U.S. patent application number 15/833110 was filed with the patent office on 2018-08-30 for anti-dengue virus antibodies and uses thereof.
The applicant listed for this patent is Massachusetts Institute of Technology. Invention is credited to Luke Nathaniel Robinson, Ram Sasisekharan, Kannan Tharakaraman.
Application Number | 20180246101 15/833110 |
Document ID | / |
Family ID | 50068678 |
Filed Date | 2018-08-30 |
United States Patent
Application |
20180246101 |
Kind Code |
A1 |
Sasisekharan; Ram ; et
al. |
August 30, 2018 |
ANTI-DENGUE VIRUS ANTIBODIES AND USES THEREOF
Abstract
The present invention provides, among other things, antibody
agents (e.g., antibodies, and/or antigen-binding fragments thereof)
that bind to DV epitopes, as well as compositions containing them
and methods of designing, providing, formulating, using,
identifying and/or characterizing them. In some embodiments,
provided antibody agents show significant binding to a plurality of
DV serotypes. In some embodiments, provided antibody agents show
significant binding to all four DV serotypes. Such antibody agents
are useful, for example, in the prophylaxis, treatment, diagnosis,
and/or study of DV.
Inventors: |
Sasisekharan; Ram;
(Lexington, MA) ; Robinson; Luke Nathaniel;
(Quincy, MA) ; Tharakaraman; Kannan; (Woburn,
MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Massachusetts Institute of Technology |
Cambridge |
MA |
US |
|
|
Family ID: |
50068678 |
Appl. No.: |
15/833110 |
Filed: |
December 6, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15291199 |
Oct 12, 2016 |
9880167 |
|
|
15833110 |
|
|
|
|
13951066 |
Jul 25, 2013 |
9499607 |
|
|
15291199 |
|
|
|
|
61780209 |
Mar 13, 2013 |
|
|
|
61680385 |
Aug 7, 2012 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
G01N 2333/185 20130101;
C07K 2317/34 20130101; C07K 2317/33 20130101; G01N 33/56983
20130101; A61P 31/12 20180101; C07K 2317/565 20130101; C07K 2317/92
20130101; G01N 2469/10 20130101; C07K 2317/76 20130101; C07K
16/1081 20130101; C07K 16/10 20130101 |
International
Class: |
G01N 33/569 20060101
G01N033/569; C07K 16/10 20060101 C07K016/10 |
Goverment Interests
GOVERNMENT SUPPORT
[0002] This invention was made with government support under grant
number R37 GM057073 awarded by the National Institutes of Health.
The government has certain rights in the invention.
Claims
1-64. (canceled)
65. An antibody agent that: (a) has a heavy chain variable region
that shows at least 95% substantial sequence homology with that of
heavy chain variable region of 4E11 (SEQ ID NO. 1) and a light
chain variable region that shows at least 95% substantial sequence
homology with that of light chain variable region of 4E11 (SEQ ID
NO. 2); and (b) has a sequence variation from 4E11 at a position
selected from those in one or more of Tables 4-8, and combinations
thereof.
66. The antibody agent of claim 65, wherein the antibody agent: (a)
competes with 4E11 for binding to an epitope within each of SEQ ID
NO. 17 (EDIII-DV1), SEQ ID NO. 18 (EDIII-DV2), SEQ ID NO. 19
(EDIII-DV3), SEQ ID NO. 20 (EDIII-DV4); (b) shows enhanced affinity
for the epitope within SEQ ID NO. 20 (EDIII-DV4) relative to that
shown by 4E11; and/or (c) shows comparable affinity to that shown
by 4E11 for the epitopes within each of SEQ ID NO. 17 (EDIII-DV1),
SEQ ID NO. 18 (EDIII-DV2), and SEQ ID NO. 19 (EDIII-DV3).
67. A pharmaceutical composition comprising the antibody agent of
claim 65 and at least one pharmaceutically acceptable carrier or
excipient.
68. A method of providing an antibody composition, the method
comprising steps of: providing an antibody agent that: (a) has a
heavy chain variable region that shows at least 95% substantial
sequence homology with that of heavy chain variable region of 4E11
(SEQ ID NO. 1) and a light chain variable region that shows at
least 95% substantial sequence homology with that of light chain
variable region of 4E11 (SEQ ID NO. 2); (b) has a sequence
variation from 4E11 at a position selected from those in one or
more of Tables 4-8, and combinations thereof; and formulating the
antibody agent with at least one pharmaceutically acceptable
carrier or excipient to provide the antibody composition.
69. The method of claim 68, wherein the antibody agent: (a)
competes with 4E11 for binding to an epitope within each of SEQ ID
NO. 17 (EDIII-DV1), SEQ ID NO. 18 (EDIII-DV2), SEQ ID NO. 19
(EDIII-DV3), SEQ ID NO. 20 (EDIII-DV4); (b) shows enhanced affinity
for the epitope within SEQ ID NO. 20 (EDIII-DV4) relative to that
shown by 4E11; and/or (c) shows comparable affinity to that shown
by 4E11 for the epitopes within each of SEQ ID NO. 17 (EDIII-DV1),
SEQ ID NO. 18 (EDIII-DV2), and SEQ ID NO. 19 (EDIII-DV3).
70. A method of treating a subject, the method comprising a step
of: administering to a subject suffering from or susceptible to
Dengue virus an antibody agent that: (a) has a heavy chain variable
region that shows at least 95% substantial sequence homology with
that of heavy chain variable region of 4E11 (SEQ ID NO. 1) and a
light chain variable region that shows at least 95% substantial
sequence homology with that of light chain variable region of 4E11
(SEQ ID NO. 2); and (b) has a sequence variation from 4E11 at a
position selected from those in one or more of Tables 4-8, and
combinations thereof.
71. The method of claim 70, wherein the antibody agent: (a)
competes with 4E11 for binding to an epitope within each of SEQ ID
NO. 17 (EDIII-DV1), SEQ ID NO. 18 (EDIII-DV2), SEQ ID NO. 19
(EDIII-DV3), SEQ ID NO. 20 (EDIII-DV4); (b) shows enhanced affinity
for the epitope within SEQ ID NO. 20 (EDIII-DV4) relative to that
shown by 4E11; and/or (c) shows comparable affinity to that shown
by 4E11 for the epitopes within each of SEQ ID NO. 17 (EDIII-DV1),
SEQ ID NO. 18 (EDIII-DV2), and SEQ ID NO. 19 (EDIII-DV3).
72. The method of claim 70, wherein the step of administering
comprises administering a pharmaceutical composition comprising:
the antibody agent; and at least one pharmaceutically acceptable
carrier or excipient, wherein the composition is formulated for
administration by a route selected from the group consisting of:
oral (PO), intravenous (IV), intramuscular (IM), intra-arterial,
intramedullary, intrathecal, subcutaneous (SQ), intraventricular,
transdermal, interdermal, intradermal, rectal (PR), vaginal,
intraperitoneal (IP), intragastric (IG), topical, mucosal,
intranasal, buccal, enteral, vitreal, sublingual, intratracheal
instillation, bronchial instillation, oral spray, nasal spray,
aerosol, or through a portal vein catheter.
73. A method of claim 72, wherein: the pharmaceutical composition
is formulated for IV administration; and the step of administering
involves administration by intravenous infusion.
74. A method of claim 72, wherein: the pharmaceutical composition
is formulated for IM administration; and the step of administration
is by intramuscular injection.
75. A method of claim 72, wherein: the pharmaceutical composition
is formulated for SQ administration; and the step of administration
is by subcutaneous injection.
76. A method of treating a subject, the method comprising a step
of: administering to a subject suffering from or susceptible to
Dengue virus an antibody agent characterized in that multivariate
logistic regression (MLR) analysis of features selected from the
group consisting of: ZEPII value, main chain-main chain H-bonds,
density of H-bonds, percentage of charged groups, density of
cation-pi interactions, buried surface area, percentage of neutral
polar groups, density of ionic bonds, and combinations thereof,
generates a predicted crystal structure for the antibody agent with
its antigen that is characterized by an RMSD that is not greater
than 3 angstroms.
77. A method of treating a subject, the method comprising a step
of: administering to a subject suffering from or susceptible to
Dengue virus an antibody agent that: (a) competes with 4E11 for
binding in and ELISA assay; (b) has at least a 450-fold affinity
improvement to an epitope within EDIII-DV4 (SEQ ID NO. 20) compared
to binding by 4E11 and maintains binding affinity to EDIII of DV1
(SEQ ID NO. 17), DV2 (SEQ ID NO. 18), and DV3 (SEQ ID NO. 19); (c)
has a heavy chain variable region that shows at least 95%
substantial sequence homology with that of heavy chain variable
region of 4E11 (SEQ ID NO. 1) and a light chain variable region
that shows at least 95% substantial sequence homology with that of
light chain variable region of 4E11 (SEQ ID NO. 2); and (d) has a
sequence variation from 4E11 at a position selected from those in
one or more of Tables 4-8, and combinations thereof.
78. A method of treating a subject, the method comprising a step
of: administering to a subject suffering from or susceptible to
Dengue virus an antibody agent that (a) has at least a 75-fold
increase in neutralizing potency towards DV4 compared to
neutralizing potency by 4E11 in a focus reduction neutralization
test (FRNT); (b) maintains neutralizing potency to DV1-3 compared
to neutralizing potency by 4E11 in a FRNT test; (c) has a heavy
chain variable region that shows at least 95% substantial sequence
homology with that of heavy chain variable region of 4E11 (SEQ ID
NO. 1) and a light chain variable region that shows at least 95%
substantial sequence homology with that of light chain variable
region of 4E11 (SEQ ID NO. 2); and (d) has a sequence variation
from 4E11 at a position selected from those in one or more of
Tables 4-8, and combinations thereof.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U.S.C. .sctn.
119(e) of U.S. Provisional Application No. 61/680,385, filed Aug.
7, 2012, and United States Provisional Application No. 61/780,209,
filed Mar. 13, 2013, the contents of each which are incorporated
herein by reference in their entirety.
SEQUENCE LISTING
[0003] The present specification makes reference to a Sequence
Listing (submitted electronically as a .txt file named "Sequence
Listing.txt" on Jul. 25, 2013). The .txt file was generated on Jul.
22, 2013 and is 12.6 kb in size. The entire contents of the
Sequence Listing are herein incorporated by reference.
BACKGROUND
[0004] Dengue virus (DV) is a member of the virus family
Falviviridae and is transmitted to people by several species of
mosquito within the genus Aedes, principally Aedes aegypti. Over
3.6 billion people worldwide are at risk of being infected with DV
and more than 200 million infections of DV are estimated to occur
each year globally (McBride et al., 2000 Microbes & Infection
2:1041-1050, Guzman et al., 2010 Nature Rev. Microbiol. 8: S7-16).
Dengue Fever is the most medically relevant arboviral disease in
humans. The significant increases in incidence, geographical
outreach, and severity of disease cases of Dengue are making DV a
major human pathogen. Unfortunately, effective therapeutic regimens
are not currently available; the most effective current prevention
measures lie in mosquito control.
SUMMARY
[0005] The present invention provides methods and compositions for
the treatment and/or prevention of DV infection. Among other
things, the present invention provides antibody agents that
neutralize all four DV serotypes. In some embodiments, provided
antibody agents are variants of reference antibody 4E11; in some
such embodiments, provided antibody agents have amino acid
sequences that show high overall sequence identity with that of
4E11, or a relevant fragment thereof, yet include specific sequence
variations as compared with 4E11 and show a significant improvement
in neutralization of at least one DV serotype as compared with that
observed for 4E11.
[0006] The present invention provides the insight that reference
antibody 4E11, has certain desirable attributes, including binding
to all four DV serotypes and having potent neutralizing ability of
three of the four DV serotypes, but also lacks the ability to
effectively neutralize the fourth DV serotype. The present
invention identifies the source of the problem of 4E11's inability
to effectively neutralize this fourth DV serotype. In particular,
the present invention defines structural feature modifications that
improve the ability of an antibody agent whose sequence contains
the modification(s) to neutralize the relevant DV serotype, as
compared with the ability of 4E11, which lacks the modifications.
The present invention therefore defines and provides antibodies
having structures that include the relevant structural feature
modifications (but may otherwise be substantially identical to that
of 4E11) and being characterized by an ability to neutralize DV
serotype 4 (DV4). In some embodiments, provided antibody agents
show abilities to neutralize each of the other three DV serotypes
that are not significantly reduced as compared that of 4E11.
Indeed, in some embodiments, provided antibody agents are
characterized by a surprising increase in neutralization capability
with respect to one or more of the other three DV serotypes (DV1-4)
as compared with that observed with 4E11.
[0007] The present invention provides technologies for defining
structural modifications that impart biological activities of
interest to polypeptides, while maintaining structural features
required to preserve other activities.
[0008] In some embodiments, the present invention provides antibody
agents that bind to DV epitopes, as well as compositions containing
them and methods of designing, providing, formulating, using,
identifying and/or characterizing them. In some embodiments,
provided antibody agents show significant binding to a plurality of
DV serotypes. In some embodiments, provided antibody agents show
significant binding to all four DV serotypes. Provided antibody
agents are useful, for example, in the prophylaxis, treatment,
diagnosis, and/or study of DV.
[0009] In some embodiments, provided antibody agents cross-compete
with one or more previously-described reference anti-DV antibodies.
In some embodiments, provided antibody agents bind to an epitope
that is or comprises an amino acid sequence within SEQ ID NO. 17
(EDIII-DV1), SEQ ID NO. 18 (EDIII-DV2), SEQ ID NO. 19 (EDIII-DV3),
SEQ ID NO. 20 (EDIII-DV4) and/or combinations thereof. In some
embodiments, provided antibody agents do not significantly
cross-compete with one or more particular previously-described
anti-DV antibodies.
[0010] In some embodiments, provided antibody agents neutralize DV
in established model systems with greater potency than does one or
more previously-described reference anti-DV antibodies. The present
invention encompasses, among other things, the recognition that
provided antibody agents may offer greater therapeutic and/or
prophylactic benefit than do previously-described anti-DV
antibodies.
[0011] Provided antibody agents are useful in a variety of contexts
including, for example, in therapeutic, prophylactic, diagnostic,
and/or research applications. In some embodiments, provided
antibody agents are useful in the treatment of chronic and/or acute
DV infection, for example by administering to a subject suffering
from or susceptible to such infection a therapeutically effective
amount of one or more provided such provided antibody agents. In
some embodiments, a therapeutically effective amount is an amount
sufficient to achieve one or more particular biological effects,
including, but not limited to, (i) reducing severity or frequency
of, and/or delaying onset or re-emergence of one or more symptoms
or characteristics of DV infection in an individual susceptible to
or suffering from DV infection; and/or (ii) reducing risk of
infection and/or of development of one or more symptoms or
characteristics of DV infection in an individual exposed or at risk
of exposure to DV infection. In some embodiments, the one or more
symptoms or characteristics of DV infection is or comprises high
fever and at least one or more additional symptoms selected for
example from severe headache, severe eye pain, joint pain, muscle
pain, bone pain, rash, mild bleeding manifestation (e.g., nose or
gum bleeding, petechiae, easy bruising), abdominal pain, vomiting,
black, tarry stools, drowsiness or irritability, pale, cold or
clammy skin, difficulty breathing, low white cell count,
circulating viral particles in an individual or one or more tissues
(e.g., blood, bone marrow) or organs (e.g., liver) thereof In some
embodiments, an individual suffering from DV infection displays
high fever and at least two such additional symptoms.
[0012] In some embodiments, provided antibody agents may be used to
prevent, reduce recurrence of, and/or delay onset of one or more
symptoms or characteristics of DV infection. In some embodiments,
provided antibody agents may be used, for example, for passive
immunization of individuals recently exposed to DV or at risk of
being exposed to DV, newborn babies born to DV-positive mothers,
and/or liver transplantation patients (e.g., to prevent possible
recurrent DV infections in such patients).
[0013] In some embodiments, the present invention provides viral
mimic agents whose structure includes one or more conserved
elements of certain DV antigens, for example sufficient to permit
the viral mimic agent to mimic one or more biological activities of
the relevant DV antigen. In some embodiments, such viral mimic
agents include such conserved structural elements of DV antigens,
for example as defined herein, and lack one or more other
structural elements of the DV antigens. In some embodiments,
provided viral mimic agents are or comprise one or more
polypeptides. In some embodiments, provided viral mimic agent
polypeptides have amino acid sequences that include one or more
conserved sequence elements from a DV antigen; in some embodiments,
provided viral mimic agent polypeptides lack one or more other
sequence elements from the DV antigen. For example, in some
embodiments, provided viral mimic agent polypeptides are or
comprise fragments of a DV antigen.
[0014] In some embodiments, the present invention provides
therapeutic methods of treatment, utilized after development of one
or more symptoms of DV infection. In some embodiments, the present
invention provides therapeutic methods of prophylaxis, utilized
prior to development of one or more symptoms of DV infection,
and/or prior to exposure to DV, DV infection, or risk thereof. In
some particular embodiments, the present invention provides passive
immunization technologies.
[0015] In some embodiments, the present invention provides
diagnostic methods of detecting DV in and/or otherwise
characterizing samples such as clinical, environmental, and/or
research samples.
[0016] The present invention provides systems for designing,
identifying, and/or characterizing useful anti-DV antibody agents.
For example, in some embodiments, the present invention provides
empirical computational approaches that capture particular
physicochemical features common to protein interfaces. In some
embodiments, such approaches permit prediction of protein-protein
interactions (e.g., antigen-antibody interactions), including for
example predicting which amino acid sequences might show
particularly high interaction affinity. In some embodiments,
provided approaches are usefully applied to design, identify,
and/or characterize sequences that differ from a reference sequence
and show one or more improved characteristics (e.g., improved
affinity) with regard to their protein-protein interactions.
[0017] The present invention provides systems for stratifying
patients based on their immunological response to DV. The present
invention provides methods for identifying those patients likely to
respond well to DV immunotherapy. For example, a patient's serum
may be used to test for the presence of antibodies directed against
a particular epitope of DV (e.g., epitope to which provided
antibody agents specifically binds). If the patient does not have
adequate levels of antibodies directed to such an epitope, one or
more provided DV antibody agents may be administered to the
patient. The patient's own immune response may be supplemented with
provided DV antibody agents. In some embodiments, immunotherapy
aids in clearance of DV virus and/or resolution of DV infection. In
some embodiments, immunotherapy in accordance with the present
invention treats and/or prevents chronic DV infection.
[0018] In some embodiments, the present invention provides methods
of designing, identifying and/or characterizing useful antibody
agents. For example, in some embodiments, such methods involve
determining whether a test antibody agent competes for antigen
binding with one or more reference anti-DV antibodies and/or other
antibody agents. In some embodiments, a test antibody agent is
identified as a useful antibody agent if it cross-competes with one
or more reference DV antibodies.
[0019] In some embodiments, provided antibody agents are combined
with one or more additional pharmaceutically acceptable substances
to provide pharmaceutical compositions. The present invention
provides pharmaceutical compositions for treatment, prevention,
diagnosis and/or characterization of DV infection.
[0020] In some embodiments, pharmaceutical compositions comprise
antibody agents that are or comprise, for example, human antibodies
or fragments or variants thereof that bind to any DV serotype and
neutralize DV infection in vitro. In some embodiments,
pharmaceutical compositions comprise antibody agents that are or
comprise, for example human antibodies or fragments or variants
thereof that bind to any DV serotype and neutralize DV infection in
vivo. In some embodiments, DV neutralization by provided antibody
agents in in vitro systems is correlative and/or predictive of DV
neutralization by provided antibody agents in vivo (e.g., in humans
and/or other mammals).
[0021] In some embodiments, provided antibody agents may be
utilized together with one or more other therapies for treating,
reducing incidence, frequency, or severity of, and/or delaying
onset of DV infection or one or more symptoms or characteristics
thereof. For example, in some embodiments, provided antibody agents
are utilized together with one or more anti-viral agents,
anti-inflammatories, pain relievers, immunomodulating therapeutics
and combination therapy, which preferably involves other DV
targets. For example, in some embodiments, in some embodiments,
provided antibody agents are administered in combination with one
or more interferons (e.g., interferon .alpha.-2b,
interferon-.gamma., etc.), analgesics (preferably containing
acetaminophen and not aspirin and/or ibuprofen), anti-DV monoclonal
antibodies, anti-DV polyclonal antibodies, RNA polymerase
inhibitors, protease inhibitors, nucleoside analogs, helicase
inhibitors, immunomodulators, antisense compounds, short
interfering RNAs (siRNAs), short hairpin RNAs (shRNAs), micro RNAs
(miRNAs), RNA aptamers, ribozymes, and combinations thereof.
[0022] Thus, in some embodiments, the invention specifically
provides an antibody agent which binds to and neutralizes each of
Dengue Virus serotypes D1, D2, D3, and D4. In some embodiments, the
antibody agent binds to an epitope that is or comprises an amino
acid sequence within: SEQ ID NO. 17 (EDIII-DV1), SEQ ID NO. 18
(EDIII-DV2), SEQ ID NO. 19 (EDIII-DV3), SEQ ID NO. 20 (EDIII-DV4),
or combinations thereof. In some embodiments, the antibody agent
binds to an epitope in the A-strand region of envelop glycoprotein
of Dengue virus.
[0023] In some embodiments, the epitope comprises on or more
residues corresponding to that at a position selected from the
group consisting of 305, 306, 307, 308, 309, 310, 311, 312, 323,
325, 327, 329, 360, 361, 362, 363, 364, 385, 387, 388, 389, 390,
391, and combinations thereof, of any one of SEQ ID NOs. 17-20. In
some embodiments, the corresponding residue at position 305 is
selected from the group consisting of: serine, lysine, and
threonine. In some embodiments, the corresponding residue at
position 310 is lysine. In some embodiments, the corresponding
residue at position 311 is lysine. In some embodiments, the
corresponding residue at position 323 is selected from the group
consisting of arginine, lysine, and glutamine. In some embodiments,
the corresponding residue at position 327 is selected from the
group consisting of lysine and glutamate. In some embodiments, the
corresponding residue at position 329 is selected from the group
consisting of arginine, aspartate, glutamate, and threonine.
[0024] In some embodiments, the invention provides an antibody
agent whose heavy chain variable region and/or light chain variable
region includes at least one complementarity determining region
(CDR) sharing at least 80% sequence identity with a CDR of
reference antibody 4E11, but differs by substitution of at least
one amino residue within the CDR. In some embodiments, the antibody
agent includes at least one CDR that is substantially identical to
a reference CDR of antibody 4E11 in that it is either identical to
such reference CDR or includes between 1-5 substitutions of amino
acids within such reference CDR. In some embodiments, the reference
CDR is selected from the group consisting of one found between
residues 27 and 33 of the 4E11 heavy chain (SEQ ID NO. 1), one
found between residues 53 and 58 of the 4E11 heavy chain (SEQ ID
NO. 1), one found between residues 100 and 106 of the 4E11 heavy
chain (SEQ ID NO. 1), one found between residues 24 and 38 of the
4E11 light chain (SEQ ID NO. 2), one found between residues 54 and
60 of the 4E11 light chain (SEQ ID NO. 2), one found between
residues 93 and 101 of the 4E11 light chain (SEQ ID NO. 2); and
combinations thereof. In some embodiments, the antibody agent
includes at least one CDR that is substantially identical to a
reference CDR set forth below, in that it is either identical to
such reference CDR or includes between 1-5 substitutions of amino
acids within such reference CDR reference CDRs: GFNIKDT (SEQ ID NO.
7), DPANGD (SEQ ID NO. 8), GWEGFAY (SEQ ID NO. 9), RASENVDKYGNSFMH
(SEQ ID NO. 14), RASNLES (SEQ ID NO. 15), and/or QRSNEVPWT (SEQ ID
NO. 16). In some embodiments, the reference CDR is a heavy chain
CDR. In some embodiments, the reference CDR is a light chain CDR.
In some embodiments, the antibody agent includes at least one heavy
chain CDR that is substantially identical to a heavy chain
reference CDR and also includes at least one light chain CDR that
is identical to a light chain reference CDR. In some embodiments,
each of the CDRs in the antibody agent is substantially identical
to one of the reference CDRs.
[0025] In some embodiments, the invention provides an antibody
agent whose heavy chain variable region includes at least one
complementarity determining region (CDR) sharing at least 95%
sequence identity with a CDR of reference antibody 4E11, but
differs by substitution of at least one amino acid residue within
the CDR. In some embodiments, the antibody agent includes at least
one CDR that is substantially identical to a reference CDR of
antibody 4E11 in that it is either identical to such reference CDR
or includes between 1-5 substitutions of amino acids within such
reference CDR. In some embodiments, the reference CDR is selected
from the group consisting of one found between residues 27 and 33
of the 4E11 heavy chain (SEQ ID NO. 1), one found between residues
53 and 58 of the 4E11 heavy chain (SEQ ID NO. 1), one found between
residues 100 and 106 of the 4E11 heavy chain (SEQ ID NO. 1), one
found between residues 24 and 38 of the 4E11 light chain (SEQ ID
NO. 2), one found between residues 54 and 60 of the 4E11 light
chain (SEQ ID NO. 2), one found between residues 93 and 101 of the
4E11 light chain (SEQ ID NO. 2), and combinations thereof. In some
embodiments, the antibody agent includes at least one CDR that is
substantially identical to a reference CDR set forth below, in that
it is either identical to such reference CDR or includes between
1-5 substitutions of amino acids within such reference CDR
reference CDRs: GFNIKDT (SEQ ID NO. 7), DPANGD (SEQ ID NO. 8),
GWEGFAY (SEQ ID NO. 9), RASENVDKYGNSFMH (SEQ ID NO. 14), RASNLES
(SEQ ID NO. 15), and/or QRSNEVPWT (SEQ ID NO. 16). In some
embodiments, the reference CDR is a heavy chain CDR. In some
embodiments, the reference CDR is a light chain CDR. In some
embodiments, the antibody agent includes at least one heavy chain
CDR that is substantially identical to a heavy chain reference CDR
and also includes at least one light chain CDR that is identical to
a light chain reference CDR. In some embodiments, each of the CDRs
in the antibody agent is substantially identical to one of the
reference CDRs. In some embodiments, the heavy chain variable
region CDR has substitution of the amino acid residue at position
55. In some embodiments, the substitute amino acid at position 55
is selected form the group consisting of glutamate and aspartate.
In some embodiments, the light chain variable region CDR has
substitution of the amino acid residue at positions selected from
the group consisting of 31, 57, 59, 60, and combinations thereof.
In some embodiments, the substitute amino acid residue at position
31 is lysine. In some embodiments, the substitute amino acid
residue at position 57 is selected from the group consisting of
glutamate and serine. In some embodiments, the substitute amino
acid residue at position 59 is selected from the group consisting
of glutamine and asparagine. In some embodiments, the substitute
amino acid residue at position 60 is selected from the group
consisting of tryptophan, tyrosine, and arginine.
[0026] In some embodiments, the invention provides an antibody
agent which is an IgG. In some embodiments, an antibody agent is a
monoclonal antibody. In some embodiments, an antibody agent is
selected from the group consisting of: a mouse antibody, a
humanized antibody, a human antibody, a purified antibody, an
isolated antibody, a chimeric antibody, a polyclonal antibody, and
combinations thereof. In some embodiments, an antibody agent is
provided wherein the antigen binding fragment is selected from the
group consisting of: a Fab fragment, a Fab' fragment, a
F(ab').sub.2 fragment, a Fd fragment, a Fd' fragment, a Fv
fragment, a dAb fragment, a scFv fragment, an isolated CDR region,
a dsFv diabody, a single chain antibody, and combinations
thereof.
[0027] In some embodiments, the invention provides a cell line
expressing an antibody agent specific to Dengue virus, wherein the
antibody agent binds to and neutralizes each of Dengue Virus
serotypes D1, D2, D3, and D4. In some embodiments, the invention
provides a pharmaceutical composition including one or more
antibody agents wherein the antibody agent binds to and neutralizes
each of Dengue Virus serotypes D1, D2, D3, and D4 and a
pharmaceutically acceptable excipient. In some embodiments, a
pharmaceutical composition further includes at least one additional
antiviral agent.
[0028] In some embodiments, the invention provides methods of
treating a subject in need thereof, including the step of
administering an antibody agent wherein the antibody agent binds to
and neutralizes each of Dengue Virus serotypes D1, D2, D3, and D4.
In some embodiments, the invention provides kits including at least
one antibody agent wherein the antibody agent binds to and
neutralizes each of Dengue Virus serotypes D1, D2, D3, and D4, a
syringe, needle, or applicator for administration of the at least
one antibody or fragment to a subject, and instructions for
use.
[0029] In some embodiments, the invention provides methods of
manufacturing pharmaceutical compositions, the method including the
steps of providing an antibody agent wherein the antibody agent
binds to and neutralizes each of Dengue Virus serotypes D1, D2, D3,
and D4, and formulating the antibody agent with at least one
pharmaceutically acceptable carrier, so that a pharmaceutical
composition is generated. In some embodiments, the pharmaceutical
composition is a liquid composition. In some embodiments, the
pharmaceutical composition is formulated for parenteral
administration. In some embodiments, the pharmaceutical composition
is formulated for intravenous administration. In some embodiments,
the pharmaceutical composition is formulated for intravenous
administration to a child.
BRIEF DESCRIPTION OF THE DRAWING
[0030] The Figures of the Drawing are for illustration purposes
only, not for limitation.
[0031] FIG. 1 shows the effect of window size on prediction
accuracy. The window size represents the number of predicted
positives. Prediction accuracy is determined by the number of test
case structures (overall 37) correctly predicted. When the window
size is one (i.e., when one out of 101 structures is predicted to
be positive), nearly half of the x-ray structures (48%.about.18 out
of 37) were correctly identified, the binomial probability of which
is 1.46E-26 (n=37, p=0.009, number of successes=18) if the
structures were chosen at random. The prediction accuracy of
MLR-method is seen to be a logarithmically increasing function of
window size with accuracy reaching 85% at window size 5 and 100% at
window size 10. On the contrary, ZRANK fails to predict 100% of the
structures even when the window size is 20.
[0032] FIGS. 2A-C illustrate docking results of a local search. For
this assessment, native-like structures are defined as having less
than 3 angstroms (.ANG.) RMSD from the ligand in the x-ray
structure, calculated for ligand atoms that are within 7 .ANG. of
the fixed receptor. Structures that have RMSD>3 .ANG. are
referred as non-native structures. (A) Each point on the surface
plot represents a docking decoy. The x-axis shows the ZRANK score;
the Y-axis represents RMSD (in .ANG.) to the X-ray structure; the Z
axis represents MLR based prediction probabilities. ZRANK scores of
native-like structures vary between -60 to -30 Kcal/mol. (B)
Correlation between ZRANK scores (x-axis) and RMSD (y-axis). Data
points inside dotted circles are close to native x-ray structure.
(C) Correlation between MLR-based probability and RMSD. There is a
significant correlation between prediction probabilities vs. RMSD
but no such correlation exists between ZRANK and RMSD.
[0033] FIG. 3 demonstrates the affinity and in vitro activity of
4E11 antibody.
[0034] FIG. 4 shows a flowchart of the antibody design
approach.
[0035] FIG. 5 demonstrates the superposition of the top five
docking models on fixed EDIII. EDIII domain is represented as
spheres; 4E11, displayed as the surface in each model.
[0036] FIGS. 6A-B illustrate sequence and structural determinants
of poor DV4 binding. (A) Sequence alignment of EDIII domain region
of four serotypes. Putative mAb binding residues are shaded in
grey. Residues at 307, 329, 361, 364, 385, 388 and 390
differentiate DV4 from reminder of the sequences; these are
numbered. Residue contacts made by the five mAb mutations are
boxed. Notably, 5 out of 6 new contacts are formed against
conserved epitope residues of A & B strands. This explains why
the new mutations are not detrimental to DV1-3 binding. (B)
Structural model of 4E11/EDIII interaction. Sequence positions that
discriminate DV4 from other strains are labeled and the side chains
of amino acids therein represented as sticks.
[0037] FIG. 7 demonstrates that affinity-enhancing mutations
localize to the periphery of the 4E11:EDIII-DV4 interface. The
positive positions identified in the binding screen are highlighted
and shown in a structural model of 4E11:EDIII-DV4 interaction. All
positive mutations are located at the periphery of the binding
interface. The two panels represent different views of the same
model. EDIII (top), VH (right), and VL (left) proteins are
represented respectively, in each panel.
[0038] FIGS. 8A-H show surface plasmon resonance (SPR) sensograms
of 4E11 WT and 4E5A with antigens EDIII of DV1-4.
[0039] FIG. 9 illustrates in vitro neutralizing activity of
antibodies assessed by focus reduction neutralization test (FRNT).
Neutralization assays were performed with DV1-4 and antibodies 4E11
WT, m4E11 WT, 4E5A, and 4G2. Serial dilutions of antibody were
mixed with equal amounts of virus and added to Vero cell monolayers
with a viscous overlay. After 4-6 days, cells were fixed and foci
were immunostained and counted. Data points represent averages of
duplicates with error bars representing standard deviation. A
standard four-parameter logistic model was fit to the data using
least squares regression. 4E5A shows similar neutralizing activity
to 4E11 and m4E11 for DV1-3 and a substantial increase in
neutralizing activity to DV4. 4G2, a representative flavivirus
fusion-loop specific antibody, demonstrates lower neutralizing
activity for DV1-3 and only slightly higher activity to DV4
relative to 4E5A.
[0040] FIG. 10 shows in vivo prophylactic DV2 challenge model. The
data show virus in the serum of AF129 mice on day 3 after virus
challenge. Mice treated with AB1 or placebo 1 day prior to virus
challenge. RNA extracted from the serum of the mice was amplified
by QRT-PCR and an approximate Log.sub.10 CCID.sub.50 titer was
extrapolated based on a curve from control RNA taken from a sample
of known titer. The dashed line represents the approximate limit of
detection.
[0041] FIG. 11 demonstrates amino acid frequencies in paratope and
epitope. Data generated from 77 antigen-antibody complexes.
[0042] FIG. 12 (Table 2) shows the 20.times.20 amino acid
propensity matrix.
[0043] FIG. 13 (Table 6) shows the affinities of single mutant
antibodies with increased EDIII-DV4 affinity and similar
EDIII-DV1-3 affinities relative to 4E11 WT.
DEFINITIONS
[0044] In order for the present invention to be more readily
understood, certain terms are first defined below; those of
ordinary skill in the art will appreciate and understand the use
and scope of these terms as defined below and/or otherwise used
herein.
[0045] Adult: As used herein, the term "adult" refers to a human
eighteen years of age or older. Body weights among adults can vary
widely with a typical range being 90 pounds to 250 pounds.
[0046] Affinity: As is known in the art, "affinity" is a measure of
the tightness with a particular ligand (e.g., an antibody) binds to
its partner (e.g., an epitope). Affinities can be measured in
different ways.
[0047] Amino acid: As used herein, term "amino acid," in its
broadest sense, refers to any compound and/or substance that can be
incorporated into a polypeptide chain. In some embodiments, an
amino acid has the general structure H.sub.2N--C(H)(R)--COOH. In
some embodiments, an amino acid is a naturally occurring amino
acid. In some embodiments, an amino acid is a synthetic amino acid;
in some embodiments, an amino acid is a d-amino acid; in some
embodiments, an amino acid is an 1-amino acid. "Standard amino
acid" refers to any of the twenty standard 1-amino acids commonly
found in naturally occurring peptides. "Nonstandard amino acid"
refers to any amino acid, other than the standard amino acids,
regardless of whether it is prepared synthetically or obtained from
a natural source. As used herein, "synthetic amino acid"
encompasses chemically modified amino acids, including but not
limited to salts, amino acid derivatives (such as amides), and/or
substitutions. Amino acids, including carboxy- and/or
amino-terminal amino acids in peptides, can be modified by
methylation, amidation, acetylation, protecting groups, and/or
substitution with other chemical groups that can change the
peptide's circulating half-life without adversely affecting their
activity. Amino acids may participate in a disulfide bond. Amino
acids may comprise one or posttranslational modifications, such as
association with one or more chemical entities (e.g., methyl
groups, acetate groups, acetyl groups, phosphate groups, formyl
moieties, isoprenoid groups, sulfate groups, polyethylene glycol
moieties, lipid moieties, carbohydrate moieties, biotin moieties,
etc.). The term "amino acid" is used interchangeably with "amino
acid residue," and may refer to a free amino acid and/or to an
amino acid residue of a peptide. It will be apparent from the
context in which the term is used whether it refers to a free amino
acid or a residue of a peptide.
[0048] Animal: As used herein, the term "animal" refers to any
member of the animal kingdom. In some embodiments, "animal" refers
to humans, of either sex and at any stage of development. In some
embodiments, "animal" refers to non-human animals, at any stage of
development. In certain embodiments, the non-human animal is a
mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog,
a cat, a sheep, cattle, a primate, and/or a pig). In some
embodiments, animals include, but are not limited to, mammals,
birds, reptiles, amphibians, fish, insects, and/or worms. In
certain embodiments, the animal is susceptible to infection by DV.
In some embodiments, an animal may be a transgenic animal,
genetically engineered animal, and/or a clone.
[0049] Antibody agent: As used herein, the term "antibody agent"
refers to an agent that specifically binds to a particular antigen.
In some embodiments, the term encompasses any polypeptide with
immunoglobulin structural elements sufficient to confer specific
binding. Suitable antibody agents include, but are not limited to,
human antibodies, primatized antibodies, chimeric antibodies,
bi-specific antibodies, humanized antibodies, conjugated antibodies
(i.e., antibodies conjugated or fused to other proteins,
radiolabels, cytotoxins), Small Modular ImmunoPharmaceuticals
("SMIPs.TM."), single chain antibodies, cameloid antibodies, and
antibody fragments. As used herein, the term "antibody agent" also
includes intact monoclonal antibodies, polyclonal antibodies,
single domain antibodies (e.g., shark single domain antibodies
(e.g., IgNAR or fragments thereof)), multispecific antibodies (e.g.
bi-specific antibodies) formed from at least two intact antibodies,
and antibody fragments so long as they exhibit the desired
biological activity. In some embodiments, the term encompasses
stapled peptides. In some embodiments, the term encompasses one or
more antibody-like binding peptidomimetics. In some embodiments,
the term encompasses one or more antibody-like binding scaffold
proteins. In come embodiments, the term encompasses monobodies or
adnectins. In many embodiments, an antibody agent is or comprises a
polypeptide whose amino acid sequence includes one or more
structural elements recognized by those skilled in the art as a
complementarity determining region (CDR); in some embodiments an
antibody agent is or comprises a polypeptide whose amino acid
sequence includes at least one CDR (e.g., at least one heavy chain
CDR and/or at least one light chain CDR) that is substantially
identical to one found in a reference antibody. In some embodiments
an included CDR is substantially identical to a reference CDR in
that it is either identical in sequence or contains between 1-5
amino acid substitutions as compared with the reference CDR. In
some embodiments an included CDR is substantially identical to a
reference CDR in that it shows at least 85%, 86%, 87%, 88%, 89%,
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence
identity with the reference CDR. In some embodiments an included
CDR is substantially identical to a reference CDR in that it shows
at least 96%, 96%, 97%, 98%, 99%, or 100% sequence identity with
the reference CDR. In some embodiments an included CDR is
substantially identical to a reference CDR in that at least one
amino acid within the included CDR is deleted, added, or
substituted as compared with the reference CDR but the included CDR
has an amino acid sequence that is otherwise identical with that of
the reference CDR. In some embodiments an included CDR is
substantially identical to a reference CDR in that 1-5 amino acids
within the included CDR are deleted, added, or substituted as
compared with the reference CDR but the included CDR has an amino
acid sequence that is otherwise identical to the reference CDR . In
some embodiments an included CDR is substantially identical to a
reference CDR in that at least one amino acid within the included
CDR is substituted as compared with the reference CDR but the
included CDR has an amino acid sequence that is otherwise identical
with that of the reference CDR. In some embodiments an included CDR
is substantially identical to a reference CDR in that 1-5 amino
acids within the included CDR are deleted, added, or substituted as
compared with the reference CDR but the included CDR has an amino
acid sequence that is otherwise identical to the reference CDR. In
some embodiments, an antibody agent is or comprises a polypeptide
whose amino acid sequence includes structural elements recognized
by those skilled in the art as an immunoglobulin variable domain.
In some embodiments, an antibody agent is a polypeptide protein
having a binding domain which is homologous or largely homologous
to an immunoglobulin-binding domain
[0050] Antibody: As is known in the art, an "antibody" is an
immunoglobulin that binds specifically to a particular antigen. The
term encompasses immunoglobulins that are naturally produced in
that they are generated by an organism reacting to the antigen, and
also those that are synthetically produced or engineered. An
antibody may be monoclonal or polyclonal. An antibody may be a
member of any immunoglobulin class, including any of the human
classes: IgG, IgM, IgA, and IgD. A typical immunoglobulin
(antibody) structural unit as understood in the art, is known to
comprise a tetramer. Each tetramer is composed of two identical
pairs of polypeptide chains, each pair having one "light"
(approximately 25 kD) and one "heavy" chain (approximately 50-70
kD). The N-terminus of each chain defines a variable region of
about 100 to 110 or more amino acids primarily responsible for
antigen recognition. The terms "variable light chain"(VL) and
"variable heavy chain" (VH) refer to these light and heavy chains
respectively. Each variable region is further subdivided into
hypervariable (HV) and framework (FR) regions. The hypervariable
regions comprise three areas of hypervariability sequence called
complementarity determining regions (CDR 1, CDR 2 and CDR 3),
separated by four framework regions (FR1, FR2, FR2, and FR4) which
form a beta-sheet structure and serve as a scaffold to hold the HV
regions in position. The C-terminus of each heavy and light chain
defines a constant region consisting of one domain for the light
chain (CL) and three for the heavy chain (CH1, CH2 and CH3). In
some embodiments, the term "full length" is used in reference to an
antibody to mean that it contains two heavy chains and two light
chains, optionally associated by disulfide bonds as occurs with
naturally-produced antibodies. In some embodiments, an antibody is
produced by a cell. In some embodiments, an antibody is produced by
chemical synthesis. In some embodiments, an antibody is derived
from a mammal. In some embodiments, an antibody is derived from an
animal such as, but not limited to, mouse, rat, horse, pig, or
goat. In some embodiments, an antibody is produced using a
recombinant cell culture system. In some embodiments, an antibody
may be a purified antibody (for example, by immune-affinity
chromatography). In some embodiments, an antibody may be a human
antibody. In some embodiments, an antibody may be a humanized
antibody (antibody from non-human species whose protein sequences
have been modified to increase their similarity to antibody
variants produced naturally in humans). In some embodiments, an
antibody may be a chimeric antibody (antibody made by combining
genetic material from a non-human source, e.g., mouse, rat, horse,
or pig, with genetic material from humans).
[0051] Antibody fragment: As used herein, an "antibody fragment"
includes a portion of an intact antibody, such as, for example, the
antigen-binding or variable region of an antibody. Examples of
antibody fragments include Fab, Fab', F(ab')2, and Fv fragments;
triabodies; tetrabodies; linear antibodies; single-chain antibody
molecules; and multi specific antibodies formed from antibody
fragments. For example, antibody fragments include isolated
fragments, "Fv" fragments, consisting of the variable regions of
the heavy and light chains, recombinant single chain polypeptide
molecules in which light and heavy chain variable regions are
connected by a peptide linker ("ScFv proteins"), and minimal
recognition units consisting of the amino acid residues that mimic
the hypervariable region. In many embodiments, an antibody fragment
contains sufficient sequence of the parent antibody of which it is
a fragment that it binds to the same antigen as does the parent
antibody; in some embodiments, a fragment binds to the antigen with
a comparable affinity to that of the parent antibody and/or
competes with the parent antibody for binding to the antigen.
Examples of antigen binding fragments of an antibody include, but
are not limited to, Fab fragment, Fab' fragment, F(ab')2 fragment,
scFv fragment, Fv fragment, dsFv diabody, dAb fragment, Fd'
fragment, Fd fragment, and an isolated complementarity determining
region (CDR) region. An antigen binding fragment of an antibody may
be produced by any means. For example, an antigen binding fragment
of an antibody may be enzymatically or chemically produced by
fragmentation of an intact antibody and/or it may be recombinantly
produced from a gene encoding the partial antibody sequence.
Alternatively or additionally, antigen binding fragment of an
antibody may be wholly or partially synthetically produced. An
antigen binding fragment of an antibody may optionally comprise a
single chain antibody fragment. Alternatively or additionally, an
antigen binding fragment of an antibody may comprise multiple
chains which are linked together, for example, by disulfide
linkages. An antigen binding fragment of an antibody may optionally
comprise a multimolecular complex. A functional antibody fragment
typically comprises at least about 50 amino acids and more
typically comprises at least about 200 amino acids.
[0052] Antiviral agent: As used herein, the term "antiviral agent"
refers to a class of medication used specifically for treating
viral infections by inhibiting, deactivating, or destroying virus
particles. In general, an antiviral agent may be or comprise a
compound of any chemical class (e.g., a small molecule, metal,
nucleic acid, polypeptide, lipid and/or carbohydrate). In some
embodiments, an antiviral agent is or comprises an antibody or
antibody mimic. In some embodiments, an antiviral agent is or
comprises a nucleic acid agent (e.g., an antisense oligonucleotide,
a siRNA, a shRNA, etc) or mimic thereof. In some embodiments, an
antiviral agent is or comprises a small molecule. In some
embodiments, an antiviral agent is or comprises a
naturally-occurring compound (e.g., small molecule). In some
embodiments, an antiviral agent has a chemical structure that is
generated and/or modified by the hand of man.
[0053] Approximately: As used herein, the term "approximately" or
"about," as applied to one or more values of interest, refers to a
value that is similar to a stated reference value. In certain
embodiments, the term "approximately" or "about" refers to a range
of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%,
13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in
either direction (greater than or less than) of the stated
reference value unless otherwise stated or otherwise evident from
the context (except where such number would exceed 100% of a
possible value).
[0054] Baby: As used herein, the term "baby" refers to a human
under two years of age. Typical body weights for a baby rages from
3 pounds up to 20 pounds.
[0055] Biologically active: As used herein, the phrase
"biologically active" refers to a characteristic of any substance
that has activity in a biological system (e.g., cell culture,
organism, etc.). For instance, a substance that, when administered
to an organism, has a biological effect on that organism, is
considered to be biologically active. In particular embodiments,
where a protein or polypeptide is biologically active, a portion of
that protein or polypeptide that shares at least one biological
activity of the protein or polypeptide is typically referred to as
a "biologically active" portion.
[0056] Characteristic portion: As used herein, the term
"characteristic portion" is used, in the broadest sense, to refer
to a portion of a substance whose presence (or absence) correlates
with presence (or absence) of a particular feature, attribute, or
activity of the substance. In some embodiments, a characteristic
portion of a substance is a portion that is found in the substance
and in related substances that share the particular feature,
attribute or activity, but not in those that do not share the
particular feature, attribute or activity. In certain embodiments,
a characteristic portion shares at least one functional
characteristic with the intact substance. For example, in some
embodiments, a "characteristic portion" of a protein or polypeptide
is one that contains a continuous stretch of amino acids, or a
collection of continuous stretches of amino acids, that together
are characteristic of a protein or polypeptide. In some
embodiments, each such continuous stretch generally contains at
least 2, 5, 10, 15, 20, 50, or more amino acids. In general, a
characteristic portion of a substance (e.g., of a protein,
antibody, etc.) is one that, in addition to the sequence and/or
structural identity specified above, shares at least one functional
characteristic with the relevant intact substance. In some
embodiments, a characteristic portion may be biologically
active.
[0057] Child: As used herein, the term "child" refers to a human
between two and 18 years of age. Body weight can vary widely across
ages and specific children, with a typical range being 30 pounds to
150 pounds.
[0058] Combination therapy: The term "combination therapy", as used
herein, refers to those situations in which two or more different
pharmaceutical agents are administered in overlapping regimens so
that the subject is simultaneously exposed to both agents.
[0059] Comparable: The term "comparable" is used herein to describe
two (or more) sets of conditions or circumstances that are
sufficiently similar to one another to permit comparison of results
obtained or phenomena observed. In some embodiments, comparable
sets of conditions or circumstances are characterized by a
plurality of substantially identical features and one or a small
number of varied features. Those of ordinary skill in the art will
appreciate that sets of conditions are comparable to one another
when characterized by a sufficient number and type of substantially
identical features to warrant a reasonable conclusion that
differences in results obtained or phenomena observed under the
different sets of conditions or circumstances are caused by or
indicative of the variation in those features that are varied.
[0060] Corresponding to: As used herein, the term "corresponding
to" is often used to designate the position/identity of an amino
acid residue in a polypeptide of interest. Those of ordinary skill
will appreciate that, for purposes of simplicity, residues in a
polypeptide are often designated using a canonical numbering system
based on a reference related polypeptide, so that an amino acid
"corresponding to" a residue at position 190, for example, need not
actually be the 190.sup.th amino acid in a particular amino acid
chain but rather corresponds to the residue found at 190 in the
reference polypeptide; those of ordinary skill in the art readily
appreciate how to identify "corresponding" amino acids.
[0061] Dosage form: As used herein, the terms "dosage form" and
"unit dosage form" refer to a physically discrete unit of a
therapeutic protein (e.g., antibody) for the patient to be treated.
Each unit contains a predetermined quantity of active material
calculated to produce the desired therapeutic effect. It will be
understood, however, that the total dosage of the composition will
be decided by the attending physician within the scope of sound
medical judgment.
[0062] Dosing regimen: A "dosing regimen" (or "therapeutic
regimen"), as that term is used herein, is a set of unit doses
(typically more than one) that are administered individually to a
subject, typically separated by periods of time. In some
embodiments, a given therapeutic agent has a recommended dosing
regimen, which may involve one or more doses. In some embodiments,
a dosing regimen comprises a plurality of doses each of which are
separated from one another by a time period of the same length; in
some embodiments, a dosing regimen comprises a plurality of doses
and at least two different time periods separating individual
doses. In some embodiments, all doses within a dosing regimen are
of the same unit dose amount. In some embodiments, different doses
within a dosing regimen are of different amounts. In some
embodiments, a dosing regimen comprises a first dose in a first
dose amount, followed by one or more additional doses in a second
dose amount different from the first dose amount. In some
embodiments, a dosing regimen comprises a first dose in a first
dose amount, followed by one or more additional doses in a second
dose amount same as the first dose amount.
[0063] DV serotype: As used herein, the term "serotype" generally
refers to distinct variations within DVs. The four different DV
serotypes (DV1-4) comprising the DV genetic group differ from one
another by approximately 25% to 40% at the amino acid level. The
four serotypes of DV vary in pathogenicities but all are prevalent
in areas of Asia, Africa, Central and South America. Infection with
one of these serotypes provides life-long immunity to that serotype
however it also increases risk of severe disease upon a secondary
infection from a heterologous DV serotype.
[0064] Epitope: As used herein, the term "epitope" has its meaning
as understood in the art. It will be appreciated by those of
ordinary skill in the art that an epitope also known as antigenic
determinant, is a molecular region of an antigen that is recognized
by the immune system, specifically by antibodies, B cells, or T
cells. It will be further appreciated that epitopes can be composed
of sugars, lipids, or amino acids. The epitopes of protein antigens
are divided into two categories, conformational epitopes and linear
epitopes, based on their structure and interaction with the
paratope (part of an antibody that recognizes the epitope). A
conformational epitope is composed of discontinuous sections of the
antigen's amino acid sequence and these epitopes interact with the
paratope based on the 3-D surface features and shape or tertiary
structure of the antigen. Linear epitopes interact with the
paratope based on their primary structure and a linear epitope is
formed by a continuous sequence of amino acids from the
antigen.
[0065] Expression: As used herein, "expression" of a nucleic acid
sequence refers to one or more of the following events: (1)
production of an RNA template from a DNA sequence (e.g., by
transcription); (2) processing of an RNA transcript (e.g., by
splicing, editing, 5' cap formation, and/or 3' end formation); (3)
translation of an RNA into a polypeptide or protein; and/or (4)
post-translational modification of a polypeptide or protein.
[0066] Functional: As used herein, a "functional" biological
molecule is a biological molecule in a form in which it exhibits a
property and/or activity by which it is characterized.
[0067] Gene: As used herein, the term "gene" has its meaning as
understood in the art. It will be appreciated by those of ordinary
skill in the art that the term "gene" may include gene regulatory
sequences (e.g., promoters, enhancers, etc.) and/or intron
sequences. It will further be appreciated that definitions of gene
include references to nucleic acids that do not encode proteins but
rather encode functional RNA molecules such as tRNAs, RNAi-inducing
agents, etc. For the purpose of clarity we note that, as used in
the present application, the term "gene" generally refers to a
portion of a nucleic acid that encodes a protein; the term may
optionally encompass regulatory sequences, as will be clear from
context to those of ordinary skill in the art. This definition is
not intended to exclude application of the term "gene" to
non-protein-coding expression units but rather to clarify that, in
most cases, the term as used in this document refers to a
protein-coding nucleic acid.
[0068] Gene product or expression product: As used herein, the term
"gene product" or "expression product" generally refers to an RNA
transcribed from the gene (pre-and/or post-processing) or a
polypeptide (pre- and/or post-modification) encoded by an RNA
transcribed from the gene.
[0069] Homology: As used herein, the term "homology" refers to the
overall relatedness between polymeric molecules, e.g., between
nucleic acid molecules (e.g., DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. In some embodiments,
polymeric molecules are considered to be "homologous" to one
another if their sequences are at least 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
In some embodiments, polymeric molecules are considered to be
"homologous" to one another if their sequences are at least 25%,
30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,
95%, or 99% similar.
[0070] Identity: As used herein, the term "identity" refers to the
overall relatedness between polymeric molecules, e.g., between
nucleic acid molecules (e.g., DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. Calculation of the percent
identity of two nucleic acid sequences, for example, can be
performed by aligning the two sequences for optimal comparison
purposes (e.g., gaps can be introduced in one or both of a first
and a second nucleic acid sequences for optimal alignment and
non-identical sequences can be disregarded for comparison
purposes). In certain embodiments, the length of a sequence aligned
for comparison purposes is at least 30%, at least 40%, at least
50%, at least 60%, at least 70%, at least 80%, at least 90%, at
least 95%, or substantially 100% of the length of the reference
sequence. The nucleotides at corresponding nucleotide positions are
then compared. When a position in the first sequence is occupied by
the same nucleotide as the corresponding position in the second
sequence, then the molecules are identical at that position. The
percent identity between the two sequences is a function of the
number of identical positions shared by the sequences, taking into
account the number of gaps, and the length of each gap, which needs
to be introduced for optimal alignment of the two sequences. The
comparison of sequences and determination of percent identity
between two sequences can be accomplished using a mathematical
algorithm. For example, the percent identity between two nucleotide
sequences can be determined using the algorithm of Meyers and
Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into
the ALIGN program (version 2.0) using a PAM120 weight residue
table, a gap length penalty of 12 and a gap penalty of 4. The
percent identity between two nucleotide sequences can,
alternatively, be determined using the GAP program in the GCG
software package using an NWSgapdna.CMP matrix.
[0071] Isolated: As used herein, the term "isolated" refers to a
substance and/or entity that has been (1) separated from at least
some of the components with which it was associated when initially
produced (whether in nature and/or in an experimental setting),
and/or (2) produced, prepared, and/or manufactured by the hand of
man. Isolated substances and/or entities may be separated from
about 10%, about 20%, about 30%, about 40%, about 50%, about 60%,
about 70%, about 80%, about 90%, about 91%, about 92%, about 93%,
about 94%, about 95%, about 96%, about 97%, about 98%, about 99%,
or more than about 99% of the other components with which they were
initially associated. In some embodiments, isolated agents are
about 80%, about 85%, about 90%, about 91%, about 92%, about 93%,
about 94%, about 95%, about 96%, about 97%, about 98%, about 99%,
or more than about 99% pure. As used herein, a substance is "pure"
if it is substantially free of other components. As used herein,
calculation of percent purity of isolated substances and/or
entities should not include excipients (e.g., buffer, solvent,
water, etc.).
[0072] Mimotope: As used herein, the term "mimotope" refers to a
macromolecule which mimics the structure of an epitope. In some
embodiments, a mimotope elicits an antibody response identical or
similar to that elicited by its corresponding epitope. In some
embodiments, an antibody that recognizes an epitope also recognizes
a mimotope which mimics that epitope. In some embodiments, a
mimotope is a peptide. In some embodiments, a mimotope is a small
molecule, carbohydrate, lipid, or nucleic acid. In some
embodiments, mimotopes are peptide or non-peptide mimotopes of
conserved DV epitopes. In some embodiments, by mimicking the
structure of a defined viral epitope, a mimotope interferes with
the ability of DV virus particles to bind to its natural binding
partners (e.g., DV target receptor, Rab5, GRP78), e.g., by binding
to the natural binding partner itself.
[0073] Mutant: As used herein, the term "mutant" refers to an
entity that shows significant structural identity with a reference
entity but differs structurally from the reference entity in the
presence or level of one or more chemical moieties as compared with
the reference entity. In many embodiments, a mutant also differs
functionally from its reference entity. In general, whether a
particular entity is properly considered to be a "mutant" of a
reference entity is based on its degree of structural identity with
the reference entity. As will be appreciated by those skilled in
the art, any biological or chemical reference entity has certain
characteristic structural elements. A mutant, by definition, is a
distinct chemical entity that shares one or more such
characteristic structural elements. To give but a few examples, a
small molecule may have a characteristic core structural element
(e.g., a macrocycle core) and/or one or more characteristic pendent
moieties so that a mutant of the small molecule is one that shares
the core structural element and the characteristic pendent moieties
but differs in other pendent moieties and/or in types of bonds
present (single vs double, E vs Z, etc) within the core, a
polypeptide may have a characteristic sequence element comprised of
a plurality of amino acids having designated positions relative to
one another in linear or three-dimensional space and/or
contributing to a particular biological function, a nucleic acid
may have a characteristic sequence element comprised of a plurality
of nucleotide residues having designated positions relative to on
another in linear or three-dimensional space. For example, a mutant
polypeptide may differ from a reference polypeptide as a result of
one or more differences in amino acid sequence and/or one or more
differences in chemical moieties (e.g., carbohydrates, lipids, etc)
covalently attached to the polypeptide backbone. In some
embodiments, a mutant polypeptide shows an overall sequence
identity with a reference polypeptide that is at least 85%, 86%,
87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%.
Alternatively or additionally, in some embodiments, a mutant
polypeptide does not share at least one characteristic sequence
element with a reference polypeptide. In some embodiments, the
reference polypeptide has one or more biological activities. In
some embodiments, a mutant polypeptide shares one or more of the
biological activities of the reference polypeptide. In some
embodiments, a mutant polypeptide lacks one or more of the
biological activities of the reference polypeptide. In some
embodiments, a mutant polypeptide shows a reduced level of one or
more biological activities as compared with the reference
polypeptide.
[0074] Nucleic acid: As used herein, the term "nucleic acid," in
its broadest sense, refers to any compound and/or substance that is
or can be incorporated into an oligonucleotide chain. In some
embodiments, a nucleic acid is a compound and/or substance that is
or can be incorporated into an oligonucleotide chain via a
phosphodiester linkage. In some embodiments, "nucleic acid" refers
to individual nucleic acid residues (e.g., nucleotides and/or
nucleosides). In some embodiments, "nucleic acid" refers to an
oligonucleotide chain comprising individual nucleic acid residues.
As used herein, the terms "oligonucleotide" and "polynucleotide"
can be used interchangeably. In some embodiments, "nucleic acid"
encompasses RNA as well as single and/or double-stranded DNA and/or
cDNA. Furthermore, the terms "nucleic acid," "DNA," "RNA," and/or
similar terms include nucleic acid analogs, i.e., analogs having
other than a phosphodiester backbone. For example, the so-called
"peptide nucleic acids," which are known in the art and have
peptide bonds instead of phosphodiester bonds in the backbone, are
considered within the scope of the present invention. The term
"nucleotide sequence encoding an amino acid sequence" includes all
nucleotide sequences that are degenerate versions of each other
and/or encode the same amino acid sequence. Nucleotide sequences
that encode proteins and/or RNA may include introns. Nucleic acids
can be purified from natural sources, produced using recombinant
expression systems and optionally purified, chemically synthesized,
etc. Where appropriate, e.g., in the case of chemically synthesized
molecules, nucleic acids can comprise nucleoside analogs such as
analogs having chemically modified bases or sugars, backbone
modifications, etc. A nucleic acid sequence is presented in the 5'
to 3' direction unless otherwise indicated. The term "nucleic acid
segment" is used herein to refer to a nucleic acid sequence that is
a portion of a longer nucleic acid sequence. In many embodiments, a
nucleic acid segment comprises at least 3, 4, 5, 6, 7, 8, 9, 10, or
more residues. In some embodiments, a nucleic acid is or comprises
natural nucleosides (e.g., adenosine, thymidine, guanosine,
cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine,
and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine,
2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine,
5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine,
2-aminoadenosine, C5-bromouridine, C5-fluorouridine,
C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine,
C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine,
7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine,
O(6)-methylguanine, and 2-thiocytidine); chemically modified bases;
biologically modified bases (e.g., methylated bases); intercalated
bases; modified sugars (e.g., 2'-fluororibose, ribose,
2'-deoxyribose, arabinose, and hexose); and/or modified phosphate
groups (e.g., phosphorothioates and 5'-N-phosphoramidite linkages).
In some embodiments, the present invention is specifically directed
to "unmodified nucleic acids," meaning nucleic acids (e.g.,
polynucleotides and residues, including nucleotides and/or
nucleosides) that have not been chemically modified in order to
facilitate or achieve delivery.
[0075] Patient: As used herein, the term "patient" or "subject"
refers to any organism to which a provided composition may be
administered, e.g., for experimental, diagnostic, prophylactic,
cosmetic, and/or therapeutic purposes. Typical patients include
animals (e.g., mammals such as mice, rats, rabbits, non-human
primates, and/or humans). In some embodiments, a patient is a
human. A human includes pre and post natal forms.
[0076] Pharmaceutically acceptable: The term "pharmaceutically
acceptable" as used herein, refers to substances that, within the
scope of sound medical judgment, are suitable for use in contact
with the tissues of human beings and animals without excessive
toxicity, irritation, allergic response, or other problem or
complication, commensurate with a reasonable benefit/risk
ratio.
[0077] Pharmaceutically acceptable carrier: As used herein, the
term "pharmaceutically acceptable carrier" means a
pharmaceutically-acceptable material, composition or vehicle, such
as a liquid or solid filler, diluent, excipient, or solvent
encapsulating material, involved in carrying or transporting the
subject compound from one organ, or portion of the body, to another
organ, or portion of the body. Each carrier must be "acceptable" in
the sense of being compatible with the other ingredients of the
formulation and not injurious to the patient. Some examples of
materials which can serve as pharmaceutically-acceptable carriers
include: sugars, such as lactose, glucose and sucrose; starches,
such as corn starch and potato starch; cellulose, and its
derivatives, such as sodium carboxymethyl cellulose, ethyl
cellulose and cellulose acetate; powdered tragacanth; malt;
gelatin; talc; excipients, such as cocoa butter and suppository
waxes; oils, such as peanut oil, cottonseed oil, safflower oil,
sesame oil, olive oil, corn oil and soybean oil; glycols, such as
propylene glycol; polyols, such as glycerin, sorbitol, mannitol and
polyethylene glycol; esters, such as ethyl oleate and ethyl
laurate; agar; buffering agents, such as magnesium hydroxide and
aluminum hydroxide; alginic acid; pyrogen-free water; isotonic
saline; Ringer's solution; ethyl alcohol; pH buffered solutions;
polyesters, polycarbonates and/or polyanhydrides; and other
non-toxic compatible substances employed in pharmaceutical
formulations.
[0078] Pharmaceutical composition: As used herein, the term
"pharmaceutical composition" refers to an active agent, formulated
together with one or more pharmaceutically acceptable carriers. In
some embodiments, active agent is present in unit dose amount
appropriate for administration in a therapeutic regimen that shows
a statistically significant probability of achieving a
predetermined therapeutic effect when administered to a relevant
population. In some embodiments, pharmaceutical compositions may be
specially formulated for administration in solid or liquid form,
including those adapted for the following: oral administration, for
example, drenches (aqueous or non-aqueous solutions or
suspensions), tablets, e.g., those targeted for buccal, sublingual,
and systemic absorption, boluses, powders, granules, pastes for
application to the tongue; parenteral administration, for example,
by subcutaneous, intramuscular, intravenous or epidural injection
as, for example, a sterile solution or suspension, or
sustained-release formulation; topical application, for example, as
a cream, ointment, or a controlled-release patch or spray applied
to the skin, lungs, or oral cavity; intravaginally or
intrarectally, for example, as a pessary, cream, or foam;
sublingually; ocularly; transdermally; or nasally, pulmonary, and
to other mucosal surfaces.
[0079] Polypeptide: As used herein, a "polypeptide", generally
speaking, is a string of at least two amino acids attached to one
another by a peptide bond. In some embodiments, a polypeptide may
include at least 3-5 amino acids, each of which is attached to
others by way of at least one peptide bond. Those of ordinary skill
in the art will appreciate that polypeptides sometimes include
"non-natural" amino acids or other entities that nonetheless are
capable of integrating into a polypeptide chain, optionally.
[0080] Protein: As used herein, the term "protein" refers to a
polypeptide (i.e., a string of at least two amino acids linked to
one another by peptide bonds). Proteins may include moieties other
than amino acids (e.g., may be glycoproteins, proteoglycans, etc.)
and/or may be otherwise processed or modified. Those of ordinary
skill in the art will appreciate that a "protein" can be a complete
polypeptide chain as produced by a cell (with or without a signal
sequence), or can be a characteristic portion thereof. Those of
ordinary skill will appreciate that a protein can sometimes include
more than one polypeptide chain, for example linked by one or more
disulfide bonds or associated by other means. Polypeptides may
contain 1-amino acids, d-amino acids, or both and may contain any
of a variety of amino acid modifications or analogs known in the
art. Useful modifications include, e.g., terminal acetylation,
amidation, methylation, etc. In some embodiments, proteins may
comprise natural amino acids, non-natural amino acids, synthetic
amino acids, and combinations thereof. The term "peptide" is
generally used to refer to a polypeptide having a length of less
than about 100 amino acids, less than about 50 amino acids, less
than 20 amino acids, or less than 10 amino acids. In some
embodiments, proteins are antibodies, antibody fragments,
biologically active portions thereof, and/or characteristic
portions thereof.
[0081] Recurrent DV infection: As used herein, a "recurrent DV
infection" refers to reemergence of clinical and/or laboratory
evidence of infection, e.g., one or more symptoms of infection or
the presence of circulating DV particles and/or DV particles in the
subject's liver.
[0082] Refractory: The term "refractory" as used herein, refers to
any subject that does not respond with an expected clinical
efficacy following the administration of provided compositions as
normally observed by practicing medical personnel.
[0083] Serotype: In general, a "serotype" or "serovar" refers to
distinct variations within a species of bacteria or viruses or
among immune cells of different individuals. These microorganisms
are typically classified together based on their cell surface
antigens, allowing the epidemiologic classification of organisms to
the sub-species level.
[0084] Small Molecule: In general, a "small molecule" is a molecule
that is less than about 5 kilodaltons (kD) in size. In some
embodiments, the small molecule is less than about 4 kD, 3 kD,
about 2 kD, or about 1 kD. In some embodiments, the small molecule
is less than about 800 daltons (D), about 600 D, about 500 D, about
400 D, about 300 D, about 200 D, or about 100 D. In some
embodiments, a small molecule is less than about 2000 g/mol, less
than about 1500 g/mol, less than about 1000 g/mol, less than about
800 g/mol, or less than about 500 g/mol. In some embodiments, small
molecules are non-polymeric. In some embodiments, in accordance
with the present invention, small molecules are not proteins,
polypeptides, oligopeptides, peptides, polynucleotides,
oligonucleotides, polysaccharides, glycoproteins, proteoglycans,
etc.
[0085] Substantially: As used herein, the term "substantially"
refers to the qualitative condition of exhibiting total or
near-total extent or degree of a characteristic or property of
interest. One of ordinary skill in the biological arts will
understand that biological and chemical phenomena rarely, if ever,
go to completion and/or proceed to completeness or achieve or avoid
an absolute result. The term "substantially" is therefore used
herein to capture the potential lack of completeness inherent in
many biological and chemical phenomena.
[0086] Substantial sequence homology: The phrase "substantial
homology" is used herein to refer to a comparison between amino
acid or nucleic acid sequences. As will be appreciated by those of
ordinary skill in the art, two sequences are generally considered
to be "substantially homologous" if they contain homologous
residues in corresponding positions. Homologous residues may be
identical residues. Alternatively, homologous residues may be
non-identical residues will appropriately similar structural and/or
functional characteristics. For example, as is well known by those
of ordinary skill in the art, certain amino acids are typically
classified as "hydrophobic" or "hydrophilic"amino acids., and/or as
having "polar" or "non-polar" side chains Substitution of one amino
acid for another of the same type may often be considered a
"homologous" substitution. Typical amino acid categorizations are
summarized below:
TABLE-US-00001 Alanine Ala A nonpolar neutral 1.8 Arginine Arg R
polar positive -4.5 Asparagine Asn N polar neutral -3.5 Aspartic
acid Asp D polar negative -3.5 Cysteine Cys C nonpolar neutral 2.5
Glutamic acid Glu E polar negative -3.5 Glutamine Gln Q polar
neutral -3.5 Glycine Gly G nonpolar neutral -0.4 Histidine His H
polar positive -3.2 Isoleucine Ile I nonpolar neutral 4.5 Leucine
Leu L nonpolar neutral 3.8 Lysine Lys K polar positive -3.9
Methionine Met M nonpolar neutral 1.9 Phenylalanine Phe F nonpolar
neutral 2.8 Proline Pro P nonpolar neutral -1.6 Serine Ser S polar
neutral -0.8 Threonine Thr T polar neutral -0.7 Tryptophan Trp W
nonpolar neutral -0.9 Tyrosine Tyr Y polar neutral -1.3 Valine Val
V nonpolar neutral 4.2
TABLE-US-00002 Ambiguous Amino Acids 3-Letter 1-Letter Asparagine
or aspartic acid Asx B Glutamine or glutamic acid Glx Z Leucine or
Isoleucine Xle J Unspecified or unknown amino acid Xaa X
[0087] As is well known in this art, amino acid or nucleic acid
sequences may be compared using any of a variety of algorithms,
including those available in commercial computer programs such as
BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and
PSI-BLAST for amino acid sequences. Exemplary such programs are
described in Altschul, et al., Basic local alignment search tool,
J. Mol. Biol., 215(3): 403-410, 1990; Altschul, et al., Methods in
Enzymology; Altschul, et al., "Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs", Nucleic Acids Res.
25: 3389-3402, 1997; Baxevanis, et al., Bioinformatics: A Practical
Guide to the Analysis of Genes and Proteins, Wiley, 1998; and
Misener, et al., (eds.), Bioinformatics Methods and Protocols
(Methods in Molecular Biology, Vol. 132), Humana Press, 1999; all
of the foregoing of which are incorporated herein by reference. In
addition to identifying homologous sequences, the programs
mentioned above typically provide an indication of the degree of
homology. In some embodiments, two sequences are considered to be
substantially homologous if at least 50%, at least 55%, at least
60%, at least 65%, at least 70%, at least 75%, at least 80%, at
least 85%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99% or more of their corresponding residues are
homologous over a relevant stretch of residues. In some
embodiments, the relevant stretch is a complete sequence. In some
embodiments, the relevant stretch is at least 10, at least 15, at
least 20, at least 25, at least 30, at least 35, at least 40, at
least 45, at least 50, at least 55, at least 60, at least 65, at
least 70, at least 75, at least 80, at least 85, at least 90, at
least 95, at least 100, at least 125, at least 150, at least 175,
at least 200, at least 225, at least 250, at least 275, at least
300, at least 325, at least 350, at least 375, at least 400, at
least 425, at least 450, at least 475, at least 500 or more
residues.
[0088] Substantial identity: The phrase "substantial identity" is
used herein to refer to a comparison between amino acid or nucleic
acid sequences. As will be appreciated by those of ordinary skill
in the art, two sequences are generally considered to be
"substantially identical" if they contain identical residues in
corresponding positions. As is well known in this art, amino acid
or nucleic acid sequences may be compared using any of a variety of
algorithms, including those available in commercial computer
programs such as BLASTN for nucleotide sequences and BLASTP, gapped
BLAST, and PSI-BLAST for amino acid sequences. Exemplary such
programs are described in Altschul, et al., Basic local alignment
search tool, J. Mol. Biol., 215(3): 403-410, 1990; Altschul, et
al., Methods in Enzymology; Altschul et al., Nucleic Acids Res. 25:
3389-3402, 1997; Baxevanis et al., Bioinformatics: A Practical
Guide to the Analysis of Genes and Proteins, Wiley, 1998; and
Misener, et al., (eds.), Bioinformatics Methods and Protocols
(Methods in Molecular Biology, Vol. 132), Humana Press, 1999. In
addition to identifying identical sequences, the programs mentioned
above typically provide an indication of the degree of identity. In
some embodiments, two sequences are considered to be substantially
identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their
corresponding residues are identical over a relevant stretch of
residues. In some embodiments, the relevant stretch is a complete
sequence. In some embodiments, the relevant stretch is at least 10,
15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,
100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400,
425, 450, 475, 500 or more residues.
[0089] Suffering from: An individual who is "suffering from" a
disease, disorder, or condition (e.g., DV) has been diagnosed with
and/or exhibits one or more symptoms of the disease, disorder, or
condition. DV infection is frequently asymptomatic. In some
embodiments, an individual who is suffering from DV has been
exposed to and/or infected with DV, but does not display any
symptoms of DV infection and/or has not been diagnosed with DV
infection. In some embodiments, an individual who is suffering from
DV is an individual who has one or more DV particles in his/her
blood.
[0090] Susceptible to: An individual who is "susceptible to" a
disease, disorder, or condition (e.g., DV) is at risk for
developing the disease, disorder, or condition. In some
embodiments, an individual who is susceptible to a disease,
disorder, or condition does not display any symptoms of the
disease, disorder, or condition. In some embodiments, an individual
who is susceptible to a disease, disorder, or condition has not
been diagnosed with the disease, disorder, and/or condition. In
some embodiments, an individual who is susceptible to a disease,
disorder, or condition is an individual who has been exposed to
conditions associated with development of the disease, disorder, or
condition (e.g., the individual has been exposed to DV). In some
embodiments, a risk of developing a disease, disorder, and/or
condition is a population-based risk (e.g., intravenous drug users;
recipients of donated blood, blood products, and organs prior to
1992, when such products began to be screened; healthcare workers
handling needles; babies born to DV-infected mothers; etc.).
[0091] Symptoms are reduced: According to the present invention,
"symptoms are reduced" when one or more symptoms of a particular
disease, disorder or condition is reduced in magnitude (e.g.,
intensity, severity, etc.) or frequency. For purposes of clarity, a
delay in the onset of a particular symptom is considered one form
of reducing the frequency of that symptom. To give but a few
examples, exemplary symptoms of DV include, but are not limited to,
sudden onset of fever, high fever (often over 40.degree. C.),
muscle and joint pains, headache, vomiting, diarrhea, occurrence of
a rash as flushed skin or measles-like rash, petechiae (small red
spots caused by broken capillaries that do not disappear when skin
is pressed), bleeding from the mucous membranes, low white blood
cell count, low platelets, metabolic acidosis, elevated level of
aminotransferase from the liver, plasma leakage resulting in
hemoconcentration (indicated by a rising hematocrit) and
hypoalbuminemia, fluid accumulation in the chest and abdominal
cavity (e.g., pleural effusion or ascites), gastrointestinal
bleeding, shock and hemorrhage, positive tourniquet test,
hypotension, infection of the brain or heart, impairment of vital
organs (e.g., liver), neurological disorders such as transverse
myelitis, and/or combinations thereof. It is not intended that the
present invention be limited only to cases where the symptoms are
eliminated. The present invention specifically contemplates
treatment such that one or more symptoms is/are reduced (and the
condition of the subject is thereby "improved"), albeit not
completely eliminated.
[0092] Therapeutic agent: As used herein, the phrase "therapeutic
agent" refers to any agent that elicits a desired pharmacological
effect when administered to an organism. In some embodiments, an
agent is considered to be a therapeutic agent if it demonstrates a
statistically significant effect across an appropriate population.
In some embodiments, the appropriate population may be a population
of model organisms. In some embodiments, an appropriate population
may be defined by various criteria, such as a certain age group,
gender, genetic background, preexisting clinical conditions, etc.
In some embodiments, a therapeutic agent is any substance that can
be used to alleviate, ameliorate, relieve, inhibit, prevent, delay
onset of, reduce severity of, and/or reduce incidence of one or
more symptoms or features of a disease, disorder, and/or
condition.
[0093] Therapeutically effective amount: As used herein, the term
"therapeutically effective amount" refers to an amount of a
therapeutic protein which confers a therapeutic effect on the
treated subject, at a reasonable benefit/risk ratio applicable to
any medical treatment. The therapeutic effect may be objective
(i.e., measurable by some test or marker) or subjective (i.e.,
subject gives an indication of or feels an effect). In particular,
the "therapeutically effective amount" refers to an amount of a
therapeutic protein or composition effective to treat, ameliorate,
or prevent a desired disease or condition, or to exhibit a
detectable therapeutic or preventative effect, such as by
ameliorating symptoms associated with the disease, preventing or
delaying the onset of the disease, and/or also lessening the
severity or frequency of symptoms of the disease. A therapeutically
effective amount is commonly administered in a dosing regimen that
may comprise multiple unit doses. For any particular therapeutic
protein, a therapeutically effective amount (and/or an appropriate
unit dose within an effective dosing regimen) may vary, for
example, depending on route of administration, on combination with
other pharmaceutical agents. Also, the specific therapeutically
effective amount (and/or unit dose) for any particular patient may
depend upon a variety of factors including the disorder being
treated and the severity of the disorder; the activity of the
specific pharmaceutical agent employed; the specific composition
employed; the age, body weight, general health, sex and diet of the
patient; the time of administration, route of administration,
and/or rate of excretion or metabolism of the specific fusion
protein employed; the duration of the treatment; and like factors
as is well known in the medical arts.
[0094] Treatment: As used herein, the term "treatment" (also
"treat" or "treating") refers to any administration of a substance
(e.g., provided compositions) that partially or completely
alleviates, ameliorates, relives, inhibits, delays onset of,
reduces severity of, and/or reduces incidence of one or more
symptoms, features, and/or causes of a particular disease,
disorder, and/or condition (e.g., DV). Such treatment may be of a
subject who does not exhibit signs of the relevant disease,
disorder and/or condition and/or of a subject who exhibits only
early signs of the disease, disorder, and/or condition.
Alternatively or additionally, such treatment may be of a subject
who exhibits one or more established signs of the relevant disease,
disorder and/or condition. In some embodiments, treatment may be of
a subject who has been diagnosed as suffering from the relevant
disease, disorder, and/or condition. In some embodiments, treatment
may be of a subject known to have one or more susceptibility
factors that are statistically correlated with increased risk of
development of the relevant disease, disorder, and/or
condition.
[0095] Unit dose: The expression "unit dose" as used herein refers
to an amount administered as a single dose and/or in a physically
discrete unit of a pharmaceutical composition. In many embodiments,
a unit dose contains a predetermined quantity of an active agent.
In some embodiments, a unit dose contains an entire single dose of
the agent. In some embodiments, more than one unit dose is
administered to achieve a total single dose. In some embodiments,
administration of multiple unit doses is required, or expected to
be required, in order to achieve an intended effect. A unit dose
may be, for example, a volume of liquid (e.g., an acceptable
carrier) containing a predetermined quantity of one or more
therapeutic agents, a predetermined amount of one or more
therapeutic agents in solid form, a sustained release formulation
or drug delivery device containing a predetermined amount of one or
more therapeutic agents, etc. It will be appreciated that a unit
dose may be present in a formulation that includes any of a variety
of components in addition to the therapeutic agent(s). For example,
acceptable carriers (e.g., pharmaceutically acceptable carriers),
diluents, stabilizers, buffers, preservatives, etc., may be
included as described infra. It will be appreciated by those
skilled in the art, in many embodiments, a total appropriate daily
dosage of a particular therapeutic agent may comprise a portion, or
a plurality, of unit doses, and may be decided, for example, by the
attending physician within the scope of sound medical judgment. In
some embodiments, the specific effective dose level for any
particular subject or organism may depend upon a variety of factors
including the disorder being treated and the severity of the
disorder; activity of specific active compound employed; specific
composition employed; age, body weight, general health, sex and
diet of the subject; time of administration, and rate of excretion
of the specific active compound employed; duration of the
treatment; drugs and/or additional therapies used in combination or
coincidental with specific compound(s) employed, and like factors
well known in the medical arts.
[0096] Vaccination: As used herein, the term "vaccination" refers
to the administration of a composition intended to generate an
immune response, for example to a disease-causing agent. For the
purposes of the present invention, vaccination can be administered
before, during, and/or after exposure to a disease-causing agent,
and in certain embodiments, before, during, and/or shortly after
exposure to the agent. In some embodiments, vaccination includes
multiple administrations, appropriately spaced in time, of a
vaccinating composition.
[0097] Vector: As used herein, "vector" refers to a nucleic acid
molecule capable of transporting another nucleic acid to which it
is associated. In some embodiment, vectors are capable of
extra-chromosomal replication and/or expression of nucleic acids to
which they are linked in a host cell such as a eukaryotic and/or
prokaryotic cell. Vectors capable of directing the expression of
operatively linked genes are referred to herein as "expression
vectors."
[0098] Wild-type: As used herein, the term "wild-type" has its
art-understood meaning that refers to an entity having a structure
and/or activity as found in nature in a "normal" (as contrasted
with mutant, diseased, altered, etc) state or context. Those of
ordinary skill in the art will appreciate that wild type genes and
polypeptides often exist in multiple different forms (e.g.,
alleles).
DV Nomenclature
[0099] It is well known by those skilled in the art that DV
nomenclature typically utilizes Roman numerals (e.g., "I," "II,"
"III," "IV," etc.) that represents DV genotype and a lowercase
letter (e.g., "a," "b," etc.) that represents DV subtype. Although
the rules of nomenclature are generally accepted in the art, those
of ordinary skill in the art recognize that the rules of
nomenclature are not always strictly followed in publications,
presentations, conversation, etc. Thus, those skilled in the art
would recognize that, for example, it is implicit that "DV Ia," "DV
genotype Ia," and "DV subtype Ia" could be used interchangeably by
one of skill in the art, and that all three terms are intended to
refer to DV genotype I, subtype a.
[0100] As used herein, Roman numerals (e.g., "I," "II," "III,"
"IV," etc.) are used to refer to DV genotype, and lowercase letters
(e.g., "a," "b," etc.) are used to refer to DV subtypes. It will
also be understood that, when DV of a particular genotype is
referred to herein, it is meant to encompass all subtypes of the
named genotype. To give but one example, "genotype I" is used
herein to refer to all subtypes of genotype I (e.g., genotype I,
subtype a; genotype I, subtype b; etc.).
[0101] As used herein, any Roman numeral (e.g., "I," "II," "III,"
"IV," etc.) that is present after the genotype and subtype
designations will be understood to refer to the DV strain.
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
[0102] The present invention provides useful anti-DV antibody
agents with particular structural and/or functional
characteristics, as well as compositions and methods relating to
such antibody agents.
Dengue Virus (DV) Infection
[0103] DV infection represents a major arthropod-borne viral
disease, with over 3.5 billion people living in areas of risk for
the disease, and over 200 million infections worldwide, resulting
in 21,000 deaths per year. Notably, the annual average number of
reported Dengue Virus infections, the geographical spread, and the
severity of disease have all increased dramatically in recent
years. Dengue Virus epidemics can cause significant morbidity,
leading to substantial economic costs and health care impacts
(Guzman et al, 2010 Nature Reviews Microbiol. 8: S7-16).
[0104] DV infection is caused by any of the four related viruses
primarily transmitted by Aedes aegypti mosquitoes and is endemic to
tropical and sub-tropical regions. Infection in a mammal is
initiated by injection of the DV during the blood meal of an
infected Aedes mosquito, whereby the DV is primarily deposited in
the extravascular tissues. The incubation period of DV after a
mosquito bite is between 3 to 14 days. Dendritic cells, monocytes,
and macrophages are among the first targets of DV. After initial
replication in the skin and lymphatic ganglia, DV appears in the
blood in the course of the acute febrile stage, generally 3 to 5
days.
[0105] Routine laboratory diagnosis of Dengue Virus infection is
based on isolation of the DV and/or detection of antibodies
specific to DV. Infection can cause several different syndromes,
influenced by age and/or immunological status of the infected
individual. Primary DV infection may be asymptomatic or may result
in Dengue Fever. Dengue Fever is characterized by a high fever that
typically has two phases and at least one additional symptom such
as headache (often severe), pain (which can be severe) in any of a
variety of body parts (e.g., eye, joint, muscle, bone, abdomen),
skin eruptions or rash, mild bleeding manifestation (e.g., nose or
gum bleeding, petechiae, easy bruising), lymphadenopathy, vomiting,
discolored (black) stools, mood effects such as prostration,
drowsiness or irritability, skin that is pale, cold, or clammy,
difficulty breathing, low white cell count, circulating viral
particles in one or more of an organism's tissues (e.g., blood,
bone marrow, etc) and/or organs (e.g., liver) (see, for example,
Center for Disease Control description; see also US 2011/0189226).
Reduced leukocyte and platelet numbers frequently occur.
[0106] Dengue Hemorrhagic Fever (DHF) is a potentially deadly
complication of DV infection. DHF is characterized by extreme
lethargy and drowsiness, coupled with the high fever and other
symptoms associated with Dengue Fever. Increased vascular
permeability and abnormal homeostasis can lead to a decrease in
blood volume, hypotension, and in severe cases, hypovolemic shock
and internal bleeding. Two factors that appear to play a major role
in the occurrence of hemorrhagic Dengue Fever are: rapid viral
replication with a high level of viremia; and a major inflammatory
response with the release of high levels of inflammatory mediators.
Without treatment, the mortality rate for hemorrhagic Dengue Fever
can reach 10%.
[0107] Children are particularly susceptible to the effects of DV
infection, which can increase dramatically with repeated exposure.
During initial Dengue Virus infections, most children experience
subclinical infection or mild undifferentiated febrile syndromes.
During secondary Dengue Virus infections the pathophysiology of the
disease often changes dramatically. Sequential infections can
result in an acute vascular permeability syndrome known as Dengue
Shock Syndrome (DSS). DSS is usually a progression of DHF and is
frequently fatal. DSS is characterized by rapid and poor volume
pulse, hypotension, cold extremities, and restlessness. Without
medical intervention, the fatality rate for DSS can reach 40-50%
(Thullier et al, 1999 Journal of Biotechnology 69:183-190). The
severity of DSS is age-dependent, with vascular leakage being most
severe in young children.
[0108] DV infections in adults are often accompanied by a tendency
for bleeding that can lead to severe hemorrhage. DV infections can
be life-threatening when they occur in individuals with asthma,
diabetes, and/or other chronic diseases (Guzman et al, 2010 Nature
Reviews Microbiol. 8: S7-16).
[0109] The leading theory proposed to explain the increased risk of
severe disease in secondary cases of DV is antibody dependent
enhancement (ADE). Dengue Viruses (DVs) display antibody epitopes
that are unique to each serotype as well as epitopes that are
shared between or among serotypes. A subject has experienced (and
recovered from) a primary DV infection may develops robust antibody
responses that cross react with all DV serotypes (DV1-4). However,
despite the cross reactivity, antibodies only prevent re-infection
by the same (homologous) serotype and individuals are susceptible
to subsequent infections with different (heterologous) serotypes .
Individuals experiencing a secondary Dengue infection with a new
serotype face a much greater risk of developing DHF, indicating
that pre-existing immunity to DV can exacerbate disease. The ADE
theory of DV postulates that weakly neutralizing antibodies from
the first infection bind to the second serotype and enhance
infection of Fc.gamma.R bearing myeloid cells such as monocytes and
macrophages (Wahala et al., 2011 Viruses 3: 2374-2395).
[0110] At least three types of mechanisms have been proposed to
explain development of severe forms of DV infection: (i) they may
be caused by particularly virulent virus strains; (ii) pre-existing
subneutralizing antibodies could enhance the antibody-mediated
uptake of DV by monocytes or macrophages, which are designated as
host cells of DV (e.g., ADE); and (iii) antibodies directed against
a non-structural protein of the virus (NS1) may cross-react with
fibrinogen, thrombocytes and endothelial cells, thus triggering
hemorrhages.
[0111] Currently, there is no specific treatment for Dengue Fever.
Recommended therapies address symptoms, and include bed rest,
control of the fever and pain through antipyretics and/or
analgesics, and adequate hydration. Efforts focus on balancing
liquid losses, replacement of coagulation factors and the infusion
of heparin. The sequence and antigenic variability of DVs have
challenged efforts to develop effective vaccines or therapeutics
(Whitehead et al., 2007 Nature Reviews Microbiology 5: 518-528).
Unfortunately, the leading vaccine candidate recently demonstrated
protective efficacy of only 30% in a phase II study (Thomas et al.,
2011 Curr Op Infectious Disease 24:442-450; Sabchareon et al., 2012
Lancet 380(9853): 1559-1567). Therefore, there is a need for the
development of improved DV therapies, vaccines. Particularly
valuable would be the development of treatments applicable to all
DV serotypes. Such a therapy would have a tremendous impact on
human health, especially in developing countries.
DV Antigens
[0112] DV infections are caused by four viruses (DV1-4), which are
of similar serological type but differ antigenically. DVs are
positive single-stranded RNA viruses belonging to the genus
flavivirus within the Flaviviridae family. The virion comprises a
spherical particle, 40-50 nm in diameter, with a lipopolysaccharide
envelope. The RNA genome, which is approximately 11 kb in length,
comprises a 5' type I end but lacks a 3' poly-A tail. The
organization of the genome comprises the following elements: a 5'
non-coding region (NCR), a region encoding structural proteins
(capsid (C), pre-membrane/membrane (prM/M), envelope (E)) and a
region encoding non-structural proteins
(NS1-NS2A-NS2B-NS3-NS4A-NS4B-NS5) and a 3' NCR.
[0113] The viral genomic RNA is associated with the capsid proteins
to form a nucleocapsid. As typical of flaviviruses, the Dengue
viral genome encodes an uninterrupted coding region which is
translated into a single polyprotein which is post-translationally
processed. Important biological properties of DV, include receptor
binding, hemagglutination of erythrocytes, induction of
neutralizing antibodies and the protective immune response, are
associated with the E protein (Wahala et al., 2011 Viruses 3:
2374-2395).
[0114] The PrM protein, a glycoprotein of about 19 kDa, contains
six highly conserved cysteine residues forming three disulfide
bridges and is cleaved to Pr and M proteins by furin or furin-like
protease during maturation.
[0115] The NS1 protein, also a glycoprotein of about 40 kDa,
contains 12 highly conserved cysteine residues forming six
disulfide bridges and is present intracellularly, on the cell
surface, and outside the cells (Lai et. al., 2008 Journal of
Virology 82(13): 6631-43).
[0116] The E protein, a glycoprotein of approximately 55 kDa,
contains 12 strictly conserved cysteine residues forming six
disulfide bridges and is present as a heterodimer with PrM protein
before the maturation of the virion. X-ray crystallographic studies
of the ectodomain of E protein have revealed three distinct
beta-barrel domains connected to the viral membrane by a helical
stem anchor and two antiparallel transmembrane domains. Domain III
(EDIII) adopts an immunoglobulin-like fold and has been suggested
to play a critical role in receptor interactions. Domain II (EDII)
is an elongated domain composed of two long finger-like structures
and contains a highly conserved 13 amino acid fusion loop (EDII-FL)
at the tip, and participates in the membrane fusion and
dirnerization of E protein. The central domain of E (domain I; EDI)
is a nine-stranded .beta.-barrel that is connected to EDIII and
EDII by one and four flexible linkers, respectively. E proteins are
important for viral assembly, receptor attachment, entry, viral
fusion, and possibly immune evasion during the flavivirus life
cycle and, thus, are dynamic proteins required to adopt several
distinct conformations and arrangements on the virus particle.
Moreover, E protein is the major target of both neutralizing and
enhancing antibodies (Lai et al., 2008 journal of Virology 82:
6631-6643; Pierson et al., 2008 Cell Host & Microbe 4:
229-38).
[0117] DVs are assembled on the membrane of the endoplasmic
reticulum (ER) and the virus buds into the lumen of the ER as
immature virus particles. Unlike mature virus particles that have a
smooth surface, immature virus particles that bud into the ER have
a rough surface created by trimers of E/prM heterodimers that form
sixty spiked projections with icosahedral symmetry on the viral
envelope (Perera et al., 2008 Antivir. Res. 80 11-22). The E
proteins of each trimer project away from the surface of the virion
and interact with prM via the distal end of EDII including the
fusion loop. PrM on immature virions restricts the ability of E
proteins to undergo oligomeric rearrangement in the low pH
Golgi-derived secretory compartments during viral egress, thus
preventing premature and adventitious fusion (Guirakhoo et al.,
1991 Journal of Virology 72: 1323-1329; Heinz et al., 1994 Journal
of Virology 198(1): 109-117). As immature virions traffic through
the acidic compartments of the trans-Golgi network (TGN), changes
in the orientation of prM and E proteins unmask a site for the
cellular serine protease furin. In this low pH environment, the E
proteins of immature virions form antiparallel dimers that lie flat
against the surface of the virion and are arranged with T=3
quasi-icosahedral symmetry (Yu et al., 2009 Journal of Virology
83(23): 12101-12107). The prM protein continues to mask the fusion
loop of EDII until it is released after furin cleavage and a
transition to neutral pH occurs in the extracellular space. The
resulting mature and infectious viruses are relatively smooth
particles composed of 90 E protein dimers and 180 copies of the
.about.70 amino acid M protein. In this configuration, E proteins
on the mature DV exist in three distinct environments defined by
their proximity to the 2-, 3-, or 5-fold axis of symmetry (Kuhn et
al., 2002 Cell 108: 717-25). Thus, all the E protein subunits are
not in identical environments on the viral surface and steric and
other considerations result in preferential interactions of some E
subunits over others with receptors and antibodies.
[0118] Antibodies recognizing the highly conserved fusion loop on E
protein demonstrate broad reactivity to all four DV serotypes;
however their neutralization potency is typically limited,
presumably due to this epitope being largely inaccessible in mature
DV. Some antibodies which recognize the `A` .beta.-strand of E
protein domain III (EDIII) have been shown to potently neutralize
particular DV strains, but are not known to be effective against
all four serotypes (Lok et al., Nature Structural & Molecular
Biol. 15: 312-317). The `A` .beta.-strand is part of a sub complex
epitope centered at positions 305-308 (DV3 numbering) on the
EDIII.
[0119] As described herein, the present invention encompasses the
finding that the E antigen, and particularly the EDIII domain can
serve as a useful antigenic target for broad-spectrum anti-DV
antibody agents. The invention particularly demonstrates that
antibodies that bind to the E antigen (e.g., to the EDIII domain)
but do not neutralize all DV serotypes can be rationally engineered
to produce variants, and/or other antibody agents, that do
neutralize all of DV serotypes 1-4 (see, e.g., FIG. 3).
Furthermore, the present invention demonstrates that antibodies
that bind to the E antigen (e.g., to the EDIII domain) and
neutralize some but not all DV serotypes can be rationally
engineered to produce variants, and/or other antibody agents, that
have gained neutralization activity, as compared with the parent
antibody, against one or more particular strains and/or serotypes,
without significantly depleting their activity, as compared with
the parent antibody, against certain other strains and/or
subtypes.
4E11 Antibody
[0120] Antibodies have proven to be an effective class of antiviral
therapeutics, in part due to their high biochemical specificity and
their established safety record. Additionally, antibodies have a
long serum half-life (.about.21 days), enabling prophylactic uses
in people, an application of partictilar need for infectious
diseases which show rapid outbreaks, including Dengue Virus.
[0121] Antibodies that protect against flavivirus infection are
believed to act through multiple mechanisms, including one or more
of (1) direct neutralization of receptor binding, (2) inhibition of
viral fusion, (3) Fc-.gamma.-receptor-dependent viral clearance,
(4) complement-mediated lysis of virus or infected cells, and (5)
antibody-dependent cytotoxicity of infected cells (Pierson et al.,
2008 Cell Host Microbe 4: 229-38). Flavivirus neutralization is
thought to require binding by multiple antibodies (Dowd et al.,
2011 Virology 411: 306-15). Studies with E16, an EDIII binding mAb
that neutralizes West Nile virus at a post attachment stage,
indicate that .about.30 antibodies need to bind for effective
neutralization. Studies have suggested that both the affinity of
antibody binding and the total number of accessible epitopes
contribute to the neutralization potency of an antibody. Thus, even
for an antibody that binds with high affinity, the antibody will
fail to neutralize if the number of accessible epitopes is below
certain level required for neutralization. Conversely, a lower
affinity antibody may neutralize if many of the epitopes are
accessible to binding.
[0122] As already noted, Dengue viruses (DVs) display antibody
epitopes that are unique to each serotype and epitopes that are
shared between serotypes. Most studies to understand how antibodies
neutralize or enhance DV have been done with mouse monoclonal
antibodies (mAbs). As E protein is the main antigen exposed on the
surface of the virion, mouse mAbs that bind to E protein have been
the focus of much analysis. Although neutralizing mouse mAbs have
been mapped to all three domains, the most strongly neutralizing
mAbs are serotype-specific and bind to EDIII, which protrudes from
the surface of the virion. Two partially overlapping epitopes on
EDIII designated the lateral ridge and A-strand epitopes are the
main targets of mouse mAbs that neutralize DV.
[0123] The lateral ridge epitope interacts with serotype-specific
strongly neutralizing antibodies. For example, mAb 3H5 maps to the
EDIII-LR of DV serotype 2, and the epitope recognized by these mAbs
is located on both the A-strand (amino acid 304) and the FG loop
(residues 383 and 384) (Sukupolvi-Petty et al., 2007 Journal of
Virology 81(23): 12816-12826).
[0124] However, not all antibodies that bind EDIII exhibit
type-specific neutralizing activity. mAbs that bind to the A-strand
epitope cross react with more than one serotype of DV and are
designated Dengue Virus sub-complex neutralizing mAbs. For example,
the sub complex-specific mAb 1A1D-2 recognizes an epitope centered
on the A-strand of the lateral surface of EDIII and can neutralize
infection by DV serotypes 1-3 (DV1-3), but not DV serotype 4 (DV4)
(Lok et al., 2008 Nature Struct Mol Biol 15(3): 312-317; Roehrig et
al., 1998 Virology 246(2): 317-328; Sukupolvi-Petty et al., 2007
Journal of Virology 81(23): 12816-12826). The molecular basis for
the specificity of this mAb has been investigated; only one of
three residues at the center of the 1A1D-2 epitope is conserved
among all four DV serotypes (DV1-4). A similar A-strand epitope is
also recognized by the broadly neutralizing cross reactive DV mAb
4E11 (Thullier et al., 2001 Journal Gen Virol. 82(8): 1885-1892).
Experimental approaches so far have however, failed to yield
antibodies capable of potently neutralizing all four DV
serotypes.
[0125] One particular murine monoclonal antibody, known as 4E11,
that binds within EDIII of the E glycoprotein, shows potent
neutralizing activity against DV serotypes 1-4. 4E11 binds to a
conformational epitope on DV EDIII of E glycoprotein and cross
reacts with all four serotypes. 4E11 potently neutralizes DV1-3 by
interfering with attachment to host cell. However, it has poor
affinity, and therefore weak neutralizing activity, against
DV4.
[0126] A hybridoma cell line that secretes mouse monoclonal
antibody 4E11 has been deposited in the American Type Culture
Collection (ATCC) Accession number: HB-9259. Sequences of wild type
("wt") 4E11 heavy chain (HC; SEQ ID NO. 1) and light chain (LC; SEQ
ID NO. 2) are known. Sequences of wt 4E11 framework (FR) and
complement determining regions (CDRs) are known (wt 4E11 HC FR1 is
SEQ ID NO. 3, wt 4E11 HC FR2 is SEQ ID NO. 4, wt 4E11 HC FR3 is SEQ
ID NO. 5, wt 4E11 HC FR4 is SEQ ID NO. 6, wt 4E11 HC CDR1 is SEQ ID
NO. 7, wt 4E11 HC CDR2 is SEQ ID NO. 8, wt 4E11 HC CDR3 is SEQ ID
NO. 9; wt 4E11 LC FR1 is SEQ ID NO. 10, wt 4E11 LC FR2 is SEQ ID
NO. 11, wt 4E11 LC FR3 is SEQ ID NO. 12, wt 4E11 LC FR4 is SEQ ID
NO. 13, wt 4E11 LC CDR1 is SEQ ID NO. 14, wt 4E11 LC CDR2 is SEQ ID
NO. 15, wt 4E11 LC CDR3 is SEQ ID NO. 16).
TABLE-US-00003 SEQ ID NO. 1:
EVKLLEQSGAELVKPGASVRLSCTASGFNIKDTYMSWVKQRPEQGLEWIG
RIDPANGDTKYDPKFQGKATITADTSSNTAYLHLSSLTSGDTAVYYCSRG
WEGFAYWGQGTLVTVSA SEQ ID NO. 2:
ELVMTQTPASLAVSLGQRATISCRASENVDRYGNSFMHWYQQKAGQPPKL
LIYRASNLESGIPARFSGSGSRTDFTLTINPVEADDVATYFCQRSNEVPW TFGGGTKLEIKR SEQ
ID NO. 3: EVKLLEQSGAELVKPGASVRLSCTAS SEQ ID NO. 4:
YMSWVKQRPEQGLEWIGRI SEQ ID NO. 5:
TKYDPKFQGKATITADTSSNTAYLHLSSLTSGDTAVYYCSR SEQ ID NO. 6: WGQGTLVTVSA
SEQ ID NO. 7: GFNIKDT SEQ ID NO. 8: DPANGD SEQ ID NO. 9: GWEGFAY
SEQ ID NO. 10: ELVMTQTPASLAVSLGQRATISC SEQ ID NO. 11:
WYQQKAGQPPKLLIY SEQ ID NO. 12: GIPARFSGSGSRTDFTLTINPVEADDVATYFC SEQ
ID NO. 13: FGGGTKLEIKR SEQ ID NO. 14: RASENVDRYGNSFMH SEQ ID NO.
15: RASNLES SEQ ID NO. 16: QRSNEVPWT
[0127] The present invention encompasses the recognition that it
would be desirable to develop antibodies (or other antibody agents)
that are variants of wt 4E11. The present invention particularly
provides such antibodies and antibody agents. That is, the present
invention provides various antibody agents that show significant
structural identity with 4E11 and moreover show improved functional
characteristics (e.g., neutralization of DV4) as compared with that
observed with wt 4E11.
[0128] The present disclosure provides a novel scoring metric for
docking an antigen-antibody interaction. The scoring metric
framework ranks protein-protein interfaces according to
physicochemical features and propensities of pairwise amino acid
interactions observed in intermolecular interfaces. The present
disclosure uses this framework to modify properties of an existing
antibody. In some embodiments, the specificity and affinity of an
antibody for its antigen is modified. In some embodiments, the
modified antibody is a monoclonal antibody. In some embodiments,
the framework disclosed in the present invention is used to
engineer broader specificity and affinity to an anti-DV
neutralizing mAb.
[0129] Using the docked model, the mode of anti-DV antibodies
binding to all four serotypes of DV (DV1-4) was examined and the
structural basis of poor affinity of these antibodies towards DV4
were identified. Mutations were carefully designed on the paratope
of these antibodies to improve their affinity, and thereby their
neutralizing activity, towards DV4, while maintaining affinity and
neutralizing activity towards DV1-3. For designing the mutations,
the CDR loop residues of the mAbs were carefully examined one at a
time. At a given CDR position, the "wild- type" residue was
systematically substituted by the remaining amino acids excluding
glycine (Gly) and proline (Pro), and the probability of replacement
was evaluated at each instance using the statistical pairwise
propensities. Gly and Pro residues were not modified to avoid
alteration in the backbone conformation. Single mutations with high
replacement potential were modeled, and re-evaluated
computationally to find mutations that: (1) do not alter phi-psi
values; (2) do not bury polar groups; and (3) improved H-bonds,
salt bridge, van der Waals, hydrophobic contacts, and packing.
Promising single mutations identified by the computational approach
were screened using a high throughput indirect enzyme linked
immunosorbent assay (ELISA) method to identify positive mutations
that improve affinity towards DV4 EDIII while maintaining affinity
towards DV1-3 EDIII. Finally, positive single mutations were
combined to rationally design high affinity antibodies. Competition
ELISA experiments were carried out to determine the affinity, at
equilibrium and in solution, between the engineered antibodies and
EDIII from each of the four serotypes. Binding measurements were
verified using surface plasmon resonance (SPR) analysis.
[0130] In some embodiments, antibodies against A-strand epitope can
be engineered to bind to all four serotypes of DV. In some
embodiments, wt 4E11 anti-DV antibody is modified to improve its
affinity, and thereby neutralizing activity towards DV4, while
maintaining affinity towards DV1-3. In some embodiments, one of the
engineered antibodies displays .about.15 and .about.450 fold
improvement in affinity toward EDIII of DV2 and DV4, respectively,
while maintaining original affinity towards EDIII DV1 and DV3. In
some embodiments, compared to wt mAb 4E11, the engineered antibody
showed >75 fold increased neutralizing potential towards DV4,
while still maintaining "wild-type" activity towards other
serotypes. The engineered 4E11 antibody according to the present
invention represents an interesting candidate for a therapeutic
antibody to treat Dengue disease.
Provided Variant DV Antibody Agents
[0131] It will be appreciated that provided antibody agents may be
engineered, produced, and/or purified in such a way as to improve
characteristics and/or activity of the antibody agents. For
example, improved characteristics of provided antibody agents
include, but are not limited to, increased stability, improved
binding affinity and/or avidity, increased binding specificity,
increased production, decreased aggregation, decreased nonspecific
binding, among others.
[0132] In general, as described herein, provided antibody agents
can be or include, e.g., a polyclonal antibody; a monoclonal
antibody or antigen binding fragment thereof; a modified antibody
such as a chimeric antibody, reshaped antibody, humanized antibody,
or fragment thereof (e.g., Fab', Fab, F(ab').sub.2); or a
biosynthetic antibody, e.g., a single chain antibody, single domain
antibody (DAB), Fv, single chain Fv (scFv), or the like.
[0133] Methods of making and using polyclonal and monoclonal
antibodies are described, e.g., in Harlow et al., Using Antibodies:
A Laboratory Manual: Portable Protocol I. Cold Spring Harbor
Laboratory (Dec. 1, 1998). Methods for making modified antibody
agents, such as, antibodies and antibody fragments (e.g., chimeric
antibodies, reshaped antibodies, humanized antibodies, or fragments
thereof, e.g., Fab', Fab, F(ab').sub.2 fragments); or biosynthetic
antibodies (e.g., single chain antibodies, single domain antibodies
(DABs), Fv, single chain Fv (scFv), and the like), are known in the
art and can be found, e.g., in Zola, Monoclonal Antibodies:
Preparation and Use of Monoclonal Antibodies and Engineered
Antibody Derivatives, Springer Verlag (Dec. 15, 2000; 1st
edition).
[0134] The present invention provides antibody agents that bind to
all four serotypes of DV (DV1-4). In some embodiments, the present
invention provides antibody agents that bind to DV1 with a higher
affinity, as compared to the affinity of another antibody to DV1.
In some embodiments, the present invention provides antibody agents
that bind with a higher affinity to DV2, as compared to the
affinity of another antibody to DV2. In some embodiments, the
present invention provides antibody agents that bind with a higher
affinity to DV3, as compared to the affinity of another antibody to
DV3. In some embodiments, the present invention provides antibody
agents that bind with a higher affinity to DV4, as compared to the
affinity of another antibody to DV4. In some embodiments, the
present invention provides antibody agents that bind with a higher
affinity to DV1, DV2, DV3, and DV4, as compared to the affinity of
another antibody to DV1, DV2, DV3, and DV4. In some embodiments,
the present invention provides antibody agents that bind with
higher affinity to DV4, and retain binding affinity to DV1, DV2,
and DV3, as compared to the affinities of another antibody for
these DV serotypes. In some embodiments, the present invention
provides antibody agents that bind to DV1 and DV4 with higher
affinities, as compared to the affinities of another antibody for
these DV serotypes. In some embodiments, provided antibody agents
bind with a higher affinity to DV1 and DV4, and retain their
binding affinity to DV2 and DV3, as compared to the affinities of
another antibody for these DV serotypes. In some embodiments, the
present invention provides antibody agents that bind to DV2 and DV4
with higher affinities, as compared to the affinities of another
antibody for these DV serotypes. In some embodiments, provided
antibody agents bind with a higher affinity to DV2 and DV4, and
retain their binding affinity to DV1 and DV3, as compared to the
affinities of another antibody for these DV serotypes. In some
embodiments, the present invention provides antibody agents that
bind to DV3 and DV4 with higher affinities, as compared to the
affinities of another antibody for these DV serotypes. In some
embodiments, provided antibody agents bind with a higher affinity
to DV3 and DV4, and retain their binding affinity to DV1 and DV2,
as compared to the affinities of another antibody for these DV
serotypes.
[0135] In some embodiments, provided antibody agents bind to one or
more of DV1-4 with an affinity of at least 5%, 10%, 15%, 20%, 25%,
30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or
more than the affinity of a different antibody for one or more of
DV1-4. In some embodiments, provided antibody agents bind to one or
more of DV1-4 with an affinity of at least 2-fold, at least 5-fold,
at least 10-fold, at least 20-fold, at least 30-fold, at least
40-fold, at least 50-fold, at least 60-fold, at least 70-fold, at
least 80-fold, at least 90-fold, at least 100-fold, at least
200-fold, at least 300-fold, at least 400-fold, at least 500-fold
or greater affinity than that of a different antibody for one or
more of DV1-4. In some embodiments, provided antibody agents show
binding affinities for different DV serotypes that are within 2,
within 5, within 10, within 25, within 50, within 100, within 150,
within 200, within 250, within 300, within 350, or within 400-fold
affinity of one another.
[0136] In some embodiments, provided antibody agents show a
neutralization IC.sub.50 (ug/ml ) within a range as described
and/or exemplified herein. In some embodiments, provided antibody
agents show a neutralization IC.sub.50 (ug/ml ) whose lower bound
is about 0.05 ug/ml and upper bound is about 10 ug/ml . In some
embodiments, provided antibody agents show a neutralization
IC.sub.50 (ug/ml ) whose lower bound is selected from the group
consisting of 0.05 ug/ml, 0.1 ug/ml, 0.2 ug/ml, 0.3 ug/ml, 0.4
ug/ml, 0.5 ug/ml, 0.6 ug/ml, 0.7 ug/ml, 0.8 ug/ml, 0.9 ug/ml, 1.0
ug/ml, 1.1 ug/ml, 1.2 ug/ml, 1.3 ug/ml, 1.4 ug/ml, 1.5 ug/ml, 1.6
ug/ml, 1.7 ug/ml, 1.8 ug/ml, 1.9 ug/ml, 2.0 ug/ml, 2.5 ug/ml, 3.0
ug/ml, 3.5 ug/ml, 4.0 ug/ml, 4.5 ug/ml, 5.0 ug/ml or more, and
whose upper bound is higher than the lower bound and is selected
from the group consisting of 1.5 ug/ml, 1.6 ug/ml, 1.7 ug/ml, 1.8
ug/ml, 1.9 ug/ml, 2.0 ug/ml, 2.5 ug/ml, 3.0 ug/ml, 3.5 ug/ml, 4.0
ug/ml, 4.5 ug/ml, 5.0 ug/ml, 5.5 ug/ml, 6.0 ug/ml, 6.5 ug/ml, 7.0
ug/ml, 7.5 ug/ml, 8.0 ug/ml, 8.5 ug/ml, 9.0 ug/ml, 9.5 ug/ml, 10.0
ug/ml or more.
[0137] In some embodiments, provided antibody agents show binding
to DV1-4 with a K.sub.D (nM) less than 40000 nM, less than 30000
nM, less than 20000 nM, less than 10000 nM, less than 5000 nM, less
than 2000 nM, less than 1500 nM, less than 1000 nM, less than 500
nM, less than 250 nM, less than 225 nM, less than 200 nM, less than
175 nM, less than 150 nM, less than 125 nM, less than 100 nM, less
than 75 nM, less than 50 nM, less than 25 nM, less than 15 nM, less
than 10 nM, less than 5 nM, less than 2.5 nM, less than 1 nM, less
than 0.5 nM, less than 0.25 nM, less than 0.1 nM.
[0138] In some embodiments, provided antibody agents show binding
to DV1-4 with a K.sub.on (M.sup.-1s.sup.-1) whose lower bound is
about 0.01.times.10.sup.5 M.sup.-1s.sup.-1and upper bound is about
5.0.times.10.sup.6 M.sup.-1s.sup.-1. In some embodiments, provided
antibodies show binding to DV1-4 with a K.sub.on (M.sup.-1s.sup.-1)
whose lower bound is selected from the group consisting of
0.01.times.10.sup.5 M.sup.-1s.sup.-1, 0.05.times.10.sup.5
M.sup.-1s.sup.-1, 0.1.times.10.sup.5 M.sup.-1s.sup.-1,
0.5.times.10.sup.5 M.sup.-1s.sup.-1, 1.0.times.10.sup.5
M.sup.-1s.sup.-1, 2.0.times.10.sup.5 M.sup.-1s.sup.-1,
5.0.times.10.sup.5 M.sup.-1s.sup.-1, 7.0.times.10.sup.5
M.sup.-1s.sup.-1, or more, and whose upper bound is higher than the
lower bound and is selected from the group consisting of
1.0.times.10.sup.6 M.sup.-1s.sup.-1, 1.5.times.10.sup.6
M.sup.-1s.sup.-1, 2.0.times.10.sup.6 M.sup.-1s.sup.-1,
2.5.times.10.sup.6 M.sup.-1s.sup.-1, 3.0.times.10.sup.6
M.sup.-1s.sup.-1, 3.5.times.10.sup.6 M.sup.-1s.sup.-1,
4.0.times.10.sup.6 M.sup.-1s.sup.-1, 4.5.times.10.sup.6
M.sup.-1s.sup.-1, 5.0.times.10.sup.6 M.sup.-1s.sup.-1, or more.
[0139] In some embodiments, provided antibody agents show binding
to DV1-4 with a K.sub.off (s.sup.-1) whose lower bound is about
5.times.10.sup.-4 s.sup.-1 and upper bound is about
900.times.10.sup.-4 s.sup.-1. In some embodiments, provided
antibody agents show binding to DV1-4 with a K.sub.off (s.sup.-1)
whose lower bound is selected from the group consisting of
5.times.10.sup.-4s.sup.-1, 10.times.10.sup.-4s.sup.-1,
12.times.10.sup.-4s.sup.-1, 13.times.10.sup.-4s.sup.-1,
14.times.10.sup.-4s.sup.-1, 15.times.10.sup.-4s.sup.-1,
18.times.10.sup.-4s.sup.-1, 20.times.10.sup.-4s.sup.-1, or more,
and whose upper bound is higher than the lower bound and is
selected from the group consisting of 50.times.10.sup.-4s.sup.-1,
100.times.10.sup.-4s.sup.-1, 120.times.10.sup.-4s.sup.-1,
140.times.10.sup.-4s.sup.-1, 150.times.10.sup.-4s.sup.-1,
200.times.10.sup.-4s.sup.-1, 300.times.10.sup.-4s.sup.-1,
400.times.10.sup.-4s.sup.-1, 500.times.10.sup.-4s.sup.-1,
600.times.10.sup.-4s.sup.-1, 700.times.10.sup.-4s.sup.-1,
800.times.10.sup.-4s.sup.-1, 900.times.10.sup.-4s.sup.-1, or
more.
[0140] In some embodiments, provided antibody agents bind to E
glycoprotein of DV1-4. In certain embodiments, provided antibody
agents bind to EDIII of DV1-4 (SEQ ID NOs. 17-20). In some
embodiments, provided antibody agents bind to A-strand of DV1-4. In
some embodiments, the present invention provides antibody agents
that bind with higher affinity to EDIII of DV4 (SEQ ID NO. 20). In
some embodiments, the present invention provides antibody agents
that bind with higher affinity to A-strand of DV4.
TABLE-US-00004 SEQ ID NO. 17:
MCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGR
LITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFK SEQ ID NO. 18:
MCTGKFKVVKEIAETQHGTMVIRVQYEGDDSPCKIPFEIMDLEKKHVLGR
LITVNPIVIEKDSPINIEAEPPFGDSYIIIGVEPGQLKLNWFK SEQ ID NO. 19:
MCTNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGR
LITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDNALKINWYK SEQ ID NO. 20:
MCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGR
IISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTLHWFR
[0141] In some embodiments, the present invention identifies
antibody agents that bind to one or more amino acid residues in
EDIII of DV1-4 (SEQ ID NOs. 17-20) at positions 305, 306, 307, 308,
309, 310, 311, 312, 323, 325, 327, 329, 360, 361, 362, 363, 364,
385, 387, 388, 389, 390, 391, and/or combinations thereof. In some
embodiments, the present invention identifies antibody agents that
bind to one or more amino acid residues in EDIII of DV1-4 (SEQ ID
NOs. 17-20) at positions 305, 310, 311, 323, 327, 329, and/or
combinations thereof. In some embodiments, the present invention
identifies antibody agents that bind amino acid residues in EDIII
of DV1-4 (SEQ ID NOs. 17-20) at positions 305, 310, 311, 323, 327,
and 329. In some embodiments, the present invention identifies
antibody agents that bind amino acid residue in EDIII of DV1-4 (SEQ
ID NOs. 17-20) at position 305. In some embodiments, the present
invention identifies antibody agents that bind amino acid residue
in EDIII of DV1-4 (SEQ ID NOs. 17-20) at position 310. In certain
embodiments, the present invention identifies antibody agents that
bind amino acid residue in EDIII of DV1-4 (SEQ ID NOs. 17-20) at
position 311. In some embodiments, the present invention identifies
antibody agents that bind amino acid residue in EDIII of DV1-4 (SEQ
ID NOs. 17-20) at position 323. In some embodiments, the present
invention identifies antibody agents that bind amino acid residue
in EDIII of DV1-4 (SEQ ID NOs. 17-20) at position 327. In some
embodiments, the present invention identifies antibody agents that
bind amino acid residue in EDIII of DV1-4 (SEQ ID NOs. 17-20) at
position 329.
[0142] In some embodiments, a serine, lysine, and/or threonine
residue at position 305 contribute(s) to binding to provided
antibody agents. In some embodiments, a lysine residue at position
310 contributes to binding to provided antibody agents. In some
embodiments, a lysine residue at position 311 contributes to
binding to provided antibody agents. In some embodiments, an
arginine, lysine, and/or glutamine residue at position 323
contribute(s) to binding to provided antibody agents. In some
embodiments, a serine and/or glutamate residue at position 327
contribute(s) to binding to provided antibody agents. In some
embodiments, an arginine, aspartate, and/or glutamate residue at
position 329 contribute(s) to binding to provided antibody
agents.
[0143] In some embodiments, the present invention provides antibody
agents that bind with higher affinity to DV1, as compared to a wild
type ("wt") DV antibody. In some embodiments, the present invention
provides antibody agents that bind with higher affinity to DV2, as
compared to a wt or parent reference DV antibody. In some
embodiments, the present invention provides antibody agents that
bind with higher affinity to DV3, as compared to a reference
antibody such as a wt DV antibody. In some embodiments, the present
invention provides antibody agents that bind with higher affinity
to DV4, as compared to a reference DV antibody. In some
embodiments, the present invention provides antibody agents that
bind with higher affinity to DV1, DV2, DV3, and DV4, as compared to
a reference DV antibody. In some embodiments, the present invention
provides antibody agents that bind with higher affinity to DV4 and
retain binding affinity to DV1, DV2, and DV3, as compared to a
reference DV antibody. In some embodiments, the present invention
provides antibody agents that bind with higher affinity to DV2 and
DV4, as compared to a reference (wt) DV antibody. In some
embodiments, provided antibody agents that bind with higher
affinity to DV2 and DV4 and retain their binding affinity to DV1
and DV3, as compared to a reference DV antibody. In some
embodiments, a wt DV antibody is a wt 4E11 antibody.
[0144] As described herein, the present invention provides antibody
agents that show certain structural (i.e., sequence) relationship
with 4E11 and/or have particular functional attributes, including
for example certain improved functional attributes as compared with
wt 4E11.
[0145] In some embodiments, the present invention provides antibody
agents whose amino acid sequences, show specified levels of
homology and/or identity with wt 4E11. In some embodiments provided
antibody agents show at least 60%, at least 70%, at least 80%, at
least 90%, at least 95%, at least 99% identity with wt 4E11 (i.e.,
with SEQ ID NOs. 1-2).
[0146] In some embodiments, provided antibody agents have a heavy
chain (HC; SEQ ID NO. 21) CDR1 comprising sequence GFNIKDT (SEQ ID
NO. 23), a HC CDR2 comprising sequence DPENGD (SEQ ID NO. 24), a HC
CDR3 comprising sequence GWEGFAY (SEQ ID NO. 25), a light chain
(LC; SEQ ID NO. 22) CDR1 comprising sequence RASENVDKYGNSFMH (SEQ
ID NO. 26), a LC CDR2 region comprising sequence RASELQW (SEQ ID
NO. 27) and a LC CDR3 region comprising sequence QRSNEVPWT (SEQ ID
NO. 28).
TABLE-US-00005 SEQ ID NO. 21:
EVKLLEQSGAELVKPGASVRLSCTASGFNIKDTYMSWVKQRPEQGLEWIG
RIDPENGDTKYDPKFQGKATITADTSSNTAYLHLSSLTSGDTAVYYCSRG
WEGFAYWGQGTLVTVSA SEQ ID NO. 22:
ELVMTQTPASLAVSLGQRATISCRASENVDKYGNSFMHWYQQKAGQPPKL
LIYRASELQWGIPARFSGSGSRTDFTLTINPVEADDVATYFCQRSNEVPW TFGGGTKLEIKR
[0147] In some embodiments, provided antibody agents have one or
more CDRs and/or one or more FRs that are identical in sequence to
a corresponding CDR or FR of wt 4E11 (i.e. to one or more of SEQ ID
NOs. 7-9, 14-16 or 3-6, 10-13). In some embodiments, provided
antibody agents have one or more CDRs and/or FRs showing a
specified degree of homology and/or identity with the corresponding
CDRs and/or FRs of wt 4E11 as discussed below. In some embodiments,
all CDRs and FRs of a provided antibody agents show at least the
specified level of homology and/or identity. In some embodiments, a
provided antibody agents has CDR and FR sequences that together
contain no more than 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7,
6, 5, 4, 3, 2, or 1 substitutions as compared with wt 4E11.
[0148] In some embodiments, a complementarity determining region
(CDR) 1 of an antibody agent of the present invention shows at
least 65%, more than 70%, more than 75%, more than 80%, more than
85%, more than 90%, more than 95%, or more than 99% identity with
wt 4E11 (SEQ ID NO. 7 and SEQ ID NO. 14). In some embodiments, a
provided CDR1 has an amino acid sequence that is identical to that
of wt 4E11 and/or does not contain any amino acid substitutions as
compared with CDR1 of wt 4E11 (SEQ ID NO. 7 and SEQ ID NO. 14). In
some embodiments, a provided CDR1 has one or more amino acid
substitutions as compared to wt 4E11 (SEQ ID NO. 7 and SEQ ID NO.
14). In some embodiments, a provided CDR1 will have two or more
amino acid substitutions as compared to wt 4E11 (SEQ ID NO. 7 and
SEQ ID NO. 14). In some embodiments, a provided CDR has 1, 2, 3, 4
or 5 substitutions and in some embodiments 1, 2, or 3 substitutions
as compared with wt 4E11.
[0149] In some embodiments, a CDR2 of an antibody agent of the
present invention shows at least 65%, more than 70%, more than 75%,
more than 80%, more than 85%, more than 90%, more than 95%, or more
than 99% identity with wt 4E11 (SEQ ID NO. 8 and SEQ ID NO. 15). In
some embodiments, a provided CDR2 has an amino acid sequence that
is identical to that of wt 4E11 and/or does not contain any amino
acid substitutions as compared with CDR2 of wt 4E11 (SEQ ID NO. 8
and SEQ ID NO. 15). In some embodiments, a provided CDR2 has one or
more amino acid substitutions as compared to wt 4E11 (SEQ ID NO. 8
and SEQ ID NO. 15). In some embodiments, a provided CDR2 will have
two or more amino acid substitutions as compared to wt 4E11 (SEQ ID
NO. 8 and SEQ ID NO. 15). In some embodiments, a provided CDR has
1, 2, 3, 4 or 5 substitutions and in some embodiments 1, 2, or 3
substitutions as compared with wt 4E11.
[0150] In some embodiments, a CDR3 of an antibody agent of the
present invention shows at least 65%, more than 70%, more than 75%,
more than 80%, more than 85%, more than 90%, more than 95%, or more
than 99% identity with wt 4E11 (SEQ ID NO. 9 and SEQ ID NO. 16). In
some embodiments, a provided CDR3 has an amino acid sequence that
is identical to that of wt 4E11 and/or does not contain any amino
acid substitutions as compared with CDR3 of wt 4E11 (SEQ ID NO. 9
and SEQ ID NO. 16). In some embodiments, a provided CDR3 has one or
more amino acid substitutions as compared to wt 4E11 (SEQ ID NO. 9
and SEQ ID NO. 16). In some embodiments, a provided CDR3 will have
two or more amino acid substitutions as compared to wt 4E11 (SEQ ID
NO. 9 and SEQ ID NO. 16). In some embodiments, a provided CDR has
1, 2, 3, 4 or 5 substitutions and in some embodiments 1, 2, or 3
substitutions as compared with wt 4E11.
[0151] In some embodiments, a provided framework region 1 (FR1) of
an antibody agent of the present invention will share more than
65%, more than 70%, more than 75%, more than 80%, more than 85%,
more than 90%, more than 95%, or more than 99% percent identity
with wt 4E11 (SEQ ID ID NO. 3 and SEQ ID NO. 10). In some
embodiments, a provided FR1 will not have an amino acid
substitution as compared to wt 4E11 (SEQ ID ID NO. 3 and SEQ ID NO.
10). In some embodiments, a provided FR1 will have one or more
amino acid substitutions as compared to wt 4E11 (SEQ ID ID NO. 3
and SEQ ID NO. 10). In some embodiments, a provided FR1 will have
two or more amino acid substitutions as compared to wt 4E11 (SEQ ID
ID NO. 3 and SEQ ID NO. 10).
[0152] In some embodiments, a provided framework region 2 (FR2) of
an antibody agent of the present invention will share more than
65%, more than 70%, more than 75%, more than 80%, more than 85%,
more than 90%, more than 95%, or more than 99% percent identity
with wt 4E11 (SEQ ID NO. 4 and SEQ ID NO. 11). In some embodiments,
a provided FR2 will not have an amino acid substitution as compared
to wt 4E11 (SEQ ID NO. 4 and SEQ ID NO. 11). In some embodiments, a
provided FR2 will have one or more amino acid substitutions as
compared to wt 4E11 (SEQ ID NO. 4 and SEQ ID NO. 11). In some
embodiments, a provided FR2 will have two or more amino acid
substitutions as compared to wt 4E11 (SEQ ID NO. 4 and SEQ ID NO.
11).
[0153] In some embodiments, a provided framework region 3 (FR3) of
an antibody agent of the present invention will share more than
65%, more than 70%, more than 75%, more than 80%, more than 85%,
more than 90%, more than 95%, or more than 99% percent identity
with wt 4E11 (SEQ ID NO. 5 and SEQ ID NO. 12). In some embodiments,
a provided FR3 will not have an amino acid substitution as compared
to wt 4E11 (SEQ ID NO. 5 and SEQ ID NO. 12). In some embodiments, a
provided FR3 will have one or more amino acid substitutions as
compared to wt 4E11 (SEQ ID NO. 5 and SEQ ID NO. 12). In some
embodiments, a provided FR3 will have two or more amino acid
substitutions as compared to wt 4E11 (SEQ ID NO. 5 and SEQ ID NO.
12).
[0154] In some embodiments, a provided framework region 4 (FR4) of
an antibody agent of the present invention will share more than
65%, more than 70%, more than 75%, more than 80%, more than 85%,
more than 90%, more than 95%, or more than 99% percent identity
with wt 4E11 (SEQ ID NO. 6 and SEQ ID NO. 13). In some embodiments,
a provided FR4 will not have an amino acid substitution as compared
to wt 4E11 (SEQ ID NO. 6 and SEQ ID NO. 13).
[0155] In some embodiments, a provided FR4 will have one or more
amino acid substitutions as compared to wt 4E11 (SEQ ID NO. 6 and
SEQ ID NO. 13). In some embodiments, a provided FR3 will have two
or more amino acid substitutions as compared to wt 4E11 (SEQ ID NO.
6 and SEQ ID NO. 13).
[0156] In some embodiments, the VH CDR of the provided antibody
agents show at least 60%, at least 70%, at least 80%, at least 90%,
at least 95%, at least 99% identity with wt 4E11 (SEQ ID NOs.:
7-9). In some embodiments, the VH CDR of the provided antibody
agents show at least 60%, at least 70%, at least 80%, at least 90%,
at least 95%, at least 99% identity with wt 4E11 (SEQ ID NOs.:
7-9), but differs by substitution of at least one amino acid
substitution within the CDR. In some embodiments, the VH CDR of
provided antibody agents have a substitution of the corresponding
amino acid residue at position 55 of the wt 4E11 antibody. In some
embodiments, a substitute amino acid residue at position 55 is
selected from the group consisting of glutamate and aspartate. In
some embodiments, the substitute amino acid residue at position 55
is glutamate. In some embodiments, the amino acid residue in the VH
CDR of provided antibodies corresponding to amino acid residue at
position 55 of wt 4E11 is not alanine.
[0157] In some embodiments, the VL CDR of provided antibody agents
show at least 60%, at least 70%, at least 80%, at least 90%, at
least 95%, at least 99% identity with wt 4E11 (SEQ ID NOs.: 14-16).
In some embodiments, the VL CDR of provided antibody agents show at
least 60%, at least 70%, at least 80%, at least 90%, at least 95%,
at least 99% identity with wt 4E11 (SEQ ID NOs.: 14-16), but
differs by substitution of at least one amino acid substitution
within the CDR. In some embodiments, the VL CDR of provided
antibody agents have one or more substitutions of a corresponding
amino acid residue at positions 31, 57, 59, 60 and/or combinations
thereof, of the wt 4E11 antibody. In some embodiments, the VL CDR
of provided antibody agents have a substitution of the
corresponding amino acid residue at position 31 of the wt 4E11
antibody. In some embodiments, the substitute amino acid residue at
position 31 is lysine. In some embodiments, the amino acid residue
in the VL CDR of provided antibody agents corresponding to amino
acid residue at position 55 of wt 4E11 is not arginine. In some
embodiments, the VL CDR of provided antibody agents have a
substitution of the corresponding amino acid residue at position 57
of the wt 4E11 antibody. In some embodiments, the substitute amino
acid residue at position 57 is selected from the group consisting
of glutamate and serine. In some embodiments, the substitute amino
acid residue at position 57 is glutamate. In some embodiments, the
amino acid residue in the VL CDR of provided antibody agents
corresponding to amino acid residue at position 57 of wt 4E11 is
not asparagine. In some embodiments, the VL CDR of provided
antibody agents have substitution of the corresponding amino acid
residue at position 59 of the wt 4E11 antibody. In some
embodiments, the substitute amino acid residue at position 59 is
selected from the group consisting of glutamine and asparagine. In
some embodiments, the substitute amino acid residue at position 59
is glutamine. In some embodiments, the amino acid residue in the VL
CDR of provided antibody agents corresponding to amino acid residue
at position 59 of wt 4E11 is not glutamate. In some embodiments,
the VL CDR of provided antibody agents have a substitution of the
corresponding amino acid residue at position 60 of the wt 4E11
antibody. In some embodiments, the substitute amino acid residue at
position 60 is selected from the group consisting of tryptophan,
tyrosine, and arginine. In some embodiments, the substitute amino
acid residue at position 60 is tryptophan. In some embodiments, the
amino acid residue in the VL CDR of provided antibody agents
corresponding to amino acid residue at position 60 of wt 4E11 is
not serine.
[0158] In some embodiments, the VH and VL CDRs of the provided
antibody agents show at least 60%, at least 70%, at least 80%, at
least 90%, at least 95%, at least 99% identity with wt 4E11 (SEQ ID
NOs.: 7-9 and 14-16, respectively). In some embodiments, the VH and
VL CDRs of the provided antibody agents show at least 60%, at least
70%, at least 80%, at least 90%, at least 95%, at least 99%
identity with wt 4E11 (SEQ ID NOs.: 7-9 and 14-16, respectively),
but differ by substitution of at least one amino acid substitution
within the CDRs. In some embodiments, the VH CDR of provided
antibody agents have substitution of the corresponding amino acid
residue at position 55, and VL CDR of provided antibody agents have
substitution of the corresponding amino acid residue at positions
31, 57, 59 and 60, of the wt 4E11 antibody. In some embodiments,
the substitute amino acid residue at position 55 is glutamate. In
some embodiments, the substitute amino acid residue at position 31
is lysine. In some embodiments, the substitute amino acid residue
at position 57 is glutamate. In some embodiments, the substitute
amino acid residue at position 59 is glutamine. In some
embodiments, the substitute amino acid residue at position 60 is
tryptophan.
[0159] In some embodiments, the present invention provides antibody
agents that show binding to EDIII-DV4 (SEQ ID NO. 20) with a
K.sub.D (nM) less than 40000 nM, less than 30000 nM, less than
20000 nM, less than 15000 nM, less than 10000 nM, less than 8000
nM, less than 5000 nM, less than 4000 nM, less than 3000 nM, less
than 2000 nM, less than 1500 nM, less than 1000 nM, less than 500
nM, less than 250 nM, less than 225 nM, less than 200 nM, less than
175 nM, less than 150 nM, less than 125 nM, less than 100 nM, less
than 75 nM, or less than 50 nM.
[0160] In some embodiments, the present invention provides antibody
agents that show binding to EDIII-DV1 (SEQ ID NO. 17) with a
K.sub.D (nM) of less than 3 nM, less than 2.5 nM, less than 2 nM,
less than 1.5 nM, less than 1.0 nM, less than 0.5 nM, less than 0.4
nM, less than 0.3 nM, less than 0.2 nM, less than 0.1 nM, or less
than 0.05 nM.
[0161] In some embodiments, the present invention provides antibody
agents that show binding to EDIII-DV2 (SEQ ID NO. 18) with a
K.sub.D (nM) of less than 15 nM, less than 12 nM, less than 10 nM,
less than 8 nM, less than 7 nM, less than 5 nM, less than 2.5 nM,
less than 2 nM, less than 1.5 nM, less than 1 nM, less than 0.5 nM,
less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than
0.1 nM.
[0162] In some embodiments, the present invention provides antibody
agents that show binding to EDIII-DV3 (SEQ ID NO. 19) with a
K.sub.D (nM) of less than 120 nM, less than 100 nM, less than 50
nM, less than 40 nM, less than 35 nM, less than 30 nM, less than 25
nM, less than 20 nM, less than 15 nM, less than 10 nM, less than 5
nM, less than 2.5 nM, or less than 1.0 nM.
[0163] In some embodiments, the present invention provides antibody
agents with at least 2-fold, 5-fold, 10-fold, 20-fold, 30-fold,
40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold,
200-fold, 300-fold, 400-fold, 500-fold, or greater affinity for
binding to EDIII-DV4 than wt 4E11.
[0164] In some embodiments, the present invention provides antibody
agents with at least 2-fold, 5-fold, 10-fold, 20-fold, 30-fold,
40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, or greater
affinity for binding to EDIII-DV2 than wt 4E11.
[0165] In some embodiments, the present invention provides antibody
agents with at least 1-fold, 1.5-fold, 2-fold, 5-fold, 10-fold,
20-fold, 30-fold, 40-fold, 50-fold, 60-fold, or greater affinity
for binding to EDIII-DV1 and/or EDIII-DV3 than wt 4E11.
[0166] In some embodiments, the present invention provides antibody
agents that show neutralization IC.sub.50 (ug/ml ) of EDIII-DV4
(SEQ ID NO. 20) of 60 ug/ml or less, 50 ug/ml or less, 40 ug/ml or
less, 30 ug/ml or less, 20 ug/ml or less, 10 ug/ml or less, 5 ug/ml
or less, 4 ug/ml or less, 3 ug/ml or less, 2 ug/ml or less.
[0167] In some embodiments, the present invention provides antibody
agents that show neutralization IC.sub.50 (ug/ml ) of EDIII-DV3
(SEQ ID NO. 19) of 7.0 ug/ml or less, 6.0 ug/ml or less, 5.0 ug/ml
or less, 4.0 ug/ml or less, 3.0 ug/ml or less, 2.0 ug/ml or less,
1.5 ug/ml or less, 1.0 ug/ml or less, 0.90 ug/ml or less, 0.80
ug/ml or less, 0.70 ug/ml or less, 0.60 ug/ml or less, 0.50 ug/ml
or less.
[0168] In some embodiments, the present invention provides antibody
agents that show neutralization IC.sub.50 (ug/ml ) of EDIII-DV2
(SEQ ID NO. 18) of 0.2 ug/ml or less, 0.19 ug/ml or less, 0.18
ug/ml or less, 0.17 ug/ml or less, 0.16 ug/ml or less, 0.15 ug/ml
or less, 0.14 ug/ml or less, 0.13 ug/ml or less, 0.12 ug/ml or
less, 0.1 ug/ml or less, 0.1Oug/ml or less, 0.09 ug/ml or less,
0.07 ug/ml or less, 0.06 ug/ml or less, 0.05 ug/ml or less, 0.04
ug/ml or less, 0.03 ug/ml or less, 0.02 ug/ml or less, 0.0 ug/ml or
less.
[0169] In some embodiments, the present invention provides antibody
agents that show neutralization IC.sub.50 (ug/ml ) of EDIII-DV1
(SEQ ID NO. 17) of 5.0 ug/ml or less, 4.0 ug/ml or less, 3.0 ug/ml
or less, 2.5 ug/ml or less, 2.0 ug/ml or less, 1.5 ug/ml or less,
1.0 ug/ml or less, 0.90 ug/ml or less, 0.70 ug/ml or less, 0.50
ug/ml or less, 0.40 ug/ml or less, 0.30 ug/ml or less, 0.20 ug/ml
or less, 0.10 ug/ml or less.
[0170] In some embodiments, the present invention provides antibody
agents with at least 2-fold, 5-fold, 10-fold, 20-fold, 30-fold,
40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold,
150-fold, 200-fold, 400-fold, 500-fold, or more reduction of
IC.sub.50 for neutralization of EDIII-DV4 than wt 4E11.
[0171] In some embodiments, the present invention provides antibody
agents with at least 1-fold, 1.5-fold, 2-fold, 5-fold, 10-fold,
20-fold, 30-fold, 40-fold, 50-fold, 60-fold, or more reduction of
IC.sub.50 for neutralization of EDIII-DV2 than wt 4E11.
[0172] In some embodiments, the present invention provides antibody
agents with at least 1-fold, 1.5-fold, 2-fold, 5-fold, 10-fold,
20-fold, 30-fold, 40-fold, 50-fold, 60-fold, or more reduction of
IC.sub.50 for neutralization of EDIII-DV1 and/or EDIII-DV3 than wt
4E11.
[0173] In some embodiments, one or more sequences in a provided
antibody agents has been engineered (e.g., by affinity maturation
or other optimization approach) to improve one or more
characteristics or activities (e.g., to increase stability,
decrease aggregation, decrease immunogenicity, etc.) as is known in
the art.
[0174] In some embodiments, an antibody agent is modified by
PEGylation, methylation, sialylation, amination or sulfation. In
some embodiments, an antibody agent is conjugated to an amphiphilic
core/shell to produce a polymeric micelle. In some embodiments, an
antibody agent is conjugated to a hyperbranched macromolecule (i.e.
dendrimer). In some embodiments, an antibody agent is conjugated to
a natural polymer selected from the group consisting of albumin,
chitosan, heparin, paclitaxel, poly-(L-glutamate),
N-(2-hydroxypropyl)methacrylamide (HPMA), poly-(L-lactide) (PLA),
poly(amidoamine) (PAMAM), folate and/or combinations thereof. In
some embodiments, an antibody agent comprises one or more long
unstructured tails of hydrophilic amino acids (rPEG). In some
embodiments, derivatization of immunoglobulins by selectively
introducing sulfhydryl groups in the Fc region of an
immunoglobulin, using reaction conditions that do not alter the
antibody combining site are contemplated. Antibody conjugates
produced according to this methodology may exhibit improved
longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066,
incorporated herein by reference). Site-specific attachment of
effector or reporter molecules, wherein the reporter or effector
molecule is conjugated to a carbohydrate residue in the Fc region
have also been disclosed in the literature (O'Shannessy et al.,
1987).
Antibodies and/or Antibody Fragments
[0175] In some embodiments, a provided DV antibody agent is or
comprises an antibody or fragment thereof. In some embodiments, a
provided DV antibody agent is or comprises a monoclonal antibody or
fragment thereof. In some embodiments, a provided DV antibody agent
is or comprises a polyclonal antibody or fragment thereof. In some
embodiments, the DV antibody agent is or comprises a "full length"
antibody, in that it contains two heavy chains and two light
chains, optionally associated by disulfide bonds as occurs with
naturally-produced antibodies. In some embodiments, the DV antibody
agent is or comprises a fragment of a full-length antibody in that
is contains some, but not all of the sequences found in a
full-length antibody. For example, in some embodiments, a DV
antibody agent is or comprises antibody fragments which include,
but are not limited to, Fab, Fab', F(ab')2, scFv, Fv, dsFv diabody,
and Fd fragments. In some embodiments, a provided DV antibody agent
is or comprises an antibody that is a member of an antibody class
selected from the group consisting of IgG, IgM, IgA, IgD, IgE or
fragment thereof. In some embodiments, a provided DV antibody agent
is or comprises an antibody produced by chemical synthesis. In some
embodiments, a provided DV antibody agent is or comprises an
antibody produced by a cell. In some embodiments, a provided DV
antibody agent is or comprises an antibody produced using a
recombinant cell culture system. In some embodiments, a provided DV
antibody agent is or comprises a chimeric antibody, for example
from mouse, rat, horse, pig, or other species, bearing human
constant and/or variable region domains.
[0176] In some embodiments, a DV antibody agent includes one or
more antibody fragments, including, but not limited to Fab', Fab,
F(ab')2, single domain antibodies (DABs), Fv, scFv (single chain
Fv), polypeptides with antibody CDRs, scaffolding domains that
display the CDRs (e.g., anticalins) or nanobodies. For example, a
provided antibody may be a VHH (i.e., an antigen-specific VHH)
antibody that comprises only a heavy chain. Such antibody molecules
can be derived from a llama or other camelid antibody (e.g., a
camelid IgG2 or IgG3, or a CDR-displaying frame from such camelid
Ig) or from a shark antibody. In some embodiments the DV antibody
agent is or comprises an avibody (diabody, tribody, tetrabody).
Techniques for preparing and using various antibody-based
constructs and fragments are well known in the art. Means for
preparing and characterizing antibodies are also well known in the
art (See, e.g., Antibodies: A Laboratory Manual, Cold Spring Harbor
Laboratory, 1988; incorporated herein by reference).
[0177] In some embodiments, provided DV antibody agent include one
or more "Mini-antibodies" or "minibodies". Minibodies are sFv
polypeptide chains which include oligomerization domains at their
C-termini, separated from the sFv by a hinge region (Pack et al.
(1992) Biochem 31: 1579-1584). The oligomerization domain comprises
self-associating .alpha.-helices, e.g., leucine zippers, that can
be further stabilized by additional disulfide bonds. The
oligomerization domain is designed to be compatible with vectorial
folding across a membrane, a process thought to facilitate in vivo
folding of the polypeptide into a functional binding protein.
Generally, minibodies are produced using recombinant methods well
known in the art. See, e.g., Pack et al. (1992) Biochem 31:
1579-1584; Cumber et al. (1992) J Immunology 149B: 120-126.
Antibody Agent Conjugates
[0178] In some embodiments, a provided DV antibody agent is or
comprises a conjugate, in which an antibody moiety comprises or
consists of the antibody or a functional portion thereof with a
conjugated moiety. In some particular embodiments, DV antibody
agent as described herein are provided and/or utilized in
association with one or more active agents or "payloads", such as a
therapeutic or detection agent. In some such embodiments,
association between the DV antibody agent and the active agent
and/or payload comprises at least one covalent interaction so that
a DV antibody conjugate is provided.
[0179] In some embodiments, an antibody agent is a therapeutic
payload agent is an effector entity having a desired activity,
e.g., anti-viral activity, anti-inflammatory activity, cytotoxic
activity, etc. Therapeutic agents can be or comprise any class of
chemical entity including, for example, proteins, carbohydrates,
lipids, nucleic acids, small organic molecules, non-biological
polymers, metals, ions, radioisotopes, etc. In some embodiments,
therapeutic agents for use in accordance with the present invention
may have a biological activity relevant to the treatment of one or
more symptoms or causes of DV infection (e.g., for example,
anti-viral, pain-relief, anti-inflammatory, immunomodulatory,
sleep-inducing activities, etc). In some embodiments, therapeutic
agents for use in accordance with the present invention have one or
more other activities.
[0180] In some embodiments, an antibody agent is a payload
detection agent that is or comprises any moiety which may be
detected using an assay, for example due to its specific functional
properties and/or chemical characteristics. Non-limiting examples
of such agents include enzymes, radiolabel s, haptens, fluorescent
labels, phosphorescent molecules, chemiluminescent molecules,
chromophores, luminescent molecules, photoaffinity molecules,
colored particles or ligands, such as biotin.
[0181] Many appropriate payload detection agents are known in the
art, as are systems for their attachment to antibodies (see, for
e.g., U .S. Pat. Nos. 5,021,236; 4,938,948; and 4,472,509, each
incorporated herein by reference). Examples of such payload
detection agents include paramagnetic ions, radioactive isotopes,
fluorochromes, NMR-detectable substances, X-ray imaging agents,
among others. For example, in some embodiments, a paramagnetic ion
is one or more of chromium (III), manganese (II), iron (III), iron
(II), cobalt (II), nickel (II), copper (II), neodymium (III),
samarium (III), ytterbium (III), gadolinium (III), vanadium (II),
terbium (III), dysprosium (III), holmium (III), erbium (III),
lanthanum (III), gold (III), lead (II), and/or bismuth (III).
[0182] In some embodiments, a radioactive isotope is one or more of
astatine211, 14carbon, 5lchromium, 36chlorine, 57cobalt, 58cobalt,
copper67, 152Eu, gallium67, 3hydrogen, iodine123, iodine125,
iodine131, indium111, 59iron, 32phosphorus, radium223, rhenium186,
rhenium188, 75selenium, 35sulphur, technicium99m, thorium227 and/or
yttrium90. Radioactively labeled antibody agents may be produced
according to well-known methods in the art. For instance,
monoclonal antibodies can be iodinated by contact with sodium
and/or potassium iodide and a chemical oxidizing agent such as
sodium hypochlorite, or an enzymatic oxidizing agent, such as
lactoperoxidase. Provided antibody agents may be labeled with
technetium99m by ligand exchange process, for example, by reducing
pertechnate with stannous solution, chelating the reduced
technetium onto a Sephadex column and applying the antibody to this
column. In some embodiments, provided DV antibody agents are
labeled using direct labeling techniques, e.g., by incubating
pertechnate, a reducing agent such as SNCl.sub.2, a buffer solution
such as sodium-potassium phthalate solution, and the antibody.
Intermediary functional groups which are often used to bind
radioisotopes which exist as metallic ions to antibody are
diethylenetriaminepentaacetic acid (DTPA) or ethylene
diaminetetracetic acid (EDTA).
[0183] In some embodiments, a fluorescent label is or comprises one
or more of Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY
650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade
Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE,
Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue,
REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET,
Tetramethylrhodamine, and/or Texas Red, among others.
[0184] Several methods are known in the art for the attachment or
conjugation of an antibody agent to a payload. Some attachment
methods involve the use of a metal chelate complex employing, for
example, an organic chelating agent such a
diethylenetriaminepentaacetic acid anhydride (DTPA);
ethylenetriaminetetraacetic acid; N-chloro-p-toluenesulfonamide;
and/or tetrachloro-3.alpha.-6.alpha.-diphenylglycouril-3 attached
to the antibody (U.S. Pat. Nos. 4,472,509 and 4,938,948, each
incorporated herein by reference). Provided DV antibody agents may
also be reacted with an enzyme in the presence of a coupling agent
such as glutaraldehyde or periodate. Conjugates with fluorescein
markers are prepared in the presence of these coupling agents or by
reaction with an isothiocyanate.
Production of Antibodies
[0185] Provided antibody agents including antibodies, and/or
characteristic portions thereof, or nucleic acids encoding them,
may be produced by any available means. Methods for generating
antibodies (e.g., monoclonal antibodies and/or polyclonal
antibodies) are well known in the art. It will be appreciated that
a wide range of animal species can be used for the production of
antisera, including rabbit, mouse, rat, hamster, guinea pig or
goat. The choice of animal may be decided upon the ease of
manipulation, costs or the desired amount of sera, as would be
known to one of skill in the art. It will be appreciated that
antibody agent can also be produced transgenically through the
generation of a mammal or plant that is transgenic for the
immunoglobulin heavy and light chain sequences of interest and
production of the antibody in a recoverable form therefrom. In
connection with the transgenic production in mammals, antibodies
can be produced in, and recovered from, the milk of goats, cows, or
other mammals. See, e.g., U.S. Pat. Nos. 5,827,690, 5,756,687,
5,750,172, and 5,741,957.
[0186] Provided antibody agents (including antibodies and/or
characteristic portions) may be produced, for example, by utilizing
a host cell system engineered to express an inventive
antibody-encoding nucleic acid. Alternatively or additionally,
provided antibody agents may be partially or fully prepared by
chemical synthesis (e.g., using an automated peptide
synthesizer).
[0187] Exemplary sources for antibody agent preparations suitable
for the invention include, but are not limited to, conditioned
culture medium derived from culturing a recombinant cell line that
expresses a protein of interest, or from a cell extract of, e.g.,
antibody-producing cells, bacteria, fungal cells, insect cells,
transgenic plants or plant cells, transgenic animals or animal
cells, or serum of animals, ascites fluid, hybridoma or myeloma
supernatants. Suitable bacterial cells include, but are not limited
to, Escherichia coli cells. Examples of suitable E. coli strains
include: HB101, DH5.alpha., GM2929, JM109, KW251, NM538, NM539, and
any E. coli strain that fails to cleave foreign DNA. Suitable
fungal host cells that can be used include, but are not limited to,
Saccharomyces cerevisiae, Pichia pastoris and Aspergillus cells.
Suitable insect cells include, but are not limited to, S2 Schneider
cells, D. Mel-2 cells, SF9, SF21, High-5.TM., Mimic.TM.-SF9, MG1
and KC1 cells. Suitable exemplary recombinant cell lines include,
but are not limited to, BALB/c mouse myeloma line, human
retinoblasts (PER.C6), monkey kidney cells, human embryonic kidney
line (293), baby hamster kidney cells (BHK), Chinese hamster ovary
cells (CHO), mouse sertoli cells, African green monkey kidney cells
(VERO-76), human cervical carcinoma cells (HeLa), canine kidney
cells, buffalo rat liver cells, human lung cells, human liver
cells, mouse mammary tumor cells, TRI cells, MRC 5 cells, FS4
cells, and human hepatoma line (Hep G2).
[0188] Antibody agents of interest can be expressed using various
vectors (e.g., viral vectors) known in the art and cells can be
cultured under various conditions known in the art (e.g.,
fed-batch). Various methods of genetically engineering cells to
produce antibodies are well known in the art. See e.g. Ausabel et
al., eds. (1990), Current Protocols in Molecular Biology (Wiley,
N.Y.).
[0189] Provided antibody agents may be purified, if desired, using
filtration, centrifugation and/or various chromatographic methods
such as HPLC or affinity chromatography. In some embodiments,
fragments of provided antibody agents are obtained by methods which
include digestion with enzymes, such as pepsin or papain, and/or by
cleavage of disulfide bonds by chemical reduction.
Nucleic Acids
[0190] In certain embodiments, the present invention provides
nucleic acids which encode an antibody agent. In some embodiments,
the invention provides nucleic acids which are complementary to
nucleic acids which encode an antibody agent.
[0191] In some embodiments, the invention provides nucleic acid
molecules which hybridize to nucleic acids encoding an antibody
agent. Such nucleic acids can be used, for example, as primers or
as probes. To give but a few examples, such nucleic acids can be
used as primers in polymerase chain reaction (PCR), as probes for
hybridization (including in situ hybridization), and/or as primers
for reverse transcription-PCR (RT-PCR).
[0192] In certain embodiments, nucleic acids can be DNA or RNA, and
can be single stranded or double-stranded. In some embodiments,
nucleic acids may include one or more non-natural nucleotides; In
some embodiments, nucleic acids include only natural
nucleotides.
Characterization and/or Identification of DV-Related Agents
[0193] In some embodiments, the present invention provides antibody
agents that can be used to identify and/or characterize one or more
agents that mimic an DV epitope or agent and/or induce a strong
antibody response to DV.
[0194] In some embodiments, such agents include one or more
antibody-like binding peptidomimetics. Liu et al. Cell Mol Biol
(Noisy-le-grand). 2003 March; 49(2): 209-16 describe "antibody like
binding peptidomimetics" (ABiPs), which are peptides that act as
pared-down antibodies and have certain advantages of longer serum
half-life as well as less cumbersome synthesis methods. Likewise,
in some aspects, antibody-like molecules are cyclic or bicyclic
peptides. For example, methods for isolating antigen-binding
bicyclic peptides (e.g., by phage display) and for using the such
peptides are provided in U.S. Patent Pub. No. 20100317547,
incorporated herein by reference.
[0195] In some embodiments, such agents include one or more
antibody-like binding scaffold proteins. For example, in some
embodiments, one or more CDRs arising from an antibody may be
grafted onto a protein scaffold. In general, protein scaffolds may
meet the greatest number of the following criteria: (Skerra A., J.
Mol. Recogn., 2000, 13: 167-187): good phylogenetic conservation;
known three-dimensional structure (as, for example, by
crystallography, NMR spectroscopy or any other technique known to a
person skilled in the art); small size; few or no
post-transcriptional modifications; and/or easy to produce, express
and purify. The origin of such protein scaffolds can be, but is not
limited to, fibronectin (e.g., fibronectin type III domain 10),
lipocalin, anticalin (Skerra A., J. Biotechnol., 2001, 74(4):
257-75), protein Z arising from domain B of protein A of
Staphylococcus aureus, thioredoxin A or proteins with a repeated
motif such as the "ankyrin repeat" (Kohl et al., PNAS, 2003, vol.
100, No. 4, 1700-1705), the "armadillo repeat", the "leucine-rich
repeat" and the "tetratricopeptide repeat". For example, anticalins
or lipocalin derivatives are described in US Patent Publication
Nos. 20100285564, 20060058510, 20060088908, 20050106660, and PCT
Publication No. WO2006/056464, incorporated herein by reference.
Scaffolds derived from toxins such as, for example, toxins from
scorpions, insects, plants, mollusks, etc., and the protein
inhibitors of neuronal NO synthase (PIN) may also be used in
accordance with the present invention.
[0196] In some embodiments, such agents include a mimotope, which
can be used to disrupt the interaction between an influenza virus
and the HA polypeptide receptor. In some embodiment, the mimotope
is used to elicit an antibody response identical or similar to the
that elicited by its corresponding target epitope. In some
embodiments, the target epitope is a sequence that is conserved
across more than one DV serotype. In some embodiment, the conserved
epitope is a sequence that is conserved across DV serotypes 1-4. In
some embodiments, the epitope is a conserved sequence located
within the A-strand region of the E glycoprotein. In some
embodiments, a mimotope is a peptide. In some embodiments, a
mimotope is a small molecule, carbohydrate, lipid, or nucleic acid.
In some embodiments, mimotopes are peptide or non-peptide mimotopes
of conserved influenza epitopes. In some embodiments, by mimicking
the structure of a defined viral epitope, a mimotope interferes
with the ability of DV particles to bind to its natural binding
partners, e.g., by binding to the natural binding partner
itself.
[0197] In some embodiments, such an agent is a stapled peptide. In
some embodiments, the stapled peptide comprises an amino acid
sequences encoding one or more CDRs and/or FRs comprising at least
greater than 65, 70, 75, 80, 85, 86, 87, 88, 89, 90, 91, 92, 93,
94, 95, 96, 97, 98 or 99% homology and/or identity with the
corresponding CDRs and/or FRs of an anti-DV antibody (e.g., 4E11).
In some embodiments, the stapled peptide comprises an amino acid
sequence encoding one or more VH and/or VL chain sequence
comprising at least greater than 65, 70, 75, 80, 85, 86, 87, 88,
89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% homology and/or
identity with the corresponding VH and VL chains of an anti-DV
antibody (e.g., 4E11).
[0198] In certain embodiments, such an agent is or comprise a
nucleic acid, such as DNA or RNA. In certain embodiments, nucleic
acids can be DNA or RNA, and can be single stranded or
double-stranded. In some embodiments, nucleic acids may include one
or more non-natural nucleotides. In some embodiments, nucleic acids
include only natural nucleotides. In some embodiments the nucleic
acid is designed to mimic an epitope within a DV polypeptide. In
some embodiments the nucleic acid is designed to mimic a conserved
epitope within one or more DV serotypes. In some embodiments, such
an agent is or comprises one or more oligonucleotides. In some
embodiments, such an agent is or comprises one or more
oligonucleotides comprising a secondary structure such as loop,
hairpin, fold or combinations thereof. In some embodiments, such an
agent is or comprises one or more oligonucleotides comprising a
higher ordered (tertiary or quaternary) structure. In some
embodiments, such an agent is or comprises an aptamer.
[0199] In some embodiments, a vaccine may be designed to induce
production of antibodies that have been found to be lacking in the
patient. In some embodiments, it is desirable for vaccine
compositions to comprise antigens that have a native conformation,
mediate a protective response (e.g., complement activation, virus
neutralization, etc.), and/or can induce a strong antibody
response. In some embodiments, a vaccine contains an epitope or
mimotope thereof to which antibodies are not being produced
naturally in the individual. For example, synthetic peptide
mimotopes isolated with DV antibodies (e.g., DV antibodies
recognizing multiple serotypes) have the potential to induce a
potent immune response similar to the antibody used in the original
isolation of the mimotope. Administration of such a vaccine might
induce a patient's immune system to start producing a set of
antibodies directed against the administered epitope. It will be
appreciated that the mimotopes (or epitopes) in accordance with the
invention can be used alone or in combination with recombinant
proteins, inactivated DV virus, killed DV virus, and/or as a
cocktail of several different mimotopes.
[0200] In some embodiments, vaccines to DV may be utilized for
active immunization (i.e., immunization wherein microbes, proteins,
peptides, epitopes, mimotopes, etc. are administered to a subject).
In some embodiments, vaccines to DV may comprise any agent that
mimics at least one conformational epitope of DV A-strand region of
DV envelope glycoprotein may be used. For example, the agent may be
a peptide, protein, glycopeptide, glycoprotein, small molecule,
mimotope, organic compound, lipid, saccharide, organometallic
compound, inorganic compound, etc. In some embodiments, epitopes
represented in a vaccine include those against which antibodies
known to prevent infection are directed. In some embodiments,
epitopes represented in a vaccine in accordance with the invention
include ones that are conserved among different genotypes and/or
subtypes of the virus or among different strains of virus. In some
embodiments, peptides or proteins that contain conformationally
defined epitopes of A-strand region of DV are used in formulations
of a vaccine to prevent, delay onset of, treat, ameliorate symptoms
of, and/or reduce severity of infection by DV. In some embodiments,
DV A-strand region epitopes may be linear epitopes. In some
embodiments, A-strand region epitopes may be a mixture of linear
and conformational epitopes. In some embodiments, A-strand region
epitopes may be conformational epitopes. In some embodiments,
peptide epitopes are less than 100 amino acids in length. In
certain embodiments, peptide epitopes are less than 50, less than
40, less than 30, less than 20, or less than 10 amino acids in
length. In some embodiments, peptides to be used in formulating a
vaccine are peptide fragments of A-strand region protein of DV.
Typically, a peptide is used that folds in a manner similar to its
three-dimensional fold in the native A-strand region protein, thus
preserving the three-dimensional structure of the conformational
epitope.
Systems for Identifying and/or Characterizing DV-Binding Agents
[0201] The present invention provides a variety of systems for
testing, characterizing, and/or identifying DV antibody agents. In
some embodiments, provided DV antibody agent are used to identify
and/or to characterize other DV-binding agents (e.g., antibodies,
polypeptides, small molecules, etc.).
[0202] In some embodiments, provided DV-binding agents are
characterized by such systems and methods that involve contacting
the DV-binding agent with one or more candidate substrates, such as
regions of DV polypeptides, N-glycans on DV polypeptides, DV
receptors, sialylated DV receptors, and/or glycans on sialylated DV
receptors.
[0203] In some embodiments, DV-binding agents (e.g., cross reactive
antibodies) may be tested, characterized, and/or identified using
computational approaches. In some embodiments, a computational
approach involves using physicochemical features common to
protein-protein (e.g., antibody-antigen) interactions to predict
protein-protein interaction and affinity enhancing mutations.
Potency of antibodies, for example, produced using this approach in
neutralizing DV could then be predicted by various assays known in
the art (e.g., plaque reduction neutralization test, ELISA,
hemagglutination assay, and Western blot).
[0204] In some embodiments, a DV-binding agent and/or candidate
substrate may be free in solution, fixed to a support, and/or
expressed in and/or on the surface of a cell. The candidate
substrate and/or agents may be labeled, thereby permitting
detection of binding. Either the DV-binding agent or the candidate
substrate is the labeled species. Competitive binding formats may
be performed in which one of the substances is labeled, and one may
measure the amount of free label versus bound label to determine
the effect on binding.
[0205] In some embodiments, binding assays involve, for example,
exposing a candidate substrate to a DV-binding agent and detecting
binding between the candidate substrate and the agent. A binding
assay may be conducted in vitro (e.g., in a candidate tube,
comprising substantially only the components mentioned; in
cell-free extracts; and/or in substantially purified components).
Alternatively or additionally, binding assays may be conducted in
cyto and/or in vivo (e.g., within a cell, tissue, organ, and/or
organism; described in further detail below).
[0206] In certain embodiments, at least one DV-binding agent is
contacted with at least one candidate substrate and an effect
detected. In some embodiments, for example, a DV-binding agent is
contacted with a candidate substrate, and binding between the two
entities is monitored. In some embodiments, an assay may involve
contacting a candidate substrate with a characteristic portion of
an agent. Binding of the DV agent to the candidate substrate is
detected. It will be appreciated that fragments, portions,
homologs, variants, and/or derivatives of DV-binding agents may be
employed, provided that they comprise the ability to bind one or
more candidate substrates.
[0207] Binding of a DV agent to the candidate substrate may be
determined by a variety of methods well-known in the art. In some
embodiments, binding measurements may be conducted using SPR
analysis. In some embodiments, SPR analysis may be used to measure
affinity and kinetic binding parameters of a DV-binding agent. In
some embodiments, assays involving solid phase-bound DV agents and
detecting their interactions with one or more candidate substrates
may be used. Thus, a DV-binding agent may comprise a detectable
marker, such as a radioactive, fluorescent, and/or luminescent
label. Furthermore, candidate substrate can be coupled to
substances which permit indirect detection (e.g. by means of
employing an enzyme which uses a chromogenic substrate and/or by
means of binding a detectable antibody). Changes in the
conformation of DV-binding agents as the result of an interaction
with a candidate substrate may be detected, for example, by the
change in the emission of the detectable marker. Alternatively or
additionally, solid phase-bound protein complexes may be analyzed
by means of mass spectrometry.
[0208] In some embodiments, the DV-binding agent can be
non-immobilized. In some embodiments, the non-immobilized component
may be labeled (with for example, a radioactive label, an epitope
tag, an enzyme-antibody conjugate, etc.). Alternatively or
additionally, binding may be determined by immunological detection
techniques. For example, the reaction mixture may be subjected to
Western blotting and the blot probed with an antibody that detects
the non-immobilized component. Alternatively or additionally, ELISA
may be utilized to assay for binding. In some embodiments, binding
affinity of a DV agent to a candidate substrate may be determined
by using a high throughput indirect ELISA assay.
[0209] In some embodiments, focus reduction neutralization test
(FRNT) assay may be utilized for measuring activity or neutralizing
potency of a DV-binding agent. In some embodiments, animal host may
be used for measuring anti-DV activity in vivo.
[0210] In certain embodiments, cells may be directly assayed for
binding between DV agents and candidate substrates.
Immunohistochemical techniques, confocal techniques, and/or other
techniques to assess binding are well known to those of skill in
the art. Various cell lines may be utilized for such screening
assays, including cells specifically engineered for this purpose.
Examples of cells used in the screening assays include mammalian
cells, fungal cells, bacterial cells, or viral cells. A cell may be
a stimulated cell, such as a cell stimulated with a growth factor.
One of skill in the art would understand that the invention
disclosed herein contemplates a wide variety of in cyto assays for
measuring the ability of DV-binding agents to bind to candidate
substrates.
[0211] Depending on the assay, cell and/or tissue culture may be
required. A cell may be examined using any of a number of different
physiologic assays. Alternatively or additionally, molecular
analysis may be performed, including, but not limited to, western
blotting to monitor protein expression and/or test for
protein-protein interactions; mass spectrometry to monitor other
chemical modifications; etc.
[0212] In some embodiments, a binding assays described herein may
be performed using a range of concentrations of DV-binding agents
and/or candidate substrates. In some embodiments, the binding
assays described herein are used to assess the ability of a
candidate substrate to bind to a DV agent over range of antibody
concentrations (e.g. greater than about 100 .mu.g/ml, about 100
.mu.g/ml, about 50 .mu.g/ml, about 40 .mu.g/ml, about 30 .mu.g/ml,
about 20 .mu.g/ml, about 10 .mu.g/ml, about 5 .mu.g/ml, about 4
.mu.g/ml, about 3 .mu.g/ml, about 2 .mu.g/ml, about 1.75 .mu.g/ml,
about 1.5 .mu.g/ml, about 1.25 .mu.g/ml, about 1.0 .mu.g/ml, about
0.9 .mu.g/ml, about 0.8 .mu.g/ml, about 0.7 .mu.g/ml, about 0.6
.mu.g/ml, about 0.5 .mu.g/ml, about 0.4 .mu.g/ml, about 0.3
.mu.g/ml, about 0.2 .mu.g/ml, about 0.1 .mu.g/ml, about 0.05
.mu.g/ml, about 0.01 .mu.g/ml, and/or less than about 0.01
.mu.g/ml).
[0213] In some embodiments, any of the binding studies described
herein can be executed in a high throughput fashion. Using high
throughput assays, it is possible to screen up to several thousand
agents in a single day. In some embodiments, each well of a
microtiter plate can be used to run a separate assay against a
selected candidate substrate, or, if concentration and/or
incubation time effects are to be observed, every 5-10 wells can
test a single candidate substrate. Thus, a single standard
microtiter plate can assay up to 96 binding interactions between
agents and candidate substrates; if 1536 well plates are used, then
a single plate can assay up to 1536 binding interactions between
agents and candidate substrates; and so forth. It is possible to
assay many plates per day. For example, up to about 6,000, about
20,000, about 50,000, or more than about 100,000 assay screens can
be performed on binding interactions between antibodies and
candidate substrates using high throughput systems in accordance
with the present invention.
[0214] In some embodiments, such methods utilize an animal host. As
used herein, an "animal host" includes any animal model suitable
for influenza research. For example, animal hosts suitable for the
invention can be any mammalian hosts, including primates, ferrets,
cats, dogs, cows, horses, rodents such as, mice, hamsters, rabbits,
and rats. In certain embodiments, an animal host used for the
invention is a ferret. In particular, in some embodiments, an
animal host is naive to viral exposure or infection prior to
administration of an agent (optionally in an inventive
composition). In some embodiments, the animal host is inoculated
with, infected with, or otherwise exposed to virus prior to or
concurrent with administration of an agent. An animal host used in
the practice of the present invention can be inoculated with,
infected with, or otherwise exposed to virus by any method known in
the art. In some embodiments, an animal host may be inoculated
with, infected with, or exposed to virus intranasally.
[0215] Naive and/or inoculated animals may be used for any of a
variety of studies. For example, such animal models may be used for
virus transmission studies as in known in the art. It is
contemplated that the use of ferrets in virus transmission studies
may serve as a reliable predictor for virus transmission in humans.
Virus transmission studies may be used to test agents. For example,
DV-binding agents may be administered to a suitable animal host
before, during or after virus transmission studies in order to
determine the efficacy of said agent in blocking virus binding
and/or infectivity in the animal host. Using information gathered
from virus transmission studies in an animal host, one may predict
the efficacy of an agent in blocking virus binding and/or
infectivity in a human host.
Pharmaceutical Compositions
[0216] The present invention provides compositions comprising one
or more provided antibody agents. In some embodiments the present
invention provides at least one antibody and at least one
pharmaceutically acceptable excipient. Such pharmaceutical
compositions may optionally comprise and/or be administered in
combination with one or more additional therapeutically active
substances. In some embodiments, provided pharmaceutical
compositions are useful in medicine. In some embodiments, provided
pharmaceutical compositions are useful as prophylactic agents
(i.e., vaccines) in the treatment or prevention of DV infection or
of negative ramifications associated or correlated with DV
infection. In some embodiments, provided pharmaceutical
compositions are useful in therapeutic applications, for example in
individuals suffering from or susceptible to DV infection. In some
embodiments, pharmaceutical compositions are formulated for
administration to humans.
[0217] For example, pharmaceutical compositions provided herein may
be provided in a sterile injectible form (e.g., a form that is
suitable for subcutaneous injection or intravenous infusion). For
example, in some embodiments, pharmaceutical compositions are
provided in a liquid dosage form that is suitable for injection. In
some embodiments, pharmaceutical compositions are provided as
powders (e.g. lyophilized and/or sterilized), optionally under
vacuum, which are reconstituted with an aqueous diluent (e.g.,
water, buffer, salt solution, etc.) prior to injection. In some
embodiments, pharmaceutical compositions are diluted and/or
reconstituted in water, sodium chloride solution, sodium acetate
solution, benzyl alcohol solution, phosphate buffered saline, etc.
In some embodiments, powder should be mixed gently with the aqueous
diluent (e.g., not shaken).
[0218] In some embodiments, provided pharmaceutical compositions
comprise one or more pharmaceutically acceptable excipients (e.g.,
preservative, inert diluent, dispersing agent, surface active agent
and/or emulsifier, buffering agent, etc.). In some embodiments,
pharmaceutical compositions comprise one or more preservatives. In
some embodiments, pharmaceutical compositions comprise no
preservative.
[0219] In some embodiments, pharmaceutical compositions are
provided in a form that can be refrigerated and/or frozen. In some
embodiments, pharmaceutical compositions are provided in a form
that cannot be refrigerated and/or frozen. In some embodiments,
reconstituted solutions and/or liquid dosage forms may be stored
for a certain period of time after reconstitution (e.g., 2 hours,
12 hours, 24 hours, 2 days, 5 days, 7 days, 10 days, 2 weeks, a
month, two months, or longer).
[0220] Liquid dosage forms and/or reconstituted solutions may
comprise particulate matter and/or discoloration prior to
administration. In some embodiments, a solution should not be used
if discolored or cloudy and/or if particulate matter remains after
filtration.
[0221] Formulations of the pharmaceutical compositions described
herein may be prepared by any method known or hereafter developed
in the art of pharmacology. In some embodiments, such preparatory
methods include the step of bringing active ingredient into
association with one or more excipients and/or one or more other
accessory ingredients, and then, if necessary and/or desirable,
shaping and/or packaging the product into a desired single- or
multi-dose unit.
[0222] A pharmaceutical composition in accordance with the
invention may be prepared, packaged, and/or sold in bulk, as a
single unit dose, and/or as a plurality of single unit doses. As
used herein, a "unit dose" is discrete amount of the pharmaceutical
composition comprising a predetermined amount of the active
ingredient. The amount of the active ingredient is generally equal
to a dose which would be administered to a subject and/or a
convenient fraction of such a dose such as, for example, one-half
or one-third of such a dose.
[0223] Relative amounts of active ingredient, pharmaceutically
acceptable excipient, and/or any additional ingredients in a
pharmaceutical composition in accordance with the invention may
vary, depending upon the identity, size, and/or condition of the
subject treated and/or depending upon the route by which the
composition is to be administered. By way of example, the
composition may comprise between 0.1% and 100% (w/w) active
ingredient.
[0224] Pharmaceutical compositions of the present invention may
additionally comprise a pharmaceutically acceptable excipient,
which, as used herein, may be or comprise solvents, dispersion
media, diluents, or other liquid vehicles, dispersion or suspension
aids, surface active agents, isotonic agents, thickening or
emulsifying agents, preservatives, solid binders, lubricants and
the like, as suited to the particular dosage form desired.
Remington's The Science and Practice of Pharmacy, 21st Edition, A.
R. Gennaro, (Lippincott, Williams & Wilkins, Baltimore, Md.,
2006) discloses various excipients used in formulating
pharmaceutical compositions and known techniques for the
preparation thereof. Except insofar as any conventional excipient
medium is incompatible with a substance or its derivatives, such as
by producing any undesirable biological effect or otherwise
interacting in a deleterious manner with any other component(s) of
the pharmaceutical composition, its use is contemplated to be
within the scope of this invention.
Vaccines
[0225] In some embodiments, the present invention provides vaccine
compositions for use, and/or for exam in passive immunization
(i.e., immunization wherein antibodies are administered to a
subject) of a subject who is suffering from or susceptible to DV
infection. In some embodiments, passive immunization occurs when
antibodies are transferred from mother to fetus during pregnancy.
In some embodiments, passive immunization includes administration
of antibody agents directly to an individual (e.g., by injection,
orally, nasally, etc.).
[0226] In some embodiments, prophylactic applications may include
administering vaccines. In some embodiments, vaccination is
tailored to the individual patient. For example, as described
below, serum may be collected from a patient and tested for
presence of DV, and in some embodiments for one or more particular
DV serotypes. In some embodiments, appropriate recipients of
provided vaccines are individuals suffering from or susceptible to
infection with one or more DV serotypes bound and/or neutralized by
a provided antibody.
[0227] In some embodiments, a vaccine is administered orally,
intranasally, subcutaneously, intramuscularly, intradermally, or
via any other medically-appropriate route of administration. It
will be appreciated that each route of administration may require
distinct formulations or delivery mechanisms and such variable
parameters are contemplated as within the scope of the present
invention. In some embodiments, the route of administration and/or
formulation may be dictated in part by the age and/or condition of
the subject. For example, administration of a vaccine to a baby may
be performed via injection to the anterolateral aspect of the
thigh, due to the large muscle mass. In some embodiments, where the
subject is a child or an adult, administration of a vaccine to the
deltoid muscle may be preferred. It is understood that sounds
medical judgment should be used to determine the proper route
and/or formulation for administration to a particular subject.
[0228] In some embodiments, a vaccine composition comprises at
least one adjuvant. Any adjuvant may be used in accordance with the
present invention. A large number of adjuvants are known; a useful
compendium of many such compounds is prepared by the National
Institutes of Health and can be found on
www.niaid.nih.gov/daids/vaccine/pdf/compendium.pdf; see also
Allison (1998, Dev. Biol. Stand., 92: 3-11; incorporated herein by
reference), Unkeless et al. (1998, Annu. Rev. Immunol., 6: 251-281;
incorporated herein by reference), and Phillips et al. (1992,
Vaccine, 10: 151-158; incorporated herein by reference). Hundreds
of different adjuvants are known in the art and could be employed
in the practice of the present invention. Exemplary adjuvants that
can be utilized in accordance with the invention include, but are
not limited to, cytokines, gel-type adjuvants (e.g., aluminum
hydroxide, aluminum phosphate, calcium phosphate, etc.); microbial
adjuvants (e.g., immunomodulatory DNA sequences that include CpG
motifs; endotoxins such as monophosphoryl lipid A; exotoxins such
as cholera toxin, E. coli heat labile toxin, and pertussis toxin;
muramyl dipeptide, etc.); oil-emulsion and emulsifier-based
adjuvants (e.g., Freund's Adjuvant, MF59 [Novartis], SAF, etc.);
particulate adjuvants (e.g., liposomes, biodegradable microspheres,
saponins, etc.); synthetic adjuvants (e.g., nonionic block
copolymers, muramyl peptide analogues, polyphosphazene, synthetic
polynucleotides, etc.); and/or combinations thereof. Other
exemplary adjuvants include some polymers (e.g., polyphosphazenes;
described in U.S. Pat. No. 5,500,161, which is incorporated herein
by reference), Q57, QS21, squalene, tetrachlorodecaoxide, etc.
Pharmaceutically acceptable excipients have been previously
described in further detail in the above section entitled
"Pharmaceutical Compositions."
Combination Therapy
[0229] It will be appreciated that DV antibody agents in accordance
with the present invention and/or pharmaceutical compositions
thereof can be employed in combination therapies. By "in
combination with," it is not intended to imply that the agents must
be administered at the same time and/or formulated for delivery
together, although these methods of delivery are within the scope
of the invention. Compositions can be administered concurrently
with, prior to, or subsequent to, one or more other desired
therapeutics or medical procedures. In will be appreciated that
therapeutically active agents utilized in combination may be
administered together in a single composition or administered
separately in different compositions. In general, each agent will
be administered at a dose and/or on a time schedule determined for
that agent.
[0230] The particular combination of therapies (e.g., therapeutics
or procedures) to employ in a combination regimen will take into
account compatibility of the desired therapeutics and/or procedures
and the desired therapeutic effect to be achieved. It will also be
appreciated that pharmaceutical compositions of the present
invention can be employed in combination therapies (e.g.,
combination vaccine therapies), that is, the pharmaceutical
compositions can be administered concurrently with, prior to, or
subsequent to, one or more other desired therapeutic and/or
vaccination procedures.
[0231] Therapeutically effective amounts of antibody agents in
accordance with the invention combined with for use in combination
with a provided pharmaceutical composition and at least one other
active ingredient. In some embodiments, an active ingredient is an
anti-viral agent, such as, but not limited to, interferons (e.g.,
interferon .alpha.-2b, interferon-.gamma., etc.), anti-DV
monoclonal antibodies, anti-DV polyclonal antibodies, RNA
polymerase inhibitors, protease inhibitors, helicase inhibitors,
immunomodulators, antisense compounds, short interfering RNAs,
short hairpin RNAs, micro RNAs, RNA aptamers, ribozymes, and
combinations thereof. The particular combination of therapies to
employ in a combination regimen will generally take into account
compatibility of the desired therapeutics and/or procedures and the
desired therapeutic effect to be achieved. It will also be
appreciated that the therapies and/or vaccines employed may achieve
a desired effect for the same disorder (for example, an inventive
antigen may be administered concurrently with another DV vaccine),
or they may achieve different effects.
[0232] It will be appreciated that the therapies employed may
achieve a desired effect for the same purpose (for example, DV
antibodies useful for treating, preventing, and/or delaying the
onset of DV infection may be administered concurrently with another
agent useful for treating, preventing, and/or delaying the onset of
DV infection), or they may achieve different effects (e.g., control
of any adverse effects). The invention encompasses the delivery of
pharmaceutical compositions in combination with agents that may
improve their bioavailability, reduce and/or modify their
metabolism, inhibit their excretion, and/or modify their
distribution within the body.
[0233] In some embodiments, agents utilized in combination with be
utilized at levels that do not exceed the levels at which they are
utilized individually. In some embodiments, the levels utilized in
combination will be lower than those utilized individually.
[0234] In some embodiments, DV antibodies in accordance with the
invention may be administered with interferon, with RNA polymerase
inhibitors, or with both interferon and RNA polymerase
inhibitors.
[0235] In some embodiments, combination therapy may involve
administrations of a plurality of antibody agents directed to a
single epitope (e.g. a single conformational epitope). In some
embodiments, combination therapy can comprise a plurality of
antibody agents that recognize distinct epitopes (e.g., on the same
viral envelope protein or on different viral envelope proteins,
where epitopes may or may not be conformational), for example to
simultaneously interfere with multiple mechanisms in the infectious
process.
[0236] In certain embodiments, compositions in accordance with the
invention comprise exactly one antibody agent to A-strand region.
In certain embodiments, compositions include and/or combination
therapy utilize exactly two DV A-strand region antibody agents.
[0237] It will be appreciated by one of skill in the art that any
permutation or combination of antibody agents in accordance with
the present invention can be combined with any other antibody agent
to formulate compositions and/or combination therapy regimens
comprising a plurality of different antibody agents.
Methods of Administration
[0238] DV antibody agents in accordance with the invention and
pharmaceutical compositions thereof in accordance with the present
invention may be administered according to any appropriate route
and regimen. In some embodiments, a route or regimen is one that
has been correlated with a positive therapeutic benefit. In some
embodiments, a route or regimen is one that has been approved by
the FDA and/or EP.
[0239] In some embodiments, the exact amount administered may vary
from subject to subject, depending on one or more factors as is
well known in the medical arts. Such factors may include, for
example, one or more of species, age, general condition of the
subject, severity of the infection, particular composition, its
mode of administration, its mode of activity, the disorder being
treated and the severity of the disorder; the activity of the
specific DV antibody agent employed; the specific pharmaceutical
composition administered; the half-life of the composition after
administration; the age, body weight, general health, sex, and diet
of the subject; the time of administration, route of
administration, and rate of excretion of the specific compound
employed; the duration of the treatment; drugs used in combination
or coincidental with the specific compound employed and the like.
Pharmaceutical compositions may be formulated in dosage unit form
for ease of administration and uniformity of dosage. It will be
understood, however, that the total daily usage of the compositions
of the present invention will be decided by the attending physician
within the scope of sound medical judgment.
[0240] Pharmaceutical compositions of the present invention may be
administered by any route, as will be appreciated by those skilled
in the art. In some embodiments, pharmaceutical compositions of the
present invention are administered by oral (PO), intravenous (IV),
intramuscular (IM), intra-arterial, intramedullary, intrathecal,
subcutaneous (SQ), intraventricular, transdermal, interdermal,
intradermal, rectal (PR), vaginal, intraperitoneal (IP),
intragastric (IG), topical (e.g., by powders, ointments, creams,
gels, lotions, and/or drops), mucosal, intranasal, buccal, enteral,
vitreal, sublingual; by intratracheal instillation, bronchial
instillation, and/or inhalation; as an oral spray, nasal spray,
and/or aerosol, and/or through a portal vein catheter.
[0241] In specific embodiments, DV antibody agents in accordance
with the present invention and/or pharmaceutical compositions
thereof may be administered intravenously, for example, by
intravenous infusion. In specific embodiments, DV antibody agents
in accordance with the present invention and/or pharmaceutical
compositions thereof may be administered by intramuscular
injection. In specific embodiments, DV antibody agents in
accordance with the present invention and/or pharmaceutical
compositions thereof may be administered by subcutaneous injection.
In specific embodiments, DV antibody agents in accordance with the
present invention and/or pharmaceutical compositions thereof may be
administered via portal vein catheter. However, the invention
encompasses the delivery of DV antibody agents in accordance with
the present invention and/or pharmaceutical compositions thereof by
any appropriate route taking into consideration likely advances in
the sciences of drug delivery.
[0242] In certain embodiments, DV antibody agents in accordance
with the present invention and/or pharmaceutical compositions
thereof in accordance with the invention may be administered at
dosage levels sufficient to deliver from about 0.001 mg/kg to about
100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, from about 0.1
mg/kg to about 40 mg/kg, from about 0.5 mg/kg to about 30 mg/kg,
from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to
about 10 mg/kg, or from about 1 mg/kg to about 25 mg/kg of subject
body weight per day to obtain the desired therapeutic effect. The
desired dosage may be delivered more than three times per day,
three times per day, two times per day, once per day, every other
day, every third day, every week, every two weeks, every three
weeks, every four weeks, every two months, every six months, or
every twelve months. In certain embodiments, the desired dosage may
be delivered using multiple administrations (e.g., two, three,
four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen,
fourteen, or more administrations).
Prophylactic Applications
[0243] In some embodiments, DV antibody agents in accordance with
the invention may be utilized for prophylactic applications. In
some embodiments, prophylactic applications involve systems and
methods for preventing, inhibiting progression of, and/or delaying
the onset of DV infection, and/or any other DV-associated condition
in individuals susceptible to and/or displaying symptoms of DV
infection. In some embodiments, prophylactic applications involve
systems and methods for preventing, inhibiting progression of,
and/or delaying the onset of infection of the brain. In some
embodiments, prophylactic applications involve systems and methods
for preventing, inhibiting progression of, and/or delaying the
impairment of vital organs (e.g., liver).
Diagnostic Applications
[0244] In some embodiments, DV antibody agents in accordance with
the invention are used for diagnostic applications. For example, by
virtue of the variety of binding profiles of DV antibody agents,
diagnostic assays may be employed which will detect a plurality of
DV serotypes, so as to provide a pan-DV antibody agent, while at
the same time being able to dissect individual serotypes by
subtractive analysis.
[0245] For diagnostic purposes, antibody agents may be used in a
wide variety of formats for detecting A-strand region of envelope
glycoprotein, discerning DV serotypes, detecting virions and
antibodies (see, e.g., U.S. Pat. No. 5,695,390; incorporated herein
by reference). Antibody agents may be used individually or in
combination with other antibodies of the subject group or other
antibodies or with lectins which bind to the glycosyl groups
present on DV envelope proteins. For diagnostic purposes, a wide
variety of labels may be employed, which for the most part have
been mentioned previously. These include, but are not limited to,
fluorophores, chemiluminescent moieties, radioisotopes, enzymes,
particles (e.g., colloidal carbon particles, gold particles, latex
particles, etc.) ligands for which there are high affinity
receptors, and prolabels, which can be activated to provide a
detectable signal.
[0246] In some embodiments, a surface is coated with a protein,
which can bind to DV antigens as free protein (e.g., circulating
proteins) or as part of an intact or partially intact virion. One
may use antibodies of the subject invention which bind to multiple
DV serotypes or to lectins (e.g., Galanthus nivalis lectin;
"GNA").
[0247] In some embodiments, assays may involve contacting a surface
with a medium, which may contain free or DV-associated protein(s),
where the medium may be the sample or a solution of known A-strand
region of one or more serotypes. After incubation and washing to
remove non-specifically bound protein, the assay may proceed in
various manners depending upon what is being assayed. Where a blood
sample suspected of being seropositive is being assayed, the sample
may be applied to the layer of A-strand region protein, incubated,
and washed, and the presence of human antibodies bound to the
protein layer determined. One may use labeled .alpha.-human
antibodies (other than against the isotype of the subject
antibodies, where the subject antibodies have been initially used).
In assays for antibodies in seropositive subjects, subject
antibodies may be used as controls with the same reagent used to
detect any human anti-DV antibodies in the sera of such subjects.
The specificity of the antibodies in the sample can be confirmed by
using the subject antibodies, which are differentially labeled from
the anti-human antibodies and determine whether they are blocked by
the antibodies in the sample.
[0248] Where the sample is assayed for DV A-strand region protein,
detection employs labeled subject antibodies, the selection
depending upon whether one is interested in genotyping or detection
of A-strand region protein. After washing away non-specifically
bound antibody, the presence of labeled antibodies is determined by
detecting the presence of the label in accordance with known
techniques. Alternatively or additionally, where the subject
antibodies are bound to a surface, a labeled lectin for A-strand
region may be employed to detect the presence of A-strand region
protein.
[0249] Antibody agents in accordance with the invention can be used
to measure the reactivity of other antibodies, including antibodies
in sera, monoclonal antibodies, antibodies expressed as a result of
genetic engineering, etc. In some embodiments, intact virions are
used. In some embodiments, conformationally conserved envelope
proteins are used. For virion capture, see, for example, Kimura et
al., 1998, J. Med. Virology, 56: 25-32; Morita et al., 1996,
Hapato-Gastroenterology, 43: 582-585; Sata et al., 1993, Virology,
196: 354-357; and Hijikata et al., 1993, J. Virol., 67: 1953-1958;
all of which are incorporated herein by reference. One protocol
involves steps of coating a solid support with a lectin (e.g., GNA)
and then contacting the surface with a medium (e.g., serum of a
seropositive patient) comprising intact DV virions. Additives which
might destroy virions should usually be avoided (e.g., detergents).
After incubating the medium and washing to remove non-specifically
bound components of the medium, virions may be contacted with
antibodies in accordance with the invention and antibodies of the
sample. This may be performed concurrently or consecutively, where
the sample is added first. An amount of the subject antibody is
used which is sensitive to displacement by another antibody. Such
amount may be determined empirically, and one may wish to use
different amounts of the subject antibody in a series of tests. By
knowing the signal, which is obtained in the absence and presence
of the sample, one can determine the reactivity or binding affinity
of the antibodies in the sample. Various techniques may be used to
determine the amount of a subject antibody bound to the virions.
Where the subject antibodies are labeled, e.g., with biotin or
digoxigenin, streptavidin or anti-digoxigenin labeled with a
fluorophore or enzyme whose substrate produces a detectable signal
can serve to determine the amount of the subject antibodies.
[0250] Labeled subject antibody agents may be used in assaying for
the presence of DV from biopsy material. Labeled antibody may be
incubated with immobilized biopsy material, such as a liver slice,
with a solution of one or more of the subject labeled antibodies.
After washing away non-specifically bound antibodies, the presence
of the antibodies bound to the cells of the biopsied tissue may be
detected in accordance with the nature of the label.
[0251] In some embodiments, DV antibody agents in accordance with
the invention can be used to identify DV receptors. Those skilled
in the art will appreciate the multitude of ways this can be
accomplished (Sambrook J., Fritsch E. and Maniatis T. Molecular
Cloning: A Laboratory Manual. Cold Spring Harbor Press, Cold Spring
Harbor, N.Y., 1989; and Ausubel et al., eds., Current Protocols in
Molecular Biology, 1987; both of which are incorporated herein by
reference). Typically, protein and peptide receptors can be
identified by determining whether an antibody to A-strand region of
DV envelope glycoprotein can inhibit attachment of DV virions to a
cell susceptible to DV infection. Thus, receptors for DV A-strand
region proteins and peptides can be identified in this manner. A
susceptible cell can be incubated in the presence of DV and anti-DV
A-strand region antibody, and a cell-binding assay can be utilized
to determine whether attachment is decreased in the presence of the
antibody.
[0252] Cells expressing putative receptors for DV and/or libraries
of putative receptors for DV may be screened for their abilities to
bind DV. For example, cells expressing a putative DV receptor
(e.g., a receptor for DV A-strand region) can be contacted with an
DV protein or peptide in the presence of an antibody for a time and
under conditions sufficient to allow binding of the DV protein or
peptide to putative receptor on the surface of the cell.
Alternatively or additionally, DV proteins, peptides, or virions
can be pre-incubated with antibody prior to contacting the putative
receptor on the cell surface. Binding can be detected by any means
known in the art, e.g., flow cytometry etc. (see Ausubel et al. or
Sambrook et al., supra). A decrease in binding to the surface of
the cell in the presence of antibody compared to binding in the
absence of the cell in the absence of the antibody indicates the
identification of an DV receptor.
[0253] In some embodiments, methods of identifying DV receptors
include the use of solid supports, such as beads, columns, and the
like. For example, receptors for DV proteins and peptides (e.g.,
A-strand region proteins and/or fragments thereof) and/or DV
virions can be identified by attaching an DV antibody to a solid
support and then contacting the antibody with an DV protein or
peptide for a time sufficient for the DV protein or peptide to bind
to the antibody. This provides an DV protein ligand for putative DV
receptors that can be contacted with the antibody:ligand complex on
the solid support for a time and under conditions sufficient to
allow binding of a receptor to the DV protein or peptide. Proteins
can be expressed from a library or provided as a cell extract or
purified protein preparation from natural or recombinant cells.
Once specific binding complexes between the DV protein peptide are
formed, unbound DV proteins or peptides, e.g., library proteins or
peptide that did not bind specifically to the DV proteins or
peptides, are removed, e.g., by standard washing steps. Bound
proteins are then eluted and identified, e.g., by gel
electrophoresis.
Kits
[0254] The invention provides a variety of kits for conveniently
and/or effectively carrying out methods in accordance with the
present invention. Kits typically comprise one or more DV antibody
agents in accordance with the invention. In some embodiments, kits
comprise a collection of different DV antibody agents to be used
for different purposes (e.g., diagnostics, treatment, and/or
prophylaxis). Typically kits will comprise sufficient amounts of DV
antibody agents to allow a user to perform multiple administrations
to a subject(s) and/or to perform multiple experiments. In some
embodiments, kits are supplied with or include one or more DV
antibody agents that have been specified by the purchaser.
[0255] In certain embodiments, kits for use in accordance with the
present invention may include one or more reference samples;
instructions (e.g., for processing samples, for performing tests,
for interpreting results, for solubilizing DV antibody agents, for
storage of DV antibody agents, etc.); buffers; and/or other
reagents necessary for performing tests. In certain embodiments
kits can comprise panels of antibodies. Other components of kits
may include cells, cell culture media, tissue, and/or tissue
culture media.
[0256] Kits may comprise instructions for use. For example,
instructions may inform the user of the proper procedure by which
to prepare a pharmaceutical composition comprising DV antibody
agents and/or the proper procedure for administering pharmaceutical
compositions to a subj ect.
[0257] In some embodiments, kits include a number of unit dosages
of a pharmaceutical composition comprising DV antibody agents. A
memory aid may be provided, for example in the form of numbers,
letters, and/or other markings and/or with a calendar insert,
designating the days/times in the treatment schedule in which
dosages can be administered. Placebo dosages, and/or calcium
dietary supplements, either in a form similar to or distinct from
the dosages of the pharmaceutical compositions, may be included to
provide a kit in which a dosage is taken every day.
[0258] Kits may comprise one or more vessels or containers so that
certain of the individual components or reagents may be separately
housed. Kits may comprise a means for enclosing the individual
containers in relatively close confinement for commercial sale,
e.g., a plastic box, in which instructions, packaging materials
such as styrofoam, etc., may be enclosed.
[0259] In some embodiments, kits are used in the treatment,
diagnosis, and/or prophylaxis of a subject suffering from and/or
susceptible to DV. In some embodiments, such kits comprise (i) at
least one DV antibody agent; (ii) a syringe, needle, applicator,
etc. for administration of the at least one DV antibody agent to a
subject; and (iii) instructions for use.
[0260] In some embodiments, kits are used in the treatment,
diagnosis, and/or prophylaxis of a subject suffering from and/or
susceptible to DV. In some embodiments, such kits comprise (i) at
least one DV antibody agent provided as a lyophilized powder; and
(ii) a diluent for reconstituting the lyophilized powder. Such kits
may optionally comprise a syringe, needle, applicator, etc. for
administration of the at least one DV antibody agent to a subject;
and/or instructions for use.
[0261] The present invention provides kits containing reagents for
the generation of vaccines comprising at least one DV antibody
agent. In some embodiments, such kits may include cells expressing
DV antibodies, characteristic portions thereof, and/or biologically
active portions thereof; (ii) media for growing the cells; and
(iii) columns, resin, buffers, tubes, and other tools useful for
antibody purification. In some embodiments, such kits may include
(i) plasmids containing nucleotides encoding DV antibodies,
characteristic portions thereof, and/or biologically active
portions thereof; (ii) cells capable of being transformed with the
plasmids, such as mammalian cell lines, including but not limited
to, Vero and MDCK cell lines; (iii) media for growing the cells;
(iv) expression plasmids containing no nucleotides encoding DV
antibodies as negative controls; (v) columns, resin, buffers,
tubes, and other tools useful for antibody purification; and (vi)
instructions for use.
[0262] In some embodiments, kits are used to detect the presence of
DV in one or more samples. Such samples may be pathological
samples, including, but not limited to, blood, serum/plasma,
peripheral blood mononuclear cells/peripheral blood lymphocytes
(PBMC/PBL), sputum, urine, feces, throat swabs, dermal lesion
swabs, cerebrospinal fluids, cervical smears, pus samples, food
matrices, and tissues from various parts of the body such as brain,
spleen, and liver. Such samples may be environmental samples,
including, but not limited to, soil, water, and flora. Other
samples that have not been listed may also be applicable. In some
embodiments, such kits comprise (i) at least one DV antibody; (ii)
a sample known to contain DV, as a positive control; and (iii) a
sample known not to contain DV, as a negative control; and (iv)
instructions for use.
[0263] In some embodiments, kits are used to neutralize DV in one
or more samples. Such kits may provide materials needed to treat an
DV-containing sample with at least one DV antibody agent and to
test the ability of the treated sample to infect cultured cells
relative to untreated sample. Such kits may include (i) at least
one DV antibody agent; (ii) cells capable of being cultured and
infected with DV; (iii) an antibody that is incapable of binding to
and neutralizing DV, as a negative control; (iv) an antibody that
is capable of binding to and neutralizing DV, as a positive
control; (v) a sample known not to contain DV, as a negative
control; (vi) a sample known to contain DV, as a positive control;
and (vii) instructions for use.
EXAMPLES
[0264] The present invention will be better understood in
connection with the following Examples. However, it should be
understood that these examples are for illustrative purposes only
and are not meant to limit the scope of the invention. Various
changes and modifications to the disclosed embodiments will be
apparent to those skilled in the art and such changes and
modifications including, without limitation, those relating to the
formulations and/or methods of the invention may be made without
departing from the spirit of the invention and the scope of the
appended claims.
Example 1
Prediction of Protein-Protein Complex Structure by Analyzing
Physicochemical Features of the Interaction
[0265] Studies in this Example illustrate the development and use
of key physicochemical features to model a protein-protein (e.g.,
antigen-antibody) interaction. Analysis in this Example assists in
distinguishing accurate native-like structures for an
antigen-antibody interaction from inaccurate structures and thus,
helps in overcoming the limitations of using only energetic
functions to rank poses, as performed in modeling of
protein-protein interaction using computational docking models.
Furthermore, the failure to identify the native pose of nine test
cases analyzed in this Example, highlights the limitations of the
current search algorithm and the challenges associated with
designing affinity enhancing mutations for antigen-antibody
complexes.
[0266] To capture as many geometrical and chemical properties that
form the basis of a molecular recognition, thirteen atomic level
features: seven chemical and six physical (Table 1) were used to
describe an antigen-antibody interface. Further, a data set
comprising of 77 non-redundant 3D structures of antigen-antibody
complexes was assembled (see Methods section) and split into two
parts, a training set consisting of 40 structures and a test set
consisting of the remaining 37 structures. Corresponding to each
structure, 100 decoy models were constructed using computational
docking (see Methods section), yielding a total of 7,777 structures
(7,700 decoy+77 x-ray). In the training phase, multivariate
logistic regression analysis (MLR) was used to determine the
relationship between each feature (explanatory variable) and the
degree to which it can successfully discriminate x-ray versus
decoys poses (outcome variable). This analysis assisted in
achieving a subset of all the explanatory variables that could be
combined to predict the value of the outcome variable. Input
features generated from each PDB file (and its decoys) were
represented as standardized Z-scores to prevent non-uniform
learning, which can lead to over (or under) estimation of
significance. For the prediction phase, the pre-computed
significant features were employed to predict the probability that
a structure in the test data set is native-like.
[0267] The results from MLR analysis suggested that the relative
dominance of individual features affecting the probability of
accurately discriminating native versus decoy structures was in the
order of ZEPII>main chain-main chain H-bonds>density of
H-bonds>percentage of charged groups>density of cation-pi
interactions>buried surface area>percentage of neutral polar
groups>density of ionic bonds. Each of the above features was
found to be significant at an alpha level of 0.05. Based on the
logistic regression coefficients, H-bond and ionic bond density,
main chain-main chain H-bonds and buried surface area appear to be
over-estimated in the docked models. This is anticipated since
increasing the values of the above features tends to maximize the
scoring function. On the contrary, ZEPII, cation-pi interactions,
percentage of charged and neutral polar groups appear to be
under-represented in the docked models. Cation-pi interactions,
percentage of charged and neutral polar groups do not contribute
significantly to the energy scoring function; hence these features
were not optimized in the docked interfaces. Further, assessment of
docked models shows that docking procedure does not faithfully
recapitulate the pairwise interactions common to dissociable
antigen-antibody complexes; hence the mock interfaces were found to
have low ZEPII values.
[0268] Next, MLR was used to predict x-ray structures of 37
antigen-antibody interactions in the test data set using the
pre-computed significant features, and then the sensitivity of the
MLR-based prediction was compared to those of the ZRANK energy
function, used in docked models (see Methods section). Overall, MLR
was shown to be better at predicting x-ray structures than ZRANK
energy function (FIG. 1), suggesting that MLR approach yielded
improvements over ZRANK in predicting native-like binding poses.
Closer examination of the decoy models, their ZRANK scores and
MLR-based prediction probabilities revealed interesting insights
(FIG. 2). ZDOCK identified native-like structures for 29 out of the
37 structures indicating that computational search algorithms to be
very accurate. However, (1) ZRANK score varied significantly even
between structurally similar poses (FIG. 2A); (2) very different
structures could receive approximately the same score making it
difficult to discriminate accurate from inaccurate solutions (FIG.
2A); (3) worse, inaccurate solutions often received better score
than native-like structures (FIG. 2A); (4) while MLR-based
prediction probability also varied between structurally similar
poses, non-native poses rarely received high prediction probability
indicating that the likelihood of a false positive structure
prediction was lower when the poses are ranked according to
prediction probability. Accordingly, prediction probability was
seen to correlate better with RMSD when compared to ZRANK score
(FIGS. 2B & 2C).
Example 2
Using Physicochemical Features for Prediction of Affinity-Enhancing
Mutations
[0269] Studies in this Example show the development of a scoring
scheme for designing affinity enhancing mutations for
protein-protein (e.g., antigen-antibody) interactions.
[0270] Specifically, this Example describes a mathematical model
developed to quantify the propensities of pairwise amino acid
interactions (see Methods section). These statistical propensities
were formulated as an interaction matrix that assigns a weight to
each possible pair of amino acids. The fitness of a residue at a
CDR position, also called the amino acid interface fitness (AIF),
was the combined propensity of all inter-protein pairwise contacts
(defined as two amino acids within a certain distance of each
other) involving that residue. Substitutions that lead to an
improvement in AIF value without any structural consequences were
considered as candidates for affinity enhancement. The propensities
were determined using statistics on amino acid contacts in a
database of known protein structures (see Methods section).
Avoiding multiple distance cutoffs and energy minimization steps
eliminated heavy dependencies on atomic coordinates.
[0271] Consistent with the observations made by previous studies,
the propensity data showed the dominance of tyrosine, tryptophan,
serine and phenylalanine over other residues in the paratope (Table
2 (FIG. 12)). The AIF metric was then used to predict affinity
enhancing mutations of antibodies across three different systems
for which published data validated the predictions. One of the test
case was the anti-EGFR antibody drug cetuximab (Erbitux), where a
10-fold affinity improvement to 52 pM was engineered by three
mutations on the light chain. Two of these predicted mutations,
S26D and T31E were shown to improve binding affinity as single
mutations in cetuximab and closer inspection of the third mutation
(N93A) revealed that Ala is among a set of residues with weak
contact propensities overall. Another test case was the
anti-lysozyme model antibody D44.1, where eighteen mutations were
predicted to be suitable for affinity enhancement. Four of the
predicted mutations on the heavy chain, T28D, T58D, E35S, G99D,
were part of a published high-affinity variant of D44.1. Another
test case was the antibody E2 that targets cancer-associated serine
protease MT-SP1. AIF metric predicted eight mutations which
included T98R, confirming a previous in-silico affinity enhancement
study, which had identified a single mutation T98R for improving
the antibody affinity by 14-fold to 340 pM.
Example 3
Design of Affinity Enhancing Mutations in Dengue Antibody
[0272] Analysis in this Example illustrates that an anti-DV
antibody that binds only certain serotypes of DV can be modified
through engineering such that a variant is generated that potently
neutralizes activity of all four serotypes of DV. Specifically,
studies in this Example show that rationally designed mutations in
a Dengue mAb 4E11 augments its affinity for DV serotype 4 (DV4),
and do not significantly detrimentally affect its binding to DV
serotypes 1-3 (DV1-3).
[0273] Binding and neutralizing activity profiles of mAb 4E11 show
high affinity and inhibitory potency to DV1-3, but low affinity and
neutralizing activity to DV4 (FIG. 3). To engineer 4E11 for potent
neutralization activity to all four serotypes, the design approach
(FIG. 4) relied on three important factors: (1) to generate an
accurate model of 4E11-EDIII interaction, (2) to understand the
serotype-specific structural elements and recapturing the
determinants of affinity and specificity, and (3) to design of
substitutions which confer favorable interaction and hence improved
affinity with DV4.
[0274] In the absence of the antibody crystal structure, a
structural model of the Fv region was built and the modeled Fv was
docked against EDIII of DV1 using ZDOCK software, and previously
published functional data on the epitope and CDR H3 paratope
(Watanabe et al., 2012 Trends in Microbiology 20: 11-20) were
included as specific residues in the binding interface to ensure
docked poses did not deviate significantly from the native complex
(see Methods section). ZDOCK was run five times with different
combinations of input interface residues and the best ranking model
from each run (FIG. 5) was re-ranked using MLR probabilities (Table
3). The top model predicted by the MLR approach did not match with
the prediction of the ZRANK method.
[0275] The top model predicted by the MLR approach was validated by
comparison performed between paratope hot spots computationally
predicted by the web server ANCHOR [Dosztanyi et al., 2009
Bioinformatics 25: 2745-2746] and hot spots determined
experimentally by Ala-scanning of each position in all CDR loops of
4E11 with binding assessment by indirect ED-III (DV1) ELISA. Hot
spot prediction of the selected model correctly identified 61% of
experimentally determined hot spots, whereas the remaining poses
had hot spot prediction accuracies of <45% (range 28-44%), thus
indicating that the selected pose was likely to reflect the true
4E11/ED-III binding configuration.
[0276] The top 4E11-ED-III (DV1) model was used to guide the
modeling of the interaction between 4E11 and a representative EDIII
strain from each of the other three serotypes (see Methods
section). Using the four structural models, the mode of antibody
binding to each of the serotypes was examined and the molecular
basis of poor affinity towards DV4 serotype was identified using a
combination of sequence and ED-III domain-level structural
analysis. Analysis revealed multiple amino acid differences within
and around the 4E11 binding interface between DV4 and other
serotypes. Notably, the orientation of the A-strand (residues
305-308) relative to neighboring .beta.-strands was different in
DV4 owing to a localized difference at position 307 (FIG. 6).
Consistent with the low affinity and neutralizing potency to DV4,
the 4E11-EDIII (DV4) interface possessed smaller BSA, fewer H-bonds
and salt bridge contacts.
[0277] AIF index was next applied to design mutations which enhance
affinity to DV4 binding. This resulted in a set of 87 mutations
spanning 23 CDR positions. The predicted mutations included amino
acids of all types. The choice of amino acid replacements were not
always intuitive (e.g., if the epitope region surrounding a
paratope CDR position was negatively charged, Arg and Lys were not
always statistically favored at that CDR position). While residues
that improve energetics were favored, affinity gain might happen
through improvements in electrostatic complementarity, packing and
hydrophobic surface area. A conscious effort was taken in designing
affinity-enhancing mutations at CDR positions proximal to DV4
serotype-specific residues (FIG. 6). Mutations that had potential
to improve DV4 affinity while not being detrimental to other
serotypes were given higher preference. In an effort to learn about
the effects of point mutations on binding affinity, mutants were
not restricted to residues with the highest probabilities of
success.
Example 4
Experimental Characterization of Engineered Dengue Antibody
[0278] Experiments in this Example elucidate that specific
engineered site-directed mutations in an antibody increase its
affinity and/or potency for EDIII of DV4 without, or with only
minimal reduction in binding affinity and/or potency to EDIII of
DV1-3. Experiments in this Example also demonstrate that binding
properties of engineered antibodies can also be accurately
quantified. Experiments in this study moreover show that an
engineered Dengue antibody designed by combining specific
successful single-mutations results in maximum increase in the
affinity of the antibody. Furthermore, experiments in this Example
confirm that engineered antibodies designed in this study not only
exhibit strong inhibitory activity to all four serotypes of DV, but
also have potent antiviral activity in vivo.
[0279] A total of 87 mutations were selected for experimental
testing by indirect ELISA using purified recombinant EDIII of DV1-4
as the coated antigen. Mutants were generated by site-directed
mutagenesis, sequence-confirmed, and expressed from 293 cells by
transient transfection. Ten mutations were identified with enhanced
EDIII-DV4 affinity with no or minimal reduction in binding to EDIII
of DV1-3 (Table 3). These 10 mutations spanned five CDR positions,
with four in VL (R31, N57, E59, and S60) and one in VH (A55). Eight
of the 10 mutations were in VL, with 7 being in L2 alone. The
successful mutations were mostly charged or polar in nature, and
found to reside at the periphery of the antibody-antigen interface
area (FIG. 7). Structural analysis showed the mutant side chains
created contacts with highly conserved epitope residues, suggesting
why they were not detrimental to DV 1-3 binding (FIG. 6 and Table
5).
[0280] For further accurate quantification of binding properties of
these 10 single-mutants discussed above, competition ELISA
experiments were performed to determine affinities at equilibrium
and in solution. Table 6 (FIG. 13) outlines affinity results from
five single mutant antibodies, representing those mutations which
demonstrated greatest EDIII-DV4 affinity enhancement while
maintaining affinity to EDIII of DV1-3. The extent of DV4 affinity
enhancement ranged from 1.1-fold (VL-R31K) to 9.2-fold (VH-A55E).
Surprisingly, two mutations conferred increased affinity to other
serotypes; VH-A55E resulted in a 16- and 7-fold affinity increase
to ED-III-DV2 and ED-III-DV3, respectively, while VL-N57E
demonstrated a 3-fold affinity increase to ED-III-DV2. Only three
of the 15 affinities measured to serotypes 1-3 (with the five
single mutant antibodies) showed a decrease greater than 2-fold,
and only one antibody-EDIII affinity (VL-E59Q for EDIII-DV3)
resulted in greater than a 3-fold decrease in affinity.
[0281] Structurally, the five affinity-enhancing positions map to
spatially distinct regions of the paratope (FIG. 7) suggesting that
additional enhancement could be achieved by combining successful
single mutations. Multiple three-, four- and five-mutant
combinations were tested, and a quintuple mutant antibody, termed
4E5A, showed the greatest increase in affinity. Surprisingly, 4E5A
was composed of five substitutions representing the amino acid
change at each position which conferred greatest affinity
improvement to EDIII-DV4 as a single mutant. Compared to the
parental mAb, 4E5A displayed 450-fold affinity improvement to
EDIII-DV4 (K.sub.D=91 nM) while maintaining affinity to EDIII of
DV1 and DV3 and a 15-fold affinity increase to DV2 (Table 7 and
Table 8). Significantly, these results illustrated that affinity of
an antibody could be increased from micromolar to near-nanomolar
affinity. Surface Plasmon Resonance (SPR) was used to verify
affinity measurements as well as obtain kinetic binding parameters
(Table 9 and FIG. 8). Affinity values from SPR were in good
quantitative agreement with those obtained by competition ELISA,
with the exception that specific binding of 4E11 WT to EDIII-DV4
could not be detected, indicating a very low affinity, which was in
general agreement with competition ELISA results (K.sub.D=41
.mu.M).
[0282] To determine whether increased affinity of 4E5A to EDIII-DV4
translated to enhanced activity, a focus reduction neutralization
test (FRNT) assay was used. Compared to WT 4E11, 4E5A showed a
>75 fold increase in neutralizing potency towards DV4, and it
maintained potency to DV1-3 (FIG. 9). 4E5A showed strong inhibitory
activity to all four serotypes, with FRNT.sub.50 values of 0.19,
0.028, 0.77, and 4.0 .mu.g/ml for DV1-4, respectively. To further
elucidate 4E5A activity, the antibody was assessed in an AG129
mouse model of DV2 challenge, which shows peak viremia at day 3
post-infection. At both 1 mg/kg and 5 mg/kg, 4E5A demonstrated a
significant reduction in viremia, with 5 mg/kg treatment resulting
in virus titer levels below the limit of detection (FIG. 10).
Collectively, these results showed that the engineered mAb 4E5A
exhibited strong inhibitory activity to all four serotypes of DV
and had potent antiviral activity in vivo.
[0283] Engineered antibodies that can be designed based on this
study (e.g., 4E5A) represent important drug candidates and
additionally can be taken up for further rounds of affinity
maturation and humanization as is known in the art. The crystal
structure of 4E11/ED-III complex was published prior to submission
of the present patent application, which allowed comparison of the
structural model discussed in this study with the published complex
structure and indeed, excellent correspondence between the two
structures with C-alpha RMSD value of 1.4 angstrom was observed,
further confirming the significance of this study.
Discussion
[0284] Traditional approaches for discovering antibodies of
therapeutic interest rely on experimental methods such as
phage-display techniques. However, these approaches are expensive,
technically challenging and time consuming. For instance, the
influenza FI6 mAb, which neutralizes clade 1 & 2 viruses, was
identified by screening 104,000 B cells. An alternate strategy
would be to modify the properties of an existing antibody via
rational engineering. In this study, computational methods for ab
initio modeling and antibody re-design were presented. In test
runs, the sensitivity of the MLR prediction method in picking X-ray
structures (out of several decoy models) appeared superior to
ZRANK. Further, it was shown that the AIF metric could capture
known affinity enhancing mutations across multiple systems. This
framework was then applied to engineer broader specificity and
affinity to an anti-Dengue neutralizing mAb. The results obtained
by this study were important as: (1) only few studies have
attempted to improve the cross-reactivity of an antibody; (2) this
is the first study that has employed an empirical approach towards
antibody re-design and affinity enhancement; and (3) affinity
enhancing mutations were predicted without the crystal structure of
the antibody-antigen complex (aka blind prediction). This study
showed for the first time that application of a computational
approach led to a greater than .about.400-fold improvement in
affinity of an antibody (Table 10). Given the simplicity of these
computational methods, they could be broadly employed for antibody
engineering, and unlike physics-based energetic approaches, they
are not affected by the precise location of the atom coordinates of
the starting structure.
[0285] The top docking solution from ZRANK was structurally very
different from the native-structure, indicating that any affinity
enhancement efforts following the top ZRANK model would not have
led to fruitful results. Affinity enhancing mutations were also
predicted using the X-ray structure by energetics approach and
results highlighted the challenges in discriminating stabilizing
and neutral mutations (Table 11). More significantly the affinity
enhancing mutations N57E, N57S and E59N were classified as
destabilizing (Table 11). Since ZRANK is widely used and has shown
considerable success in the CAPRI experiments, the method presented
in this study would perform comparatively well when stacked against
other docking algorithms. The fact that ZEPII appeared
significantly, indicated that amino acid composition and
inter-residue contacts contained discriminatory power.
Interestingly, some geometrical features also have the predictive
power to discriminate native interfaces from decoys. This
correlated with the observation made by previous studies that
antigen-antibody interfaces were more planar and significantly
well-ordered or packed. Between the different combinations of
interface residues that were used to generate the five different
models, the accurate model was produced by using all the known
epitope and paratope interface residues as adding more context
narrowed the search space and therefore increased the chances of
finding a near-native complex structure.
[0286] Phage display and directed evolution methods randomized
select CDR loops, especially VH-CDR loops since they accounted for
most of the stabilizing contacts. The results on 4E11 showed that
diversification strategies must use a rational approach and involve
VL-loops for targeted diversification. The observation that
affinity enhancing mutations were mainly polar in nature and were
present at the periphery of the binding interface was consistent
with known data. It is likely that these mutations increased the
association rate by increasing the efficiency of collision. The
success rate in predicting mutations with targeted activities is
12% (10/87). These results were encouraging given the complexity of
the design problem (i.e. involvement of multiple antigens) and
considering that random mutations would have in average a
detrimental effect on binding affinity.
[0287] Studies have shown that murine germl ine harbors gene
segments with an inherent capacity for high-affinity binding to
EDIII domain (Ref 24, 32). Despite the beneficial effect of the 5
mutations, these mutations have not co-evolved in vivo. Codon-level
analysis showed that amino acid replacements at N57E and S60W
required at least two base changes highlighting the limitations at
the genomic level. Previous studies have shown that the epitopes
recognized by anti-DV antibodies fall into three different regions:
(1) lateral-ridge epitope on ED-III (serotype-specific potent
neutralizers); (2) A-strand of DIII (subcomplex-specific
neutralizers); and (3) other DII and DIII epitopes
(complex-specific or flavivirus cross-reactive moderately potent
neutralizers). In this study, it was shown for the first time that
antibody against A-strand epitope could be engineered to bind all
four serotypes with good in vitro potency. Collectively, 4E5A
exhibited an interesting broad spectrum neutralization profile and
would be an antibody of interest for potential therapeutic
development for treatment of Dengue disease. mAb therapeutics
against DV in humans could face regulatory hurdles due to
antibody-dependent enhancement. However, recent studies have shown
that modifications to the Fc region of recombinant anti-DV
antibodies prevent ADE in vivo, thus presenting opportunities for
these newer complementary approaches. The degree of conservation of
mAb epitope can be a significant factor in determining neutralizing
spectrum and in vivo protection. Phylogenetic analysis of DV4
viruses has revealed the existence of four distinct genotypes: I
(Southeast Asia), II (Indonesia), III and IV (Sylvatic or
Malaysia). Within genotype II, viruses cluster into two distinct
clades previously defined as IIa and IIb. Sequence analysis of
4E11-5A's epitope region revealed high degree of conservation in
genotypes IIa, IIb and 4, while relatively lower conservation in
genotype I, suggesting to the present inventors that the engineered
antibody would likely be effective against the majority of DV4
viruses.
TABLE-US-00006 TABLE 1 Description of physicochemical features.
Feature No. Description of feature Feature sub-classification
Chemical 1 Number of various types of interactions (1) hydrophobic,
(2) disulphide bridges, (3) hydrogen bond, (4) ionic interactions,
(5) aromatic-aromatic, (6) aromatic-sulphur, (7) cation-pi 2
density of each type of interactions (i.e. how (1) hydrophobic, (2)
disulphide many contacts of each type is observed on bridges, (3)
hydrogen bond, (4) ionic average per 100 square angstroms of the
interactions, (5) aromatic-aromatic, interface) (6)
aromatic-sulphur, (7) cation-pi 3 classification of hydrogen-bonds
(1) main chain - main chain, (2) main chain - side chain, (3) side
chain - side chain) 4 number of salt bridge interactions 5 number
of hydrogen bonds that involve charged residues 6 composition of
chemical groups (1) polar, (2) neutral and (3) non- polar chemical
groups 7 ZEPII Assesses the frequencies of favorable interactions
to indicate the probability of antibody binding to a given surface
(see Methods section) Physical 7 buried surface area 8 planarity 9
surface complementarity 10 interface atom packing density 11
distance between the binding site of the antigen from its center of
mass 12 novel metric that quantifies the antibody binding potential
of a surface by enumerating the number of favorable interactions
that are common to antigen-antibody interfaces
[0288] Table 2. The 20.times.20 amino acid propensity matrix. (FIG.
12). Paratope amino acids are indicated on the left side and
epitope amino acids are indicated on the upper side. The propensity
data was generated using 77 non-redundant antigen-antibody
complexes.
TABLE-US-00007 TABLE 3 Physicochemical properties of the top five
docked structural models. Columns 2-9 provide values of
pre-computed significant features for the docked models. The
p-value and odds ratio (OR) are listed in the column headers. The
MLR regression coefficient of the features is listed in the last
row of the table. Columns 10 and 11 provide MLR-based prediction
probability and ZRANK score, respectively. Ionic Percentage contact
Cation-pi Main chain- Percentage of neutral ZEPII BSA density
density Hydrogen bond main chain of charged polar groups (OR = (OR
= (OR = (OR = density (OR = (OR = groups (OR = (OR = 4.948081868;
0.595234401; 0.769203281; 1.453682511; 0.409261894; 0.072352881;
4.853984917; 1.412696091; MLR p-value = p-value = p-value = p-value
p-value p-value p-value p-value prediction ZRANK Pose 2E-16)
0.000994) 0.048709) 0.000831) 0.000000432) 3.06E-11) 0.000000516)
0.03383) probability score 1 1.1032203 2269 0.485 0.176 0.661 15 10
0.1071 0.00263 -75.833 2 1.10727273 1941 0.567 0.155 0.824 16 15
0.0982 0.00159 -85.636 3 1.1028767 2340 0.513 0.128 1.026 24 19
0.1389 0.00003 -66.759 4 1.0836066 2436 0.369 0.164 0.698 17 14
0.1186 0.00192 -71.73 5 0.9682895 2481 0.363 0.202 0.846 21 16
0.1587 0.00001 -72.775 Regression 1.599 -0.5188 -0.2624 0.3741
-0.8934 -2.6262 1.5798 0.3455 coefficient
TABLE-US-00008 TABLE 4 Mutations that led to increase in EDIII-DV4
affinity while maintaining original EDIII-DV1-3 affinity. Chain CDR
Position WT residue Mutation VH H2 55 Ala Glu VH H2 55 Ala Asp VL
L1 31 Arg Lys VL L2 57 Asn Glu VL L2 57 Asn Ser VL L2 59 Glu Gln VL
L2 59 Glu Asn VL L2 60 Ser Trp VL L2 60 Ser Tyr VL L2 60 Ser
Arg
TABLE-US-00009 TABLE 5 Contacts made by affinity enhancing
mutations. WT Predicted DV4 Chain & CDR Position residue
Mutation contacts VH - H2 55 Ala Glu H-bond, Ionic contact with Lys
(310), Lys (323) Asp H-bond, Ionic contact with Lys (310), Lys
(323) VL - L1 31 Arg Lys Ionic contact with Glu (311) VL - L2 57
Asn Glu Ionic contact with Lys (305) Ser H-bond with Lys (310) VL -
L2 59 Glu Gln H-bond with Glu (327) Asn H-bond with Glu (327) VL -
L2 60 Ser Trp Hydrophobic contact with Ala (329) Tyr H-bond with
Glu (327) Arg Ionic, H-bond with Glu (327) and H-bond with Gly
(328)
[0289] Table 6. Affinities of single mutant antibodies with
increased EDIII-DV4 affinity and similar EDIII-DV1-3 affinities
relative to 4E11 WT. (FIG. 13). Mutations included are those which,
for each identified position, demonstrated greatest EDIII-DV4
affinity while approximately maintaining EDIII-DV1-3 affinity.
K.sub.D values represent the average of at least two independent
experiments.
TABLE-US-00010 TABLE 7 Affinity of combination mutant 4E11-5A.
EDIII-DV1 EDIII-DV2 EDIII-DV3 EDIII-DV4 K.sub.D Fold- K.sub.D Fold-
K.sub.D Fold- K.sub.D Fold- Method mAb (nM) change (nM) change (nM)
change (nM) change Competition 4E11WT 0.328 -- 5.20 -- 21.8 --
40,793 -- ELISA 4E11-5A 0.309 1.1 0.246 21.1 16.5 1.3 91.2 447.3
SPR 4E11WT 0.50 -- 6.20 -- 7.58 -- NB -- 4E11-5A 1.78 0.28 0.70 8.9
5.19 1.5 114 --
TABLE-US-00011 TABLE 8 Energetic calculations of 4E5A showing
mutations have additive effect on binding energy. Antibody
EDIII-DV4 .DELTA.G (kcal/mol).sup.a EDIII-DV4 .DELTA..DELTA.G
(kcal/mol).sup.b 4E11 WT -5.98 -- VH-A55E -7.29 -1.31 VL-R31K -6.03
-0.05 VL-N57E -6.92 -0.93 VL-E59Q -6.76 -0.77 VL-S60W -6.24 -0.26
4E5A -9.59 -3.61 .sup.aFree energy calculated by .DELTA.G =
RTln(K.sub.D) at 25.degree. C. .sup.b.DELTA..DELTA.G =
.DELTA.G.sub.mutant - .DELTA.G.sub.WT
TABLE-US-00012 TABLE 9 Kinetic binding parameters for 4E11 and 4E5A
measured by SPR. EDIII-DV1 EDIII-DV2 EDIII-DV3 EDIII-DV4
k.sub.on.sup.a k.sub.off.sup.b k.sub.on.sup.a k.sub.off.sup.b
k.sub.on.sup.a k.sub.off.sup.b k.sub.on.sup.a k.sub.off.sup.b 4E11
1.11 5.51 1.98 123 1.34 102 N.B..sup.c N.B..sup.c 4E5A 1.17 20.8
2.01 14.1 2.76 143 0.766 875 k.sub.on.sup.a values are expressed as
(.times.10.sup.6 m.sup.-1s.sup.-1) k.sub.off.sup.b values are
expressed as (.times.10.sup.-4 s.sup.-1) .sup.cN.B., no binding
TABLE-US-00013 TABLE 10 Comparison of results of various in silico
antibody affinity enhancement studies. Crystal Single/multi
Affinity Study Method Antibody Antigen structure? antigen
improvement Our study Empirical 4E11 Dengue No Multi ~450
informatics gpE Lippow SM Energetics D44.1 lysozyme Yes Single 140
et. al., Nature Biotech (2007) Marvin J.S. Energetics Y0101 VEGF
Yes Single ~6 et. al., Biochemistry (2003) Clark LA Energetics AQC2
VLA1 Yes Single ~10 et.al., Protein Science (2006) Farady et al.
Energetics E2 Protease Yes Single 14 (2009) MT-SP1 Bioorg. Med.
Chem. Lett.
TABLE-US-00014 TABLE 11 Antibody mutations predicted using
energetics approach. Mutations that increased the affinity of 4E11
are bolded and underlined. Muta- Effect Muta- Effect Muta- Effect
Muta- Effect Muta- Effect tion Muta- of tion Muta- of tion Muta- of
tion Muta- of tion Muta- of at tion Muta- at tion Muta- at tion
Muta- at tion Muta- at tion Muta- ALA55 Energy tion ARG31 Energy
tion ASN57 Energy tion GLU59 Energy tion SER60 Energy tion VH:ALA55
VL:ARG31 VL:ASN57 VL:GLU59 VL:SER60 GLU -1 stabi- LYS -1.01 stabi-
LEU -1.79 stabi- PHE -1.02 stabi- SER -2.21 stabi- lizing lizing
lizing lizing lizing THR -0.44 neutral HIS -0.13 neutral PHE -1.69
stabi- TYR -1 stabi- PHE -2.17 stabi- lizing lizing lizing TRP -0.4
neutral MET -0.04 neutral TYR -1.44 stabi- GLN -0.86 stabi- ARG
-1.69 stabi- lizing lizing lizing ASP -0.37 neutral PRO -0.04
neutral ARG -0.88 stabi- ARG -0.5 neutral LYS -1.69 stabi- lizing
lizing GLN -0.33 neutral ARG 0 neutral TRP -0.64 stabi- LYS -0.35
neutral GLN -1.65 stabi- lizing lizing LEU -0.33 neutral ILE 0.16
neutral GLN -0.62 stabi- ASP -0.29 neutral LEU -1.44 stabi- lizing
lizing TYR -0.29 neutral THR 0.22 neutral MET -0.57 stabi- MET
-0.24 neutral TRP -1.31 stabi- lizing lizing ARG -0.23 neutral VAL
0.22 neutral HIS -0.51 stabi- HIS -0.23 neutral MET -1.26 stabi-
lizing lizing PRO -0.23 neutral ASN 0.24 neutral LYS -0.04 neutral
LEU -0.1 neutral HIS -0.8 stabi- lizing ILE -0.17 neutral ALA 0.3
neutral ASN 0 neutral ILE -0.01 neutral ASN -0.79 stabi- lizing MET
-0.17 neutral CYS 0.32 neutral ILE 0.53 de- GLU 0 neutral CYS -0.64
stabi- stabi- lizing lizing VAL -0.14 neutral SER 0.34 neutral ASP
0.58 de- PRO 0.05 neutral THR -0.57 stabi- stabi- lizing lizing PHE
-0.09 neutral GLY 0.41 neutral PRO 0.68 de- VAL 0.06 neutral ALA
-0.56 stabi- stabi- lizing lizing CYS -0.04 neutral TYR 0.46
neutral THR 0.93 de- THR 0.17 neutral ASP -0.45 neutral stabi-
lizing ALA 0 neutral PHE 0.47 neutral CYS 1.14 de- SER 0.34 neutral
GLU -0.42 neutral stabi- lizing HIS 0.06 neutral GLN 0.48 neutral
GLU 1.17 de- CYS 0.39 neutral GLY -0.05 neutral stabi- lizing GLY
0.07 neutral LEU 0.48 neutral ALA 1.32 de- ALA 0.51 de- TYR 0
neutral stabi- stabi- lizing lizing ASN 0.13 neutral TRP 0.68 de-
SER 1.53 de- GLY 0.52 de- ILE 0.43 neutral stabi- stabi- stabi-
lizing lizing lizing SER 0.17 neutral ASP 1.14 de- VAL 1.88 de- ASN
0.68 de- VAL 0.61 de- stabi- stabi- stabi- stabi- lizing lizing
lizing lizing LYS 1.06 de- GLU 1.26 de- GLY 1.95 de- TRP 2.53 de-
PRO 3.31 de- stabi- stabi- stabi- stabi- stabi- lizing lizing
lizing lizing lizing
Methods
A Mathematical Model for Estimating Contact Propensities of Amino
Acids in the Antigen-Antibody Interface
[0290] Briefly, in an antigen-antibody interface, a pair of
residues presumably interact if they had favorable energetics of
interaction or by chance occurrence. The propensity of amino acid
interaction was calculated by computing the number of interactions
expected by chance i.e. the expected frequency, and dividing the
observed frequency by this number.
[0291] If two amino acids, one from each side of the
antigen-antibody interface, were within 4.5 .ANG. (i.e. shortest
non-H atom distance is less than 4.5 .ANG.) from each other, they
were defined as pair residues. If the total number of pairwise
interactions between residues x (antigen) and y (antibody) at the
interface was N(x, y), then their concurrence frequency, F(x, y),
was defined as follows:
F ( x , y ) = N ( x , y ) l = 1 20 m = 1 20 N ( l , m )
##EQU00001##
The denominator of the above equation indicates the summation of
pairwise interactions of all residue pairs in the interface.
[0292] The frequency of occurrence of every amino acid at paratope
and epitope must be calculated. The frequency of a particular amino
acid x in the epitope, F.sup.epitope(x), was defined as
follows:
F epitope ( x ) = N ( x ) l = 1 20 N ( l ) ##EQU00002##
In the above equation N(x) denotes the count of amino acid x in the
epitope. The denominator represents the total number of all amino
acids in the epitopes.
[0293] Similarly, the frequency of occurrence of amino acid y in
the paratope, F.sup.paratope(y), was defined as follows:
F paratope ( y ) = N ( y ) l = 1 20 N ( l ) ##EQU00003##
In the above equation, N(y) denotes the number of amino acid y in
the paratope. The denominator indicates the total number of all
amino acids in the paratopes.
[0294] Parameters F(x,y), F.sup.epitope(x) and F.sup.paratope(y)
were determined using all the seventy-seven benchmarked
antigen-antibody structures in the data set. Consistent with
observations made by previous studies, tyrosine, serine, glycine
and asparagine were the most abundant paratope residues whereas
lysine, arginine, leucine and glycine were the most abundant
epitope residues (FIG. 11). If the occurrences of amino acids x and
y were independent, EF.sup.epitope-paratope(x,y) defined in the
below equation was an expected frequency rate that amino acids x
and y appear concurrently.
EF(x,y)=F.sup.epitope(x)F.sup.paratope(y)
[0295] If the concurrence rate of the amino acids x and y at the
interface for the antigen was more than the expected rate, the
following ratio RA.sub.a(x, y) becomes greater than 1.
RA ( x , y ) = F ( x , y ) EF ( x , y ) ##EQU00004##
[0296] RA.sub.s(x,y) was a 20.times.20 matrix. Exemplary
applications of RA.sub.s(x,y) are suggested below.
[0297] Using RA(x,y) to determine the AIF of a CDR residue. The AIF
of a CDR residue in the interface was defined as the sum of the
RA(x,y) with its neighbors. Neighbors were defined by a distance
criterion (4.5 .ANG.).
[0298] Determine the optimal choice of amino acid at an interface
position (paratope re-engineering). Given an antigen-antibody
complex, amino acid preferences at a CDR position were computed
using the contact potential score. Specifically, at a given CDR
position, the wild type (WT) residue was systematically substituted
by the remaining amino acids excluding glycine and proline (to
avoid backbone conformation alterations) and the probability of
replacement was evaluated at each instance using the AIF metric.
Single mutations with replacement potential higher than wild type
residue were reevaluated computationally to find mutations
that--(a) do not bury polar groups, and (b) do not cause steric
hindrance.
[0299] Using RA(x,y) to quantify the strength of interaction of
antigen-antibody interface (the Epitope-Paratope Interface Index).
The interaction between an antigen and antibody results from the
formation of numerous non-covalent bonds. Therefore, the
interaction affinity was directly related to summation of the
attractive and repulsive forces (van der Waals interactions,
hydrogen bonds, salt bridges and hydrophobic force). Herein, the
strength of interaction of an antibody-antigen interface was
investigated quantitatively by a linear combination of RAs for all
combinations of amino acid pairs. An index expressing the strength
of an antigen-antibody interface `i` (called Epitope-Paratope
Interface Index (EPII)) was defined by:
EPII i = x = 1 20 y = 1 20 F i ( x , y ) RA ( x , y ) x = 1 20 y =
1 20 F i ( x , y ) ##EQU00005##
In the equation above F.sup.i(x,y) denotes the concurrence
frequency of amino acids x (x belongs to secondary structural
groups) and y at interface i.
[0300] Using EPII to discriminate a true antigen-antibody
interaction from docking decoys. In order to distinguish an
interface with the most potential from other decoy interfaces
generated by computational docking, the EPII values should be
normalized by all the interfaces in the protein. Z-scored EPII were
used for this purpose. If M interfaces were found in a protein, the
Z-scored EPII for interface i was calculated as follows:
Z EPII i = EPII i - .mu. .sigma. , where ##EQU00006## .mu. = i = 1
M EPII i M ##EQU00006.2## .sigma. = i = 1 M ( EPII i - .mu. ) * (
EPII i - .mu. ) M ##EQU00006.3##
The Z.sub.EpII.sub.i score was an indicator of the probability of
antibody binding to a given interface. Interface with the highest
Z.sub.EpII.sub.i score (or with Z.sub.EpII.sub.i above the
consensus value established for antigen-antibody interaction
(discussed above)) in a protein was the most probable site for
antibody binding.
Data Set of Non-Redundant Antigen-Antibody Structural Complexes and
Computational Docking to Generate Decoy Models
[0301] A total of 568 antigen-antibody complexes from the Protein
Data Bank were analyzed. In order to ensure proper enumeration of
geometric interface features (planarity, buried surface area etc.),
structures wherein the antigen length was less than 20 amino acids
were excluded. Additionally, many structures contained same or
similar antigen, which could bias the studies, giving higher weight
for factors derived from multiply-represented protein antigen. To
remove redundant structures from the data set, structures that have
homologous antigen (defined by BLAST_ENREF_40 P-value 10e27) and
share 50% epitope residues were classified under the same group and
the structure with the highest resolution was selected as the
representative. This led to seventy-seven non-redundant
antigen-antibody complex structures.
[0302] ZDOCK was used to generate decoy computational models of
antigen-antibody interaction. The protocol for generating the
decoys models were the same for all the seventy seven structural
complexes. Only the variable domain of the antibody was used for
docking. The larger of the two molecules was considered the
receptor while the smaller molecule was considered the ligand. The
ligand orientation was rotated 6 degrees at each step to sample the
various conformations. Since, the initial docking procedure
explores a relative large area, distance constraints between
putative hotspot residues on epitope and paratope were set up to
ensure the generated models did not shift significantly from the
native pose. Two hotspot residues were selected on either side to
ensure the challenges faced with structure prediction was
equivalent to the 4E11 scenario. In all the decoys models, the
putative epitope and paratope hotspots were within 10 angstroms
from each other. Hotspots were identified using the web server,
ANCHOR. The initial docking procedure generated 2,000 poses which
were then clustered based on an all-versus-all RMSD matrix,
described previously. The RMSD between two docked poses was
calculated based on the ligand residues within 7 angstroms of the
binding interface. Docked protein poses representing the cluster
centers were considered as decoy models. ZDOCK uses shape
complementarity along with desolvation and electrostatic energy
terms (`ZRANK`) to rank the docked poses. Each of these decoys was
further refined using CHARMm minimization.
[0303] The X-ray structures were combined with the decoy models for
evaluating the sensitivity of the prediction methods.
Homology Modeling of 4E11 Fv
[0304] Structural model of 4E11 Fv was built using SIWW-MODEL
homology modeling server. Studies indicated that the overall
accuracy of modeling the hypervariable CDR was appropriate when (1)
the degree of sequence similarity between the target and the
template was high, (2) main-chain conformations of the CDR loops
L1, L2, L3, H1, H2 follow the "canonical structure" and (3) heavy
chain CDR3 (H3) was not unusually long.
Computational Docking for Generating 4E11-EDIII (DV 1-4) Poses
[0305] The modeled Fv was docked against EDIII of a select DV1
strain using ZDOCK. DV1 antigen was used because mAb 4E11 was
originally isolated from a mouse infected with a DV1 virus. The
structure of the DV1 antigen was modeled using SWISS MODEL homology
modeling server keeping the solved crystal structure of DV1 EDIII
(PDB: 3IRC) as the template. ZDOCK uses shape complementarity along
with desolvation and electrostatic energy terms (`ZRANK`) to rank
the docked poses. In order to ensure the docked poses do not
deviate significantly from the native complex, mapped epitope and
paratope residues found in the literature were forced to be
included in the binding interface. Residues included in the
interface were 307K, 389L and 391W (epitope; DV1 numbering as in
3IRC) and 101W, 102E (paratope; numbering based on sequence
position).
[0306] The structures of 4E11 in complex with DV 2, 3, 4 (EDIII)
were modeled using 4E11-DV1 EDIII structural model as the
template.
Equivalents and Scope
[0307] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the invention, described
herein. The scope of the present invention is not intended to be
limited to the above Description, but rather is as set forth in the
appended claims.
[0308] In the claims articles such as "a," "an," and "the" may mean
one or more than one unless indicated to the contrary or otherwise
evident from the context. Claims or descriptions that include "or"
between one or more members of a group are considered satisfied if
one, more than one, or all of the group members are present in,
employed in, or otherwise relevant to a given product or process
unless indicated to the contrary or otherwise evident from the
context. The invention includes embodiments in which exactly one
member of the group is present in, employed in, or otherwise
relevant to a given product or process. The invention includes
embodiments in which more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process. Furthermore, it is to be understood that the invention
encompasses all variations, combinations, and permutations in which
one or more limitations, elements, clauses, descriptive terms,
etc., from one or more of the listed claims is introduced into
another claim. For example, any claim that is dependent on another
claim can be modified to include one or more limitations found in
any other claim that is dependent on the same base claim.
Furthermore, where the claims recite a composition, it is to be
understood that methods of using the composition for any of the
purposes disclosed herein are included, and methods of making the
composition according to any of the methods of making disclosed
herein or other methods known in the art are included, unless
otherwise indicated or unless it would be evident to one of
ordinary skill in the art that a contradiction or inconsistency
would arise.
[0309] Where elements are presented as lists, e.g., in Markush
group format, it is to be understood that each subgroup of the
elements is also disclosed, and any element(s) can be removed from
the group. It should it be understood that, in general, where the
invention, or aspects of the invention, is/are referred to as
comprising particular elements, features, etc., certain embodiments
of the invention or aspects of the invention consist, or consist
essentially of, such elements, features, etc. For purposes of
simplicity those embodiments have not been specifically set forth
in haec verba herein. It is noted that the term "comprising" is
intended to be open and permits the inclusion of additional
elements or steps.
[0310] Where ranges are given, endpoints are included. Furthermore,
it is to be understood that unless otherwise indicated or otherwise
evident from the context and understanding of one of ordinary skill
in the art, values that are expressed as ranges can assume any
specific value or subrange within the stated ranges in different
embodiments of the invention, to the tenth of the unit of the lower
limit of the range, unless the context clearly dictates
otherwise.
[0311] In addition, it is to be understood that any particular
embodiment of the present invention that falls within the prior art
may be explicitly excluded from any one or more of the claims.
Since such embodiments are deemed to be known to one of ordinary
skill in the art, they may be excluded even if the exclusion is not
set forth explicitly herein.
[0312] The publications discussed above and throughout the text are
provided solely for their disclosure prior to the filing date of
the present application. Nothing herein is to be construed as an
admission that the inventors are not entitled to antedate such
disclosure by virtue of prior disclosure.
[0313] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the invention described
herein. The scope of the present invention is not intended to be
limited to the above Description, but rather is as set forth in the
following claims:
Sequence CWU 1
1
281117PRTArtificial Sequencewt 4E11 HC 1Glu Val Lys Leu Leu Glu Gln
Ser Gly Ala Glu Leu Val Lys Pro Gly 1 5 10 15 Ala Ser Val Arg Leu
Ser Cys Thr Ala Ser Gly Phe Asn Ile Lys Asp 20 25 30 Thr Tyr Met
Ser Trp Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp 35 40 45 Ile
Gly Arg Ile Asp Pro Ala Asn Gly Asp Thr Lys Tyr Asp Pro Lys 50 55
60 Phe Gln Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn Thr Ala
65 70 75 80 Tyr Leu His Leu Ser Ser Leu Thr Ser Gly Asp Thr Ala Val
Tyr Tyr 85 90 95 Cys Ser Arg Gly Trp Glu Gly Phe Ala Tyr Trp Gly
Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ala 115
2112PRTArtificial Sequencewt 4E11 LC 2Glu Leu Val Met Thr Gln Thr
Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile
Ser Cys Arg Ala Ser Glu Asn Val Asp Arg Tyr 20 25 30 Gly Asn Ser
Phe Met His Trp Tyr Gln Gln Lys Ala Gly Gln Pro Pro 35 40 45 Lys
Leu Leu Ile Tyr Arg Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala 50 55
60 Arg Phe Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr Leu Thr Ile Asn
65 70 75 80 Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Phe Cys Gln Arg
Ser Asn 85 90 95 Glu Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu
Glu Ile Lys Arg 100 105 110 326PRTArtificial Sequencewt 4E11 HC FR1
3Glu Val Lys Leu Leu Glu Gln Ser Gly Ala Glu Leu Val Lys Pro Gly 1
5 10 15 Ala Ser Val Arg Leu Ser Cys Thr Ala Ser 20 25
419PRTArtificial Sequencewt 4E11 HC FR2 4Tyr Met Ser Trp Val Lys
Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile 1 5 10 15 Gly Arg Ile
541PRTArtificial Sequencewt 4E11 HC FR3 5Thr Lys Tyr Asp Pro Lys
Phe Gln Gly Lys Ala Thr Ile Thr Ala Asp 1 5 10 15 Thr Ser Ser Asn
Thr Ala Tyr Leu His Leu Ser Ser Leu Thr Ser Gly 20 25 30 Asp Thr
Ala Val Tyr Tyr Cys Ser Arg 35 40 611PRTArtificial Sequencewt 4E11
HC FR4 6Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ala 1 5 10
77PRTArtificial Sequencewt 4E11 HC CDR1 7Gly Phe Asn Ile Lys Asp
Thr 1 5 86PRTArtificial Sequencewt 4E11 HC CDR2 8Asp Pro Ala Asn
Gly Asp 1 5 97PRTArtificial Sequencewt 4E11 HC CDR3 9Gly Trp Glu
Gly Phe Ala Tyr 1 5 1023PRTArtificial Sequencewt 4E11 LC FR1 10Glu
Leu Val Met Thr Gln Thr Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10
15 Gln Arg Ala Thr Ile Ser Cys 20 1115PRTArtificial Sequencewt 4E11
LC FR2 11Trp Tyr Gln Gln Lys Ala Gly Gln Pro Pro Lys Leu Leu Ile
Tyr 1 5 10 15 1232PRTArtificial Sequencewt 4E11 LC FR3 12Gly Ile
Pro Ala Arg Phe Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr 1 5 10 15
Leu Thr Ile Asn Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Phe Cys 20
25 30 1311PRTArtificial Sequencewt 4E11 LC FR4 13Phe Gly Gly Gly
Thr Lys Leu Glu Ile Lys Arg 1 5 10 1415PRTArtificial Sequencewt
4E11 LC CDR1 14Arg Ala Ser Glu Asn Val Asp Arg Tyr Gly Asn Ser Phe
Met His 1 5 10 15 157PRTArtificial Sequencewt 4E11 LC CDR2 15Arg
Ala Ser Asn Leu Glu Ser 1 5 169PRTartificialwt 4E11 LC CDR3 16Gln
Arg Ser Asn Glu Val Pro Trp Thr 1 5 1793PRTDengue virus type 1
17Met Cys Thr Gly Ser Phe Lys Leu Glu Lys Glu Val Ala Glu Thr Gln 1
5 10 15 His Gly Thr Val Leu Val Gln Val Lys Tyr Glu Gly Thr Asp Ala
Pro 20 25 30 Cys Lys Ile Pro Phe Ser Ser Gln Asp Glu Lys Gly Val
Thr Gln Asn 35 40 45 Gly Arg Leu Ile Thr Ala Asn Pro Ile Val Thr
Asp Lys Glu Lys Pro 50 55 60 Val Asn Ile Glu Ala Glu Pro Pro Phe
Gly Glu Ser Tyr Ile Val Val 65 70 75 80 Gly Ala Gly Glu Lys Ala Leu
Lys Leu Ser Trp Phe Lys 85 90 1893PRTDengue virus type 2 18Met Cys
Thr Gly Lys Phe Lys Val Val Lys Glu Ile Ala Glu Thr Gln 1 5 10 15
His Gly Thr Met Val Ile Arg Val Gln Tyr Glu Gly Asp Asp Ser Pro 20
25 30 Cys Lys Ile Pro Phe Glu Ile Met Asp Leu Glu Lys Lys His Val
Leu 35 40 45 Gly Arg Leu Ile Thr Val Asn Pro Ile Val Ile Glu Lys
Asp Ser Pro 50 55 60 Ile Asn Ile Glu Ala Glu Pro Pro Phe Gly Asp
Ser Tyr Ile Ile Ile 65 70 75 80 Gly Val Glu Pro Gly Gln Leu Lys Leu
Asn Trp Phe Lys 85 90 1993PRTDengue virus type 3 19Met Cys Thr Asn
Thr Phe Val Leu Lys Lys Glu Val Ser Glu Thr Gln 1 5 10 15 His Gly
Thr Ile Leu Ile Lys Val Glu Tyr Lys Gly Glu Asp Ala Pro 20 25 30
Cys Lys Ile Pro Phe Ser Thr Glu Asp Gly Gln Gly Lys Ala His Asn 35
40 45 Gly Arg Leu Ile Thr Ala Asn Pro Val Val Thr Lys Lys Glu Glu
Pro 50 55 60 Val Asn Ile Glu Ala Glu Pro Pro Phe Gly Glu Ser Asn
Ile Val Ile 65 70 75 80 Gly Ile Gly Asp Asn Ala Leu Lys Ile Asn Trp
Tyr Lys 85 90 2093PRTDengue virus type 4 20Met Cys Ser Gly Lys Phe
Ser Ile Asp Lys Glu Met Ala Glu Thr Gln 1 5 10 15 His Gly Thr Thr
Val Val Lys Val Lys Tyr Glu Gly Ala Gly Ala Pro 20 25 30 Cys Lys
Val Pro Ile Glu Ile Arg Asp Val Asn Lys Glu Lys Val Val 35 40 45
Gly Arg Ile Ile Ser Ser Thr Pro Leu Ala Glu Asn Thr Asn Ser Val 50
55 60 Thr Asn Ile Glu Leu Glu Pro Pro Phe Gly Asp Ser Tyr Ile Val
Ile 65 70 75 80 Gly Val Gly Asn Ser Ala Leu Thr Leu His Trp Phe Arg
85 90 21117PRTArtificial SequenceHC of provided antibody agents
21Glu Val Lys Leu Leu Glu Gln Ser Gly Ala Glu Leu Val Lys Pro Gly 1
5 10 15 Ala Ser Val Arg Leu Ser Cys Thr Ala Ser Gly Phe Asn Ile Lys
Asp 20 25 30 Thr Tyr Met Ser Trp Val Lys Gln Arg Pro Glu Gln Gly
Leu Glu Trp 35 40 45 Ile Gly Arg Ile Asp Pro Glu Asn Gly Asp Thr
Lys Tyr Asp Pro Lys 50 55 60 Phe Gln Gly Lys Ala Thr Ile Thr Ala
Asp Thr Ser Ser Asn Thr Ala 65 70 75 80 Tyr Leu His Leu Ser Ser Leu
Thr Ser Gly Asp Thr Ala Val Tyr Tyr 85 90 95 Cys Ser Arg Gly Trp
Glu Gly Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val
Ser Ala 115 22112PRTArtificial SequenceLC of provided antibody
agents 22Glu Leu Val Met Thr Gln Thr Pro Ala Ser Leu Ala Val Ser
Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Glu Asn
Val Asp Lys Tyr 20 25 30 Gly Asn Ser Phe Met His Trp Tyr Gln Gln
Lys Ala Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile Tyr Arg Ala Ser
Glu Leu Gln Trp Gly Ile Pro Ala 50 55 60 Arg Phe Ser Gly Ser Gly
Ser Arg Thr Asp Phe Thr Leu Thr Ile Asn 65 70 75 80 Pro Val Glu Ala
Asp Asp Val Ala Thr Tyr Phe Cys Gln Arg Ser Asn 85 90 95 Glu Val
Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105 110
237PRTArtificial SequenceHC CDR1 of provided antibody agents 23Gly
Phe Asn Ile Lys Asp Thr 1 5 246PRTArtificial SequenceHC CDR2 of
provided antibody agents 24Asp Pro Glu Asn Gly Asp 1 5
257PRTartificialHC CDR3 of provided antibody agents 25Gly Trp Glu
Gly Phe Ala Tyr 1 5 2615PRTArtificial SequenceLC CDR1 of provided
antibody agents 26Arg Ala Ser Glu Asn Val Asp Lys Tyr Gly Asn Ser
Phe Met His 1 5 10 15 277PRTArtificial SequenceLC CDR2 of provided
antibody agents 27Arg Ala Ser Glu Leu Gln Trp 1 5 289PRTArtificial
SequenceLC CDR3 of provided antibody agents 28Gln Arg Ser Asn Glu
Val Pro Trp Thr 1 5
* * * * *
References