounts of LiAlH.sub.4 in the presence of THF or DIBAL-H or sodium
borohydride to produce the nitro Compound C. [B. P. Bandgar and S.
S. Pandit, Tetrahedron Letters 44 (2003) 3855-3858]
[0440] Nitro Compound C was reduced to aniline Compound I by either
treatment with SnCl.sub.2 or catalytic hydrogenation with Pd/C (10%
w/w) as catalyst in methanol at room temperature for about 6-11
hours with yield from 65-81%. It could be obtained through the
following procedures using MultiMaxIR system with an RB04-50
Reactor B. The reactor was filled initially with 35 ml of methanol,
0.03 mg of 10% Pd/C and 0.0252 mol of nitro Compound C and the
hydrogen was add in the reactor up to pressure at 6.3 bar (H.sub.2,
const.).
[0441] Referring to the scheme of synthesis of Compound M,
Boc-protected L-valine was treated with N-hydroxysuccinimide and
EDAC-HCl in DCM or N-hydroxysuccinimide and EDC in DCM to give the
succinimide ester. This activated ester was reacted with
L-Citrulline and CH.sub.3CN, H.sub.2O, NaHCO.sub.3 to furnish
Boc-protected Compound M.
[0442] Referring to the scheme of synthesis of Compound Tap-18H,
aniline Compound I was coupled with Boc-protected Compound M by
means of either DCC/HOBt in DMF at room temperature for 32 hours to
give Compound N (yield 78-82%), or with PS-carbodiimide, in which
reaction the synthesis of Compound N was carried out starting from
100 mg of Compound M with 1.5 equivalents of aniline Compound I in
the presence of two equivalents of PS-carbodiimide and 1.7
equivalents of HOBt in DCM for 24 hours. Analysis by LC/MS showed
the peak with the desired mass and approximately 50-60%
conversion.
[0443] The coupled product Compound N was then reacted with
4-nitrophenyl chloroformate in the presence of 2,6-lutidine in DCM
at RT for 8 hours to yield carbonate Compound P, LC/MS showed the
peak with the desired mass.
[0444] Treatment of carbonate Compound P with monomethyl Dolastatin
10 in the presence of HOAt and Et.sub.3N in DMF resulted in the
formation of Compound Q.
[0445] Referring to the scheme of synthesis of Compound O,
3-alanine was treated with maleic anhydride in DMF and the acid so
obtained was reacted with N-hydroxysuccinimide (NHS) under DCC
coupling to give NHS-ester. The BOC protective group in
commercially available t-blc-N-amido-dPEG4-acid was removed by
treatment with TFA to give the TFA salt of the amine, which was
reacted with previously synthesized NHS ester. The carboxylic acid
so obtained was isolated and was coupled with N-hydroxysuccinimide
using EDCI to furnish NHS ester Compound O.
[0446] Referring to the scheme of synthesis of Compound Tap-18H,
the Boc-group in Compound Q was removed with TFA and the free amine
was coupled with NHS ester Compound O in anhydrous acetonitrile and
NaHCO.sub.3 at room temperature for 12-36 hours to produce the
final product Tap-18H with yield of 35-45%.
[0447] FIG. 5 shows an NMR spectrum of Tap-18H.
[0448] Synthesis of Compound TAP-18Hr1
[0449] Tap-18Hr1 was synthesized with the formula shown below. FIG.
6 shows NMR spectrum of Tap-18Hr1.
##STR00080##
[0450] Synthesis of Compound TAP-18Hr2
[0451] Tap-18Hr2 was synthesized with the formula shown below. FIG.
7 shows NMR spectrum of Tap-18Hr2.
##STR00081##
[0452] Preparation of Antibody Drug Conjugates (ADCs)
[0453] h5F1Ca. 1 was prepared by traditional method. DTT and DTPA
were obtained from Sigma-Aldrich (St. Louis, Mo.). TCEP was
obtained from Acros (Morris Plains, N.J.). DTNB was obtained from
Thermo Scientific (Rockford, Ill.). Sodium phosphate, sodium
borate, and sodium chloride were obtained from J.T. Baker (Center
Valley, Pa.). Cysteine was obtained from Alfa Aesar (Ward Hill,
Mass.).
[0454] h5F1Ca. 1 was reduced with about 1.3 equivalents of TCEP in
0.025 M sodium borate pH 8, 0.025 M NaCl, 1 mM DTPA for 2 hours at
37.degree. C. The protein concentration was quantified using an
absorbance value of 1.42 at 280 nm for a 1.0 mg/mL solution, and
the molar concentration determined using a molecular weight of
150,000 g/mol. The concentration of mAb-cysteine thiols produced
was determined by titrating with DTNB. Typically resulting in about
2.0 to 2.5 thiols/mAb when 1.3 molar equivalents of TCEP were
used.
[0455] Partially reduced h5F1Ca. 1 was alkylated with 1.2 molar of
maleimidocaproyl-drugs/mAb-cysteine thiol or
maleimido-drugs/mAb-cysteine thiol. The alkylation reaction was
performed at 10.degree. C. for 60 minutes. Cysteine (1 mM final)
was used to quench any unreacted, excess maleimidocaproyl- drugs or
maleimido- drugs. The ADCs were first adjusted to pH 5 with 1 M
acetic acid and applied to a HiTrap.TM. SP FF column (GE
Healthcare) at a flow rate of 1 mL/min. The column size was 1 mL
per 10 mg of ADC. The column was previously equilibrated with 5
column volumes of binding buffer, 25 mM sodium acetate with 15%
DMSO pH 5. Following application, the column was washed with 10
column volume of binding buffer and then eluted with elution
buffer, 25 mM sodium acetate pH 5, 0-15% DMSO, 300 mM NaCl. The
purified ADCs were changed to phosphate buffered saline by dialysis
overnight at 4.degree. C.
Cell Lines
[0456] The gastric cancer cells SNU-16 (BCRC, Cat. No. 60212), the
colorectal cancer cells COLO 205 (ATCC, Cat. No. CCL-222), DLD-1
(ATCC, Cat. No. CCL-221) and SW480 (ATCC, Cat. No. CCL-228) were
cultured in RPMI Medium 1640 (GIBCO, Cat. No. 22400) supplemented
with 10% FBS (GIBCO, Cat. No. 26140) and 100 U/mL penicillin/100
.mu.g/mL streptomycin (GIBCO, Cat. No. 15140).
[0457] The colorectal cancer cell line DLD-1 (BCRC, Cat. No. 60132)
was cultured in RPMI Medium 1640 supplemented with 10% FBS, 1 mM
sodium pyruvate (GIBCO, Cat. No. 11360), and 100 U/mL
penicillin/100 .mu.g/mL streptomycin.
[0458] The pancreatic cancer cell line PANC-1 (BCRC, Cat. No.
60284) was cultured in Dulbecco's modified Eagle's medium (GIBCO,
Cat. No. 11965) supplemented with 10% FBS and 100 U/mL
penicillin/100 .mu.g/mL streptomycin.
[0459] The pancreatic cancer cells Panc 02.03B were adapted from
Panc 02.03 (ATCC, Cat. No. CRL-2553), and cultured without insulin
in RPMI Medium 1640 supplemented with 15% FBS, 100 U/mL
penicillin/100 .mu.g/mL streptomycin and 1 mM sodium pyruvate
(GIBCO, Cat. No. 11360).
[0460] Analysis of ADCs by Reversed-Phase HPLC
[0461] ADCs were analyzed under denaturing and reducing conditions
by heating with 25 mM DTT, 3M guanidine hydrochloride at 80.degree.
C. for 10 minutes. The 50 .mu.g denatured ADCs were applied to
PLRP-S column (2.1.times.150 mm, 8 .mu.m, 1000 .ANG., Aligent
(Santa Clara, Calif.)). The flow rate was 0.8 mL/min and the column
temperature was 80.degree. C. Solvent A was 0.05% trifluoroacetic
acid in water and solvent B was 0.04% trifluoroacetic acid in
acetonitrile. The method included the following: Isocratic 25% B
for 3 minutes; a 25-minute linear gradient to 50% B; a 2-minute
linear gradient to 95% B; a 1-minute linear gradient to 25% B; and
isocratic 25% B for 2 minutes. Peak assignments were made with
unconjugated h5F1Ca. 1 (L0 and H0). L1, H1, H2, and H3 were
assigned by their elution time, UV spectra (the A248/280 ratio
increases with drug loading), and SDS-PAGE profile (light chain and
heavy chain).
[0462] In-Vitro Cytotoxicity by WST-1 Assay
[0463] Cancer cells SNU-16, Panc 02.03B, COLO 205 and SW480 were
seeded 1.times.10.sup.4, 3.times.10.sup.3, 2.times.10.sup.4 and
1.2.times.10.sup.4 cells/well, respectively, on 96-well microtiter
plates. Cancer cells DLD-1 and PANC-1 were seeded 1.times.10.sup.4
cells/well on 96-well microtiter plates. h5F1Ca. 1/Tap18H ADC,
h5F1Ca. 1/Tap18Hr1 or naked antibody h5F1Ca. 1 were added in
triplicate at final concentration of 3 .mu.g/mL and 1 .mu.g/mL or
final indicated concentrations and a final volume 200 .mu.L/well.
Cells were then incubated at 37.degree. C. and 5% CO.sub.2, and
cell viability was detected at 72 hours or 96 hours by cell
proliferation reagent WST-1 (Roche (Nutley, N.J.), Cat. No.
11644807001) following manufacturer's instructions. In brief, at
the end of incubation 100 .mu.L of medium was withdrawn and 10
.mu.L/well of WST-1 was added to the tested cell line. After
optimal color development (when OD.sub.450 of untreated
control.gtoreq.1.00), absorbance at 450 nm (OD.sub.450 value) was
measured by spectrophotometer (Molecular Devices (Sunnyvale,
Calif.), VERSAmax microplate reader). The mean of the triplicates
was obtained and background (medium control) was subtracted. The
resultant OD.sub.450 values were then used to calculate %
inhibition according to the following formula: [OD.sub.450
solvent-OD.sub.450 sample]/[OD.sub.450 solvent]*100. Solvent
indicates the untreated control.
[0464] ADC Treatment in Cancer Xenograft Model
[0465] To establish a subcutaneous xenograft model,
5.times.10.sup.6 SNU-16 cells were implanted into the right flank
of C.B-17 SCID mice (Lasco, Taipei, Taiwan). The ADC treatment
initiated when average tumor volume reached 110-120 mm.sup.3
(marked as Day 1). h5F1Ca. 1/Tap18H or h5F1Ca. 1/Tap18Hr1 was
injected intravenously at 1 or 2 mg/kg in 100 .mu.L. Tumor volume
was measured twice weekly with a caliper in two perpendicular
dimensions, and calculated according to the formula
(0.52*length*width*width).
Results
[0466] Analysis of ADCs by Reversed-Phase HPLC
[0467] Reducing and denaturing reversed-phase HPLC was used to
separate and characterize light and heavy chains with different
drugs. In this method, pretreatment of the ADC with 3M guanidine
hydrochloride and excess of DTT at 80.degree. C. denature antibody
and break the interchain and intrachain disulfides allow separation
of light chain with 0 or 1 drugs (L0 and L1) and heavy chain with
0, 1, 2, 3 drugs (H0, H1, H2, H3) (FIGS. 1A and 1B). In general,
the dolastatin-10 is more hydrophobic than MMAE. However, the data
shows that heavy and light chain with dolastatin-10 drug eluted
earlier than monomethyl auristatin E (MMAE) drug in L1, H1, H2, and
H3 peaks. This shows that the extra piperazine group in the
dolastatin-10 based drug reduces the hydrophobicity of molecule.
This characteristic of the piperazine group may reduce the possible
aggregation in high drug loading ADC cause by the hydrophobicity of
dolastation-10.
[0468] FIGS. 1A and 1B show the reversed-phase HPLC
characterization of ADCs. FIG. 1A shows the chromatogram for
h5F1Ca. 1/Tap-18H. FIG. 1B shows the chromatogram for h5F1Ca.
1/MMAE. Light chain with 0 or 1 drugs (L0 and L1) and heavy chain
with 0, 1, 2, 3 drugs (H0, H1, H2, H3) are shown.
[0469] In Vitro Cytotoxicity
[0470] The in vitro cytotoxic activity of the h5F1Ca. 1/Tap18H was
evaluated in the h5F1Ca. 1 antigen positive cancer cell lines
(SNU-16, COLO 205 and Panc02.03B) and antigen negative cell line
(SW480). Cytotoxicity by the naked h5F1Ca. 1 antibody was also
tested in parallel. As shown in Table 3, while h5F1Ca. 1 alone was
not able to induce cytotoxicity at tested concentrations (3 and 1
.mu.g/mL), h5F1Ca. 1/Tap18H effectively inhibited the growth of
cancer cell lines, SNU-16, COLO 205 and Panc02.03B. No toxicity was
observed in the antigen negative cell line SW480, indicating ADC
killing was via a specific targeting mechanism. These results
demonstrate that the ADC delivered cytotoxic drug to the target
cancer cells with antigen specificity.
TABLE-US-00006 TABLE 3 In vitro cytotoxic activity by
h5F1Ca.1/Tap18H (% inhibition) 3 .mu.g/mL 1 .mu.g/mL SNU-16
h5F1Ca.1/Tap18H 95.7 90.6 h5F1Ca.1 -13.7 -0.1 COLO 205
h5F1Ca.1/Tap18H 90.1 82.4 h5F1Ca.1 -11.0 -7.2 Panc 02.03B
h5F1Ca.1/Tap18H 81.0 78.4 h5F1Ca.1 -12.5 -6.4 SW480 h5FCa.1/Tap18H
-20.9 -12.4 h5F1Ca.1 -9.2 -3.8 Note: Negative values indicate no
inhibition observed in the tested wells.
[0471] The cytotoxic activity of the h5F1Ca. 1/Tap18Hr1 was also
evaluated in a separate experiment. Similarly, effective inhibition
was induced by h5F1Ca. 1/Tap18Hr1 in binding-positive gastric
cancer cell line SNU-16, but not in the binding-negative colorectal
cell line SW480 (Table 4).
TABLE-US-00007 TABLE 4 In vitro cytotoxic activity by
h5F1Ca.1/Tap18Hr1 (% inhibition) 3 .mu.g/mL 1 .mu.g/mL SNU-16
h5F1Ca.1/Tap18Hr1 98.2 97.0 h5F1Ca.1 4.0 3.3 SW480
h5F1Ca.1/Tap18Hr1 5.4 1.9 h5F1Ca.1 -3.0 1.2 Note: Inhibition below
10% is considered background value of the assay. Negative values
indicate no inhibition observed in the tested wells.
[0472] In Vivo Evaluation of ADC
[0473] Potency of ADC h5F1Ca. 1/Tap18H was evaluated in vivo
against the gastric cancer cells SNU-16. When inoculated tumor size
reached 120 mm.sup.3 (marked as Day 1), mice were treated with a
single dose of ADC or vehicle at 2 mg/kg. Compared to the vehicle
group in which tumor rapidly grew and approached 400 mm.sup.3 at
day 12, h5F1Ca. 1/Tap18H group displayed remission at Day 5, and
mean tumor sizes were further suppressed down to <20 mm.sup.3 at
day 12 (FIG. 2). Body weight of these mice remained unchanged in
both treatment and vehicle groups. Therefore, the data show that
h5F1Ca. 1/Tap18H can effectively inhibit growth of antigen positive
tumor in SCID mice.
[0474] FIG. 2 shows a graph of in vivo anti-tumor activity by
h5F1Ca. 1/Tap18H against gastric cancer SNU-16.
[0475] Potency of ADC h5F1Ca. 1/Tap18Hr1 was evaluated in vivo
against the gastric cancer cells SNU-16. When inoculated tumor size
reached 100 mm.sup.3 (marked as day 1), mice were treated with 2
weekly doses of vehicle or ADC at 1 mg/kg. As shown in FIG. 3,
administration of h5F1Ca. 1/Tap18Hr1 caused tumor regression, in
which mean tumor size was suppressed down to <10 mm.sup.3. Body
weight of these mice remained unchanged in both treatment and
vehicle groups. Therefore, our data show that h5F1Ca. 1/Tap18Hr1
can effectively inhibit growth of antigen-positive tumor in SCID
mice.
Example 2: Effects of Anti-TfR Antibody Based Antibody Drug
Conjugate (ADC) in Inhibiting Tumor Growth
Preparation of Antibody Drug Conjugates (ADCs)
[0476] Chimeric 5D7-54.17 (c5D7) was produced from Flp-In CHO cells
transfected with expression vector, pcDNA5-FRT-hIgG1, containing
the heavy and light chain variable region genes of murine
5D7-54.17. The c5D7 antibody was then conjugated to the cytotoxic
drug monomethyl dolastatin 10 to evaluate its anti-tumor effect in
vivo via a piperazine containing linker (see Table 5 for
structure). In one example, purified c5D7 was firstly reduced with
3.0 equivalents of TCEP (or tris(2-carboxyethyl)phosphine) in 0.025
M sodium borate pH 8, 0.025 M NaCl, 1 mM DTPA (or Pentetic acid or
diethylene triamine pentaacetic acid) for 2 h at 37.degree. C. The
protein concentration was quantified using an absorbance value of
1.346 at 280 nm for a 1.0 mg/mL solution, and the molar
concentration determined using a molecular weight of 145,194 g/mol.
The concentration of mAb-cysteine thiols produced was determined by
titrating with DTNB (or 5,5'-dithiobis-(2-nitrobenzoic acid)).
Typically 4.0 to 4.5 thiols/mAb was produced when 3.0 molar
equivalents of TCEP were used. Partially reduced c5D7 was alkylated
with 2.4 molar of maleimidocaproyl- monomethyl dolastatin
10/mAb-cysteine thiol. The alkylation reaction was performed at
10.degree. C. for 30 min. Cysteine (1 mM final) was used to quench
any unreacted, excess maleimidocaproyl-monomethyl dolastatin 10
drug. The resultant ADCs were changed to phosphate buffered saline
by dialysis overnight at 4.degree. C.
[0477] Tap-18Hr1 was synthesized with the formula shown below. FIG.
6 shows NMR spectrum of Tap-18Hr1.
TABLE-US-00008 TABLE 5 The Linker-Drug portion of the Antibody-Drug
conjugate. ##STR00082##
(Tap-18Hr1)
[0478] We further examined the in vitro cytotoxic activity of the
c5D7/Tap18Hr1 in the binding-positive colorectal cancer cell line
DLD-1, and binding-negative pancreatic cell line PANC-1. Consistent
with data presented above, effective growth inhibition in DLD-1
cells was induced by c5D7/Tap18Hr1 but not by c5D7 antibody alone
(Table 6). Nor inhibition was observed in the binding-negative cell
line PANC-1 at the indicated doses. Taken together, these results
demonstrate that our ADC delivered cytotoxic drug only to the
target cancer cells expressing the specific antigen.
TABLE-US-00009 TABLE 6 In vitro cytotoxic activity by c5D7/Tap18Hr1
(% inhibition) 0.3 .mu.g/mL 0.1 .mu.g/mL DLD-1 c5D7/Tap18Hr1 62.0
35.4 c5D7 -0.3 0.6 PANC-1 c5D7/Tap18Hr1 1.4 2.9 c5D7 4.5 4.6 Note:
Inhibition below 10% is considered background value of the assay.
Negative values indicate no inhibition observed in the tested
wells.
ADC Treatment in Cancer Xenograft Model
[0479] To establish a subcutaneous xenograft model,
5.times.10.sup.6 DLD-1 colorectal cancer cells were implanted into
the right flank of C.B-17 SCID mice (Lasco, Taipei, Taiwan).
Drug-conjugated c5D7 ADC was administered intravenously at 3 mg/kg
at days 1 and 5 post tumor inoculation. Tumor volume was measured
twice weekly with a caliper in two perpendicular dimensions, and
calculated according to the formula
(0.52.times.length.times.width.times.width).
Results
[0480] The chimeric 5D7-54.17 antibody (c5D7) was used in preparing
an antibody drug conjugate (ADC), c5D7/Tap18Hr1 (see above for the
methods of making the ADC). The anti-tumor activity of
c5D7/Tap18Hr1 was evaluated in vivo on DLD-1 transplanted SCID
mice. Treatment was initiated at days 1 and 5 following tumor
inoculation with vehicle or ADC at 3 mg/kg. Compared to the vehicle
group in which tumor approached 500 mm.sup.3 at day 14,
c5D7/Tap18Hr1 completely suppressed tumor growth throughout the
study period (FIG. 4). Body weight of mice from either group
remained unchanged after treatment (25 g on average). The data
shows that cancer targeting delivery of cytotoxic drug by the
anti-transferrin receptor c5D7 was able to effectively inhibit
tumor growth in vivo.
REFERENCES
[0481] 1. Carter, P J and Senter, P D. Antibody-drug conjugates for
cancer therapy. Cancer J. 2008; 14: 154-169) [0482] 2. Teicher, BA.
Antibody-drug conjugate targets. Current cancer Drug Targets 2009,
9: 982-1004. [0483] 3. Ducry, L and Stump, B. Antibody-drug
conjugates: linking cytotoxic payloads to monoclonal antibodies.
Bioconjugate chem., 2010, 21: 5-13. [0484] 4. Koblinski, J E.,
Ahram, M and Sloane, B F. Unraveling the role of proteases in
cancer. Clin. Chem. Acta 2000; 291:113-135.
Sequence CWU 1
1
41448PRTArtificial SequenceSynthetic construct 1Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys
Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Val
Met His Trp Ile Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Tyr Ile Asn Pro Tyr Asn Gly Gly Thr Gln Tyr Asn Glu Lys Phe
50 55 60 Lys Gly Arg Ala Thr Leu Thr Ser Asp Thr Ser Ala Ser Thr
Ala Tyr65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Ala Arg Arg Thr Phe Pro Tyr Tyr Phe Asp
Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Leu Thr Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro 115 120 125 Leu Ala Pro Ser Ser Lys
Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140 Cys Leu Val Lys
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145 150 155 160 Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170
175 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
180 185 190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205 Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser
Cys Asp Lys Thr 210 215 220 His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser225 230 235 240 Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255 Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270 Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285 Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295
300 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr305 310 315 320 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr 325 330 335 Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu 340 345 350 Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys 355 360 365 Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380 Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp385 390 395 400 Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410
415 Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
420 425 430 Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 435 440 445 2219PRTArtificial SequenceSynthetic construct
2Asp Val Val Met Thr Gln Thr Pro Leu Ser Leu Pro Val Thr Leu Gly1 5
10 15 Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Leu His
Ser 20 25 30 Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro
Gly Gln Ser 35 40 45 Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg
Phe Ser Gly Val Pro 50 55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Lys Ile65 70 75 80 Ser Arg Val Glu Ala Glu Asp
Val Gly Val Tyr Tyr Cys Phe Gln Gly 85 90 95 Ser His Ala Pro Leu
Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 110 Arg Thr Val
Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu 115 120 125 Gln
Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe 130 135
140 Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu
Gln145 150 155 160 Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser 165 170 175 Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu 180 185 190 Lys His Lys Val Tyr Ala Cys Glu
Val Thr His Gln Gly Leu Ser Ser 195 200 205 Pro Val Thr Lys Ser Phe
Asn Arg Gly Glu Cys 210 215 3449PRTArtificial SequenceSynthetic
construct 3Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Val Val Lys Pro
Gly Ala1 5 10 15 Ser Met Lys Met Ser Cys Lys Thr Ser Gly Tyr Lys
Phe Thr Gly Tyr 20 25 30 Tyr Met Asp Trp Val Lys Gln Ser Leu Gly
Ala Ser Phe Glu Trp Ile 35 40 45 Gly Arg Val Ile Pro Ser Asn Gly
Asp Thr Arg Tyr Asn Gln Lys Phe 50 55 60 Glu Gly Lys Ala Thr Leu
Thr Val Asp Arg Ser Ser Ser Thr Ala Tyr65 70 75 80 Met Glu Leu Asn
Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Arg
Lys Pro Leu Ser Gly Asn Ala Ala Asp Tyr Trp Gly Gln Gly 100 105 110
Thr Ser Val Thr Val Ser Thr Ala Ser Thr Lys Gly Pro Ser Val Phe 115
120 125 Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala
Leu 130 135 140 Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
Val Ser Trp145 150 155 160 Asn Ser Gly Ala Leu Thr Ser Gly Val His
Thr Phe Pro Ala Val Leu 165 170 175 Gln Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro Ser 180 185 190 Ser Ser Leu Gly Thr Gln
Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205 Ser Asn Thr Lys
Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220 Thr His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235
240 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
245 250 255 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His
Glu Asp 260 265 270 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn 275 280 285 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr Tyr Arg Val 290 295 300 Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320 Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335 Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350 Leu
Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360
365 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
370 375 380 Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro
Val Leu385 390 395 400 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys 405 410 415 Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu 420 425 430 Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 445 Lys
4214PRTArtificial SequenceSynthetic construct 4Glu Thr Thr Val Thr
Gln Ser Pro Ala Ser Leu Ser Val Ala Thr Gly1 5 10 15 Glu Lys Val
Thr Ile Arg Cys Ile Thr Ser Thr Asp Ile Asp Asp Asp 20 25 30 Met
Asn Trp Tyr Gln Gln Lys Pro Gly Glu Pro Pro Lys Leu Leu Ile 35 40
45 Ser Asp Gly Asn Thr Leu Arg Pro Gly Val Pro Ser Arg Phe Ser Ser
50 55 60 Ser Gly Tyr Gly Thr Asp Phe Val Phe Thr Ile Glu Asn Thr
Leu Ser65 70 75 80 Glu Asp Ile Thr Asp Tyr Tyr Cys Met Gln Ser Asp
Asn Met Pro Phe 85 90 95 Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile
Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro Pro
Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val Cys
Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln Trp
Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160 Glu
Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170
175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr
180 185 190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr
Lys Ser 195 200 205 Phe Asn Arg Gly Glu Cys 210
* * * * *