U.S. patent application number 15/959663 was filed with the patent office on 2018-08-30 for methods of treating a fatty acid amide hydrolase-mediated condition.
The applicant listed for this patent is Infinity Pharmaceuticals, Inc.. Invention is credited to Brian C. Austad, Louis Grenier, Michael J. Grogan, Tao Liu, Theodore A. Martinot, Priscilla L. White, Lin-Chen Yu.
Application Number | 20180244700 15/959663 |
Document ID | / |
Family ID | 43827639 |
Filed Date | 2018-08-30 |
United States Patent
Application |
20180244700 |
Kind Code |
A1 |
Austad; Brian C. ; et
al. |
August 30, 2018 |
METHODS OF TREATING A FATTY ACID AMIDE HYDROLASE-MEDIATED
CONDITION
Abstract
The present invention provides fatty acid amide hydrolase
inhibitors, solid forms thereof, compositions thereof, and methods
of making and using the same.
Inventors: |
Austad; Brian C.;
(Tewksbury, MA) ; Grenier; Louis; (Newton, MA)
; Grogan; Michael J.; (Winchester, MA) ; Liu;
Tao; (Ashland, MA) ; White; Priscilla L.;
(Malden, MA) ; Martinot; Theodore A.; (Jamaica
Plain, MA) ; Yu; Lin-Chen; (Quincy, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Infinity Pharmaceuticals, Inc. |
Cambridge |
MA |
US |
|
|
Family ID: |
43827639 |
Appl. No.: |
15/959663 |
Filed: |
April 23, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14631712 |
Feb 25, 2015 |
9951089 |
|
|
15959663 |
|
|
|
|
13019262 |
Feb 1, 2011 |
9034849 |
|
|
14631712 |
|
|
|
|
61301181 |
Feb 3, 2010 |
|
|
|
61412734 |
Nov 11, 2010 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 17/02 20180101;
A61P 1/08 20180101; A61P 25/20 20180101; A61P 13/10 20180101; A61P
15/00 20180101; A61P 3/04 20180101; A61P 25/00 20180101; A61P 37/00
20180101; A61P 37/02 20180101; A61P 1/04 20180101; A61P 9/12
20180101; A61P 29/00 20180101; A61P 43/00 20180101; A61P 3/00
20180101; A61P 17/00 20180101; A61P 19/02 20180101; C07B 2200/13
20130101; A61P 21/00 20180101; A61P 25/28 20180101; A61P 1/02
20180101; C07F 5/05 20130101; A61P 25/08 20180101; A61P 9/00
20180101; A61P 9/10 20180101; A61P 17/04 20180101; C07F 5/025
20130101; A61P 1/00 20180101; A61P 27/06 20180101; A61P 25/36
20180101 |
International
Class: |
C07F 5/05 20060101
C07F005/05; C07F 5/02 20060101 C07F005/02 |
Claims
1. A method of preparing Compound 1: ##STR00041## or a
pharmaceutically acceptable salt, hydrate or solvate thereof, or
anhydride thereof; comprising the steps of: (a) coupling a compound
of formula E-1: ##STR00042## wherein: LG.sup.1 and LG.sup.2 are
independently selected from a halogen or sulfonate; with a compound
of formula E-2: ##STR00043## wherein each R.sup.1 and R.sup.2 is
independently selected from hydrogen or an C.sub.1-6 alkyl,
C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.6-12 aryl or C.sub.6-12
heteroaryl group, or R.sup.1 and R.sup.2 are joined to form a 5-8
membered ring; in order to provide a compound of formula E-3:
##STR00044## wherein: LG.sup.2 is selected from a halogen or
sulfonate; and (b) reacting E-3 with a boronation reagent and a
metal reagent in order to provide Compound 1 or a pharmaceutically
acceptable salt, hydrate or solvate thereof, or anhydride
thereof.
2. The method according to claim 1, wherein the method further
comprises crystallizing Compound 1 of step (b) to provide
crystalline Compound 1.
3. The method according to claim 2, wherein the crystallizing step
comprises crystallizing Compound 1 from a polar solution comprising
water, a polar apolar solvent or a mixture thereof.
4. The method according to claim 2, wherein the crystallizing step
comprises crystallizing Compound 1 from a mixture of water and
acetone.
5. The method according to claim 2, wherein the crystalline
Compound 1 is further washed with a non-polar solution.
6. The method according to claim 5, wherein the non-polar solution
comprises hexanes, heptanes or a mixture thereof.
7. The method according to claim 1, wherein E-1 is E-1b:
##STR00045##
8. The method according to claim 1, wherein E-2 is E-2a:
##STR00046##
9. The method according to claim 1, wherein E-3 is E-3a:
##STR00047##
10. The method according to claim 1, wherein the coupling step
comprises a palladium catalyst.
11. The method according to claim 10, wherein the palladium
catalyst is selected from Pd(PPh.sub.3).sub.4, Pd(OAc).sub.2,
Pd.sub.2(dba).sub.3, Pd(dppf).sub.2Cl.sub.2, and
PdCl.sub.2(PPh.sub.3).sub.2.
12. The method according to claim 1, wherein the coupling step
comprises a base.
13. The method according to claim 12, wherein the base is selected
from triethylamine, diisopropylethylamine, potassium carbonate,
sodium carbonate, cesium carbonate, potassium bicarbonate, sodium
bicarbonate, cesium bicarbonate, potassium acetate, sodium acetate,
potassium phosphate, lithium hydroxide, sodium hydroxide and
magnesium hydroxide.
14. The method according to claim 1, wherein the boronation reagent
is a boronate ester.
15. The method according to claim 14, wherein the boronate ester is
selected from trimethyl borate, triethyl borate, triallyl borate,
triisopropyl borate, Tributyl borate, Tri-tert-butyl borate,
Tripentyl borate, Trihexyl borate, Tritolyl borate, Tribenzyl
borate, Triphenyl borate, Trimethylene borate, Triethanolamine
borate, Trimethallyl borate,
2-Methoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Methoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-Isopropoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Isopropoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-(2-dimethylaminoethoxy)-4-methyl-1,3,2-dioxaborinane,
2-butoxy-4,4,6-trimethylL-1,3,2-dioxaborinane, tris
(2,2,2-trifluoroethyl) borate, tris(1-isopropyl-2-methylpropyl)
borate, and
2,2'-(2-methyl-2,4-pentanediyldioxy)bis(4,4,6-trimethyl-1,3,2-dioxabo-
rinane).
16. The method according to claim 1, wherein the metal reagent is
an alkyl lithium reagent comprising n-butyllithium or
hexyllithium.
17. The method according to claim 1, wherein the method step (b)
further comprises the steps of dehydrating Compound 1 in order to
provide an anhydride of Compound 1 followed by hydrolyzing the
anhydride of Compound 1 in order to provide Compound 1, or a
pharmaceutically acceptable salt, hydrate or solvate thereof.
18. The method according to claim 17, wherein the anhydride of
Compound 1 is Compound 2: ##STR00048## or a pharmaceutically
acceptable salt, hydrate or solvate thereof.
19. A method of treating an FAAH-mediated condition comprising
administering to a subject in need thereof a therapeutically
effective amount of a solid form of a crystalline compound of
formula 1: ##STR00049## or a pharmaceutically acceptable salt,
hydrate, or solvate thereof, or anhydride thereof.
20. The method according to claim 19, wherein the FAAH-mediated
condition is selected from the group consisting of a painful
condition, an inflammatory condition, an immune disorder, a
disorder of the central nervous system, a metabolic disorder, a
cardiac disorder and glaucoma.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 14/631,712, filed Feb. 25, 2015, pending,
which is a divisional of U.S. patent application Ser. No.
13/019,262, filed Feb. 1, 2011, now U.S. Pat. No. 9,034,849, issued
May 19, 2015, which application claims priority to U.S. Provisional
Application No. 61/301,181, filed Feb. 3, 2010, and U.S.
Provisional Application No. 61/412,734, filed Nov. 11, 2010, the
disclosure of each of which is hereby incorporated herein in its
entirety by this reference.
STATEMENT ACCORDING TO 37 C.F.R. .sctn. 1.821(c) or (e)--SEQUENCE
LISTING SUBMITTED AS PDF FILE WITH A REQUEST TO TRANSFER CRF FROM
PARENT APPLICATION
[0002] Pursuant to 37 C.F.R. .sctn. 1.821(c) or (e), a file
containing a PDF version of the Sequence Listing has been submitted
concomitant with this application, the contents of which are hereby
incorporated by reference. The transmittal documents of this
application include a Request to Transfer CRF from the parent
application.
BACKGROUND OF THE INVENTION
[0003] Fatty acid amide hydrolase (FAAH), also referred to as
oleamide hydrolase and anandamide amidohydrolase, is an integral
membrane protein responsible for the hydrolysis of several
important endogenous neuromodulating fatty acid amides (FAAs),
including anandamide, oleoylethanolamide and palmitoylethanolamide,
and is intimately involved in their regulation. Because these FAAs
interact with cannabinoid and vanilliod receptors, they are often
referred to as "endocannabinoids" or "endovanilliods." Initial
interest in this area focused on developing FAAH inhibitors to
augment the actions of FAAs and reduce pain. Further investigation
found FAAH inhibitors, through interactions of the FAAs with unique
extracellular and intracellular receptors, can be used to treat a
variety of conditions that include, but are not limited to,
inflammation, metabolic disorders (e.g., obesity-related conditions
and wasting conditions such as cachexias and anorexia), disorders
of the central nervous system (e.g., disorders associated with
neurotoxicity and/or neurotrauma, stroke, multiple sclerosis,
spinal cord injury, movement disorders such as basal ganglia
disorders, amylotrophic lateral sclerosis, Alzheimer's disease,
epilepsy, mental disorders such as anxiety, depression, learning
disorders and Schizophrenia, sleep disorders such as insomnia,
nausea and/or emesis, and drug addiction), cardiac disorders (e.g.,
hypertension, circulatory shock, myocardial reperfusion injury and
atherosclerosis) and glaucoma (Pacher et al., "The Endocannabinoid
System as an Emerging Target of Pharmacotherapy," Pharmacological
Reviews (2006) 58:389-462; Pillarisetti et al., "Pain and Beyond:
Fatty Acid Amides and Fatty Acid Amide Hydrolase Inhibitors in
Cardiovascular and Metabolic Diseases," Drug Discovery Today (2009)
597:1-14).
SUMMARY OF THE INVENTION
[0004] Compound 1 is a potent FAAH inhibitor and is, therefore,
useful for treating conditions mediated by FAAH.
[0005] Provided herein are, among other things, crystalline
Compound 1, pharmaceutically acceptable salts, hydrates or solvates
thereof and/or anhydrides thereof, improved methods of making
Compound 1, pharmaceutical compositions comprising Compound 1
and/or anhydrides thereof, and methods of using the same in the
treatment of FAAH-mediated conditions. Such embodiments and others
are described herein.
##STR00001##
[0006] For example, in one aspect, provided is crystalline Compound
1, or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0007] In certain embodiments, crystalline Compound 1 is
substantially free of any one of the following compounds:
##STR00002##
[0008] In certain embodiments, crystalline Compound 1 is
substantially free of amorphous Compound 1.
[0009] In certain embodiments, crystalline Compound 1 is
substantially free of other crystalline forms of Compound 1.
[0010] In certain embodiments, crystalline Compound 1 is
substantially free of one or more anhydrides of Compound 1.
[0011] In certain embodiments, one or more anhydrides are selected
from Compound 2:
##STR00003##
[0012] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0013] In certain embodiments, crystalline Compound 1 is pure and
isolated.
[0014] In certain embodiments, crystalline Compound 1 is
crystalline Form A having at least one of the following
characteristics: [0015] (i) one or more transition temperatures
selected from about 128.+-.5.degree. C. and about 244.+-.2.degree.
C. as determined by differential scanning calorimetry (DSC); [0016]
(ii) one or more peaks in an X-ray powder diffraction (XRPD)
pattern selected from 9.68.+-.0.10, 17.26.+-.0.10, 21.60.+-.0.10,
24.68.+-.0.10, 25.48.+-.0.10, 27.73.+-.0.10 and 29.08.+-.0.10
.theta.-2.theta. (degrees); [0017] (iii) an X-ray powder
diffraction (XRPD) pattern substantially similar to that depicted
in FIG. 1, 19 (row A), 22, or 23; and/or [0018] (iv) a differential
scanning calorimetry (DSC) scan substantially similar to that
depicted in FIG. 2.
[0019] In another aspect, also provided is an anhydride of Compound
1, also referred to herein as Compound 2:
##STR00004##
[0020] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0021] In certain embodiments, Compound 2 is provided as
crystalline Compound 2, or a pharmaceutically acceptable salt,
hydrate or solvate thereof.
[0022] In certain embodiments, crystalline Compound 2 is
substantially free of any one of the following compounds:
##STR00005##
[0023] In certain embodiments, crystalline Compound 2 is
substantially free of amorphous Compound 2.
[0024] In certain embodiments, crystalline Compound 2 is
substantially free of other crystalline forms of Compound 2.
[0025] In certain embodiments, crystalline Compound 2 is
substantially free of Compound 1 or other anhydrides thereof.
[0026] In certain embodiments, crystalline Compound 2 is pure and
isolated.
[0027] In certain embodiments, crystalline Compound 2 is
crystalline Form I having at least one of the following
characteristics: [0028] (i) one or more transition temperatures
selected from about 112.+-.5.degree. C. and about 241.+-.2.degree.
C. as determined by differential scanning calorimetry (DSC); [0029]
(ii) one or more peaks in an X-ray powder diffraction (XRPD)
pattern selected from 6.32.+-.0.10, 12.69.+-.0.10, 17.69.+-.0.10,
and 26.77.+-.0.10; [0030] (iii) an X-ray powder diffraction (XRPD)
pattern substantially similar to that depicted in FIG. 8, 28, or
29; and/or [0031] (iv) a diffraction scanning calorimetry (DSC)
scan substantially similar to that depicted in FIG. 18.
[0032] In another aspect, provided is a pharmaceutical composition
comprising crystalline Compound 1:
##STR00006##
[0033] or a pharmaceutically acceptable salt, hydrate or solvate
thereof, and a pharmaceutically acceptable excipient.
[0034] In certain embodiments, the pharmaceutical composition
further comprises crystalline Compound 2:
##STR00007##
[0035] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0036] In yet another aspect, provided is a method of preparing
Compound 1:
##STR00008##
[0037] or a pharmaceutically acceptable salt, hydrate or solvate
thereof; comprising the steps of:
[0038] (a) coupling a compound of formula E-1:
##STR00009##
[0039] wherein:
[0040] LG.sup.1 and LG.sup.2 are independently selected from a
halogen or sulfonate;
[0041] with a compound of formula E-2:
##STR00010##
[0042] wherein each R.sup.1 and R.sup.2 is independently selected
from hydrogen or an C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6
alkynyl, C.sub.6-12 aryl or C.sub.6-12 heteroaryl group, or R.sup.1
and R.sup.2 are joined to form a 5-8 membered ring;
[0043] in order to provide a compound of formula E-3:
##STR00011##
[0044] wherein:
[0045] LG.sup.2 is selected from a halogen or sulfonate; and
[0046] (b) reacting E-3 with a boronation reagent and a metal
reagent in order to provide Compound 1.
[0047] In certain embodiments, the method further comprises
crystallizing Compound 1 of step (b) to provide crystalline
Compound 1.
[0048] In certain embodiments, the crystallizing step comprises
crystallizing Compound 1 from a polar solution comprising water, a
polar apolar solvent or a mixture thereof.
[0049] In certain embodiments, the crystallizing step comprises
crystallizing Compound 1 from a mixture of water and acetone.
[0050] In certain embodiments, the crystalline Compound 1 is
further washed with a non-polar solution.
[0051] In certain embodiments, the non-polar solution comprises
hexanes, heptanes or a mixture thereof.
[0052] In certain embodiments, E-1 is E-1b:
##STR00012##
[0053] In certain embodiments, E-2 is E-2a:
##STR00013##
[0054] In certain embodiments, E-3 is E-3a:
##STR00014##
[0055] In certain embodiments, the coupling step comprises a
palladium catalyst. In certain embodiments, the palladium catalyst
is selected from Pd(PPh.sub.3).sub.4, Pd(OAc).sub.2,
Pd.sub.2(dba).sub.3, Pd(dppf).sub.2Cl.sub.2, and
PdCl.sub.2(PPh.sub.3).sub.2.
[0056] In certain embodiments, the coupling step comprises a base.
In certain embodiments, the base is selected from triethylamine,
diisopropylethylamine, potassium carbonate, sodium carbonate,
cesium carbonate, potassium bicarbonate, sodium bicarbonate, cesium
bicarbonate, potassium acetate, sodium acetate, potassium
phosphate, lithium hydroxide, sodium hydroxide and magnesium
hydroxide.
[0057] In certain embodiments, the boronation reagent is a boronate
ester. In certain embodiments, the boronate ester is selected from
trimethyl borate, triethyl borate, triallyl borate, triisopropyl
borate, Tributyl borate, Tri-tert-butyl borate, Tripentyl borate,
Trihexyl borate, Tritolyl borate, Tribenzyl borate, Triphenyl
borate, Trimethylene borate, Triethanolamine borate, Trimethallyl
borate, 2-Methoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Methoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-Isopropoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Isopropoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-(2-dimethylaminoethoxy)-4-methyl-1,3,2-dioxaborinane,
2-butoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
tris(2,2,2-trifluoroethyl) borate, tris(1-isopropyl-2-methylpropyl)
borate, and
2,2'-(2-methyl-2,4-pentanediyldioxy)bis(4,4,6-trimethyl-1,3,2-dioxaborina-
ne).
[0058] In certain embodiments, the metal reagent is an alkyl
lithium reagent. In certain embodiments, the alkyl lithium reagent
is n-butyllithium or hexyllithium. In certain embodiments, the
metal reagent is an alkylmagnesium halide. In some embodiments, the
alkylmagnesium halide is methylmagnesium bromide.
[0059] In certain embodiments, the method step (b) further
comprises the steps of dehydrating Compound 1 in order to provide
an anhydride of Compound 1 followed by hydrolysis of the anhydride
of Compound 1 in order to provide Compound 1. In certain
embodiments, the dehydration step is performed in situ (i.e.,
Compound 1 is not isolated). In certain embodiments, the hydrolysis
step is performed by addition of water to the anhydride of Compound
1.
[0060] In certain embodiments, the anhydride of Compound 1 is
Compound 2:
##STR00015##
[0061] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0062] In certain embodiments, this method provides pure and
isolated crystalline Compound 1. In certain embodiments, these
additional steps (i.e., dehydration followed by hydrolysis) provide
pure and isolated crystalline Compound 1.
[0063] In yet another aspect, provided is a method of treating an
FAAH-mediated condition comprising administering to a subject in
need thereof a therapeutically effective amount of crystalline
Compound 1, as defined herein.
[0064] In certain embodiments, the FAAH-mediated condition is
selected from a painful condition, an inflammatory condition, an
immune disorder, a disorder of the central nervous system, a
metabolic disorder, a cardiac disorder and glaucoma.
[0065] In certain embodiments, the FAAH-mediated condition is a
painful condition selected from neuropathic pain, central pain,
deafferentation pain, chronic pain, post-operative pain,
pre-operative pain, nociceptive pain, acute pain, non-inflammatory
pain, inflammatory pain, pain associated with cancer, wound pain,
burn pain, pain associated with medical procedures, pain resulting
from pruritus, painful bladder syndrome, pain associated with
premenstrual dysphoric disorder, pain associated with premenstrual
syndrome, pain associated with chronic fatigue syndrome, pain
associated with pre-term labor, pain associated with withdrawal
symptoms from drug addiction, joint pain, arthritic pain,
lumbosacral pain, musculo-skeletal pain, headache, migraine, muscle
ache, lower back pain, neck pain, toothache dental/maxillofacial
pain and visceral pain.
[0066] In certain embodiments, the FAAH-mediated condition is an
inflammatory condition or an immune disorder.
[0067] In certain embodiments, the inflammatory condition or immune
disorder is a gastrointestinal disorder.
[0068] In certain embodiments, the inflammatory condition or immune
disorder is a skin condition.
[0069] In certain embodiments, the FAAH-mediated condition is a
disorder of the central nervous system selected from neurotoxicity
and/or neurotrauma, stroke, multiple sclerosis, spinal cord injury,
epilepsy, a mental disorder, a sleep condition, a movement
disorder, nausea and/or emesis, amyotrophic lateral sclerosis,
Alzheimer's disease and drug addiction.
[0070] In certain embodiments, the FAAH-mediated condition is a
metabolic disorder selected from a wasting condition or an
obesity-related condition or complication thereof.
[0071] In certain embodiments, the FAAH-mediated condition is a
cardiac disorder selected from hypertension, circulatory shock,
myocardial reperfusion injury and atherosclerosis.
[0072] In certain embodiments, the FAAH-mediated condition is
glaucoma.
[0073] In yet another aspect, provided is a compound of the
formula:
##STR00016##
[0074] or a pharmaceutically acceptable salt, solvate or hydrate
thereof.
BRIEF DESCRIPTION OF THE DRAWINGS
[0075] FIG. 1 shows an X-ray Diffraction Pattern of Form A of
Compound 1.
[0076] FIG. 2 shows a Differential Scanning calorimetry (DSC) trace
of Form A of Compound 1.
[0077] FIG. 3 shows a multiple chromatogram overlay of the Suzuki
cross-coupling reaction in eight different solvents. The peak at 5
minutes is the starting material. The peak at 6 minutes is the
product.
[0078] FIG. 4 shows a multiple chromatogram overlay of the initial
base screen for the Suzuki cross-coupling. For all experiments,
three equivalents of base were added relative to the limiting
trihalide starting material.
[0079] FIG. 5 shows a multiple chromatogram overlay of the organic
base screen for the Suzuki cross-coupling. All reactions were
performed using 1-PrOH as the only solvent. The catalyst, unless
otherwise noted, was PdCl.sub.2(PPh.sub.3).sub.2. Unless otherwise
noted, 3 equivalents of base were used in each experiment.
[0080] FIG. 6 shows the multiple chromatogram overlay of the
catalyst screen for the Suzuki cross-coupling. (a)
Pd(PPh.sub.3).sub.4/K.sub.2CO.sub.3; (b) Pd(OAc).sub.2/PPh.sub.3;
(c) Pd(OAc).sub.2; (d) Pd.sub.2(dba).sub.3/PPh.sub.3; (e)
Pd.sub.2(dba).sub.3; (f) Pd(dppf).sub.2Cl.sub.2; (g)
Pd(PPh.sub.3).sub.4. (dba=dibenzylideneacetone;
dppf=(diphenylphosphoryl)ferrocene). All reactions, except for (a),
used NaHCO.sub.3 as the base. The solvent for all reactions was
1-PrOH/water. 3 Mol % of Pd was used for all reactions except (b)
and (d).
[0081] FIG. 7 depicts impurities generated during the synthesis of
Compound 1.
[0082] FIG. 8 depicts an XRPD pattern of a representative lot of
Form I of the Compound 1 anhydride (e.g., Form I of Compound
2).
[0083] FIG. 9 shows a comparison of Compound 1 isolated from 1)
n-heptane (a; 20.times. magnification); and 2) acetone/water (b;
10.times. magnification) with a pause after nucleation to allow for
crystal growth.
[0084] FIG. 10 shows a comparison of HPLC retention times for (a)
the synthesized impurity versus (b) the isolated impurity
IMP-4.
[0085] FIG. 11 shows a comparison of the UV spectra of the isolated
(bottom) and synthetic (top) IMP-4.
[0086] FIG. 12 shows a comparison of mass spectra of the isolated
(bottom) and synthetic (top) IMP-4.
[0087] FIG. 13 shows a comparison of full NMR spectra of the
isolated (bottom) and synthetic (top) IMP-4 (400 MHz in
acetone-d.sub.6).
[0088] FIG. 14 shows a comparison of the aromatic region of NMR
spectra of the isolated (bottom) and synthetic (top) IMP-4 (400 MHz
in acetone-d.sub.6).
[0089] FIG. 15 shows a typical reaction IPC for the conversion of
E-3a to Compound 1 (complete reaction).
[0090] FIG. 16 shows a typical reaction IPC (14 hours) for the
formation of E-3a (complete reaction).
[0091] FIG. 17 shows a typical IPC for the conversion of E-3a to
Compound 1/Compound 1 anhydride (e.g., Compound 2) (complete
reaction).
[0092] FIG. 18 shows a Differential Scanning calorimetry (DSC)
trace of Form I of Compound 2.
[0093] FIG. 19 (rows A-D) shows an XRPD overlay of Form A and
Material B of Compound 1. Row A is an exemplary XRPD pattern of
Form A crystal form. Row B is an exemplary XRPD pattern of Material
B crystal form. Rows C and D show exemplary XRPD patterns for a
mixture of Form A and Material B crystal forms.
[0094] FIG. 20 shows an ORTEP drawing of Compound 1.
[0095] FIG. 21 shows hydrogen bonding in Compound 1.
[0096] FIG. 22 shows a calculated XRPD pattern of Form A of
Compound 1.
[0097] FIG. 23 shows an experimental XRPD pattern of Form A of
Compound 1.
[0098] FIG. 24 shows a packing diagram of a crystalline Compound 1
viewed down the crystallographic a axis.
[0099] FIG. 25 shows a packing diagram of a crystalline Compound 1
viewed down the crystallographic b axis.
[0100] FIG. 26 shows a packing diagram of a crystalline Compound 1
viewed down the crystallographic c axis.
[0101] FIG. 27 shows a comparison of the calculated XRPD pattern to
the experimental pattern of Form A of Compound 1.
[0102] FIG. 28 shows a PANALYTICAL.RTM. XRPD pattern of Form I of
Compound 2.
[0103] FIG. 29 shows an XRPD pattern of Form I of Compound 2.
[0104] FIG. 30 shows a proton NMR of crystalline Compound 2.
[0105] FIG. 31 shows an XRPD pattern of Form A1 of Compound 1.
[0106] FIG. 32 shows an XRPD pattern of Material B of Compound
1.
[0107] FIG. 33 shows an XRPD pattern of a mixture comprising
Material B of Compound 1 and a second component.
[0108] FIG. 34 shows a DSC and TGA overlay of Material B of
Compound 1.
[0109] FIG. 35 shows an XRPD pattern of Material B of Compound
1.
SEQUENCE IDENTIFICATION NUMBERS
TABLE-US-00001 [0110] SEQ ID NO: 1: Homo sapiens FAAH amino acid
sequence MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRA
GLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTY
VGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQ
DSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPL
FGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCG
ICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETK
QSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPC
LGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHE
IEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCL
DFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQ
CVALPWQEELCLRFMREVERLMTPEKQSS
DEFINITIONS
Chemical Definitions
[0111] Definitions of specific functional groups and chemical terms
are described in more detail below. For purposes of this invention,
the chemical elements are identified in accordance with the
Periodic Table of the Elements, CAS version, Handbook of Chemistry
and Physics, 75.sup.th Ed., inside cover, and specific functional
groups are generally defined as described therein. Additionally,
general principles of organic chemistry, as well as specific
functional moieties and reactivity, are described in Organic
Chemistry, Thomas Sorrell, University Science Books, Sausalito,
1999; Smith and March March's Advanced Organic Chemistry, 5.sup.th
Edition, John Wiley & Sons, Inc., New York, 2001; Larock,
Comprehensive Organic Transformations, VCH Publishers, Inc., New
York, 1989; Carruthers, Some Modern Methods of Organic Synthesis,
3.sup.rd Edition, Cambridge University Press, Cambridge, 1987.
[0112] The term "alkyl," as used herein, refers to saturated,
straight- or branched-chain optionally substituted hydrocarbon
radicals derived from an aliphatic moiety containing between one
and six carbon atoms (e.g., C.sub.1-6 alkyl) by removal of a single
hydrogen atom. In some embodiments, the alkyl group employed in the
invention contains 1-5 carbon atoms. In another embodiment, the
alkyl group employed contains 1-4 carbon atoms. In still other
embodiments, the alkyl group contains 1-3 carbon atoms. In yet
another embodiment, the alkyl group contains 1-2 carbons. Examples
of alkyl radicals include, but are not limited to, methyl, ethyl,
n-propyl, isopropyl, n-butyl, iso-butyl, sec-butyl, sec-pentyl,
iso-pentyl, tert-butyl, n-pentyl, neopentyl, n-hexyl, sec-hexyl,
n-heptyl, n-octyl, n-decyl, n-undecyl, dodecyl, and the like.
[0113] The term "alkenyl," as used herein, denotes a monovalent
group derived from a straight- or branched-chain optionally
substituted aliphatic moiety having at least one carbon-carbon
double bond by the removal of a single hydrogen atom. In certain
embodiments, the alkenyl group employed in the invention contains
2-6 carbon atoms (e.g., C.sub.2-6 alkenyl). In certain embodiments,
the alkenyl group employed in the invention contains 2-5 carbon
atoms. In some embodiments, the alkenyl group employed in the
invention contains 2-4 carbon atoms. In another embodiment, the
alkenyl group employed contains 2-3 carbon atoms. Alkenyl groups
include, for example, ethenyl, propenyl, butenyl,
1-methyl-2-buten-1-yl, and the like.
[0114] The term "alkynyl," as used herein, refers to a monovalent
group derived from a straight- or branched-chain optionally
substituted aliphatic moiety having at least one carbon-carbon
triple bond by the removal of a single hydrogen atom. In certain
embodiments, the alkynyl group employed in the invention contains
2-6 carbon atoms (e.g., C.sub.2-6 alkynyl). In certain embodiments,
the alkynyl group employed in the invention contains 2-5 carbon
atoms. In some embodiments, the alkynyl group employed in the
invention contains 2-4 carbon atoms. In another embodiment, the
alkynyl group employed contains 2-3 carbon atoms. Representative
alkynyl groups include, but are not limited to, ethynyl, 2-propynyl
(propargyl), 1-propynyl, and the like.
[0115] The term "aryl," used alone or as part of a larger moiety as
in "aralkyl," "aralkoxy," or "aryloxyalkyl," refers to monocyclic
and bicyclic optionally substituted ring systems having a total of
five to twelve ring members, wherein at least one ring in the
system is aromatic and wherein each ring in the system contains
three to seven ring members. In some embodiments, "aryl" refers to
monocyclic and bicyclic optionally substituted ring systems having
a total of six to twelve ring members (e.g., C.sub.6-12 aryl),
wherein at least one ring in the system is aromatic and wherein
each ring in the system contains three to seven ring members. The
term "aryl" may be used interchangeably with the term "aryl ring."
In certain embodiments of the present invention, "aryl" refers to
an aromatic ring system which includes, but is not limited to,
phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear
one or more substituents. Also included within the scope of the
term "aryl," as it is used herein, is a group in which an aromatic
ring is fused to one or more non-aromatic rings, such as indanyl,
phthalimidyl, naphthimidyl, phenantriidinyl, or tetrahydronaphthyl,
and the like.
[0116] The terms "heteroaryl" used alone or as part of a larger
moiety, e.g., "heteroaralkyl" or "heteroaralkoxy," refer to
optionally substituted groups having 5 to 10 ring atoms, preferably
5, 6, or 9 ring atoms; having 6, 10, or 14 .pi. electrons shared in
a cyclic array; and having, in addition to carbon atoms, from one
to five heteroatoms. In some embodiments, the term "heteroaryl"
refers to optionally substituted groups as defined above having 6
to 10 ring atoms (e.g., C.sub.6-12 heteroaryl). The term
"heteroatom" refers to nitrogen, oxygen, or sulfur, and includes
any oxidized form of nitrogen or sulfur, and any quaternized form
of a basic nitrogen. Heteroaryl groups include, without limitation,
thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl,
tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl,
isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl,
pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl.
The terms "heteroaryl" and "heteroar-," as used herein, also
include groups in which a heteroaromatic ring is fused to one or
more aryl, cycloaliphatic, or heterocyclyl rings, where the radical
or point of attachment is on the heteroaromatic ring. Non-limiting
examples include indolyl, isoindolyl, benzothienyl, benzofuranyl,
dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl,
isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl,
4H-quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl,
phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and
pyrido[2,3-b]-1,4-oxazin-3(4H)-one. A heteroaryl group may be mono-
or bicyclic. The term "heteroaryl" may be used interchangeably with
the terms "heteroaryl ring," "heteroaryl group," or
"heteroaromatic," any of which terms include rings that are
optionally substituted. The term "heteroaralkyl" refers to an alkyl
group substituted by a heteroaryl, wherein the alkyl and heteroaryl
portions independently are optionally substituted.
[0117] As described herein, compounds of the invention may contain
"optionally substituted" moieties. In general, the term
"substituted," whether preceded by the term "optionally" or not,
means that one or more hydrogens of the designated moiety are
replaced with a suitable substituent. Unless otherwise indicated,
an "optionally substituted" group may have a suitable substituent
at each substitutable position of the group, and when more than one
position in any given structure may be substituted with more than
one substituent selected from a specified group, the substituent
may be either the same or different at every position. Combinations
of substituents envisioned by this invention are preferably those
that result in the formation of stable or chemically feasible
compounds. The term "stable," as used herein, refers to compounds
that are not substantially altered when subjected to conditions to
allow for their production, detection, and, in certain embodiments,
their recovery, purification, and use for one or more of the
purposes disclosed herein.
[0118] Suitable monovalent substituents on a substitutable carbon
atom of an "optionally substituted" group are independently
halogen; --(CH.sub.2).sub.0-4R.sup.o; --(CH.sub.2).sub.0-4OR.sup.o;
--O--(CH.sub.2).sub.0-4C(O)OR.sup.o;
--(CH.sub.2).sub.0-4CH(OR.sup.o).sub.2;
--(CH.sub.2).sub.0-4SR.sup.o; --(CH.sub.2).sub.0-4Ph, which may be
substituted with R.sup.o;
--(CH.sub.2).sub.0-4O(CH.sub.2).sub.0-1Ph, which may be substituted
with R.sup.o; --CH.dbd.CHPh, which may be substituted with R.sup.o;
--NO.sub.2; --CN; --N.sub.3; --(CH.sub.2).sub.0-4N(R.sup.o).sub.2;
--(CH.sub.2).sub.0-4N(R.sup.o)C(O)R.sup.o; --N(R.sup.o)C(S)R.sup.o;
--(CH.sub.2).sub.0-4N(R.sup.o)C(O)NR.sup.o.sub.2;
--N(R.sup.o)C(S)NR.sup.o.sub.2;
--(CH.sub.2).sub.0-4N(R.sup.o)C(O)OR.sup.o;
--N(R.sup.o)N(R.sup.o)C(O)R.sup.o;
--N(R.sup.o)N(R.sup.o)C(O)NR.sup.o.sub.2;
--N(R.sup.o)N(R.sup.o)C(O)OR.sup.o;
--(CH.sub.2).sub.0-4C(O)R.sup.o; --C(S)R.sup.o;
--(CH.sub.2).sub.0-4C(O)OR.sup.o; --(CH.sub.2).sub.0-4C(O)SR.sup.o;
--(CH.sub.2).sub.0-4C(O)OSiR.sup.o.sub.3;
--(CH.sub.2).sub.0-4OC(O)R.sup.o; --OC(O)(CH.sub.2).sub.0-4SR--,
SC(S)SR.sup.o; --(CH.sub.2).sub.0-4SC(O)R.sup.o;
--(CH.sub.2).sub.0-4C(O)NR.sup.o.sub.2; --C(S)NR.sup.o.sub.2;
--C(S)SR.sup.o; --SC(S)SR.sup.o,
--(CH.sub.2).sub.0-4OC(O)NR.sup.o.sub.2; --C(O)N(OR.sup.o)R.sup.o;
--C(O)C(O)R.sup.o; --C(O)CH.sub.2C(O)R.sup.o;
--C(NOR.sup.o)R.sup.o; --(CH.sub.2).sub.0-4SSR.sup.o;
--(CH.sub.2).sub.0-4S(O).sub.2R.sup.o;
--(CH.sub.2).sub.0-4S(O).sub.2OR.sup.o;
--(CH.sub.2).sub.0-4OS(O).sub.2R.sup.o; --S(O).sub.2NR.sup.o.sub.2;
--(CH.sub.2).sub.0-4S(O)R.sup.o;
--N(R.sup.o)S(O).sub.2NR.sup.o.sub.2;
--N(R.sup.o)S(O).sub.2R.sup.o; --N(OR.sup.o)R.sup.o;
--C(NH)NR.sup.o.sub.2; --P(O).sub.2R.sup.o; --P(O)R.sup.o.sub.2;
--OP(O)R.sup.o.sub.2; --OP(O)(OR.sup.o.sub.2; SiR.sup.o.sub.3;
--(C.sub.1-4 straight or branched)alkylene)O--N(R.sup.o.sub.2; or
--(C.sub.1-4 straight or branched)alkylene)C(O)O--N(R.sup.o).sub.2,
wherein each R.sup.o may be substituted as defined below and is
independently hydrogen, C.sub.1-6 aliphatic, --CH.sub.2Ph,
--O(CH.sub.2).sub.0-1Ph, or a 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur, or, notwithstanding the
definition above, two independent occurrences of R.sup.o, taken
together with their intervening atom(s), form a 3-12-membered
saturated, partially unsaturated, or aryl mono- or bicyclic ring
having 0-4 heteroatoms independently selected from nitrogen,
oxygen, or sulfur, which may be substituted as defined below.
[0119] Suitable monovalent substituents on R.sup.o (or the ring
formed by taking two independent occurrences of R.sup.o together
with their intervening atoms), are independently halogen,
--(CH.sub.2).sub.0-2R.sup. , -(haloR.sup. ),
--(CH.sub.2).sub.0-2OH, --(CH.sub.2).sub.0-2OR.sup. ,
--(CH.sub.2).sub.0-2CH(OR.sup. ).sub.2; --O(haloR.sup. ), --CN,
--N.sub.3, --(CH.sub.2).sub.0-2C(O)R.sup. ,
--(CH.sub.2).sub.0-2C(O)OH, --(CH.sub.2).sub.0-2C(O)OR.sup.o,
--(CH.sub.2).sub.0-2SR.sup. , --(CH.sub.2).sub.0-2SH,
--(CH.sub.2).sub.0-2NH.sub.2, --(CH.sub.2).sub.0-2NHR.sup. ,
--(CH.sub.2).sub.0-2NR.sup. .sub.2, --NO.sub.2, --SiR.sup. .sub.3,
OSiR.sup. .sub.3, --C(O)SR.sup. , --(C.sub.1-4 straight or branched
alkylene)C(O)OR.sup. , or --SSR.sup. , wherein each R.sup. is
unsubstituted or where preceded by "halo" is substituted only with
one or more halogens, and is independently selected from C.sub.1-4
aliphatic, --CH.sub.2Ph, --O(CH.sub.2).sub.0-1Ph, or a 5-6-membered
saturated, partially unsaturated, or aryl ring having 0-4
heteroatoms independently selected from nitrogen, oxygen, or
sulfur. Suitable divalent substituents on a saturated carbon atom
of R.sup.o include .dbd.O and .dbd.S.
[0120] Suitable divalent substituents on a saturated carbon atom of
an "optionally substituted" group include the following: .dbd.O,
.dbd.S, .dbd.NNR*.sub.2, .dbd.NNHC(O)R*, .dbd.NNHC(O)OR*,
.dbd.NNHS(O).sub.2R*, .dbd.NR*, .dbd.NOR*,
--O(C(R*.sub.2)).sub.2-3O--, or --S(C(R*.sub.2)).sub.2-3S--,
wherein each independent occurrence of R* is selected from
hydrogen, C.sub.1-6 aliphatic, which may be substituted as defined
below, or an unsubstituted 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur. Suitable divalent
substituents that are bound to vicinal substitutable carbons of an
"optionally substituted" group include: --O(CR*.sub.2).sub.2-3O--,
wherein each independent occurrence of R* is selected from
hydrogen, C.sub.1-6 aliphatic, which may be substituted as defined
below, or an unsubstituted 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur.
[0121] Suitable substituents on the aliphatic group of R* include
halogen, --R.sup. , -(haloR.sup. ), --OH, --OR.sup. ,
--O(haloR.sup. ), --CN, --C(O)OH, --C(O)OR.sup. , --NH.sub.2,
--NHR.sup. , --NR.sup. .sub.2, or --NO.sub.2, wherein each R.sup.
is unsubstituted or where preceded by "halo" is substituted only
with one or more halogens, and is independently C.sub.1-4
aliphatic, --CH.sub.2Ph, --O(CH.sub.2).sub.0-1Ph, or a 5-6-membered
saturated, partially unsaturated, or aryl ring having 0-4
heteroatoms independently selected from nitrogen, oxygen, or
sulfur.
[0122] Suitable substituents on a substitutable nitrogen of an
"optionally substituted" group include --R.sup..dagger.,
--NR.sup..dagger..sub.2, --C(O)R.sup..dagger.,
--C(O)OR.sup..dagger., --C(O)C(O)R.sup..dagger.,
--C(O)CH.sub.2C(O)R.sup..dagger., --S(O).sub.2R.sup..dagger.,
--S(O).sub.2NR.sup..dagger..sub.2, --C(S)NR.sup..dagger..sub.2,
--C(NH)NR.sup..dagger..sub.2, or
--N(R.sup..dagger.)S(O).sub.2R.sup..dagger.; wherein each
R.sup..dagger. is independently hydrogen, C.sub.1-6 aliphatic,
which may be substituted as defined below, unsubstituted --OPh, or
an unsubstituted 5-6-membered saturated, partially unsaturated, or
aryl ring having 0-4 heteroatoms independently selected from
nitrogen, oxygen, or sulfur, or, notwithstanding the definition
above, two independent occurrences of R.sup..dagger., taken
together with their intervening atom(s) form an unsubstituted
3-12-membered saturated, partially unsaturated, or aryl mono- or
bicyclic ring having 0-4 heteroatoms independently selected from
nitrogen, oxygen, or sulfur. Suitable substituents on the aliphatic
group of R.sup..dagger. are independently halogen, --R.sup. ,
-(haloR.sup. ), --OH, --OR.sup. , --O(haloR.sup. ), --CN, --C(O)OH,
--C(O)OR.sup. , --NH.sub.2, --NHR.sup. , --NR.sup. .sub.2, or
--NO.sub.2, wherein each R.sup. is unsubstituted or where preceded
by "halo" is substituted only with one or more halogens, and is
independently C.sub.1-4 aliphatic, --CH.sub.2Ph,
--O(CH.sub.2).sub.0-1Ph, or a 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur.
[0123] As used herein, the term "boronic acid" refers to any
chemical compound comprising a --B(OH).sub.2 moiety. Arylboronic
acid compounds readily form anhydrides by dehydration of the
boronic acid moiety (see, for example, Snyder et al., J. Am. Chem.
Soc. (1958) 80:3611). An "anhydride" of a boronic acid includes,
but is not limited to, dimers, trimers and oligomers of the boronic
acid and mixtures thereof.
[0124] As used herein, the term "pharmaceutically acceptable salt"
refers to those salts which are, within the scope of sound medical
judgment, suitable for use in contact with the tissues of humans
and lower animals without undue toxicity, irritation, allergic
response and the like, and are commensurate with a reasonable
benefit/risk ratio. Pharmaceutically acceptable salts are well
known in the art. For example, S. M. Berge et al., describe
pharmaceutically acceptable salts in detail in J. Pharmaceutical
Sciences, 1977, 66:1-19, incorporated herein by reference.
Pharmaceutically acceptable salts of the compounds of this
invention include those derived from suitable inorganic and organic
acids and bases. Examples of pharmaceutically acceptable, nontoxic
acid addition salts are salts of an amino group formed with
inorganic acids such as hydrochloric acid, hydrobromic acid,
phosphoric acid, sulfuric acid and perchloric acid or with organic
acids such as acetic acid, oxalic acid, maleic acid, tartaric acid,
citric acid, succinic acid or malonic acid or by using other
methods used in the art such as ion exchange. Other
pharmaceutically acceptable salts include adipate, alginate,
ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate,
borate, butyrate, camphorate, camphorsulfonate, citrate,
cyclopentanepropionate, digluconate, dodecyl sulfate,
ethanesulfonate, formate, fumarate, glucoheptonate,
glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate,
hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate,
laurate, lauryl sulfate, malate, maleate, malonate,
methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate,
oleate, oxalate, palmitate, pamoate, pectinate, persulfate,
3-phenylpropionate, phosphate, picrate, pivalate, propionate,
stearate, succinate, sulfate, tartrate, thiocyanate,
p-toluenesulfonate, undecanoate, valerate salts, and the like.
Salts derived from appropriate bases include alkali metal, alkaline
earth metal, ammonium and N.sup.+(C.sub.1-4alkyl).sub.4 salts.
Representative alkali or alkaline earth metal salts include sodium,
lithium, potassium, calcium, magnesium, and the like. Further
pharmaceutically acceptable salts include, when appropriate,
nontoxic ammonium, quaternary ammonium, and amine cations formed
using counterions such as halide, hydroxide, carboxylate, sulfate,
phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
[0125] A compound is referred to as "isolated" (e.g., "isolated
Compound 1" or "isolated Compound 2") if the compound is free from
the reaction mixture from which it was synthesized. Isolation of a
compound can be performed by any method known to one skilled in the
art, including chromatography (e.g., high pressure liquid
chromatography (HPLC)), trituration, precipitation,
crystallization, distillation, and/or extraction, or any sequential
combination thereof. Compounds may be isolated as solids. At
sufficiently high temperature, the solid may melt, and thus the
compound may also be isolated in its liquid phase.
[0126] As used herein "amorphous" refers to a solid form of a
compound wherein there is no long-range order of the positions of
the atoms. The amorphous nature of a solid can be confirmed, for
example, by examination of the X-ray powder diffraction pattern. If
the XRPD does not show any sharp intensity peaks, and/or has one or
more "halos" (broad bumps) in the XRPD then the compound is
amorphous.
[0127] As used herein, "crystalline" refers to a solid form of a
compound wherein there exists long-range atomic order in the
positions of the atoms. The crystalline nature of a solid can be
confirmed, for example, by examination of the X-ray powder
diffraction pattern. If the XRPD shows sharp intensity peaks in the
XRPD then the compound is crystalline.
[0128] As used herein, "polymorph" refers to a crystalline compound
having more than one crystal structure, e.g., resulting from
differences in molecular packing and/or molecular conformation of
the compound in the solid state. When polymorphism exists as a
result of difference in crystal packing it is called packing
polymorphism. Polymorphism can also result from the existence of
different conformers of the same molecule in conformational
polymorphism. In pseudopolymorphism the different crystal types are
the result of hydration or solvation. One exemplary way of
characterizing a polymorph is via its unique X-ray powder
diffraction (XRPD) pattern.
[0129] The term "solvate" refers to a crystalline compound wherein
a stoichiometric or non-stoichiometric amount of solvent, or
mixture of solvents, is incorporated into the crystal
structure.
[0130] The term "hydrate" refers to a crystalline compound where a
stoichiometric or non-stoichiometric amount of water is
incorporated into the crystal structure.
[0131] As used herein, "chemically stable" refers to a compound
that exhibits total organic impurities of less than about 10%, less
than about 5%, less than about 4%, less than about 3%, less than
about 2%, less than about 1%, less than about 0.5%, less than about
0.25%, or less than about 0.1%, when subjected to a particular
condition including, for example, a stressing condition for a
period of time. As used herein, "physically stable" refers to
crystalline forms, or a mixture of crystalline and/or amorphous
forms, that do not undergo crystal form change when subjected to a
particular condition including, for example, a stressing condition
for a period of time, with or without dessicant. In some
embodiments, the stressing condition is relative humidity, storing
at a temperature between 1-10, 10-20, 20-30, 30-40, 40-50, 50-60,
60-70, 70-80, 80-90, or 90-100.degree. C. In certain embodiments,
the period of time is at least 1, at least 2, at least 3, at least
4, at least 5, at least 10, or at least 20 weeks.
[0132] As used herein, the terms "about" and "approximately" when
used in combination with a numeric value or range of values used to
characterize a particular crystal form, amorphous form, or mixture
thereof of a compound mean the value or range of values may deviate
to an extent deemed reasonable to one of ordinary skill in the art
while describing the particular crystal form, amorphous form, or
mixture thereof.
DETAILED DESCRIPTION OF THE INVENTION
[0133] Compound 1, also referred to as
3,3'-difluorobiphenyl-4-ylboronic acid, is particularly useful for
treating conditions mediated by FAAH. Compound 1 is provided in the
class of molecules described in US2009/0099131 and WO2008/63300,
the entirety of each of which is incorporated herein by
reference.
Methods for Preparing Compound 1
[0134] The present invention provides various improved methods to
prepare Compound 1 and anhydrides provided therefrom.
[0135] For example, in one aspect, provided is a method of
preparing Compound 1 comprising a biaryl cross-coupling step (S-1),
followed by a metallation/boronation step (S-2), as depicted in
Scheme 1, wherein the variable LG.sup.1 and LG.sup.2 are leaving
groups and the group --BOR.sup.1OR.sup.2 corresponds to a boronic
acid (i.e., --B(OH).sub.2) or a protected form thereof.
##STR00017##
(i) Step S-1. Biaryl Cross-Coupling Reaction
[0136] The coupling reaction between E-1 and E-2 occurs, generally,
via displacement of LG.sup.1 of compound E-1, wherein both LG.sup.1
and LG.sup.2 are leaving groups. A "leaving group" is a group that
is subject to nucleophilic displacement, i.e., a chemical group
that is readily displaced by an incoming chemical moiety (e.g., a
cross-coupling catalyst capable of oxidative addition). Leaving
groups are well known in the art, e.g., see, Advanced Organic
Chemistry, Jerry March, 5.sup.th Ed., pp. 351-357, John Wiley and
Sons, N.Y. Exemplary leaving groups include, but are not limited
to, halogens (e.g., chloro, iodo, bromo, fluoro) and sulfonates
(e.g., methanesulfonyloxy (mesyloxy), toluenesulfonyloxy,
trifluoromethanesulfonyloxy).
[0137] In certain embodiments, LG.sup.1 and LG.sup.2 are
independently selected from halogen and sulfonate. In certain
embodiments, LG.sup.1 and LG.sup.2 are independently selected from
halogen. In certain embodiments, LG.sup.1 and LG.sup.2 are
independently selected from --Br or --I. In certain embodiments,
LG.sup.1 is --Br. In certain embodiments, LG.sup.1 is --I. In
certain embodiments, LG.sup.2 is --Br. In certain embodiments,
LG.sup.2 is --I. In certain embodiments, LG.sup.1 is --Br and
LG.sup.2 is --Br (e.g., 1,4-dibromo-2-fluorobenzene, "E-1a"). In
certain embodiments, LG.sup.1 is --I and LG.sup.2 is --Br (e.g.,
1-bromo-2-fluoro-4-iodobenzene, "E-1b"). As described generally
above, compound E-2 corresponds to a boronic acid (wherein R.sup.1
and R.sup.2 are hydrogen), a protected form thereof, or boronate
ester. In some embodiments, R.sup.1 and R.sup.2 are independently
selected from hydrogen or an C.sub.1-6 alkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, C.sub.6-12 aryl or C.sub.6-12 heteroaryl group,
or R.sup.1 and R.sup.2 are joined to form a 5-8 membered ring,
provided that R.sup.1 and R.sup.2 are not both hydrogen. In certain
embodiments, E-2 is a boronic acid wherein R.sup.1 and R.sup.2 are
hydrogen (e.g., 3-fluorophenylboronic acid, "E-2a." In some
embodiments, E2 is a boronate ester. Exemplary boronate esters
include, without limitation, ethyl esters, mannitol esters,
picolinates, and pinacol esters.
[0138] In some embodiments, the biaryl cross-coupling reaction of
step S-1 takes place in the presence of one or more catalysts
(e.g., organic or inorganic catalysts). In some embodiments, the
catalyst is an organic catalyst. In some embodiments, the catalyst
is an inorganic catalyst. In some embodiments, the inorganic
catalyst is a Group 10 transition metal catalyst (e.g., nickel
catalyst, palladium catalyst, platinum catalyst). In some
embodiments, the inorganic catalyst is an organometallic catalyst
(e.g., comprising an inorganic metal and at least one organic
ligand). In some embodiments, the inorganic metal is a Group 10
transition metal (e.g., nickel, palladium, platinum).
[0139] In certain embodiments, the inorganic catalyst is a
palladium catalyst. In certain embodiments, the inorganic catalyst
is a palladium catalyst and the reaction is a Suzuki coupling. In
certain embodiments, the palladium catalyst comprises one or more
types of ligands. Exemplary ligands include phosphine ligands
(e.g., PPh.sub.3, P(tBu).sub.3, diphenylphosphorylferrocene (dppf),
diisopropylphosphorylferrocene (dipf)), halogens (e.g., fluorine,
chlorine, bromine, iodine), carboxylates (e.g., acetates), organic
compounds capable of ligating to a metal to form a complex (e.g.,
dibenzylideneacetone (dba), 1,3- or 1,5-cyclooctadiene (COD)), and
donor solvents (e.g., THF, diethylether, etc.). Exemplary palladium
catalysts include, but are not limited to, Pd(PPh.sub.3).sub.4,
Pd(OAc).sub.2, Pd.sub.2(dba).sub.3, Pd(dppf).sub.2Cl.sub.2, and
PdCl.sub.2(PPh.sub.3).sub.2. In certain embodiments, the catalyst
is PdCl.sub.2(PPh.sub.3).sub.2.
[0140] In some embodiments, the catalyst loading of step S-1 is
from about 0.01 mol % to about 10 mol % of catalyst relative to
substrate (i.e., relative to compound E-1). In certain embodiments,
the catalyst loading is about 0.1 mol % to about 5 mol %. In
certain embodiments, the catalyst loading is about 0.1 mol % to
about 4 mol %. In certain embodiments, the catalyst loading is
about 0.1 mol % to about 3 mol %. In certain embodiments, the
catalyst loading is about 0.1 mol % to about 2 mol %. In certain
embodiments, the catalyst loading is about 0.1 mol % to about 1 mol
%. In certain embodiments, the catalyst loading is about 0.1% to
about 0.5 mol %. In certain embodiments, the catalyst loading is
about 0.2 to about 0.5 mol %.
[0141] In certain embodiments, the catalyst loading is less than
about 5 mol %, less than about 4 mol %, less than about 3 mol %,
less than about 2 mol %, less than about 1 mol %, less than about
0.9 mol %, less than about 0.8 mol %, less than about 0.7 mol %,
less than about 0.6 mol %, less than about 0.5 mol %, less than
about 0.4 mol %, less than about 0.3 mol %, less than about 0.2 mol
%, or less than about 0.1 mol %. In certain embodiments, the
catalyst is used in an amount of less than about 3.0 mol %.
[0142] In some embodiments, the step S-1 occurs in the presence of
one or more bases, e.g., organic or inorganic bases. Exemplary
organic bases include, but are not limited to, tertiary amines
(e.g., triethylamine, diisopropylethylamine). Exemplary inorganic
bases include, but are not limited to, carbonates (e.g., potassium
carbonate, sodium carbonate, cesium carbonate), bicarbonates (e.g.,
potassium bicarbonate, sodium bicarbonate, cesium bicarbonate),
acetates (e.g., potassium acetate, sodium acetate), phosphates
(e.g., potassium phosphate), hydroxides (e.g., lithium hydroxide,
sodium hydroxide, magnesium hydroxide). In certain embodiments, the
base is an inorganic base. In certain embodiments, the base is
sodium bicarbonate (NaHCO.sub.3). In certain embodiments, the base
is sodium carbonate (Na.sub.2CO.sub.3).
[0143] In some embodiments, the base of step S-1 is provided in
about 1 to about 6 equivalents or in about 2 to about 4 equivalents
of base relative to substrate. In certain embodiments, the base of
step S-1 is provided in less than about 6 equivalents, less than
about 5 equivalents or, less than about 4 equivalents of base
relative to substrate. In certain embodiments, about 3 equivalents
of base is employed.
[0144] In some embodiments, the step S-1 occurs in the presence of
one or more solvents. Exemplary solvents include, but are not
limited to, organic solvents, water and/or mixtures thereof.
Exemplary organic solvents include, but are not limited to, alcohol
solvents (e.g., methanol, ethanol, 1-propanol, isopropanol,
1,2-propanediol, n-butanol, t-butanol, t-amyl alcohol), ethers
(e.g., tetrahydrofuran, 2-methyltetrahydrofuran, diethylether,
1,4-dioxane, 1,2-dimethoxyethane, methyl t-butyl ether, diethoxy
methane), aromatic solvents (e.g., benzene, toluene, xylenes),
acetonitrile, dimethylsulfoxide, dimethylformamide,
N-methylpyrrolidinone, halogenated solvents (e.g., dichloromethane,
chloroform, dichloroethane), esters (e.g., methyl acetate, ethyl
acetate, 2-propyl acetate), ketones (e.g., methyl isobutyl ketone,
acetone), and hydrocarbons (e.g., hexanes, n-heptane,
cyclohexane).
[0145] In some embodiments, the solvent is a mixture of an organic
solvent and water. In some embodiments, the solvent is a mixture of
an alcohol solvent and water. In certain embodiments, the solvent
mixture is a mixture of 1-propyl alcohol (1-PrOH) and water.
Exemplary percentages of organic solvent in water for these
mixtures include, but are not limited to, about 10% to about 90%
organic solvent in water, about 20% to about 90% organic solvent in
water, about 25% to about 90% organic solvent in water, about 30%
to about 80% organic solvent in water, about 40% to about 80%
organic solvent in water, or about 50% to about 80% organic solvent
in water (e.g., 1-PrOH in water). Exemplary ratios of organic
solvent to water for these mixtures include, but are not limited
to, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, and 1:1 of
organic solvent to water (e.g., 1-PrOH to H.sub.2O). In certain
embodiments, the ratio of 1-PrOH:H.sub.2O is about 4:1 (i.e., about
75% 1-PrOH in water). In certain embodiments, the ratio of
1-PrOH:H.sub.2O is about 8:3 (i.e., about 62.5% 1-PrOH in
water).
[0146] In some embodiments, the step S-1 requires an amount of
solvent such that the concentration of the reaction is about 0.01 M
to about 10 M. In some embodiments, the concentration of the
reaction is about 0.1 M to about 5 M. In some embodiments, the
concentration of the reaction is about 0.1 M to about 2.5 M. In
some embodiments, the concentration of the reaction is about 0.1 M
to about 1.5 M. In some embodiments, the concentration of the
reaction is about 0.5 M to about 1.5 M.
[0147] In some embodiments, the step S-1 requires an amount of
solvent ranging from about 8 volumes of solvent to about 12 volumes
of solvent. In some embodiments, the step S-1 requires an amount of
solvent ranging from about 8 volumes of solvent to about 11 volumes
of solvent. In some embodiments, the step S-1 requires an amount of
solvent ranging from about 9 volumes of solvent to about 11 volumes
of solvent. In some embodiments, the step S-1 requires an amount of
solvent ranging from about 9.5 volumes of solvent to about 11
volumes of solvent. In some embodiments, the step S-1 requires an
amount of solvent ranging from about 10 volumes of solvent to about
11 volumes of solvent. In some embodiments, the step S-1 requires
an amount of solvent of about 10.0, 10.1, 10.2, 10.3, 10.4, 10.5,
10.6, 10.7, 10.8, 10.9, or 11.0 volumes of solvent. In some
embodiments, the step S-1 requires an amount of solvent of about
10.7 volumes of solvent. In some embodiments, the step S-1 requires
an amount of solvent of about 10.0 volumes of solvent.
[0148] In some embodiments, the step S-1 requires a temperature
from about 50.degree. C. to about 100.degree. C. In certain
embodiments, the reaction temperature is from about 70.degree. C.
to about 90.degree. C. In some embodiments, the reaction
temperature is from about 75.degree. C. to about 90.degree. C. In
some embodiments, the reaction temperature is from about 75.degree.
C. to about 85.degree. C. In some embodiments, the reaction
temperature is about 83.degree. C.
[0149] Reaction times for the step S-1 range from about 10 to about
30 hours. In some embodiments, the reaction time ranges from about
12 to about 24 hours. In certain embodiments, the reaction time
ranges from about 14 to about 20 hours.
[0150] The product of step S-1 may be processed to remove
impurities prior to performing step S-2. In some embodiments,
processing comprises treatment with a suitable solid support in
order to reduce the amount of residual catalyst present. In certain
embodiments, treatment with a suitable solid support comprises
silica gel treatment. In certain embodiments, silica gel treatment
may be performed as a batch fed operation or as an in-line
filtration operation. In certain embodiments, silica gel treatment
is performed as an in-line filtration operation prior to step
S-2.
(ii) Step S-2. Metallation-Boronation Reaction
[0151] As depicted above Scheme 1, E-3 is used to generate Compound
1 via metallation/boronation. As used herein, the
metallation/boronation reaction of step S-2 requires a boronation
reagent and a metal reagent capable of undergoing exchange with
LG.sup.2 of E-3. Such metal reagent is capable of metallating
(e.g., with lithium or magnesium) E3. In certain embodiments,
LG.sup.2 of E-3 is bromo (i.e., 4-bromo-3,3'-difluorobiphenyl,
"E-3a").
[0152] In certain embodiments, the metal reagent of S-2 is an alkyl
lithium reagent. In certain embodiments, the alkyl lithium reagent
is n-butyllithium or hexyllithium. In certain embodiments, the
alkyl lithium reagent is hexyllithium.
[0153] In certain embodiments, the metal reagent of S-2 is
magnesium metal or an alkylmagnesium halide (e.g., methylmagnesium
bromide).
[0154] In certain embodiments, the boronation reagent of S-2 is a
borate ester reagent, e.g., B(OR.sup.3).sub.3 wherein each R.sup.3
is independently a C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6
alkynyl, C.sub.6-12 aryl or C.sub.6-12 heteroaryl group, or two
R.sup.3 groups are joined to form a 5-8 membered ring. In certain
embodiments, the boronation reagent is B(OR.sup.3).sub.3 wherein
each R.sup.3 is independently methyl, ethyl, propyl, isopropyl,
butyl, cyclohexyl. Exemplary borate ester reagents include, but are
not limited to, trimethyl borate, triethyl borate, triallyl borate,
triisopropyl borate, Tributyl borate, Tri-tert-butyl borate,
Tripentyl borate, Trihexyl borate, Tritolyl borate, Tribenzyl
borate, Triphenyl borate, Trimethylene borate, Triethanolamine
borate, Trimethallyl borate,
2-Methoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Methoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-Isopropoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Isopropoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-(2-dimethylaminoethoxy)-4-methyl-1,3,2-dioxaborinane,
2-butoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
tris(2,2,2-trifluoroethyl) borate, tris(1-isopropyl-2-methylpropyl)
borate, and 2,2'-(2-methyl-2,4-pentanediyldioxy)
bis(4,4,6-trimethyl-1,3,2-dioxaborinane). In certain embodiments,
the borate ester reagent is B(OiPr).sub.3 (triisopropyl
borate).
[0155] In certain embodiments, the alkyl lithium reagent of S-2 is
hexyllithium and the boronation reagent of S-2 is
B(OiPr).sub.3.
[0156] In certain embodiments, the boronation reagent is provided
in about 1 equivalent to about 1.5 equivalents to E-3. In certain
embodiments, the boronation reagent is provided in about 1
equivalent to about 1.4 equivalents, in about 1 equivalent to about
1.3 equivalents, in about 1 equivalent to about 1.2 equivalents, or
in about 1 equivalent to about 1.1 equivalents, relative to E-3. In
certain embodiments, the boronation reagent is provided in about 1
equivalent to about 1.3 equivalents relative to E-3.
[0157] In certain embodiments, the metal reagent is provided in
about 1 equivalent to about 1.5 equivalents to E-3. In certain
embodiments, the metal reagent is provided in about in about 1
equivalent to about 1.4 equivalents, in about 1 equivalent to about
1.3 equivalents, in about 1 equivalent to about 1.2 equivalents, or
in about 1 equivalent to about 1.1 equivalents, relative to E-3. In
certain embodiments, the metal reagent is provided in about 1
equivalent to about 1.2 equivalents relative to E-3.
[0158] In certain embodiments, the metal reagent is titrated prior
to use. Titration methods are well known to those of skill in the
chemical arts. In some embodiments, in order to avoid any excess
addition, the reaction is undercharged with an initial portion of
metal reagent, the extent of conversion is determined (using, e.g.,
HPLC analysis), and an additional portion of metal reagent is added
as needed to drive the reaction to completion.
[0159] In some embodiments, the metallation/boronation step S-2
occurs in the presence of one or more organic solvents. Exemplary
organic solvents include, but are not limited to, aromatic solvents
(e.g., benzene, toluene, xylenes), ethers (e.g., tetrahydrofuran,
2-methyltetrahydrofuran, 1,2-dimethoxyethane, 1,4-dioxane, methyl
t-butyl ether, diethoxy methane) and hydrocarbons (e.g., hexanes,
n-heptane, cyclohexane). In certain embodiments, the solvent is
selected from an ether, a hydrocarbon or a mixture thereof. In
certain embodiments, the solvent is a combination of
2-methyltetrahydrofuran and a hydrocarbon. In certain embodiments,
the solvent is a combination of 2-methyltetrahydrofuran and
n-heptane. In certain embodiments, the solvent combination of an
ether (e.g., 2-methyltetrahydrofuran) and a hydrocarbon (e.g.,
n-heptane) is provided in a ratio of 2:1 ether to hydrocarbon.
[0160] In some embodiments, the temperature of the reaction of step
S-2 ranges from about -78.degree. C. to about 0.degree. C. during
the metal reagent addition. In some embodiments, the temperature
ranges from about -78.degree. C. to about -10.degree. C. In some
embodiments, the temperature ranges from about -78.degree. C. to
about -20.degree. C. In some embodiments, the temperature ranges
from about -78.degree. C. to about -30.degree. C. In some
embodiments, the temperature ranges from about -60.degree. C. to
about -30.degree. C. In some embodiments, the temperature ranges
from about -50.degree. C. to about -30.degree. C. In some
embodiments, the temperature is about -78.degree. C., about
-65.degree. C., about -60.degree. C., about -55.degree. C., about
-50.degree. C., about -45.degree. C., about -40.degree. C., about
-35.degree. C., or about -30.degree. C. In certain embodiments, the
temperature is about -35.degree. C.
[0161] In some embodiments, the metal reagent of S-2 is added
slowly over time to minimize the occurrence of by-products. One of
skill in the art would recognize that the rate of addition may
change depending on the scale on which the reaction is performed.
In certain embodiments, the metal reagent is added over a period of
no less than about 60 minutes. In some embodiments, the required
amount of metal reagent is added over a period of about 60, 80, or
120 minutes. In certain embodiments, the metal reagent is added
over a period of no less than about 120 minutes. In some
embodiments, the metal reagent is added over a period of time
ranging from about 60 minutes to about 120 minutes.
[0162] Upon completion of the reaction, step S-2 is quenched with
water. In certain embodiments, wherein the boronating reagent is a
borate ester reagent, the quench involved is an acidic quench
(using, e.g., 1 M HCl) in order to hydrolyze the boronic ester
formed in situ to the boronic acid, Compound 1. In certain
embodiments, the aqueous layer is then separated and discarded and
the organic layer is concentrated to provide Compound 1. However,
in certain embodiments, Compound 1 is provided after the quench of
step S-2 using additional steps and methods as described below and
herein (e.g., provided after steps S-3 and S-4).
(iii) Crystallization of Compound 1
[0163] In certain embodiments, specific crystalline or amorphous
forms, or mixtures thereof, of Compound 1 or a derivative thereof,
can be made using the methods described herein, as well as other
methods known to those of ordinary skill in the art. In certain
embodiments, such methods provide Compound 1 as the "Form A"
crystal form, which, in some embodiments, exhibits the
characteristics and properties described herein. In certain
embodiments, such methods provide Compound 1 as the "Material B"
crystal form, which, in some embodiments, exhibits the
characteristics and properties described herein. In certain
embodiments, such methods provide a mixture of Form A and Material
B.
[0164] Crystalline forms may be prepared by the methods described
herein or by techniques known in the art, including heating,
cooling, freeze drying, lyophilization, quench cooling the melt,
rapid solvent evaporation, slow solvent evaporation, solvent
recrystallization, antisolvent addition, slurry recrystallization,
crystallization from the melt, desolvation, recrystallization in
confined spaces such as, e.g., in nanopores or capillaries,
recrystallization on surfaces or templates such as, e.g., on
polymers, recrystallization in the presence of additives, such as,
e.g., co-crystal counter-molecules, desolvation, dehydration, rapid
cooling, slow cooling, exposure to solvent and/or water, drying,
including, e.g., vacuum drying, vapor diffusion, sublimation,
grinding (including, e.g., cryo-grinding and solvent-drop
grinding), microwave-induced precipitation, sonication-induced
precipitation, laser-induced precipitation and precipitation from a
supercritical fluid. The particle size of the resulting crystalline
forms, which can vary, (e.g., from nanometer dimensions to
millimeter dimensions), can be controlled, e.g., by varying
crystallization conditions, such as, e.g., the rate of
crystallization and/or the crystallization solvent system, or by
particle-size reduction techniques, e.g., grinding, milling,
micronizing or sonication.
[0165] In certain embodiments, the method provides an additional
step of crystallizing Compound 1 from a non-polar or polar
solution.
[0166] In certain embodiments, Compound 1 is crystallized from a
non-polar solution. Exemplary non-polar solutions include a
hydrocarbon solvents (e.g., hexanes, heptanes), aromatic solvents
(e.g., benzene, toluene, xylenes), or mixtures thereof. For
example, in certain embodiments, step S-2 is quenched with water,
treated with a non-polar solution and the reaction mixture
distilled under vacuum to provide crystalline Compound 1. In
certain embodiments, the temperature of the distillation is below
about 45.degree. C.
[0167] In certain embodiments, Compound 1 is crystallized from a
polar solution (e.g., water, a polar aprotic organic solvent, or a
mixture thereof). In certain embodiments, Compound 1 is
crystallized from a mixture of water and a polar aprotic organic
solvent. In certain embodiments, the mixture of polar aprotic
organic solvent in water is from about 5% to about 95% polar
aprotic organic solvent in water, from about 10% to about 90% polar
aprotic organic solvent in water, from about 15% to about 85% polar
aprotic organic solvent in water, from about 20% to about 80% polar
aprotic organic solvent in water, from about 25% to about 75% polar
aprotic organic solvent in water, from about 30% to about 70% polar
aprotic organic solvent in water, from about 35% to about 65% polar
aprotic organic solvent in water, or from about 40% to about 70%
polar aprotic organic solvent in water.
[0168] Exemplary polar aprotic organic solvents include, but are
not limited to, acetone, and acetonitrile or a mixture thereof. In
certain embodiments, the polar aprotic organic solvent is
acetone.
[0169] For example, in certain embodiments, Compound 1 isolated
from the reaction mixture of step S-2 is crystallized from a polar
solution of acetone and water. In certain embodiments, the polar
solution is from about 5% to about 95% acetone in water, from about
10% to about 90% acetone in water, from about 15% to about 85%
acetone in water, from about 20% to about 80% acetone in water,
from about 25% to about 75% acetone in water, from about 30% to
about 70% acetone in water, from about 35% to about 65% acetone in
water, or from about 40% to about 70% acetone in water.
[0170] In certain embodiments, the crystallization step involves
dissolving Compound 1 in a first solvent (e.g., acetone) and
heating to a desired temperature (e.g., reflux) while an
appropriate amount of a second solvent (e.g., water) is added such
that the solution, upon cooling to ambient temperature, forms
recrystallized Compound 1. In certain embodiments, alternating
portions of the first and second solvents (e.g., acetone and water)
are added to the refluxing solution in iterations prior to cooling
of the solution. In some embodiments, the cooling of the solution
occurs for a specified amount of time (e.g., greater than about 8
hours) and/or at a specified temperature (e.g., from about
20.degree. C. to about 30.degree. C., or about 25.degree. C. plus
or minus 5.degree. C.). In some embodiments, crystalline Compound 1
is isolated via filtration and dried using any method known in the
chemical arts to afford Compound 1 substantially free from water as
assessed using methods known in the art to measure water content
(e.g., Karl Fischer titration). In certain embodiments, the
Compound 1 crystallized from a polar solution is further washed
with a non-polar solution. In certain embodiments, the non-polar
solution comprises a hydrocarbon solvent, e.g., hexanes or heptanes
or a mixture thereof. In some embodiments, crystalline Compound 1
provided by this method has an X-ray powder diffraction pattern
substantially similar to that depicted in FIG. 1, Form A.
[0171] In some embodiments, the formation of the Form A crystal
form of Compound 1 is accomplished by crystallization in a solvent
selected from acetone, acetonitrile, chloroform, dichloromethane,
diethyl ether, dimethylformamide, p-dioxane, ethyl acetate,
heptane, tetrahydrofuran, isopropyl ether, methyl ethyl ketone,
2-methyl tetrahydrofuran, methyl iso-butyl ketone, tert-butyl
methyl ether, nitromethane, toluene, or water. In certain
embodiments, crystallization of Form A is performed in a mixture of
one or more of said solvents. In some embodiments, crystallization
is performed in the following mixture of solvents: 1:1
heptane/chloroform, 2:1 heptane/THF, 1:1 acetone/water, 1:1
acetonitrile water, 1:1 dimethylformamide/water; 1:1
p-dioxane/water, or 1:1 THF/water.
[0172] In some embodiments, provided herein are methods for forming
a crystal form of Compound 1 comprising (a) dissolving Compound 1
in a 50:50 mixture of acetone and water at a temperature of about
51.degree. C.; (b) filtering the resulting solution; (c) allowing
the solution to cool to ambient temperature; and (d) allowing the
solution to stand at ambient temperature for at least 1 day. In
some embodiments, the filtering of step (b) is accomplished via hot
filtering. In a particular embodiment, the filtering of step (b) is
accomplished via hot filtering into a warm container. In certain
embodiments, the temperature of about 51.degree. C. of step (a) is
obtained by heating the solution in a container on a hot plate. In
further embodiments, in step (c), the solution is cooled to ambient
temperature by turning the hot plate off and allowing the solution
to stand on the hot plate as the hot plate cools. In certain
embodiments, the methods provide a Form A crystal form of Compound
1.
[0173] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from acetone. In one embodiment, the methods comprise slow
evaporation. In some embodiments, the methods comprise crash
precipitation with heptane. In certain embodiments, the methods
provide a Form A crystal form of Compound 1.
[0174] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from acetonitrile. In some embodiments, the methods comprise slow
evaporation. In some embodiments, the methods comprise heating to
51.degree. C., slow cooling from a temperature of about 51.degree.
C. to about room temperature and, in some embodiments, allowing the
solution to stand at room temperature for about 1 day. In some
embodiments, the methods comprise vapor diffusion with water over,
in some embodiments, about 8 days. In certain embodiments, the
methods provide a Form A crystal form of Compound 1.
[0175] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from chloroform. In some embodiments, the methods comprise slow
evaporation. In some embodiments, the methods comprise heating to
51.degree. C., slow cooling from a temperature of about 51.degree.
C. to about room temperature and, in further embodiments, allowing
the solution to stand at room temperature for about 1 day and, in
even further embodiments, subsequently cooling to about 0.degree.
C. In further embodiments, the solution is kept at about 0.degree.
C. for about 11 days. In some embodiments, the methods comprise
vapor diffusion with heptane over, in some embodiments, about 13
days. In certain embodiments, the methods provide a Form A crystal
form of Compound 1.
[0176] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from dichloromethane. In some embodiments, the methods comprise
slow evaporation. In some embodiments, the methods comprise crash
precipitation with heptane. In certain embodiments, the methods
provide a Form A crystal form of Compound 1.
[0177] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from diethyl ether. In some embodiments, the methods comprise slow
evaporation. In certain embodiments, the methods provide a Form A
crystal form of Compound 1.
[0178] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from dimethylformamide. In some embodiments, the methods comprise
fast evaporation. In certain embodiments, the methods provide a
Form A crystal form of Compound 1.
[0179] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from p-dioxane. In some embodiments, the methods comprise slow
evaporation. In certain embodiments, the methods provide a Form A
crystal form of Compound 1.
[0180] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from ethyl acetate. In some embodiments, the methods comprise slow
evaporation. In some embodiments, the methods comprise crash
precipitation from heptane. In certain embodiments, the methods
provide a Form A crystal form of Compound 1.
[0181] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from heptane. In some embodiments, the methods comprise slurrying
at room temperature for, in some embodiments, about 14 days. In
certain embodiments, the methods provide a Form A crystal form of
Compound 1.
[0182] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 2:1 heptane/chloroform. In some embodiments, the methods
comprise slow evaporation. In certain embodiments, the methods
provide a Form A crystal form of Compound 1.
[0183] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 2:1 heptane/THF. In some embodiments, the methods comprise
slow evaporation. In certain embodiments, the methods provide a
Form A crystal form of Compound 1.
[0184] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from isopropyl ether. In some embodiments, the methods comprise
slow evaporation. In some embodiments, the methods comprise
slurrying at room temperature for, in some embodiments, about 14
days. In some embodiments, the methods comprise heating to
51.degree. C., slow cooling from a temperature of about 51.degree.
C. to about room temperature and, in further embodiments, allowing
the solution to stand at room temperature for about 1 day. In some
embodiments, the methods comprise crash precipitation with heptane.
In certain embodiments, the methods provide a Form A crystal form
of Compound 1.
[0185] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from methyl ethyl ketone. In some embodiments, the methods comprise
slow evaporation. In some embodiments, the methods comprise crash
precipitation with heptane. In certain embodiments, the methods
provide a Form A crystal form of Compound 1.
[0186] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 2-methyl THF. In some embodiments, the methods comprise slow
evaporation. In certain embodiments, the methods provide a Form A
crystal form of Compound 1.
[0187] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from methyl iso-butyl ketone. In some embodiments, the methods
comprise slow evaporation. In certain embodiments, the methods
provide a Form A crystal form of Compound 1.
[0188] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from tert-butyl methyl ether. In some embodiments, the methods
comprise slow evaporation. In some embodiments, the methods
comprise crash precipitation with heptane. In certain embodiments,
the methods provide a Form A crystal form of Compound 1.
[0189] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from nitromethane. In some embodiments, the methods comprise slow
evaporation. In some embodiments, the methods comprise slurrying at
room temperature for, in some embodiments, about 14 days. In some
embodiments, the methods comprise heating to 51.degree. C., slow
cooling from a temperature of about 51.degree. C. to about room
temperature and, in further embodiments, allowing the solution to
stand at room temperature for about 1 day and, in even further
embodiments, subsequently cooling to about 0.degree. C. In a
further embodiment, the solution is kept at about 0.degree. C. for
about 11 days. In certain embodiments, the methods provide a Form A
crystal form of Compound 1.
[0190] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from toluene. In some embodiments, the methods comprise fast
evaporation. In some embodiments, the methods comprise slurrying at
room temperature for, in some embodiments, about 14 days. In some
embodiments, the methods comprise heating to 51.degree. C., slow
cooling from a temperature of about 51.degree. C. to about room
temperature and, in further embodiments, allowing the solution to
stand at room temperature for about 1 day. In certain embodiments,
the methods provide a Form A crystal form of Compound 1.
[0191] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from water. In some embodiments, the methods comprise slurrying at
room temperature for, in some embodiments, about 14 days. In
certain embodiments, the methods provide a Form A crystal form of
Compound 1.
[0192] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 50:50 acetone/water. In some embodiments, the methods comprise
partial slow evaporation. In some embodiments, the methods comprise
slurrying at room temperature for, in some embodiments, about 14
days. In some embodiments, the methods comprise heating to
51.degree. C., slow cooling from a temperature of about 51.degree.
C. to about room temperature and, in further embodiments, allowing
the solution to stand at room temperature for about 1 day. In
certain embodiments, the methods provide a Form A crystal form of
Compound 1.
[0193] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 50:50 acetonitrile/water. In some embodiments, the methods
comprise partial slow evaporation. In some embodiments, the methods
comprise slurrying at room temperature for, in some embodiments,
about 14 days. In some embodiments, the methods comprise heating to
51.degree. C., slow cooling from a temperature of about 51.degree.
C. to about room temperature and, in further embodiments, allowing
the solution to stand at room temperature for about 1 day. In
certain embodiments, the methods provide a Form A crystal form of
Compound 1.
[0194] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 50:50 dimethylformamide/water. In some embodiments, the
methods comprise fast evaporation. In some embodiments, the methods
comprise slurrying at room temperature for, in some embodiments,
about 14 days. In some embodiments, the methods comprise heating to
51.degree. C., slow cooling from a temperature of about 51.degree.
C. to about room temperature and, in further embodiments, allowing
the solution to stand at room temperature for about 1 day. In
certain embodiments, the methods provide a Form A crystal form of
Compound 1.
[0195] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from 50:50 p-dioxane/water. In some embodiments, the methods
comprise slow evaporation. In some embodiments, the methods
comprise heating to 51.degree. C., slow cooling from a temperature
of about 51.degree. C. to about room temperature and, in further
embodiments, allowing the solution to stand at room temperature for
about 1 day and, in even further embodiments, subsequently cooling
to about 0.degree. C. In further embodiments, the solution is kept
at about 0.degree. C. for about 11 days. In certain embodiments,
the methods provide a Form A crystal form of Compound 1.
[0196] In certain embodiments, provided herein are methods for
forming a crystal form of Compound 1 comprising crystallization
from THF. In some embodiments, the methods comprise slow
evaporation. In some embodiments, the methods comprise vapor
diffusion. In some embodiments, the methods comprise vapor
diffusion with heptane or water. In some embodiments, the methods
comprise vapor diffusion for 1, 2, 3, 4, 5, 6, 7, or 8 days. In
certain embodiments, the methods provide Form A crystal form of
Compound 1. In certain embodiments, the methods provide Material B
crystal form of Compound 1. In certain embodiments, the methods
provide a mixture of Form A and Material B crystal forms.
[0197] In certain embodiments, provided herein are methods for
forming a Form A crystal form of Compound 1 by storing a Material B
crystal form at a temperature of from 15-50.degree. C.,
20-35.degree. C., or about 25.degree. C.
[0198] In some embodiments, the crystallization step provides
crystalline Compound 1 having greater than about 90% purity (e.g.,
as determined by HPLC). In some embodiments, the crystallization
step provides crystalline Compound 1 having greater than about 95%
purity. In some embodiments, the crystallization step provides
crystalline Compound 1 having greater than about 98% purity. In
some embodiments, the crystallization step provides crystalline
Compound 1 having greater than about 99% purity. In some
embodiments, the crystallization step provides crystalline Compound
1 having greater than about 99.1%, about 99.2%, about 99.3%, about
99.4%, about 99.5%, about 99.6%, about 99.7%, about 99.8%, or 99.9%
purity. In certain embodiments, the crystallization step provides
crystalline Compound 1 have greater than about 90% purity to about
100% purity as determined by HPLC. In certain embodiments, the
present invention provides Compound 1 characterized in that it has
less than about 400 ppm acetone present as a residual solvent. In
certain embodiments, the present invention provides Compound 1
characterized in that it has less than about 300 ppm acetone
present as a residual solvent. In certain embodiments, the present
invention provides Compound 1 characterized in that it has no
acetone present to about 400 ppm acetone present as a residual
solvent. In certain embodiments, the present invention provides
Compound 1 characterized in that it has from about 200 ppm to about
400 ppm acetone present as a residual solvent. In certain
embodiments, the present invention provides Compound 1
characterized in that it has from about 250 ppm to about 350 ppm
acetone present as a residual solvent.
[0199] It has been found, for example, that either crystallization
of Compound 1 from a non-polar solution (e.g., hexanes, n-heptane)
or by washing crystalline Compound 1 with a non-polar solution
provides Compound 1 substantially free of one or more non-polar
impurities selected from IMP-1 and IMP-2 and IMP-3 (FIG. 7).
[0200] In certain embodiments, crystalline Compound 1 is provided
substantially free of non-polar impurity IMP-1 (FIG. 7). As used
herein "substantially free of IMP-1" refers to crystalline Compound
1 having less than about 0.1% a/a of the IMP-1 as determined by
HPLC. In certain embodiments, Compound 1 has less than about 0.09%
a/a, less than about 0.08% a/a, less than about 0.07% a/a, less
than about 0.06% a/a, less than about 0.05% a/a, less than about
0.04% a/a, less than about 0.03% a/a, less than about 0.02% a/a, or
less than about 0.01% a/a of IMP-1 as determined by HPLC. In
certain embodiments, Compound 1 has less than about 0.1% a/a to
about 0.01% a/a of IMP-1 as determined by HPLC.
[0201] In certain embodiments, crystalline Compound 1 is provided
substantially free of non-polar impurity IMP-2 (FIG. 7). As used
herein "substantially free of IMP-2" refers to crystalline Compound
1 having less than about 0.1% a/a of the IMP-2 as determined by
HPLC. In certain embodiments, Compound 1 has less than about 0.09%
a/a, less than about 0.08% a/a, less than about 0.07% a/a, less
than about 0.06% a/a, less than about 0.05% a/a, less than about
0.04% a/a, less than about 0.03% a/a, less than about 0.02% a/a, or
less than about 0.01% a/a of IMP-2 as determined by HPLC. In
certain embodiments, Compound 1 has less than about 0.1% a/a to
about 0.01% a/a of IMP-2 as determined by HPLC.
[0202] In certain embodiments, crystalline Compound 1 is provided
substantially free of non-polar impurity IMP-3 (FIG. 7). As used
herein "substantially free of IMP-3" refers to crystalline Compound
1 having less than about 0.1% a/a of the IMP-3 as determined by
HPLC. In certain embodiments, Compound 1 has less than about 0.09%
a/a, less than about 0.08% a/a, less than about 0.07% a/a, less
than about 0.06% a/a, less than about 0.05% a/a, less than about
0.04% a/a, less than about 0.03% a/a, less than about 0.02% a/a, or
less than about 0.01% a/a of IMP-3 as determined by HPLC. In
certain embodiments, Compound 1 has less than about 0.1% a/a to
about 0.01% a/a of IMP-3 as determined by HPLC.
[0203] It has also been found that crystallization from a polar
solution (e.g., a mixture of a polar aprotic organic solvent and
water) provides Compound 1 substantially free of polar impurity
IMP-4 (FIG. 7).
[0204] As used herein "substantially free of IMP-4" refers to
crystalline Compound 1 having less than about 0.1% a/a of the IMP-4
as determined by HPLC. In certain embodiments, Compound 1 has less
than about 0.09% a/a, less than about 0.08% a/a, less than about
0.07% a/a, less than about 0.06% a/a, less than about 0.05% a/a,
less than about 0.04% a/a, less than about 0.03% a/a, less than
about 0.02% a/a, or less than about 0.01% a/a of IMP-4 as
determined by HPLC. In certain embodiments, Compound 1 has less
than about 0.1% a/a to about 0.01% a/a of IMP-4 as determined by
HPLC.
[0205] In certain embodiments, the crystalline Compound 1 is
further recrystallized from a polar solution (e.g., a mixture of
water and a polar aprotic organic solvent). In certain embodiments,
crystalline Compound 1 is further recrystallized from a mixture of
acetone and water.
(iv) Intermediate Anhydride Formation
[0206] In certain embodiments, the above step S-2 method further
comprises, after an aqueous quench and separation of the aqueous
and organic layer: (i) azeotroping the organic layer to provide
Compound 1 anhydride (e.g., formed via dehydration of Compound 1),
followed by (ii) hydrolysis of the anhydride intermediate via
treatment with water to provide Compound 1 (Scheme 2).
##STR00018##
Step S-3. Azeotropic Distillation
[0207] In certain embodiments, the azeotroping step is a solvent
exchange step (e.g., optionally first distilling the organic phase
of the reaction mixture, followed by treatment of the concentrate
with an azeotroping solvent, followed by additional distillation).
In some embodiments, the solvent exchange step may optionally and
additionally comprise steps of: (1) replenishing the organic phase
with the azeotroping solvent and (2) distilling off a portion of
the resulting organic phase. Solvent exchange steps (1) and (2) can
be repeated as needed. In certain embodiments, the azeotroping
solvent facilitates removal of water and/or other organic solvents
provided in the reaction mixture to provide an anhydride of
Compound 1 (also referred to herein as "Compound 1 anhydride"). In
certain embodiments, the azeotroping solvent is a non-polar
solution (e.g., hexanes, n-heptane). In certain embodiments, the
Compound 1 anhydride is filtered from the reaction to afford a
crystalline solid. In some embodiments, crystalline Compound 1
anhydride provided by this method has an X-ray powder diffraction
pattern substantially similar to that depicted in FIG. 8, Form
I.
[0208] One of ordinary skill in the art will appreciate that the
"Compound 1 anhydride" can exist as a dimer, trimer, tetramer,
oligomer, or mixtures thereof and can comprise linear or cyclic
anhydrides. Such anhydride forms are contemplated and include, but
are not limited to, those depicted in Scheme 3. In certain
embodiments, the "Compound 1 anhydride" is the cyclic trimer
depicted in Scheme 3, also referred to herein as "Compound 2."
##STR00019##
Step S-4. Hydrolysis of the Anhydride
[0209] The "Compound 1 anhydride" is provided by dehydration of
Compound 1 from step S-3 and is hydrolyzed back to Compound 1 upon
exposure to water (i.e., step S-4). Thus, in some embodiments, the
step S-3 to provide the Compound 1 anhydride is followed by
hydrolysis of the Compound 1 anhydride by treatment with water to
provide crystalline Compound 1 (step S-4).
[0210] For example, in certain embodiments, the hydrolysis step
involves heating (e.g., refluxing) Compound 1 anhydride in a
mixture of water and a polar aprotic organic solvent (e.g.,
acetone, acetonitrile, or a mixture thereof) to provide crystalline
Compound 1 (e.g., for example, such that Compound 1 precipitates
from the mixture). In certain embodiments, the polar aprotic
organic solvent is acetone, acetonitrile or a mixture thereof. In
certain embodiments, the polar aprotic organic solvent is
acetone.
[0211] In certain embodiments, the mixture of polar aprotic organic
solvent in water is from about 5% to about 95% polar aprotic
organic solvent in water, from about 10% to about 90% polar aprotic
organic solvent in water, from about 15% to about 85% polar aprotic
organic solvent in water, from about 20% to about 80% polar aprotic
organic solvent in water, from about 25% to about 75% polar aprotic
organic solvent in water, from about 30% to about 70% polar aprotic
organic solvent in water, from about 35% to about 65% polar aprotic
organic solvent in water, or from about 40% to about 70% polar
aprotic organic solvent in water.
[0212] In certain embodiments, portions of the polar solution and
water are added to the refluxing solution in iterations prior to
cooling of the solution. In some embodiments, the cooling of the
solution occurs for a specified amount of time (e.g., greater than
about 8 hours) and/or at a specified temperature (e.g., about
25.degree. C.). In some embodiments, Compound 1 is isolated via
filtration and dried using any method known in the chemical
arts.
[0213] In certain embodiments, Compound 1 provided by the above
hydrolysis step is crystalline Compound 1, as described herein. In
some embodiments, crystalline Compound 1 provided by this method
has an X-ray powder diffraction pattern substantially similar to
that depicted in FIG. 1, Form A.
[0214] In some embodiments, crystalline Compound 1 provided by the
above hydrolysis step has greater than about 90% purity (e.g., as
determined by HPLC). In some embodiments, crystalline Compound 1
provided by the above hydrolysis step has greater than about 95%
purity. In some embodiments, crystalline Compound 1 provided by the
above hydrolysis step has greater than about 98% purity. In some
embodiments, crystalline Compound 1 provided by the above
hydrolysis step has greater than about 99% purity. In some
embodiments, crystalline Compound 1 provided by the above
hydrolysis step has greater than about 99.1%, about 99.2%, about
99.3%, about 99.4%, about 99.5%, about 99.6%, about 99.7%, about
99.8%, or about 99.9% purity. In certain embodiments, crystalline
Compound 1 provided by the above hydrolysis step has greater than
about 90% purity to about 100% purity as determined by HPLC.
[0215] In certain embodiments, the present invention provides
crystalline Compound 1 from the above hydrolysis step having less
than about 400 ppm acetone present as a residual solvent. In
certain embodiments, the present invention provides crystalline
Compound 1 from the above hydrolysis step having less than about
300 ppm acetone present as a residual solvent. In certain
embodiments, the present invention provides crystalline Compound 1
from the above hydrolysis step having no acetone present to about
400 ppm acetone present as a residual solvent. In certain
embodiments, the present invention provides crystalline Compound 1
from the above hydrolysis step having from about 200 ppm to about
400 ppm acetone present as a residual solvent. In certain
embodiments, the present invention provides crystalline Compound 1
from the above hydrolysis step having from about 250 ppm to about
350 ppm acetone present as a residual solvent.
[0216] It has been found that washing crystalline Compound 1 with a
non-polar solution after the above hydrolysis step provides
Compound 1 substantially free of one or more non-polar impurities
selected from IMP-1 and IMP-2 and IMP-3 (FIG. 7).
[0217] In certain embodiments, crystalline Compound 1 from the
above hydrolysis step is provided substantially free of non-polar
impurity IMP-1 (FIG. 7). As used herein "substantially free of
IMP-1" refers to crystalline Compound 1 having less than about 0.1%
a/a of the IMP-1 as determined by HPLC. In certain embodiments,
Compound 1 has less than about 0.09% a/a, less than about 0.08%
a/a, less than about 0.07% a/a, less than about 0.06% a/a, less
than about 0.05% a/a, less than about 0.04% a/a, less than about
0.03% a/a, less than about 0.02% a/a, or less than about 0.01% a/a
of IMP-1 as determined by HPLC. In some embodiments, Compound 1 is
less than about 0.05% a/a of IMP-1 as determined by HPLC. In
certain embodiments, Compound 1 has less than about 0.1% a/a to
about 0.01% a/a of IMP-1 as determined by HPLC.
[0218] In certain embodiments, crystalline Compound 1 from the
above hydrolysis step is provided substantially free of non-polar
impurity IMP-2 (FIG. 7). As used herein "substantially free of
IMP-2" refers to crystalline Compound 1 having less than about 0.1%
a/a of the IMP-2 as determined by HPLC. In certain embodiments,
Compound 1 has less than about 0.09% a/a, less than about 0.08%
a/a, less than about 0.07% a/a, less than about 0.06% a/a, less
than about 0.05% a/a, less than about 0.04% a/a, less than about
0.03% a/a, less than about 0.02% a/a, or less than about 0.01% a/a
of IMP-2 as determined by HPLC. In some embodiments, Compound 1 is
less than about 0.05% a/a of IMP-2 as determined by HPLC. In
certain embodiments, Compound 1 has less than about 0.1% a/a to
about 0.01% a/a of IMP-2 as determined by HPLC.
[0219] In certain embodiments, crystalline Compound 1 from the
above hydrolysis step is provided substantially free of non-polar
impurity IMP-3 (FIG. 7). As used herein "substantially free of
IMP-3" refers to crystalline Compound 1 having less than about 0.1%
a/a of the IMP-3 as determined by HPLC. In certain embodiments,
Compound 1 has less than about 0.09% a/a, less than about 0.08%
a/a, less than about 0.07% a/a, less than about 0.06% a/a, less
than about 0.05% a/a, less than about 0.04% a/a, less than about
0.03% a/a, less than about 0.02% a/a, or less than about 0.01% a/a
of IMP-3 as determined by HPLC. In some embodiments, Compound 1 is
less than about 0.05% a/a of IMP-3 as determined by HPLC. In
certain embodiments, Compound 1 has less than about 0.1% a/a to
about 0.01% a/a of IMP-3 as determined by HPLC.
[0220] It has also been found that crystallization from a polar
solution (e.g., a mixture of a polar aprotic organic solvent and
water) after the above hydrolysis step provides Compound 1
substantially free of polar impurity IMP-4 (FIG. 7). As used herein
"substantially free of IMP-4" refers to crystalline Compound 1
having less than about 0.1% a/a of the IMP-4 as determined by HPLC.
In certain embodiments, Compound 1 has less than about 0.09% a/a,
less than about 0.08% a/a, less than about 0.07% a/a, less than
about 0.06% a/a, less than about 0.05% a/a, less than about 0.04%
a/a, less than about 0.03% a/a, less than about 0.02% a/a, or less
than about 0.01% a/a of IMP-4 as determined by HPLC. In some
embodiments, Compound 1 is less than about 0.05% a/a of IMP-4 as
determined by HPLC. In certain embodiments, Compound 1 has less
than about 0.1% a/a to about 0.01% a/a of IMP-4 as determined by
HPLC.
[0221] In certain embodiments, the crystalline Compound 1 is
further recrystallized from a polar solution (e.g., a mixture of
water and a polar aprotic organic solvent). In certain embodiments,
crystalline Compound 1 is further recrystallized from a mixture of
acetone and water.
(v) Other Embodiments of the Method of Preparation
[0222] In certain embodiments, the present invention provides a
method of preparing Compound 1:
##STR00020##
[0223] or a pharmaceutically acceptable salt, hydrate or solvate
thereof and/or anhydride thereof;
[0224] comprising the steps of: [0225] (a) coupling a compound of
formula E-1:
##STR00021##
[0226] wherein: [0227] LG.sup.1 and LG.sup.2 are independently
selected from a halogen or sulfonate; [0228] with a compound of
formula E-2:
##STR00022##
[0229] wherein each R.sup.1 and R.sup.2 is independently selected
from hydrogen or an C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6
alkynyl, C.sub.6-12 aryl or C.sub.6-12 heteroaryl group, or R.sup.1
and R.sup.2 are joined to form a 5-8 membered ring;
[0230] in order to provide a compound of formula E-3:
##STR00023##
[0231] wherein: [0232] LG.sup.2 is selected from a halogen or
sulfonate; [0233] (b) reacting E-3 with a boronation reagent and a
metal reagent in order to provide Compound 1.
[0234] In certain embodiments, E-1 is E-1b:
##STR00024##
[0235] In certain embodiments, E-2 is E-2a:
##STR00025##
[0236] In certain embodiments, E-3 is E-3a:
##STR00026##
[0237] In certain embodiments, the coupling step comprises a
palladium catalyst. In certain embodiments, the palladium catalyst
is selected from Pd(PPh.sub.3).sub.4, Pd(OAc).sub.2,
Pd.sub.2(dba).sub.3, Pd(dppf).sub.2Cl.sub.2, and
PdCl.sub.2(PPh.sub.3).sub.2.
[0238] In certain embodiments, the coupling step comprises a base.
In certain embodiments, the base is selected from triethylamine,
diisopropylethylamine, potassium carbonate, sodium carbonate,
cesium carbonate, potassium bicarbonate, sodium bicarbonate, cesium
bicarbonate, potassium acetate, sodium acetate, potassium
phosphate, lithium hydroxide, sodium hydroxide and magnesium
hydroxide.
[0239] In certain embodiments, the boronation reagent is a boronate
ester. In certain embodiments, the boronate ester is selected from
trimethyl borate, triethyl borate, triallyl borate, triisopropyl
borate, Tributyl borate, Tri-tert-butyl borate, Tripentyl borate,
Trihexyl borate, Tritolyl borate, Tribenzyl borate, Triphenyl
borate, Trimethylene borate, Triethanolamine borate, Trimethallyl
borate, 2-Methoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Methoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-Isopropoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane,
2-Isopropoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
2-(2-dimethylaminoethoxy)-4-methyl-1,3,2-dioxaborinane,
2-butoxy-4,4,6-trimethyl-1,3,2-dioxaborinane,
tris(2,2,2-trifluoroethyl) borate, tris(1-isopropyl-2-methylpropyl)
borate, and 2,2'-(2-methyl-2,4-pentanediyldioxy)bis
(4,4,6-trimethyl-1,3,2-dioxaborinane).
[0240] In certain embodiments, the metal reagent is an alkyl
lithium reagent. In certain embodiments, the alkyl lithium reagent
is n-butyllithium or hexyllithium.
[0241] In certain embodiments, the method further comprises
crystallizing Compound 1 of step (b) to provide crystalline
Compound 1. Exemplary methods of crystallizing and recrystallizing
Compound 1 have been described above and herein.
[0242] For example, in certain embodiments, the crystallizing step
comprises crystallizing Compound 1 from a polar solution comprising
water, a polar apolar solvent or a mixture thereof. In certain
embodiments, the crystallizing step comprises crystallizing
Compound 1 from a mixture of water and acetone. In certain
embodiments, the crystalline Compound 1 is further washed with a
non-polar solution. In certain embodiments, the non-polar solution
comprises hexanes, heptanes or a mixture thereof. In certain
embodiments, the crystalline Compound 1 is further recrystallized
from a mixture of water and acetone.
[0243] Exemplary crystalline Compound 1 provided by these methods
is further described in the following section and in the
Examples.
[0244] In certain embodiments, the method step (b) further
comprises the steps of dehydrating Compound 1 in order to provide
an anhydride of Compound 1 followed by hydrolysis of the anhydride
of Compound 1 in order to provide Compound 1. In certain
embodiments, the dehydration step is performed in situ (i.e.,
Compound 1 is not isolated). In certain embodiments, the
dehydration step is an azeotroping step. In certain embodiments,
the azeotroping is performed by solvent exchange of the reaction
mixture. In certain embodiments, the hydrolysis step is performed
by addition of water to the anhydride of Compound 1. Exemplary
methods of dehydration, azeotroping and hydrolyses have also been
described above and herein.
[0245] In certain embodiments, the anhydride of Compound 1
("Compound 1 anhydride") is Compound 2:
##STR00027##
[0246] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0247] In certain embodiments, Compound 2 is crystalline. Exemplary
crystalline Compound 2 provided by these methods is further
described in the following section and in the Examples.
Solid Forms of Compound 1 and Anhydrides Thereof
[0248] Potential pharmaceutical solids include crystalline solids
and amorphous solids. Amorphous solids are characterized by a lack
of long-range structural order, whereas crystalline solids are
characterized by structural periodicity. The desired class of
pharmaceutical solid depends upon the specific application;
amorphous solids are sometimes selected on the basis of, e.g., an
enhanced dissolution profile, while crystalline solids may be
desirable for properties such as, e.g., physical or chemical
stability (see, e.g., S. R. Vippagunta et al., Adv. Drug. Deliv.
Rev., (2001) 48:3-26; L. Yu, Adv. Drug. Deliv. Rev., (2001)
48:27-42). A change in solid form may affect a variety of physical
and chemical properties, which may provide benefits or drawbacks in
processing, formulation, stability and bioavailability, among other
important pharmaceutical characteristics.
[0249] Whether crystalline or amorphous, potential solid forms of a
pharmaceutical compound may include single-component and
multiple-component solids. Single-component solids consist
essentially of the pharmaceutical compound in the absence of other
compounds. Variety among single-component crystalline materials may
potentially arise from the phenomenon of polymorphism, wherein
multiple three-dimensional arrangements exist for a particular
pharmaceutical compound (see, e.g., S. R. Byrn et al., Solid State
Chemistry of Drugs, (1999) SSCI, West Lafayette).
[0250] Additional diversity among the potential solid forms of a
pharmaceutical compound may arise from the possibility of
multiple-component solids. Crystalline solids comprising two or
more ionic species are termed salts (see, e.g., Handbook of
Pharmaceutical Salts: Properties, Selection and Use, P. H. Stahl
and C. G. Wermuth, Eds., (2002), Wiley, Weinheim). Additional types
of multiple-component solids that may potentially offer other
property improvements for a pharmaceutical compound or salt thereof
include, e.g., hydrates, solvates, co-crystals and clathrates,
among others (see, e.g., S. R. Byrn et al., Solid State Chemistry
of Drugs, (1999) SSCI, West Lafayette). Moreover,
multiple-component crystal forms may potentially be susceptible to
polymorphism, wherein a given multiple-component composition may
exist in more than one three-dimensional crystalline arrangement.
The discovery of solid forms is of great importance in the
development of a safe, effective, stable and marketable
pharmaceutical compound.
[0251] The solid forms provided herein are useful as active
pharmaceutical ingredients for the preparation of formulations for
use in animals or humans. Thus, embodiments herein encompass the
use of these solid forms as a final drug product. Certain
embodiments provide solid forms useful in making final dosage forms
with improved properties, e.g., powder flow properties, compaction
properties, tableting properties, stability properties, and
excipient compatibility properties, among others, that are needed
for manufacturing, processing, formulation and/or storage of final
drug products. Certain embodiments herein provide pharmaceutical
compositions comprising a single-component crystal form, a
multiple-component crystal form, a single-component amorphous form
and/or a multiple-component amorphous form comprising the compound
of formula (I) and a pharmaceutically acceptable diluent, excipient
or carrier.
[0252] Solid form and related terms refer to a physical form, which
is not predominantly in a liquid or a gaseous state. Solid forms
may be crystalline, amorphous or mixtures thereof. A
"single-component" solid form comprising a particular compound
consists essentially of that compound. A "multiple-component" solid
form comprising a particular compound comprises that compound and a
significant quantity of one or more additional species, such as
ions and/or molecules, within the solid form. The solid forms
provided herein may be crystalline, amorphous, or an intermediate
form. The crystal forms described herein, therefore, may have
varying degrees of crystallinity or lattice order. The solid forms
described herein are not limited to any particular degree of
crystallinity or lattice order, and may be 0-100% crystalline.
Methods of determining the degree of crystallinity are known to
those of ordinary skill in the, such as those described in R.
Suryanarayanan, X-Ray Power Diffractometry, Physical
Characterization of Pharmaceutical Salts, H. G. Brittain, Editor,
Mercel Dekkter, Murray Hill, N.J., 1995, pp. 187-199, which is
incorporated herein by reference in its entirety. In some
embodiments, the solid forms described herein are about 0, 5, 10,
15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95
or 100% crystalline.
[0253] Solid forms may exhibit distinct physical characterization
data that are unique to a particular solid form, such as the
crystal forms described herein. These characterization data may be
obtained by various techniques known to those skilled in the art,
including, for example, X-ray powder diffraction, differential
scanning calorimetry, thermal gravimetric analysis, and nuclear
magnetic resonance spectroscopy. The data provided by these
techniques may be used to identify a particular solid form. One
skilled in the art can determine whether a solid form is one of the
forms described herein by performing one of these characterization
techniques and determining whether the resulting data is
"substantially similar" to the reference data provided herein,
which is identified as being characteristic of a particular solid
form. Characterization data that is "substantially similar" to
those of a reference solid form is understood by those skilled in
the art to correspond to the same solid form as the reference solid
form. In analyzing whether data is "substantially similar," a
person of ordinary skill in the art understands that particular
characterization data points may vary to a reasonable extent while
still describing a given solid form, due to, for example,
experimental error and routine sample-to-sample analysis.
Compound 1
[0254] It is contemplated that Compound 1 can exist in a variety of
solid forms. Such solid forms include crystalline solids, such as
polymorphs, solvates and hydrates of crystalline Compound 1, as
well as amorphous solids, or mixtures thereof. All such solid forms
of Compound 1 are contemplated under the present invention.
[0255] In some embodiments, provided herein is crystalline Compound
1:
##STR00028##
[0256] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0257] In some embodiments, crystalline Compound 1 is substantially
free of any one of the following compounds:
##STR00029##
[0258] In certain embodiments of the present invention, Compound 1
is provided as a crystalline solid ("crystalline Compound 1"). In
certain embodiments, crystalline Compound 1 is a solid form
substantially free of amorphous Compound 1. In certain embodiments,
crystalline Compound 1 is a solid form substantially free of other
crystalline forms (i.e., polymorphs) of Compound 1. In certain
embodiments, crystalline Compound 1 is a solid form substantially
free of one or more anhydrides of Compound 1 (e.g., a dimer,
trimer, or oligomer of Compound 1, e.g., Compound 2). In certain
embodiments, Compound 1 is provided as pure and isolated
crystalline Compound 1.
[0259] As defined herein, "pure and isolated" refers to the
isolated crystalline Compound 1 having at least one of the
following characteristics: [0260] (i) a crystalline solid having
greater than 90% purity (e.g., as determined by HPLC); [0261] (ii)
a crystalline solid having less than about 400 ppm acetone present
as a residual solvent; [0262] (iii) a crystalline solid
substantially free of non-polar impurities IMP-1 and IMP-2 and
IMP-3, as defined above and herein; [0263] (iv) a crystalline solid
substantially free of polar impurity IMP-4 as defined above and
herein; [0264] (v) a crystalline solid substantially free of
amorphous Compound 1; [0265] (vi) a crystalline solid substantially
free of one or more anhydrides of Compound 1; and/or [0266] (vii) a
crystalline solid substantially free of other crystalline forms of
Compound 1.
[0267] In certain embodiments, "pure and isolated" refers to the
isolated crystalline Compound 1 having at least two of the above
listed (i) to (vii) characteristics. In certain embodiments, "pure
and isolated" refers to the isolated crystalline Compound 1 having
at least three of the above listed (i) to (vii) characteristics. In
certain embodiments, "pure and isolated" refers to the isolated
crystalline Compound 1 having at least four of the above listed (i)
to (vii) characteristics. In certain embodiments, "pure and
isolated" refers to the isolated crystalline Compound 1 having at
least five of the above listed (i) to (vii) characteristics. In
certain embodiments, "pure and isolated" refers to the isolated
crystalline Compound 1 having at least six of the above listed (i)
to (vii) characteristics. In certain embodiments, "pure and
isolated" refers to the isolated crystalline Compound 1 having all
seven of the above listed (i) to (vii) characteristics.
[0268] The phrase "substantially free of amorphous Compound 1"
means that about 90% to about 100% by weight, about 95% to about
100% by weight, about 98% to about 100% by weight, or about 99% to
about 100% by weight of Compound 1 is crystalline (i.e., not
amorphous).
[0269] The phrase "substantially free of one or more anhydrides of
Compound 1" means that at about 90% to about 100% by weight, about
95% to about 100% by weight, about 98% to about 100% by weight, or
about 99% to about 100% by weight of Compound 1 is provided as the
monomer (i.e., not an anhydride thereof).
[0270] The phrase "substantially free of one or more other
crystalline forms of Compound 1" means that at about 90% to about
100% by weight, about 95% to about 100% by weight, about 98% to
about 100% by weight, or about 99% to about 100% by weight of
Compound 1 is provided in a specific crystalline form, e.g., "Form
A," "Form A1," or "Material B."
[0271] Form A, Compound 1
[0272] "Form A," in certain embodiments, refers to a specific
crystalline form of Compound 1 having, in some embodiments, at
least one of the following characteristics: [0273] (i) one or more
transition temperatures selected from about 128.+-.5.degree. C. and
about 244.+-.2.degree. C. as determined by differential scanning
calorimetry (DSC); [0274] (ii) one or more peaks in an X-ray powder
diffraction (XRPD) pattern selected from 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10 .theta.-2.theta. degrees); [0275]
(iii) an X-ray powder diffraction (XRPD) pattern substantially
similar to that depicted in FIG. 1, 19 (row A), 22, or 23; and/or
[0276] (iv) a differential scanning calorimetry (DSC) scan
substantially similar to that depicted in FIG. 2.
[0277] In some embodiments, Form A is isolated. In certain
embodiments, "Form A" is characterized by peaks in an XRPD pattern
located at 1, 2, 3, 4, 5, 6, or all of the following approximate
peak positions: 9.68.+-.0.10, 17.26.+-.0.10, 21.60.+-.0.10,
24.68.+-.0.10, 25.48.+-.0.10, 27.73.+-.0.10 and 29.08.+-.0.10
.theta.-2.theta. (degrees). In certain embodiments, "Form A" is
characterized by two or more peaks selected from 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10. In certain embodiments, "Form A"
is characterized by three or more peaks selected from 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10. In certain embodiments, "Form A"
is characterized by four or more peaks selected from 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10. In certain embodiments, "Form A"
is characterized by five or more peaks selected from 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10. In certain embodiments, "Form A"
is characterized by six or more peaks selected from 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10. In certain embodiments, "Form A"
is characterized by all of the following peaks: 9.68.+-.0.10,
17.26.+-.0.10, 21.60.+-.0.10, 24.68.+-.0.10, 25.48.+-.0.10,
27.73.+-.0.10 and 29.08.+-.0.10. In certain embodiments, "Form A"
is characterized by the X-ray powder diffraction pattern
substantially similar to that depicted in FIG. 1, 19 (row A), 22,
or 23.
[0278] In certain embodiments, provided herein is a crystalline
form of Compound 1 having an XRPD pattern comprising peaks at
approximately 17.26, 21.60, and 27.73 degrees 2.theta.. In further
embodiments, the XRPD pattern further comprises peaks at
approximately 24.68 and 25.48 degrees 2.theta.. In even further
embodiments, the XRPD pattern further comprises peaks at
approximately 9.68 and 29.08 degrees 2.theta..
[0279] In some embodiments, provided herein is a crystal form
having at least 3, at least 4, at least 5, at least 6, at least 7,
at least 8, at least 9, at least 10, at least 11, at least 12, at
least 13, at least 14, at least 15, at least 16, at least 17, at
least 18, at least 19, at least 20, at least 21, at least 22, at
least 23, or all of the following approximate XRPD pattern peaks:
4.8, 9.7, 16.1, 16.9, 17.3, 17.8, 18.6, 18.9, 19.3, 19.7, 21.0,
21.6, 22.5, 23.7, 24.3, 24.7, 25.2, 25.5, 26.0, 26.5, 27.7, 29.0,
29.4, and 29.8 degrees 2.theta.. In some embodiments, the crystal
form has at least 8, at least 9, or at least 10 peaks. In some
embodiments, the crystal form has at least 10 peaks.
[0280] In some embodiments, provided herein is an isolated Form A
crystal form of Compound 1. In certain embodiments, the isolated
Form A crystal form has an XRPD pattern, which is substantially
similar to the pattern of FIG. 1, 19 (row A), 22, or 23. In some
embodiments, provided herein is an isolated Form A crystal form of
Compound 1, which has an XRPD pattern comprising peaks at
approximately 17.3, 21.6, and 27.7 degrees 2.theta. when analyzed
using copper K.alpha. radiation.
[0281] In certain embodiments, "Form A" is characterized by one or
more transition temperatures selected from about 128.+-.5.degree.
C. and about 244.+-.2.degree. C. as determined by differential
scanning calorimetry (DSC). In certain embodiments, "Form A" is
characterized by a transition temperature of about 244.+-.2.degree.
C. as determined by differential scanning calorimetry (DSC). In
certain embodiments, "Form A" is characterized by a transition
temperature of about 128.+-.5.degree. C. as determined by
differential scanning calorimetry (DSC). In certain embodiments,
"Form A" is characterized by two transition temperatures selected
from about 128.+-.5.degree. C. and about 244.+-.2.degree. C. as
determined by differential scanning calorimetry (DSC). In certain
embodiments, "Form A" is characterized by a differential scanning
calorimetry (DSC) scan substantially similar to that depicted in
FIG. 2.
[0282] In certain embodiments, "Form A" refers to a specific
crystalline form of Compound 1 having at least two of the above
listed (i) to (iv) characteristics. In certain embodiments, "Form
A" refers to a specific crystalline form of Compound 1 having at
least three of the above listed (i) to (iv) characteristics. In
certain embodiments, "Form A" refers to a specific crystalline form
of Compound 1 having all four of the above listed (i) to (iv)
characteristics.
[0283] In certain embodiments, Form A may have one or more
preferred orientations. Such preferred orientations may be
observable in high-resolution XRPD patterns, which may, in some
embodiments, exhibit preferred orientation effects evidenced by a
small number of high-intensity peaks.
[0284] In certain embodiments, the Form A crystal form of Compound
1 has the following approximate monoclinic cell parameters and
calculated volume: .alpha.=5.45 .ANG.; b=5.16 .ANG.; c=36.12 .ANG.;
.alpha.=90.degree.; .beta.=90.degree.; .gamma.=90.degree.; V=1016.5
.ANG..sup.3. In some embodiments, the molecular weight of an
asymmetric unit of a Form A crystal form of Compound 1 is about
234.0 g/mol with Z=4. In certain embodiments, the calculated
density of the unit is about 1.5 g cm.sup.-3.
[0285] In some embodiments, the Form A crystal form of Compound 1
is chemically stable. In some embodiments, the Form A crystal form
of Compound 1 is physically stable.
[0286] In some embodiments, the Form A crystal form of Compound 1
is substantially free of other crystalline forms of Compound 1.
[0287] In some embodiments, Form A is stable upon stressing at
approximately 75%, 80%, 85%, 90%, 95%, 97%, or 99% relative
humidity. In certain embodiments, Form A is stable at approximately
75%, 80%, 85%, 90%, 95%, 97%, or 99% relative humidity at about
40.degree. C. In yet another embodiment, Form A is stable at
approximately 75%, 80%, 85%, 90%, 95%, 97%, or 99% relative
humidity at about 40.degree. C. for about 1 week.
[0288] The term "substantially similar," when used herein in the
context of comparing X-ray powder diffraction pattern or
differential scanning calorimetry scan obtained for a solid form of
a compound, e.g., of Compound 1, means that two spectra share
defining characteristics sufficient to differentiate them from a
spectrum obtained for a different form of that compound. In certain
embodiments, the term "substantially similar" means that two
spectra are the same, i.e., visibly overlap. In certain
embodiments, spectra or characterization data that are
substantially similar to those of a reference crystalline form,
amorphous form, or mixture thereof, is understood by those of
ordinary skill in the art to correspond to the same crystalline
form, amorphous form, or mixture thereof as the particular
reference. In analyzing whether spectra or characterization data
are substantially similar, a person of ordinary skill in the art
understands that particular characterization data points may vary
to a reasonable extent while still describing a given solid form,
due to, for example, experimental error and routine
sample-to-sample analysis, or due to preferred orientation
effects.
[0289] In certain embodiments, the XRPD peaks above (degrees
2.theta. peaks) are when analyzed using copper K.alpha.
radiation.
[0290] In some embodiments, Form A is obtained by crystallization
from acetone, acetonitrile, chloroform, dichloromethane, diethyl
ether, DMF, p-dioxane, ethyl acetate, heptanes, 2:1
heptane:chloroform, 2:1 heptane:THF, isopropyl ether, methyl ethyl
ketone, 2-methyltetrahydrofuran, methyl iso-butyl ketone,
tert-butyl methyl ether, nitromethane, THF, toluene, water, 1:1
acetone:water, 1:1 acetonitrile:water, 1:1 DMF:water, or 1:1
dioxane:water.
[0291] In some embodiments, Form A is obtained by slow evaporation
from acetone. In some embodiments, Form A is obtained from crash
precipitation with heptane from acetone.
[0292] In some embodiments, Form A is obtained from slow
evaporation form acetonitrile. In some embodiments, Form A is
obtained by vapor diffusion with water from acetonitrile. In
particular embodiments, vapor diffusion is performed over about 8
days.
[0293] In some embodiments, Form A is obtained by slow evaporation
from diethyl ether.
[0294] In some embodiments, Form A is obtained by fast evaporation
from DMF. In some embodiments, Form A is obtained by slow
evaporation from p-dioxane.
[0295] In some embodiments, Form A is obtained from slow
evaporation or crash precipitation with heptanes from ethyl
acetate.
[0296] In some embodiments, Form A is obtained by slurrying in
heptane. In particular embodiments, the slurrying is performed at
room temperature. In another embodiment, the slurrying is performed
at room temperature for about 14 days.
[0297] In some embodiments, Form A is obtained by slow evaporation
from 2:1 heptane:chloroform.
[0298] In some embodiments, Form A is obtained by slow evaporation
from 2:1 heptane:THF.
[0299] In some embodiments, Form A is obtained by slow evaporation
from isopropyl ether.
[0300] In some embodiments, Form A is obtained by slow cooling from
isopropyl ether. In certain embodiments, the solution of Form A and
isopropyl ether is cooled from about 51.degree. C. to room
temperature and allowed to stand for 1 day. In some embodiments,
Form A is obtained by slow crash precipitation with heptane from
isopropyl ether.
[0301] In some embodiments, Form A is obtained by slow evaporation
from methyl ethyl ketone. In some embodiments, Form A is obtained
by crash precipitation with heptane from methyl ethyl ketone.
[0302] In some embodiments, Form A is obtained by slow evaporation
from 2-methyl THF.
[0303] In some embodiments, Form A is obtained by slow evaporation
from MTBE. In some embodiments, Form A is obtained by crash
precipitation with heptane from MTBE.
[0304] In some embodiments, Form A is obtained by slow evaporation
from nitromethane.
[0305] In some embodiments, Form A is obtained by fast evaporation,
slurry, or slow cooling from toluene. In certain embodiments, the
slurry is performed at about room temperature over about 14 days.
In certain embodiments, the solution of toluene and Compound 1 is
cooled from about 51.degree. C. to room temperature and allowed to
stand for 1 day.
[0306] In some embodiments, Form A is obtained by slurry from
water. In certain embodiments, the slurry is performed at room
temperature for about 14 days.
[0307] In some embodiments, Form A is obtained by slow evaporation,
slurry, or slow cooling from 1:1 acetone:water. In certain
embodiments, the slurry is performed at about room temperature over
about 14 days. In certain embodiments, the solution of Compound 1
and acetone/water is cooled from about 51.degree. C. to room
temperature and allowed to stand for 1 day.
[0308] In some embodiments, Form A is obtained by slow evaporation,
slurry, or slow cooling from 1:1 acetonitrile:water. In certain
embodiments, the slurry is performed at about room temperature over
about 14 days. In certain embodiments, the solution of Compound 1
and acetone/water is cooled from about 51.degree. C. to room
temperature and allowed to stand for 1 day.
[0309] In some embodiments, Form A is obtained by fast evaporation,
slurry, or slow cooling from 1:1 DMF:water. In certain embodiments,
the slurry is performed at about room temperature over about 14
days. In certain embodiments, the solution of Compound 1 and
acetone/water is cooled from about 51.degree. C. to room
temperature and allowed to stand for 1 day.
[0310] In some embodiments, Form A is obtained by slow evaporation,
or slurry from 1:1 p-dioxane:water. In certain embodiments, the
slurry is performed at about room temperature over about 14 days.
In certain embodiments, the solution of Compound 1 and
acetone/water is cooled from about 51.degree. C. to room
temperature and allowed to stand for 1 day.
[0311] Form A1, Compound 1
[0312] In some embodiments, provided herein is a Form A1 crystal
form of Compound 1. A representative XRPD pattern of Form A1 is
provided in FIG. 31. In some embodiments, provided herein is the
Form A1 crystal form of Compound A1, which has an XRPD pattern,
which is substantially similar to the pattern exhibited in FIG. 31.
In some embodiments, the Form A1 crystal form of Compound 1 is
isolated.
[0313] In some embodiments, Form A1 is obtained by crystallization
of Compound 1 from chloroform, dichloromethane, isopropyl ether, or
methyl isobutyl ether. In some embodiments, Form A1 is obtained by
slow evaporation from chloroform. In some embodiments, Form A1 is
obtained by slow evaporation or crash precipitation with heptane
from dichloromethane.
[0314] Material B, Compound 1
[0315] In some embodiments, provided herein is a Material B crystal
form of Compound 1. In some embodiments, the Form B crystal form of
Compound 1 is isolated. A representative XRPD pattern of Material B
is provided in FIG. 19 (row B), 32, or 35. In some embodiments,
provided herein is the Material B crystal form of Compound 1, which
has an XRPD pattern which is substantially similar to the pattern
exhibited in FIG. 19 (row B), 32, or 35.
[0316] In certain embodiments, Material B is characterized by a DSC
thermogram comprising one, two, three, or more thermal events at
about 119.degree. C. or higher.
[0317] In certain embodiments, Material B undergoes a weight loss
of about 10.14% when heated from 25 to 130.degree. C. In certain
embodiments, such weight loss is determined by TGA analysis.
[0318] In certain embodiments, Material B is characterized by a TGA
or DSC thermogram substantially similar to that depicted in FIG.
34.
[0319] In some embodiments, provided herein is an isolated Material
B crystal form of Compound 1. In certain embodiments, the isolated
Material B crystal form of Compound 1 has an XRPD pattern which is
substantially similar to the pattern exhibited in FIG. 19 (row B)
or 32.
[0320] In some embodiments, the Material B crystal form of Compound
1 is chemically stable. In some embodiments, the Material B crystal
form of Compound 1 is physically stable.
[0321] In some embodiments, the Material B crystal form is
substantially free of other crystal forms of Compound 1.
[0322] In some embodiments, provided herein is a mixture comprising
Material B and a second component. An exemplary XRPD pattern of
this mixture is provided in FIG. 33.
[0323] In some embodiments, Material B is hydrated. In some
embodiments, Material B is not solvated or hydrated.
[0324] In some embodiments, Material B is obtained by
crystallization from THF. In some embodiments, Material B is
obtained by slow evaporation of Compound 1 from THF. In particular
embodiments, the slow evaporation is performed on a scale of about
30 mg of Compound 1 or less. In some embodiments, Material B is
obtained by vapor diffusion with heptane for one day from THF.
[0325] In some embodiments, Material B is obtained by subjecting a
mixture of Form A and Material B to water and/or heat. In some
embodiments, Material B is obtained by subjecting a mixture of Form
A and Material B to about 80%, 85%, 90%, 95%, 97%, or 99% relative
humidity at elevated temperatures. In certain embodiments, the
elevated temperature is about 40.degree. C.
[0326] Compound 1 Form A/Material B Mixture
[0327] In some embodiments, provided herein are mixtures of Form A
and Material B crystal forms. FIG. 19 (rows C and D) provides
exemplary XRPD patterns of such a mixture. In some embodiments, the
mixtures are isolated. In some embodiments, provided herein is an
isolated mixture of Form A and Material B crystal forms of Compound
1, which has an XRPD pattern that is substantially similar to FIG.
19 (row C or D).
Compound 2
[0328] As described above and herein, dehydration of Compound 1
forms anhydrides, e.g., dimers, trimers, and/or oligomer anhydrides
of Compound 1. Assays can be used to distinguish the various
anhydrides from Compound 1 (the monomer) and from each other.
Exemplary such assays include, but are not limited to, elemental
analysis, X-ray diffraction, X-ray powder diffraction (XRPD)
analysis, .sup.1H nuclear magnetic resonance (NMR) analysis, and
Karl Fischer oven method evaporative coulometric titration.
[0329] In certain embodiments, the present invention provides a
Compound 1 anhydride, wherein in the anhydride is a dimer, trimer,
and/or oligomer of Compound 1, or a mixture thereof, as a
crystalline solid ("crystalline Compound 1 anhydride"). In some
embodiments, the present invention provides the crystalline
Compound 1 anhydride as a trimer (e.g., a linear or cyclic trimer).
In some embodiments, the present invention provides the crystalline
Compound 1 anhydride as a cyclic trimer, i.e., Compound 2, as
defined herein.
[0330] In some embodiments, provided here is crystalline Compound
2:
##STR00030##
[0331] or a pharmaceutically acceptable salt, hydrate or solvate
thereof.
[0332] In some embodiments, the crystalline Compound 2 is
substantially free of any one of the following compounds:
##STR00031##
[0333] In some embodiments, the crystalline Compound 2 is
substantially free of Compound 1 or other anhydrides thereof.
[0334] In certain embodiments, crystalline Compound 2 is a solid
form substantially free of amorphous Compound 2. In certain
embodiments, crystalline Compound 2 is a solid form substantially
free of one or more other crystalline forms of Compound 2. In
certain embodiments, crystalline Compound 2 is a solid form
substantially free of crystalline Compound 1. In certain
embodiments, crystalline Compound 2 is a solid form substantially
free of other anhydrides of Compound 1 (e.g., dimer, linear trimer,
oligomers of Compound 1). In certain embodiments, Compound 2 is
provided as pure and isolated crystalline Compound 2.
[0335] As defined herein, "pure and isolated" refers to the
isolated crystalline Compound 2 having at least one of the
following characteristics: [0336] (i) a crystalline solid having
greater than 90% purity (e.g., as determined by HPLC); [0337] (ii)
a crystalline solid having less than about 400 ppm acetone present
as a residual solvent; [0338] (iii) a crystalline solid
substantially free of non-polar impurities IMP-1 and IMP-2 and
IMP-3, as defined above and herein; [0339] (iv) a crystalline solid
substantially free of polar impurity IMP-4 as defined above and
herein; [0340] (v) a crystalline solid substantially free of
amorphous Compound 2; [0341] (vi) a crystalline solid substantially
free of Compound 1 or other anhydrides thereof; and/or [0342] (vii)
a crystalline solid substantially free of other crystalline forms
of Compound 2.
[0343] In certain embodiments, "pure and isolated" refers to the
isolated crystalline Compound 2 having at least two of the above
listed (i) to (vii) characteristics. In certain embodiments, "pure
and isolated" refers to the isolated crystalline Compound 2 having
at least three of the above listed (i) to (vii) characteristics. In
certain embodiments, "pure and isolated" refers to the isolated
crystalline Compound 2 having at least four of the above listed (i)
to (vii) characteristics. In certain embodiments, "pure and
isolated" refers to the isolated crystalline Compound 2 having at
least five of the above listed (i) to (vii) characteristics. In
certain embodiments, "pure and isolated" refers to the isolated
crystalline Compound 2 having at least six of the above listed (i)
to (vii) characteristics. In certain embodiments, "pure and
isolated" refers to the isolated crystalline Compound 2 having all
seven of the above listed (i) to (vii) characteristics.
[0344] The phrase "substantially free of amorphous Compound 2"
means that about 90% to about 100% by weight, about 95% to about
100% by weight, about 98% to about 100% by weight, or about 99% to
about 100% by weight of Compound 2 is crystalline (i.e., not
amorphous).
[0345] The phrase "substantially free of Compound 1 or other
anhydride thereof" means that at about 90% to about 100% by weight,
about 95% to about 100% by weight, about 98% to about 100% by
weight, or about 99% to about 100% by weight of Compound 2 is
provided as the cyclic trimer (i.e., not as the monomer or dimer,
linear trimer or other oligomers of Compound 1).
[0346] The phrase "substantially free of one or more other
crystalline forms of Compound 2" means that at about 90% to about
100% by weight, about 95% to about 100% by weight, about 98% to
about 100% by weight, or about 99% to about 100% by weight of
Compound 2 is provided in a specific crystalline form, e.g., "Form
I."
[0347] In certain embodiments, "Form I" Compound 2 has at least one
of the following characteristics: [0348] (i) one or more transition
temperatures selected from about 112.+-.5.degree. C. and about
241.+-.2.degree. C. as determined by differential scanning
calorimetry (DSC); [0349] (ii) one or more peaks in an X-ray powder
diffraction (XRPD) pattern selected from 6.32.+-.0.10,
12.69.+-.0.10, 17.69.+-.0.10, and 26.77.+-.0.10; [0350] (iii) an
X-ray powder diffraction (XRPD) pattern substantially similar to
that depicted in FIG. 8, 29 or 29; and/or [0351] (iv) a diffraction
scanning calorimetry (DSC) scan substantially similar to that
depicted in FIG. 18.
[0352] In some embodiments, the Form I crystal form of Compound 2
is isolated.
[0353] In certain embodiments, "Form I" is characterized by peaks
in an XRPD pattern located at 1, 2, 3, or all of the following
approximate peak positions: 6.32.+-.0.10, 12.69.+-.0.10,
17.69.+-.0.10, and 26.77.+-.0.10 .theta.-2.theta. (degrees). In
certain embodiments, "Form I" is defined by two or more peaks
6.32.+-.0.10, 12.69.+-.0.10, 17.69.+-.0.10, and 26.77.+-.0.10. In
certain embodiments, "Form I" is defined by three or more peaks
6.32.+-.0.10, 12.69.+-.0.10, 17.69.+-.0.10, and 26.77.+-.0.10. In
certain embodiments, "Form I" is defined by the X-ray powder
diffraction pattern substantially similar to that depicted in FIG.
8.
[0354] In certain embodiments, provided herein is a crystalline
form of Compound 2 having an XRPD pattern comprising peaks at
approximately 6.32, 12.69, and 26.77 degrees 2.theta.. In further
embodiments, the XRPD pattern further comprises peaks at
approximately 17.69 degrees 2.theta..
[0355] In some embodiments, provided herein is a crystal form
having at least 3, at least 4, at least 5, at least 6, at least 7,
at least 8, at least 9, at least 10, at least 11, at least 12, at
least 13, at least 14, at least 15, at least 16, at least 17, at
least 18, at least 19, at least 20, at least 21, at least 22, at
least 23, at least 24, at least 25, at least 26, at least 27, at
least 28, at least 29, at least 30, or all of the following
approximate XRPD pattern peaks: 6.3, 9.6, 11.2, 11.5, 12.7, 13.1,
14.7, 15.2, 16.9, 17.3, 17.4, 17.7, 18.0, 18.6, 19.0, 19.4, 20.4,
20.8, 21.6, 22.5, 22.7, 23.0, 23.4, 24.5, 24.7, 25.1, 25.5, 26.8,
27.7, 28.3, 29.0 degrees 2.theta.. In some embodiments, the crystal
form has at least 8, at least 9, or at least 10 of the peaks. In
some embodiments, the crystal form has at least 10 of the peaks. In
certain embodiments, provided herein is a crystal form having an
XRPD pattern comprising peaks at the following approximate
positions: 6.3, 12.7, 17.7, 18.6, 19.4, 21.6, 23.4, 24.5, 26.8, and
27.7 degrees 2.theta..
[0356] In some embodiments, provided herein is a crystal form
having at least 3, at least 4, at least 5, at least 6, at least 7,
at least 8, at least 9, at least 10, at least 11, at least 12, at
least 13, at least 14, at least 15, at least 16, at least 17, at
least 18, at least 19, at least 20, at least 21, at least 22, at
least 23, at least 24, at least 25, at least 26, at least 27, at
least 28, or all of the following approximate XRPD pattern peaks:
6.3, 11.2, 11.5, 12.7, 13.1, 14.7, 16.9, 17.3, 17.4, 17.7, 18.0,
18.6, 19.0, 19.4, 20.4, 20.8, 21.6, 22.5, 22.7, 23.0, 23.4, 24.5,
24.7, 25.1, 25.5, 26.8, 27.7, 28.3, 29.0 degrees 2.theta..
[0357] In certain embodiments, the XRPD peaks above (degrees
2.theta. peaks) are when analyzed using copper K.alpha.
radiation.
[0358] In some embodiments, provided herein is an isolated Form I
crystal form of Compound 2. In certain embodiments, the Form I
crystal form of Compound 2 has an XRPD pattern, which is
substantially similar to the pattern exhibited in FIG. 8. In some
embodiments, provided herein is an isolated Form I crystal form of
Compound 2, which has an XRPD pattern comprising peaks at
approximately 6.32, 12.69, and 26.77 degrees 2.theta. when analyzed
using copper K.alpha. radiation.
[0359] In certain embodiments, "Form I" is characterized by one or
more transition temperatures selected from about 112.+-.5.degree.
C. and about 241.+-.2.degree. C. as determined by differential
scanning calorimetry (DSC). In certain embodiments, "Form I" is
characterized by a transition temperature of about 241.+-.2.degree.
C. as determined by differential scanning calorimetry (DSC). In
certain embodiments, "Form I" is characterized by a transition
temperature of about 112.+-.5.degree. C. as determined by
differential scanning calorimetry (DSC). In certain embodiments,
"Form I" is characterized by two transition temperatures selected
from about 112.+-.5.degree. C. and about 241.+-.2.degree. C. as
determined by differential scanning calorimetry (DSC). In certain
embodiments, "Form I" is characterized by a differential scanning
calorimetry (DSC) scan substantially similar to that depicted in
FIG. 18.
[0360] In some embodiments, Form I is chemically stable. In some
embodiments, Form I is physically stable.
[0361] In some embodiments, the Form I crystal form of Compound 2
is substantially free of other crystalline forms of Compound 2.
[0362] The term "substantially similar," when used herein in the
context of comparing X-ray powder diffraction pattern or
differential scanning calorimetry scan obtained for a solid form of
Compound 2, means that two spectra share defining characteristics
sufficient to differentiate them from a spectrum obtained for a
different form of Compound 2. In certain embodiments, the term
"substantially similar" means that two spectra are the same, i.e.,
visibly overlap.
[0363] In certain embodiments, "Form I" refers to a specific
crystalline form of Compound 2 having at least two of the above
listed (i) to (iv) characteristics. In certain embodiments, "Form
I" refers to a specific crystalline form of Compound 2 having at
least three of the above listed (i) to (iv) characteristics. In
certain embodiments, "Form I" refers to a specific crystalline form
of Compound 2 having all four of the above listed (i) to (iv)
characteristics.
[0364] It is also contemplated that Compound 2 can exist in a
variety of solid forms. Such solid forms include crystalline
solids, such as polymorphs, solvates and hydrates of crystalline
Compound 2, as well as amorphous solids. All such solid forms of
Compound 2 are contemplated under the present invention.
Pharmaceutical Compositions
[0365] The terms "pharmaceutical composition" and "formulation"
refer to a composition comprising at least one pharmaceutically
active compound as described herein (e.g., crystalline Compound 1
or anhydride thereof) and a pharmaceutically acceptable
excipient.
[0366] In some embodiments, the present invention provides a
pharmaceutical composition comprising Compound 1 and a Compound 1
anhydride and a pharmaceutically acceptable excipient.
[0367] In some embodiments, the present invention provides a
pharmaceutical composition comprising a mixture of Compound 1 and
Compound 2, and a pharmaceutically acceptable excipient.
[0368] In some embodiments, the present invention provides a
pharmaceutical composition comprising a mixture of Compound 1,
Compound 2, and at least one other Compound 1 anhydride (e.g., a
dimer, a linear trimer, an oligomer), and a pharmaceutically
acceptable excipient.
[0369] In some embodiments, provided herein are pharmaceutical
compositions comprising any of the compounds, crystal forms,
materials, or mixtures described herein. In certain embodiments,
provided herein are pharmaceutical compositions comprising
crystalline Compound 1 that is substantially free of IMP-1, IMP-2,
IMP-3, or IMP-4. In certain embodiments, provided herein are
pharmaceutical compositions comprising Form A, Material B, or Form
A1 of Compound 1, or comprising a mixture of Form A and Material B
of Compound 1. In one embodiment, the pharmaceutical composition
comprising Form A is substantially free of other crystal forms of
Compound 1. In one embodiment, the pharmaceutical composition
comprising Material B is substantially free of other crystal forms
of Compound 1. In one embodiment, the pharmaceutical composition
comprising Form A1 is substantially free of other crystal forms of
Compound 1. In some embodiments, provided herein are pharmaceutical
compositions comprising Compound 2. In some embodiments, provided
herein are pharmaceutical compositions comprising Form I of
Compound 2. In certain embodiments, the pharmaceutical compositions
comprising Form I of Compound 2 are substantially free of other
crystal forms of Compound 2.
[0370] In some embodiments, the present invention provides a
pharmaceutical composition comprising Compound 1 substantially free
of Compound 1 anhydride and a pharmaceutically acceptable
excipient. In some embodiments, the present invention provides a
pharmaceutical composition comprising Compound 1 substantially free
of Compound 2 and a pharmaceutically acceptable excipient.
[0371] The phrases "a pharmaceutical composition comprising
Compound 1 substantially free of Compound 1 anhydride" or "a
pharmaceutical composition comprising Compound 1 substantially free
of Compound 2" means that about 90% to about 100% by weight, about
95% to about 100% by weight, about 98% to about 100% by weight, or
about 99% to about 100% by weight of the compound provided in the
composition is the monomer Compound 1.
[0372] In some embodiments, the present invention provides a
pharmaceutical composition comprising a mixture of Compound 2 and
at least one other Compound 1 anhydride and one or more
pharmaceutically acceptable excipients.
[0373] The present invention also provides methods for
administering pharmaceutical compositions. In certain embodiments,
the present invention provides pharmaceutical compositions that are
suitable for oral, topical, and/or parenteral administration of
Compound 1. In some embodiments, the present invention provides
pharmaceutical compositions for oral administration. For example,
in certain embodiments, Compound 1 is provided as a powder in a
pharmaceutical composition, e.g., for an oral suspension (e.g.,
wherein the powder is suspended in a vehicle comprising components
which will allow for consistent oral dosing, e.g., commercially
available USP carboxymethylcellulose sodium (CMC) in sterile Water
for Injection (sWFI)), for encapsulation in a capsule or for
compressing into a tablet. In certain embodiments, the powder
optionally comprises a mixture of crystalline Compound 1 and a
pharmaceutically acceptable excipient.
[0374] For example, in some embodiments, the powder comprising
crystalline Compound 1 and optionally containing one or more
excipients is processed to generate particles of a consistent size.
In certain embodiments, processing the powder (i.e., crystalline
Compound 1) comprises milling the powder for an amount of time
suitable to bring about a desired particle size ("milled
powder").
[0375] In some embodiments, the particle size of the milled powder
is less than about 400 .mu.m. In some embodiments, the particle
size of the milled powder is less than about 350 .mu.m. In some
embodiments, the particle size of the milled powder is less than
about 300 .mu.m. In some embodiments, the particle size of the
milled powder is less than about 275 .mu.m. In some embodiments,
the particle size of the milled powder is less than about 250
.mu.m. In some embodiments, the particle size of the milled powder
ranges from about 50 .mu.m to about 500 .mu.m. In some embodiments,
the particle size of the milled powder ranges from about 50 .mu.m
to about 400 .mu.m. In some embodiments, the particle size of the
milled powder ranges from about 50 .mu.m to about 350 .mu.m. In
some embodiments, the particle size of the milled powder ranges
from about 75 .mu.m to about 350 .mu.m. In some embodiments, the
particle size of the milled powder ranges from about 100 .mu.m to
about 300 .mu.m. In some embodiments, the particle size of the
milled powder ranges from about 100 .mu.m to about 275 .mu.m. In
some embodiments, the particle size of the milled powder ranges
from about 100 .mu.m to about 250 .mu.m. In some embodiments, the
particle size of the milled powder ranges from about 50 .mu.m to
about 500 .mu.m. The term "about," as used herein with respect to
particle size, means +/-5 .mu.m.
[0376] In some embodiments, at least 90% of a representative sample
of the milled powder has a particle size of less than about 400,
about 375, about 350, about 300, about 290, about 280, about 270,
about 260, or about 250 .mu.m. In some embodiments, at least about
90% of a representative sample of the milled powder has a particle
size of less than about 244 .mu.m.
[0377] In some embodiments, at least 50% of a representative sample
of the milled powder has a particle size of less than about 200,
about 175, about 150, about 140, about 130, about 120, about 115,
about 110, or about 105 .mu.m. In some embodiments, at least about
50% of a representative sample of the milled powder has a particle
size of less than about 105 .mu.m.
[0378] In certain embodiments, the milled powder optionally
contains excipients and is formulated as a powder for oral
suspension, a capsule, or a tablet.
[0379] In some embodiments, crystalline Compound 1 is present in a
pharmaceutical composition in an amount ranging from about 10 mg
per unit dose to about 4000 mg per unit dose. In some embodiments,
Compound 1 is present in a formulation in an amount ranging from
about 10 mg per unit dose to about 2000 mg per unit dose. In some
embodiments, Compound 1 is present in a pharmaceutical composition
in an amount ranging from about 10 mg per unit dose to about 1500
mg per unit dose. In some embodiments, Compound 1 is present in a
pharmaceutical composition in an amount ranging from about 25 mg
per unit dose to about 1500 mg per unit dose. In some embodiments,
Compound 1 is present in a pharmaceutical composition in an amount
ranging from about 50 mg per unit dose to about 1500 mg per unit
dose. In some embodiments, Compound 1 is present in a
pharmaceutical composition in an amount ranging from about 75 mg
per unit dose to about 1500 mg per unit dose. In some embodiments,
Compound 1 is present in a pharmaceutical composition in an amount
ranging from about 100 mg per unit dose to about 1500 mg per unit
dose. In some embodiments, Compound 1 is present in a
pharmaceutical composition in an amount ranging from about 100 mg
per unit dose to about 1000 mg per unit dose. In some embodiments,
Compound 1 is present in a pharmaceutical composition in an amount
ranging from about 500 mg per unit dose to about 1000 mg per unit
dose. In some embodiments, Compound 1 is present in a
pharmaceutical composition in an amount of about 10, about 25,
about 50, about 100, about 250, about 500, about 750, about 1000,
or about 2000 mg per unit dose. In certain embodiments, Compound 1
is present in a suspension for oral administration in an amount of
about 10, about 25, about 50, about 100, about 250, about 500,
about 750, about 1000, or about 2000 mg per unit dose.
[0380] The expression "unit dose," as used herein, refers to a
physically discrete unit of a pharmaceutical composition
appropriate for a subject to be treated. It will be understood,
however, that the total daily usage of a pharmaceutical composition
of the present invention will be decided by the attending physician
within the scope of sound medical judgment. The specific effective
dose level for any particular subject or organism will depend upon
a variety of factors including the condition being treated and the
severity of the condition; activity of specific active compound
employed; specific composition employed; age, body weight, general
health, sex and diet of the subject; time of administration, and
rate of excretion of the specific active compound employed;
duration of the treatment; drugs and/or additional therapies used
in combination or coincidental with specific compound(s) employed,
and like factors well known in the medical arts.
[0381] In some embodiments, Compound 1 is present in a
pharmaceutical composition in an effective amount to provide to a
subject an exposure of about 2 to about 100 ng-h/mL per unit dose.
In some embodiments, Compound 1 is present in a pharmaceutical
composition in an effective amount to provide to a subject an
exposure of about 5 to about 75 ng-h/mL per unit dose. In some
embodiments, Compound 1 is present in a pharmaceutical composition
in an effective amount to provide to a subject an exposure of about
10 to about 50 ng-h/mL per unit dose. In certain embodiments,
Compound 1 is present in a pharmaceutical composition in an
effective amount to provide to a subject an exposure of about 23 to
about 43 ng-h/mL per unit dose.
[0382] In some embodiments, the present invention provides dosage
forms suitable for administration of one or more unit dosages. For
example, the present invention provides dosage forms for the
administration of 2, 3, 4, 5, 6, 7, 8, 9, or 10 unit dosages (i.e.,
multiple unit dosages for administration are contained within a
single container). The expression "dosage form" refers to means by
which a pharmaceutical composition is stored and/or administered to
a subject. For example, the pharmaceutical composition may be
stored in a vial or syringe. The pharmaceutical composition may
also be stored in a container, which protects the pharmaceutical
composition from light (e.g., UV light). Alternatively, a container
or vial, which itself is not necessarily protective from light, may
be stored in a secondary storage container (e.g., an outer box,
bag, etc.), which protects the pharmaceutical composition from
light.
[0383] In certain embodiments, the solubility of Compound 1 in a
pharmaceutical composition can be improved by the addition of one
or more solubilizing agents. Solubilizing agents are known to one
skilled in the art and include any of those described below and
herein. In some embodiments, Compound 1 is suspended in a
suspension vehicle comprising a solubilizing agent prior to
administration to a subject. In certain embodiments, the suspension
vehicle comprises 0.5% medium viscosity carboxymethylcellulose
sodium (CMC) dissolved in sterile water for injection (sWFI) and is
administered orally.
[0384] As described above, the pharmaceutical compositions of the
present invention may optionally comprise a pharmaceutically
acceptable excipient, which, as used herein, includes any and all
solvents, diluents, or other liquid vehicle, dispersion or
suspension aids, surface active agents, isotonic agents, thickening
or emulsifying agents, preservatives, solid binders, lubricants and
the like, as suited to the particular dosage form desired.
Remington's Pharmaceutical Sciences, Sixteenth Edition, E. W.
Martin (Mack Publishing Co., Easton, Pa., 1980) discloses various
carriers used in pharmaceutical compositions and known techniques
for the preparation thereof. Except insofar as any conventional
carrier medium is incompatible with the compounds of the invention,
such as by producing any undesirable biological effect or otherwise
interacting in a deleterious manner with any other component(s) of
the pharmaceutically acceptable composition, its use is
contemplated to be within the scope of this invention. Some
examples of materials that can serve as pharmaceutically acceptable
carriers include, but are not limited to, ion exchangers, alumina,
aluminum stearate, lecithin, serum proteins, such as human serum
albumin, buffer substances such as phosphates, glycine, sorbic
acid, or potassium sorbate, partial glyceride mixtures of saturated
vegetable fatty acids, water, salts or electrolytes, such as
protamine sulfate, disodium hydrogen phosphate, potassium hydrogen
phosphate, sodium chloride, zinc salts, colloidal silica, magnesium
trisilicate, polyvinyl pyrrolidone, polyacrylates, waxes,
polyethylene-polyoxypropylene-block polymers, wool fat, sugars such
as lactose, glucose and sucrose; starches such as corn starch and
potato starch; cellulose and its derivatives such as sodium
carboxymethyl cellulose, ethyl cellulose and cellulose acetate;
powdered tragacanth; malt; gelatin; talc; excipients such as cocoa
butter and suppository waxes; oils such as peanut oil, cottonseed
oil; safflower oil; sesame oil; olive oil; corn oil and soybean
oil; glycols; such a propylene glycol or polyethylene glycol;
esters such as ethyl oleate and ethyl laurate; agar; buffering
agents such as magnesium hydroxide and aluminum hydroxide; alginic
acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl
alcohol, and phosphate buffer solutions, as well as other non-toxic
compatible lubricants such as sodium lauryl sulfate and magnesium
stearate, as well as coloring agents, releasing agents, coating
agents, sweetening, flavoring and perfuming agents, preservatives
and antioxidants can also be present in the composition, according
to the judgment of the formulator.
[0385] The pharmaceutical compositions described herein may be
prepared by any method known or hereafter developed in the art of
pharmacology. In general, such preparatory methods include the step
of bringing the active ingredient into association with a carrier
and/or one or more other accessory ingredients, and then, if
necessary and/or desirable, shaping and/or packaging the product
into a desired single- or multi-dose unit.
[0386] A pharmaceutical composition of the invention may be
prepared, packaged, and/or sold in bulk, as a single unit dose,
and/or as a plurality of single unit doses. As used herein, a "unit
dose" is discrete amount of the pharmaceutical composition
comprising a predetermined amount of the active ingredient. The
amount of the active ingredient is generally equal to the dosage of
the active ingredient, which would be administered to a subject
and/or a convenient fraction of such a dosage such as, for example,
one-half or one-third of such a dosage.
[0387] The relative amounts of the active ingredient, the
pharmaceutically acceptable carrier, and/or any additional
ingredients in a pharmaceutical composition of the invention will
vary, depending upon the identity, size, and/or condition of the
subject treated and further depending upon the route by which the
composition is to be administered. By way of example, the
composition may comprise between 0.1% and 100% (w/w) active
ingredient.
[0388] In some embodiments, the pharmaceutically acceptable
excipient is at least 95%, 96%, 97%, 98%, 99%, or 100% pure. In
some embodiments, the excipient is approved for use in humans and
for veterinary use. In some embodiments, the excipient is approved
by United States Food and Drug Administration. In some embodiments,
the excipient is pharmaceutical grade. In some embodiments, the
excipient meets the standards of the United States Pharmacopoeia
(USP), the European Pharmacopoeia (EP), the British Pharmacopoeia,
and/or the International Pharmacopoeia.
[0389] Pharmaceutically acceptable excipients used in the
manufacture of pharmaceutical compositions include, but are not
limited to, inert diluents, dispersing and/or granulating agents,
surface active agents and/or emulsifiers, disintegrating agents,
binding agents, preservatives, buffering agents, lubricating
agents, and/or oils. Such excipients may optionally be included in
the inventive compositions. Excipients such as cocoa butter and
suppository waxes, coloring agents, coating agents, sweetening,
flavoring, and perfuming agents can be present in the composition,
according to the judgment of the formulator.
[0390] Exemplary diluents include, but are not limited to, calcium
carbonate, sodium carbonate, calcium phosphate, dicalcium
phosphate, calcium sulfate, calcium hydrogen phosphate, sodium
phosphate lactose, sucrose, cellulose, microcrystalline cellulose,
kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch,
cornstarch, powdered sugar, etc., and combinations thereof.
[0391] Exemplary granulating and/or dispersing agents include, but
are not limited to, potato starch, corn starch, tapioca starch,
sodium starch glycolate, clays, alginic acid, guar gum, citrus
pulp, agar, bentonite, cellulose and wood products, natural sponge,
cation-exchange resins, calcium carbonate, silicates, sodium
carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone),
sodium carboxymethyl starch (sodium starch glycolate),
carboxymethyl cellulose, cross-linked sodium carboxymethyl
cellulose (croscarmellose), methylcellulose, pregelatinized starch
(starch 1500), microcrystalline starch, water insoluble starch,
calcium carboxymethyl cellulose, magnesium aluminum silicate
(Veegum), sodium lauryl sulfate, quaternary ammonium compounds,
etc., and combinations thereof.
[0392] Exemplary surface active agents and/or emulsifiers include,
but are not limited to, natural emulsifiers (e.g., acacia, agar,
alginic acid, sodium alginate, tragacanth, chondrux, cholesterol,
xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol,
wax, and lecithin), colloidal clays (e.g., bentonite [aluminum
silicate] and Veegum [magnesium aluminum silicate]), long chain
amino acid derivatives, high molecular weight alcohols (e.g.,
stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin
monostearate, ethylene glycol distearate, glyceryl monostearate,
and propylene glycol monostearate, polyvinyl alcohol), carbomers
(e.g., carboxy polymethylene, polyacrylic acid, acrylic acid
polymer, and carboxyvinyl polymer), carrageenan, cellulosic
derivatives (e.g., carboxymethylcellulose sodium, powdered
cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty
acid esters (e.g., polyoxyethylene sorbitan monolaurate [TWEEN.RTM.
20], polyoxyethylene sorbitan [TWEEN.RTM. 60], polyoxyethylene
sorbitan monooleate [TWEEN.RTM. 80], sorbitan monopalmitate [Span
40], sorbitan monostearate [Span 60], sorbitan tristearate [Span
65], glyceryl monooleate, sorbitan monooleate [Span 80]),
polyoxyethylene esters (e.g., polyoxyethylene monostearate [Myrj
45], polyoxyethylene hydrogenated castor oil, polyethoxylated
castor oil, polyoxymethylene stearate, and Solutol), sucrose fatty
acid esters, polyethylene glycol fatty acid esters (e.g.,
Cremophor), polyoxyethylene ethers, (e.g., polyoxyethylene lauryl
ether [Brij 30]), poly(vinyl-pyrrolidone), diethylene glycol
monolaurate, triethanolamine oleate, sodium oleate, potassium
oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl
sulfate, Pluronic F 68, Poloxamer 188, cetrimonium bromide,
cetylpyridinium chloride, benzalkonium chloride, docusate sodium,
etc., and/or combinations thereof.
[0393] Exemplary binding agents include, but are not limited to,
starch (e.g., cornstarch and starch paste); gelatin; sugars (e.g.,
sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol,
mannitol, etc.); natural and synthetic gums (e.g., acacia, sodium
alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage
of isapol husks, carboxymethylcellulose, methylcellulose,
ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, microcrystalline cellulose,
cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum
silicate (Veegum), and larch arabogalactan); alginates;
polyethylene oxide; polyethylene glycol; inorganic calcium salts;
silicic acid; polymethacrylates; waxes; water; alcohol; etc.; and
combinations thereof.
[0394] Exemplary preservatives may include antioxidants, chelating
agents, antimicrobial preservatives, antifungal preservatives,
alcohol preservatives, acidic preservatives, and other
preservatives. Exemplary antioxidants include, but are not limited
to, alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated
hydroxyanisole, butylated hydroxytoluene, monothioglycerol,
potassium metabisulfite, propionic acid, propyl gallate, sodium
ascorbate, sodium bisulfite, sodium metabisulfite, and sodium
sulfite. Exemplary chelating agents include
ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate,
disodium edetate, dipotassium edetate, edetic acid, fumaric acid,
malic acid, phosphoric acid, sodium edetate, tartaric acid, and
trisodium edetate. Exemplary antimicrobial preservatives include,
but are not limited to, benzalkonium chloride, benzethonium
chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium
chloride, chlorhexidine, chlorobutanol, chlorocresol,
chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine,
imidurea, phenol, phenoxyethanol, phenylethyl alcohol,
phenylmercuric nitrate, propylene glycol, and thimerosal. Exemplary
antifungal preservatives include, but are not limited to, butyl
paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic
acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate,
sodium benzoate, sodium propionate, and sorbic acid. Exemplary
alcohol preservatives include, but are not limited to, ethanol,
polyethylene glycol, phenol, phenolic compounds, bisphenol,
chlorobutanol, hydroxybenzoate, and phenyl ethyl alcohol. Exemplary
acidic preservatives include, but are not limited to, vitamin A,
vitamin C, vitamin E, beta-carotene, citric acid, acetic acid,
dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
Other preservatives include, but are not limited to, tocopherol,
tocopherol acetate, deteroxime mesylate, cetrimide, butylated
hydroxyanisol (BHA), butylated hydroxytoluene (BHT),
ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether
sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium
sulfite, potassium metabisulfite, Glydant Plus, Phenonip,
methylparaben, Germall 115, Germaben II, Neolone, Kathon, and
Euxyl. In certain embodiments, the preservative is an anti-oxidant.
In other embodiments, the preservative is a chelating agent.
[0395] Exemplary buffering agents include, but are not limited to,
citrate buffer solutions, acetate buffer solutions, phosphate
buffer solutions, ammonium chloride, calcium carbonate, calcium
chloride, calcium citrate, calcium glubionate, calcium gluceptate,
calcium gluconate, D-gluconic acid, calcium glycerophosphate,
calcium lactate, propanoic acid, calcium levulinate, pentanoic
acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium
phosphate, calcium hydroxide phosphate, potassium acetate,
potassium chloride, potassium gluconate, potassium mixtures,
dibasic potassium phosphate, monobasic potassium phosphate,
potassium phosphate mixtures, sodium acetate, sodium bicarbonate,
sodium chloride, sodium citrate, sodium lactate, dibasic sodium
phosphate, monobasic sodium phosphate, sodium phosphate mixtures,
tromethamine, magnesium hydroxide, aluminum hydroxide, alginic
acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl
alcohol, etc., and combinations thereof.
[0396] Exemplary lubricating agents include, but are not limited
to, magnesium stearate, calcium stearate, stearic acid, silica,
talc, malt, glyceryl behanate, hydrogenated vegetable oils,
polyethylene glycol, sodium benzoate, sodium acetate, sodium
chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate,
etc., and combinations thereof.
[0397] Exemplary oils include, but are not limited to, almond,
apricot kernel, avocado, babassu, bergamot, black current seed,
borage, cade, camomile, canola, caraway, carnauba, castor,
cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton
seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol,
gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba,
kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut,
mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange,
orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed,
pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood,
sasquana, savoury, sea buckthorn, sesame, shea butter, silicone,
soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut,
and wheat germ oils. Exemplary oils include, but are not limited
to, butyl stearate, caprylic triglyceride, capric triglyceride,
cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl
myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone
oil, and combinations thereof.
[0398] Liquid dosage forms for oral and parenteral administration
include, but are not limited to, pharmaceutically acceptable
emulsions, microemulsions, solutions, suspensions, syrups and
elixirs. In addition to the active ingredients, the liquid dosage
forms may comprise inert diluents commonly used in the art such as,
for example, water or other solvents, solubilizing agents and
emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl
carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate,
propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in
particular, cottonseed, groundnut, corn, germ, olive, castor, and
sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene
glycols and fatty acid esters of sorbitan, and mixtures thereof.
Besides inert diluents, the oral compositions can include adjuvants
such as wetting agents, emulsifying and suspending agents,
sweetening, flavoring, and perfuming agents. In certain embodiments
for parenteral administration, the conjugates of the invention are
mixed with solubilizing agents such as Cremophor, alcohols, oils,
modified oils, glycols, polysorbates, cyclodextrins, polymers, and
combinations thereof.
[0399] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions may be formulated according to
the known art using suitable dispersing or wetting agents and
suspending agents. The sterile injectable preparation may be a
sterile injectable solution, suspension or emulsion in a nontoxic
parenterally acceptable diluent or solvent, for example, as a
solution in 1,3-butanediol. Among the acceptable vehicles and
solvents that may be employed are water, Ringer's solution, U.S.P.
and isotonic sodium chloride solution. In addition, sterile, fixed
oils are conventionally employed as a solvent or suspending medium.
For this purpose any bland fixed oil can be employed including
synthetic mono- or diglycerides. In addition, fatty acids such as
oleic acid are used in the preparation of injectables.
[0400] The injectable pharmaceutical compositions can be
sterilized, for example, by filtration through a
bacterial-retaining filter, or by incorporating sterilizing agents
in the form of sterile solid compositions, which can be dissolved
or dispersed in sterile water or other sterile injectable medium
prior to use.
[0401] In order to prolong the effect of a drug, it is often
desirable to slow the absorption of the drug from subcutaneous or
intramuscular injection. This may be accomplished by the use of a
liquid suspension of crystalline or amorphous material with poor
water solubility. The rate of absorption of the drug then depends
upon its rate of dissolution which, in turn, may depend upon
crystal size and crystalline form. Alternatively, delayed
absorption of a parenterally administered drug form is accomplished
by dissolving or suspending the drug in an oil vehicle.
[0402] Solid dosage forms for oral administration include capsules,
tablets, pills, powders, and granules. In such solid dosage forms,
the active ingredient may optionally be mixed with one or more
inert, pharmaceutically acceptable excipient or carrier such as
sodium citrate or dicalcium phosphate and/or a) fillers or
extenders such as starches, lactose, sucrose, glucose, mannitol,
and silicic acid, b) binders such as, for example,
carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone,
sucrose, and acacia, c) humectants such as glycerol, d)
disintegrating agents such as agar, calcium carbonate, potato or
tapioca starch, alginic acid, certain silicates, and sodium
carbonate, e) solution retarding agents such as paraffin, f)
absorption accelerators such as quaternary ammonium compounds, g)
wetting agents such as, for example, cetyl alcohol and glycerol
monostearate, h) absorbents such as kaolin and bentonite clay, and
i) lubricants such as talc, calcium stearate, magnesium stearate,
solid polyethylene glycols, sodium lauryl sulfate, and mixtures
thereof. In the case of capsules, tablets and pills, the dosage
form may comprise buffering agents.
[0403] Solid compositions of a similar type may be employed as
fillers in soft and hard-filled gelatin capsules using such
excipients as lactose or milk sugar as well as high molecular
weight polyethylene glycols and the like. The solid dosage forms of
tablets, dragees, capsules, pills, and granules can be prepared
with coatings and shells such as enteric coatings and other
coatings well known in the pharmaceutical formulating art. They may
optionally comprise opacifying agents and can be of a composition
that they release the active ingredient(s) only, or preferentially,
in a certain part of the intestinal tract, optionally, in a delayed
manner. Examples of embedding compositions that can be used include
polymeric substances and waxes. Solid compositions of a similar
type may be employed as fillers in soft and hard-filled gelatin
capsules using such excipients as lactose or milk sugar as well as
high molecular weight polyethylene glycols and the like.
[0404] The active ingredients can be in micro-encapsulated form and
may optionally contain one or more excipients as noted above. The
solid dosage forms of tablets, dragees, capsules, pills, and
granules can be prepared with coatings and shells such as enteric
coatings, release controlling coatings and other coatings well
known in the pharmaceutical formulating art. In such solid dosage
forms the active ingredient may be admixed with at least one inert
diluent such as sucrose, lactose or starch. Such dosage forms may
comprise, as is normal practice, additional substances other than
inert diluents, e.g., tableting lubricants and other tableting aids
such as magnesium stearate and microcrystalline cellulose. In the
case of capsules, tablets and pills, the dosage forms may comprise
buffering agents. They may optionally comprise opacifying agents
and can be of a composition that they release the active
ingredient(s) only, or preferentially, in a certain part of the
intestinal tract, optionally, in a delayed manner. Examples of
embedding compositions that can be used include polymeric
substances and waxes.
[0405] General considerations in the pharmaceutical composition
and/or manufacture of pharmaceutical agents may be found, for
example, in Remington: The Science and Practice of Pharmacy
21.sup.st ed., Lippincott Williams & Wilkins, 2005.
[0406] Although the descriptions of pharmaceutical compositions
provided herein are principally directed to pharmaceutical
compositions, which are suitable for administration to humans, it
will be understood by the skilled artisan that such compositions
are generally suitable for administration to animals of all sorts.
Modification of pharmaceutical compositions suitable for
administration to humans in order to render the compositions
suitable for administration to various animals is well understood,
and the ordinarily skilled veterinary pharmacologist can design
and/or perform such modification with merely ordinary, if any,
experimentation.
[0407] Still further encompassed by the invention are
pharmaceutical packs and/or kits. Pharmaceutical packs and/or kits
provided may comprise a provided composition and a container (e.g.,
a vial, ampoule, bottle, syringe, and/or dispenser package, or
other suitable container). In some embodiments, provided kits may
optionally further include a second container comprising a suitable
aqueous carrier for dilution or suspension of the provided
composition for preparation of administration to a subject. In some
embodiments, contents of the provided formulation container and
solvent container combine to form at least one unit dosage
form.
[0408] In some embodiments, a provided composition of the invention
may be useful in conjunction with patient controlled analgesia
(PCA) devices, wherein a patient can administer, for example,
opioid analgesia as required for pain management.
[0409] Optionally, a single container may comprise one or more
compartments for containing a provided composition, and/or
appropriate aqueous carrier for suspension or dilution. In some
embodiments, a single container may be appropriate for modification
such that the container may receive a physical modification so as
to allow combination of compartments and/or components of
individual compartments. For example, a foil or plastic bag may
comprise two or more compartments separated by a perforated seal,
which may be broken so as to allow combination of contents of two
individual compartments once the signal to break the seal is
generated. A pharmaceutical pack or kit may thus comprise such
multi-compartment containers including a provided composition and
appropriate solvent and/or appropriate aqueous carrier for
suspension. Optionally, instructions for use are additionally
provided in such kits.
[0410] Optionally, instructions for use are additionally provided
in such kits of the invention. Such instructions may provide,
generally, for example, instructions for dosage and administration.
In other embodiments, instructions may further provide additional
detail relating to specialized instructions for particular
containers and/or systems for administration. Still further,
instructions may provide specialized instructions for use in
conjunction and/or in combination with additional therapy. In one
non-limiting example, the pharmaceutical compositions of the
invention may be used in conjunction with opioid analgesia
administration, which may, optionally, comprise use of a patient
controlled analgesia (PCA) device. Thus, instructions for use of
provided pharmaceutical compositions may comprise instructions for
use in conjunction with PCA administration devices.
Methods of Use and Administration
[0411] As described above, Compound 1 is an inhibitor of FAAH. As
such, it is useful for treating conditions mediated by FAAH.
[0412] The present invention provides methods for treating a
FAAH-mediated condition comprising administering to a subject in
need thereof a therapeutically effective amount of Compound 1, as
described herein.
[0413] A "subject" to which administration is contemplated
includes, but is not limited to, humans (i.e., a male or female of
any age group, e.g., a pediatric subject (e.g., infant, child,
adolescent) or adult subject (e.g., young adult, middle-aged adult
or senior adult)) and/or other primates (e.g., cynomolgus monkeys,
rhesus monkeys); mammals, including commercially relevant mammals
such as cattle, pigs, horses, sheep, goats, cats, and/or dogs;
and/or birds, including commercially relevant birds such as
chickens, ducks, geese, and/or turkeys.
[0414] As used herein, and unless otherwise specified, the terms
"treat," "treating" and "treatment" contemplate an action that
occurs while a subject is suffering from the specified disease,
disorder or condition, which reduces the severity of the disease,
disorder or condition, or retards or slows the progression of the
disease, disorder or condition.
[0415] As used herein, unless otherwise specified, the terms
"prevent," "preventing" and "prevention" contemplate an action that
occurs before a subject begins to suffer from the specified
disease, disorder or condition, which inhibits or reduces the
severity of the disease, disorder or condition.
[0416] As used herein, and unless otherwise specified, the terms
"manage," "managing" and "management" encompass preventing the
recurrence of the specified disease, disorder or condition in a
subject who has already suffered from the disease, disorder or
condition, and/or lengthening the time that a subject who has
suffered from the disease, disorder or condition remains in
remission. The terms encompass modulating the threshold,
development and/or duration of the disease, disorder or condition,
or changing the way that a subject responds to the disease,
disorder or condition.
[0417] As used herein, and unless otherwise specified, a
"therapeutically effective amount" of a compound is an amount
sufficient to provide a therapeutic benefit in the treatment or
management of a disease, disorder or condition, or to delay or
minimize one or more symptoms associated with the disease, disorder
or condition. A therapeutically effective amount of a compound
means an amount of therapeutic agent, alone or in combination with
other therapies, which provides a therapeutic benefit in the
treatment or management of the disease, disorder or condition. The
term "therapeutically effective amount" can encompass an amount
that improves overall therapy, reduces or avoids symptoms or causes
of the disease, disorder, or condition, or enhances the therapeutic
efficacy of another therapeutic agent.
[0418] As used herein, and unless otherwise specified, a
"prophylactically effective amount" of a compound is an amount
sufficient to prevent a disease, disorder or condition, or one or
more symptoms associated with the disease, disorder or condition,
or prevent its recurrence. A prophylactically effective amount of a
compound means an amount of therapeutic agent, alone or in
combination with other agents, which provides a prophylactic
benefit in the prevention of the disease, disorder or condition.
The term "prophylactically effective amount" can encompass an
amount that improves overall prophylaxis or enhances the
prophylactic efficacy of another prophylactic agent.
[0419] As used herein "inhibition," "inhibiting," "inhibit," and
"inhibitor," and the like, refer to the ability of a compound to
reduce, slow, halt or prevent activity of a particular biological
process (e.g., FAAH activity) in a cell relative to vehicle.
[0420] "FAAH-mediated condition" as used herein, refers to a
disease, disorder or condition, which is treatable by inhibition of
FAAH activity. "Disease," "disorder" or "condition" are terms used
interchangeably herein. FAAH-mediated conditions include, but are
not limited to, painful conditions, inflammatory conditions, immune
disorders, disorders of the central nervous system, metabolic
disorders, cardiac disorders and glaucoma.
[0421] In certain embodiments, the FAAH-mediated condition is a
painful condition. As used herein, a "painful condition" includes,
but is not limited to, neuropathic pain (e.g., peripheral
neuropathic pain), central pain, deafferentation pain, chronic pain
(e.g., chronic nociceptive pain, and other forms of chronic pain
such as post-operative pain, e.g., pain arising after hip, knee, or
other replacement surgery), pre-operative pain, stimulus of
nociceptive receptors (nociceptive pain), acute pain (e.g., phantom
and transient acute pain), non-inflammatory pain, inflammatory
pain, pain associated with cancer, wound pain, burn pain,
post-operative pain, pain associated with medical procedures, pain
resulting from pruritus, painful bladder syndrome, pain associated
with premenstrual dysphoric disorder and/or premenstrual syndrome,
pain associated with chronic fatigue syndrome, pain associated with
pre-term labor, pain associated with withdrawal symptoms from drug
addiction, joint pain, arthritic pain (e.g., pain associated with
crystalline arthritis, osteoarthritis, psoriatic arthritis, gouty
arthritis, reactive arthritis, rheumatoid arthritis or Reiter's
arthritis), lumbosacral pain, musculo-skeletal pain, headache,
migraine, muscle ache, lower back pain, neck pain, toothache,
dental/maxillofacial pain, visceral pain and the like.
[0422] One or more of the painful conditions contemplated herein
can comprise mixtures of various types of pain provided above and
herein (e.g., nociceptive pain, inflammatory pain, neuropathic
pain, etc.). In some embodiments, a particular pain can dominate.
In other embodiments, the painful condition comprises two or more
types of pains without one dominating. A skilled clinician can
determine the dosage to achieve a therapeutically effective amount
for a particular subject based on the painful condition.
[0423] In certain embodiments, the painful condition is neuropathic
pain. The term "neuropathic pain" refers to pain resulting from
injury to a nerve. Neuropathic pain is distinguished from
nociceptive pain, which is the pain caused by acute tissue injury
involving small cutaneous nerves or small nerves in muscle or
connective tissue. Neuropathic pain typically is long-lasting or
chronic and often develops days or months following an initial
acute tissue injury. Neuropathic pain can involve persistent,
spontaneous pain as well as allodynia, which is a painful response
to a stimulus that normally is not painful. Neuropathic pain also
can be characterized by hyperalgesia, in which there is an
accentuated response to a painful stimulus that usually is trivial,
such as a pin prick. Neuropathic pain conditions can develop
following neuronal injury and the resulting pain may persist for
months or years, even after the original injury has healed.
Neuronal injury may occur in the peripheral nerves, dorsal roots,
spinal cord or certain regions in the brain. Neuropathic pain
conditions include, but are not limited to, diabetic neuropathy
(e.g., peripheral diabetic neuropathy); sciatica; non-specific
lower back pain; multiple sclerosis pain; carpal tunnel syndrome,
fibromyalgia; HIV-related neuropathy; neuralgia (e.g.,
post-herpetic neuralgia, trigeminal neuralgia); pain resulting from
physical trauma (e.g., amputation, surgery, invasive medical
procedures, toxins, burns, infection); pain resulting from cancer
or chemotherapy (e.g., chemotherapy-induced pain such as
chemotherapy-induced peripheral neuropathy); and pain resulting
from an inflammatory condition (e.g., a chronic inflammatory
condition). Neuropathic pain can result from a peripheral nerve
disorder such as neuroma; nerve compression; nerve crush, nerve
stretch or incomplete nerve transsection; mononeuropathy or
polyneuropathy. Neuropathic pain can also result from a disorder
such as dorsal root ganglion compression; inflammation of the
spinal cord; contusion, tumor or hemisection of the spinal cord;
tumors of the brainstem, thalamus or cortex; or trauma to the
brainstem, thalamus or cortex.
[0424] The symptoms of neuropathic pain are heterogeneous and are
often described as spontaneous shooting and lancinating pain, or
ongoing, burning pain. In addition, there is pain associated with
normally non-painful sensations such as "pins and needles"
(paraesthesias and dysesthesias), increased sensitivity to touch
(hyperesthesia), painful sensation following innocuous stimulation
(dynamic, static or thermal allodynia), increased sensitivity to
noxious stimuli (thermal, cold, mechanical hyperalgesia),
continuing pain sensation after removal of the stimulation
(hyperpathia) or an absence of or deficit in selective sensory
pathways (hypoalgesia).
[0425] In certain embodiments, the painful condition is
non-inflammatory pain. The types of non-inflammatory pain include,
without limitation, peripheral neuropathic pain (e.g., pain caused
by a lesion or dysfunction in the peripheral nervous system),
central pain (e.g., pain caused by a lesion or dysfunction of the
central nervous system), deafferentation pain (e.g., pain due to
loss of sensory input to the central nervous system), chronic
nociceptive pain (e.g., certain types of cancer pain), noxious
stimulus of nociceptive receptors (e.g., pain felt in response to
tissue damage or impending tissue damage), phantom pain (e.g., pain
felt in a part of the body that no longer exists, such as a limb
that has been amputated), pain felt by psychiatric subjects (e.g.,
pain where no physical cause may exist), and wandering pain (e.g.,
wherein the pain repeatedly changes location in the body).
[0426] In certain embodiments, the painful condition is
inflammatory pain. In certain embodiments, the painful condition
(e.g., inflammatory pain) is associated with an inflammatory
condition and/or an immune disorder.
[0427] In certain embodiments, the FAAH-mediated condition is an
inflammatory condition. The term "inflammatory condition" refers to
those diseases, disorders or conditions that are characterized by
signs of pain (e.g., dolor, from the generation of noxious
substances and the stimulation of nerves), heat (e.g., calor, from
vasodilatation), redness (e.g., rubor, from vasodilatation and
increased blood flow), swelling (e.g., tumor, from excessive inflow
or restricted outflow of fluid), and/or loss of function (e.g.,
functio laesa, which can be partial or complete, temporary or
permanent. Inflammation takes on many forms and includes, but is
not limited to, acute, adhesive, atrophic, catarrhal, chronic,
cirrhotic, diffuse, disseminated, exudative, fibrinous, fibrosing,
focal, granulomatous, hyperplastic, hypertrophic, interstitial,
metastatic, necrotic, obliterative, parenchymatous, plastic,
productive, proliferous, pseudomembranous, purulent, sclerosing,
seroplastic, serous, simple, specific, subacute, suppurative,
toxic, traumatic, and/or ulcerative inflammation.
[0428] Exemplary inflammatory conditions include, but are not
limited to, inflammation associated with acne, anemia (e.g.,
aplastic anemia, haemolytic autoimmune anaemia), asthma, arteritis
(e.g., polyarteritis, temporal arteritis, periarteritis nodosa,
Takayasu's arteritis), arthritis (e.g., crystalline arthritis,
osteoarthritis, psoriatic arthritis, gouty arthritis, reactive
arthritis, rheumatoid arthritis and Reiter's arthritis), ankylosing
spondylitis, amylosis, amyotrophic lateral sclerosis, autoimmune
diseases, allergies or allergic reactions, atherosclerosis,
bronchitis, bursitis, chronic prostatitis, conjunctivitis, Chagas
disease, chronic obstructive pulmonary disease, cermatomyositis,
diverticulitis, diabetes (e.g., type I diabetes mellitus, type 2
diabetes mellitus), a skin condition (e.g., psoriasis, eczema,
burns, dermatitis, pruritus (itch)), endometriosis, Guillain-Barre
syndrome, infection, ischaemic heart disease, Kawasaki disease,
glomerulonephritis, gingivitis, hypersensitivity, headaches (e.g.,
migraine headaches, tension headaches), ileus (e.g., postoperative
ileus and ileus during sepsis), idiopathic thrombocytopenic
purpura, interstitial cystitis (painful bladder syndrome),
gastrointestinal disorder (e.g., selected from peptic ulcers,
regional enteritis, diverticulitis, gastrointestinal bleeding,
eosinophilic gastrointestinal disorders (e.g., eosinophilic
esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis,
eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux
disease (GORD, or its synonym GERD), inflammatory bowel disease
(IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous
colitis, lymphocytic colitis, ischaemic colitis, diversion colitis,
Behcet's syndrome, indeterminate colitis) and inflammatory bowel
syndrome (IBS)), lupus, multiple sclerosis, morphea, myeasthenia
gravis, myocardial ischemia, nephrotic syndrome, pemphigus
vulgaris, pernicious aneaemia, peptic ulcers, polymyositis, primary
biliary cirrhosis, neuroinflammation associated with brain
disorders (e.g., Parkinson's disease, Huntington's disease, and
Alzheimer's disease), prostatitis, chronic inflammation associated
with cranial radiation injury, pelvic inflammatory disease,
reperfusion injury, regional enteritis, rheumatic fever, systemic
lupus erythematosus, schleroderma, scierodoma, sarcoidosis,
spondyloarthopathies, Sjogren's syndrome, thyroiditis,
transplantation rejection, tendonitis, trauma or injury (e.g.,
frostbite, chemical irritants, toxins, scarring, burns, physical
injury), vasculitis, vitiligo and Wegener's granulomatosis. In
certain embodiments, the inflammatory disorder is selected from
arthritis (e.g., rheumatoid arthritis), inflammatory bowel disease,
inflammatory bowel syndrome, asthma, psoriasis, endometriosis,
interstitial cystitis and prostatistis. In certain embodiments, the
inflammatory condition is an acute inflammatory condition (e.g.,
for example, inflammation resulting from infection). In certain
embodiments, the inflammatory condition is a chronic inflammatory
condition (e.g., conditions resulting from asthma, arthritis and
inflammatory bowel disease). The compounds may also be useful in
treating inflammation associated with trauma and non-inflammatory
myalgia. The compounds may also be useful in treating inflammation
associated with cancer.
[0429] In certain embodiments, the FAAH-mediated condition is an
immune disorder. Immune disorders, such as auto-immune disorders,
include, but are not limited to, arthritis (including rheumatoid
arthritis, spondyloarthopathies, gouty arthritis, degenerative
joint diseases such as osteoarthritis, systemic lupus
erythematosus, Sjogren's syndrome, ankylosing spondylitis,
undifferentiated spondylitis, Behcet's disease, haemolytic
autoimmune anaemias, multiple sclerosis, amyotrophic lateral
sclerosis, amylosis, acute painful shoulder, psoriatic, and
juvenile arthritis), asthma, atherosclerosis, osteoporosis,
bronchitis, tendonitis, bursitis, skin conditions (e.g., psoriasis,
eczema, burns, dermatitis, pruritus (itch)), enuresis, eosinophilic
disease, gastrointestinal disorders (e.g., selected from peptic
ulcers, regional enteritis, diverticulitis, gastrointestinal
bleeding, eosinophilic gastrointestinal disorders (e.g.,
eosinophilic esophagitis, eosinophilic gastritis, eosinophilic
gastroenteritis, eosinophilic colitis), gastritis, diarrhea,
gastroesophageal reflux disease (GORD, or its synonym GERD),
inflammatory bowel disease (IBD) (e.g., Crohn's disease, ulcerative
colitis, collagenous colitis, lymphocytic colitis, ischaemic
colitis, diversion colitis, Behcet's syndrome, indeterminate
colitis) and inflammatory bowel syndrome (IBS)), and disorders
ameliorated by a gastroprokinetic agent (e.g., ileus, postoperative
ileus and ileus during sepsis; gastroesophageal reflux disease
(GORD, or its synonym GERD); eosinophilic esophagitis,
gastroparesis such as diabetic gastroparesis; food intolerances and
food allergies and other functional bowel disorders, such as
non-ulcerative dyspepsia (NUD) and non-cardiac chest pain (NCCP,
including costo-chondritis)).
[0430] In certain embodiments, the inflammatory disorder and/or the
immune disorder is a gastrointestinal disorder. In some
embodiments, the gastrointestinal disorder is selected from
gastrointestinal disorders (e.g., selected from peptic ulcers,
regional enteritis, diverticulitis, gastrointestinal bleeding,
eosinophilic gastrointestinal disorders (e.g., eosinophilic
esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis,
eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux
disease (GORD, or its synonym GERD), inflammatory bowel disease
(IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous
colitis, lymphocytic colitis, ischaemic colitis, diversion colitis,
Behcet's syndrome, indeterminate colitis) and inflammatory bowel
syndrome (IBS)). In certain embodiments, the gastrointestinal
disorder is inflammatory bowel disease (IBD).
[0431] In certain embodiments, the inflammatory condition and/or
immune disorder is a skin condition. In some embodiments, the skin
condition is pruritus (itch), psoriasis, eczema, burns or
dermatitis. In certain embodiments, the skin condition is
psoriasis. In certain embodiments, the skin condition is
pruritis.
[0432] In certain embodiments, the FAAH-mediated condition is a
disorder of the central nervous system (CNS) ("CNS disorder").
Exemplary CNS disorders include, but are not limited to,
neurotoxicity and/or neurotrauma, stroke, multiple sclerosis,
spinal cord injury, epilepsy, a mental disorder, a sleep condition,
a movement disorder, nausea and/or emesis, amyotrophic lateral
sclerosis, Alzheimer's disease and drug addiction.
[0433] In certain embodiments, the CNS disorder is neurotoxicity
and/or neurotrauma, e.g., for example, as a result of acute
neuronal injury (e.g., traumatic brain injury (TBI), stroke,
epilepsy) or a chronic neurodegenerative disorder (e.g., multiple
sclerosis, Parkinson's disease, Huntington's disease, amyotrophic
lateral sclerosis, Alzheimer's disease). In certain embodiments,
the compound of the present invention provides a neuroprotective
effect, e.g., against an acute neuronal injury or a chronic
neurodegenerative disorder.
[0434] In certain embodiments, the CNS disorder is stroke (e.g.,
ischemic stroke).
[0435] In certain embodiments, the CNS disorder is multiple
sclerosis.
[0436] In certain embodiments, the CNS disorder is spinal cord
injury.
[0437] In certain embodiments, the CNS disorder is epilepsy.
[0438] In certain embodiments, the CNS disorder is a mental
disorder, e.g., for example, depression, anxiety or anxiety-related
conditions, a learning disability or schizophrenia.
[0439] In certain embodiments, the CNS disorder is depression.
"Depression," as used herein, includes, but is not limited to,
depressive disorders or conditions, such as, for example, major
depressive disorders (e.g., unipolar depression), dysthymic
disorders (e.g., chronic, mild depression), bipolar disorders
(e.g., manic-depression), seasonal affective disorder, and/or
depression associated with drug addiction (e.g., withdrawal). The
depression can be clinical or subclinical depression. The
depression can be associated with premenstrual syndrome and/or
premenstrual dysphoric disorder.
[0440] In certain embodiments, the CNS disorder is anxiety.
"Anxiety," as used herein, includes, but is not limited to, anxiety
and anxiety-related conditions, such as, for example, clinical
anxiety, panic disorder, agoraphobia, generalized anxiety disorder,
specific phobia, social phobia, obsessive-compulsive disorder,
acute stress disorder, post-traumatic stress disorder, adjustment
disorders with anxious features, anxiety disorder associated with
depression, anxiety disorder due to general medical conditions, and
substance-induced anxiety disorders, anxiety associated with drug
addiction (e.g., withdrawal, dependence, reinstatement) and anxiety
associated with nausea and/or emesis. This treatment may also be to
induce or promote sleep in a subject (e.g., for example, a subject
with anxiety).
[0441] In certain embodiments, the CNS disorder is a learning
disorder (e.g., attention deficit disorder (ADD)).
[0442] In certain embodiments, the CNS disorder is
Schizophrenia.
[0443] In certain embodiments, the CNS disorder is a sleep
condition. "Sleep conditions" include, but are not limited to,
insomnia, narcolepsy, sleep apnea, restless legs syndrome (RLS),
delayed sleep phase syndrome (DSPS), periodic limb movement
disorder (PLMD), hypopnea syndrome, rapid eye movement behavior
disorder (RBD), shift work sleep condition (SWSD), and sleep
problems (e.g., parasomnias) such as nightmares, night terrors,
sleep talking, head banging, snoring, and clenched jaw and/or
grinding of teeth (bruxism).
[0444] In certain embodiments, the CNS disorder is a movement
disorder, e.g., basal ganglia disorders, such as, for example,
Parkinson's disease, levodopa-induced dyskinesia, Huntington's
disease, Gilles de la Tourette's syndrome, tardive diskinesia and
dystonia.
[0445] In certain embodiments, the CNS disorder is Alzheimer's
disease.
[0446] In certain embodiments, the CNS disorder is amyotrophic
lateral sclerosis (ALS).
[0447] In certain embodiments, the CNS disorder is nausea and/or
emesis.
[0448] In certain embodiments, the CNS disorder is drug addiction
(e.g., for instance, addiction to opiates, nicotine, cocaine,
psychostimulants or alcohol).
[0449] In still yet other embodiments, the FAAH-mediated condition
is a cardiac disorder, e.g., for example, selected from
hypertension, circulatory shock, myocardial reperfusion injury and
atherosclerosis.
[0450] In certain embodiments, the FAAH-mediated condition is a
metabolic disorder (e.g., a wasting condition, an obesity-related
condition or complication thereof).
[0451] In certain embodiments, the metabolic disorder is a wasting
condition. A "wasting condition," as used herein, includes, but is
not limited to, anorexia and cachexias of various natures (e.g.,
weight loss associated with cancer, weight loss associated with
other general medical conditions, weight loss associated with
failure to thrive, and the like).
[0452] In certain embodiments, the metabolic disorder is an
obesity-related condition or a complication thereof. An
"obesity-related condition" as used herein, includes, but is not
limited to, obesity, undesired weight gain (e.g., from
medication-induced weight gain, from cessation of smoking) and an
over-eating disorder (e.g., binge eating, bulimia, compulsive
eating, or a lack of appetite control each of which can optionally
lead to undesired weight gain or obesity). "Obesity" and "obese" as
used herein, refers to class I obesity, class II obesity, class III
obesity and pre-obesity (e.g., being "over-weight") as defined by
the World Health Organization.
[0453] Reduction of storage fat is expected to provide various
primary and/or secondary benefits in a subject (e.g., in a subject
diagnosed with a complication associated with obesity) such as, for
example, an increased insulin responsiveness (e.g., in a subject
diagnosed with Type II diabetes mellitus); a reduction in elevated
blood pressure; a reduction in elevated cholesterol levels; and/or
a reduction (or a reduced risk or progression) of ischemic heart
disease, arterial vascular disease, angina, myocardial infarction,
stroke, migraines, congestive heart failure, deep vein thrombosis,
pulmonary embolism, gall stones, gastroesophagael reflux disease,
obstructive sleep apnea, obesity hypoventilation syndrome, asthma,
gout, poor mobility, back pain, erectile dysfunction, urinary
incontinence, liver injury (e.g., fatty liver disease, liver
cirrhosis, alcoholic cirrhosis, endotoxin-mediated liver injury) or
chronic renal failure. Thus, the method of this invention is
applicable to obese subjects, diabetic subjects, and alcoholic
subjects.
[0454] In some embodiments, treatment of an obesity-related
condition or complication thereof involves reduction of body weight
in the subject. In some embodiments, treatment of an
obesity-related condition or complication thereof involves appetite
control in the subject.
[0455] In other embodiments, the FAAH-mediated condition is
glaucoma. The exact amount of Compound 1 and/or compositions
comprising Compound 1 required to achieve a therapeutically
effective amount will vary from subject to subject, depending on
species, age, and general condition of a subject, severity of the
side effects or disorder, mode of administration, and the like. The
desired dosage may be delivered three times a day, two times a day,
once a day, every other day, every third day, every week, twice
weekly, every two weeks, every three weeks, or every four weeks. In
certain embodiments, the desired dosage may be delivered using
multiple administrations (e.g., two, three, four, five, six, seven,
eight, nine, ten, eleven, twelve, thirteen, fourteen, or more
administrations).
[0456] In certain embodiments of the present invention, a
therapeutically effective amount of Compound 1 and/or compositions
comprising Compound 1 for administration one or more times a day to
a 70 kg adult human may comprise about 1 mg, about 5 mg, about 10
mg, about 25 mg, about 50 mg, about 100 mg, about 250 mg, about 500
mg, about 750 mg, about 1000 mg, about 2000 mg, about 2200 mg,
about 2400 mg, about 2500 mg, about 2600 mg, about 2700 mg, about
2800 mg, about 2900 mg or about 3000 mg of Compound 1 per dose. In
certain embodiments of the present invention, a therapeutically
effective amount of Compound 1 and/or compositions comprising
Compound 1 for administration one or more times a day to a 70 kg
adult human may comprise from about 1 mg to about 3000 mg, from
about 1 mg to about 2900 mg, from about 1 mg to about 2800 mg, from
about 1 mg to about 2700 mg, from about 1 mg to about 2600 mg, from
about 1 mg to about 2500 mg, from about 1 mg to about 2400 mg, from
about 1 mg to about 2300 mg, from about 1 mg to about 2200 mg, from
about 1 mg to about 2100 mg, from about 1 mg to about 2000 mg, from
about 1 mg to about 1000 mg, from about 1 mg to about 900 mg, from
about 1 mg to about 800 mg, from about 1 mg to about 700 mg, from
about 1 mg to about 600 mg, from about 1 mg to about 500 mg, from
about 1 mg to about 400 mg, from about 1 mg to about 300 mg, from
about 1 mg to about 200 mg, from about 1 mg to about 100 mg, from
about 1 mg to about 75 mg, from about 1 mg to about 50 mg, from
about 1 mg to about 25 mg, from about 1 mg to about 10 mg, and from
about 10 mg to about 800 mg of Compound 1 per dose. It will be
appreciated that dose ranges as described herein provide guidance
for the administration of inventive pharmaceutical compositions to
an adult. The amount to be administered to, for example, a child or
an adolescent can be determined by a medical practitioner or person
skilled in the art and can be lower or the same as that
administered to an adult.
[0457] The invention is also directed to methods of treating an
FAAH-mediated disease comprising administering specific doses of
Compound 1. Such doses may be administered once or more than once.
In one embodiment, such dose or doses are administered according to
schedules described herein. Compositions of Compound 1 formulated
to contain the appropriate amount of Compound 1 so that the dose is
readily administered are also envisaged.
[0458] In another aspect, the invention is directed to a method for
treating an FAAH-mediated disease in a patient, comprising
administering to a patient having an FAAH-mediated disease an
effective amount of Compound 1.
[0459] In another aspect, the invention is directed to a method for
treating an FAAH-mediated disease in a patient comprising
administering to the patient an amount of about 10 mg/m.sup.2 to
about 3000 mg/m.sup.2 of Compound 1 at least once a week. In some
embodiments, the method comprises administering to the patient an
amount of about 50 mg/m.sup.2 to about 2000 mg/m.sup.2 of Compound
1 at least once a week. In some embodiments, the method comprises
administering to the patient an amount of about 100 mg/m.sup.2 to
about 1500 mg/m.sup.2 of Compound 1 at least once a week. In some
embodiments, the method comprises administering to the patient an
amount of about 200 mg/m.sup.2 to about 1000 mg/m.sup.2 of Compound
1 at least once a week. In some embodiments, the method comprises
administering to the patient an amount of about 400 mg/m.sup.2 to
about 800 mg/m.sup.2 of Compound 1 at least once a week. In some
embodiments, the method comprises administering to the patient an
amount of about 600 mg/m.sup.2 of Compound 1 at least once a week.
The amount may be administered as a composition comprising Compound
1 and one or more pharmaceutically acceptable carriers, diluents,
or excipients. The frequency and duration of the dosing can be
determined by a medical practitioner or person skilled in the
art.
[0460] Dosages of Compound 1 utilized in accordance with the
present invention may vary with the form of administration and/or
with the particular subject being treated. In general, Compound 1
is most desirably administered at a concentration level that will
afford effective results without causing any harmful or deleterious
side-effects. In some embodiments, Compound 1 is administered in
doses ranging from about 0.01 to about 100 mg/kg/day. In some
embodiments, Compound 1 is administered in doses ranging from about
0.05 to about 100 mg/kg/day. In some embodiments, Compound 1 is
administered in doses ranging from about 0.1 to about 100
mg/kg/day. In some embodiments, Compound 1 is administered in doses
ranging from about 1 to about 100 mg/kg/day. In some embodiments,
Compound 1 is administered in doses ranging from about 5 to about
100 mg/kg/day. In some embodiments, Compound 1 is administered in
doses ranging from about 10 to about 100 mg/kg/day. In some
embodiments, Compound 1 is administered in doses ranging from about
10 to about 90 mg/kg/day. In some embodiments, Compound 1 is
administered in doses ranging from about 10 to about 80 mg/kg/day.
In some embodiments, Compound 1 is administered in doses ranging
from about 10 to about 70 mg/kg/day. In some embodiments, Compound
1 is administered in doses ranging from about 10 to about 60
mg/kg/day. In some embodiments, Compound 1 is administered in doses
ranging from about 10 to about 50 mg/kg/day. In some embodiments,
Compound 1 is administered in doses ranging from about 10 mg/kg/day
to about 40 mg/kg/day. In some embodiments, Compound 1 is
administered in doses ranging from about 10 mg/kg/day to about 30
mg/kg/day. In some embodiments, Compound 1 is administered in doses
ranging from about 10 mg/kg to about 20 mg/kg/day. In some
embodiments, Compound 1 is administered in doses ranging from about
1 mg/kg/day to about 20 mg/kg/day. In some embodiments, Compound 1
is administered in doses ranging from about 1 mg/kg/day to about 10
mg/kg/day. In some embodiments, Compound 1 is administered in doses
less than about 10 mg/kg/day. In some embodiments, Compound 1 is
administered in doses less than about 5 mg/kg/day. In some
embodiments, Compound 1 is administered in doses less than about 2
mg/kg/day. In some embodiments, Compound 1 is administered in doses
less than about 1 mg/kg/day. In some embodiments, Compound 1 is
administered in doses less than about 0.1 mg/kg/day. In some
embodiments, Compound 1 is administered in doses less than about
0.01 mg/kg/day. In some embodiments, Compound 1 is administered in
doses less than about 0.001 mg/kg/day. In some embodiments,
Compound 1 is administered in doses of about 0.1, 0.2, 0.3, 0.4,
0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 mg/kg/day. In some embodiments,
Compound 1 is administered in doses of about 0.01, 0.02, 0.03,
0.04, 0.05, 0.06, 0.07, 0.08, or 0.09 mg/kg/day. In some
embodiments, Compound 1 is administered in doses ranging from about
0.1 mg/kg/day to about 1 mg/kg/day. In some embodiments, Compound 1
is administered in doses ranging from about 0.01 mg/kg/day to about
0.1 mg/kg/day. In some embodiments, Compound 1 is administered in
doses ranging from about 0.001 mg/kg/day to about 0.01
mg/kg/day.
[0461] In some embodiments, the dose is as described above and is
administered 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times a day. In some
embodiments, the dose is as described above and is administered 1,
2, 3, or 4 times a day. In some embodiments, the dose is as
described above and is administered every other day. In some
embodiments, the dose is as described above and is administered
every two days. In some embodiments, the dose is as described above
and is administered every three days. In some embodiments, the dose
is as described above and is administered every four days. In some
embodiments, the dose is as described above and is administered
every five days. In some embodiments, the dose is as described
above and is administered every six days. In some embodiments, the
dose is as described above and is administered once a week. In some
embodiments, the dose is as described above and is administered
once every two, three, four, five, six, seven, eight, nine, or ten
weeks.
[0462] In some embodiments, Compound 1 and/or compositions
comprising Compound 1 can be administered with food. "Food"
typically means a solid food or mixed solid/liquid food with
sufficient bulk and fat content that it is not rapidly dissolved
and absorbed in the stomach. In one embodiment, food means a meal,
such as breakfast, lunch or dinner. The terms "taken with food,"
"fed" and "non-fasted" are equivalent and are as given by FDA
guidelines and criteria. In one embodiment, "with food" means that
the administration occurs between about 30 minutes prior to about 2
hours after eating a meal. In another embodiment, "with food" means
that administration occurs at substantially the same time as eating
the meal.
[0463] In some embodiments, Compound 1 can be administered under
fasted conditions. The terms "without food," "fasted" and "an empty
stomach" are equivalent and are as given by FDA guidelines and
criteria. In one embodiment, "fasted conditions" means the
condition wherein no food is consumed within 1 hour prior to
administration or 2 hours after administration. In another
embodiment, "fasted conditions" means the condition wherein no food
is consumed within 1 hour prior to administration to 2 hours after
administration.
[0464] The efficacy of Compound 1 in the treatment of an
FAAH-mediated disease, disorder, or condition according to the
present invention may be evaluated and followed using any method
known in the medical arts. Exemplary such methods include physical
examination, laboratory testing, imaging studies, etc. In some
embodiments, the treatment of an FAAH-mediated disease, disorder,
or condition may be evaluated by monitoring the subject being
treated. In some embodiments, the subject is monitored one, two,
three, four, or five times a day. In some embodiments, the subject
is monitored one, two, three, four or five times a week. In some
embodiments, the subject is monitored twice a week. In some
embodiments, monitoring is continuous. In some embodiments,
monitoring occurs for the duration of the time a subject is being
treated for an FAAH-mediated disease, disorder, or condition. In
some embodiments, monitoring occurs for the duration of the
subject's life. In some embodiments, the subject is a human and is
monitored using any of the methods known in the medical arts
suitable for monitoring humans undergoing treatment for an
FAAH-mediated disease, disorder, or condition.
Combination Therapy
[0465] It will be also appreciated that Compound 1, or a
composition thereof, as described above and herein, can be
administered in combination with one or more additional
therapeutically active agents.
[0466] By "in combination with," it is not intended to imply that
the agents must be administered at the same time and/or formulated
for delivery together, although these methods of delivery are
certainly within the scope of the invention. The compositions can
be administered concurrently with, prior to, or subsequent to, one
or more other additional therapeutically active agents. In general,
each agent will be administered at a dose and/or on a time schedule
determined for that agent. In will further be appreciated that the
additional therapeutically active agent utilized in this
combination may be administered together in a single composition or
administered separately in different compositions. The particular
combination to employ in a regimen will take into account
compatibility of the inventive compound with the additional
therapeutically active agent and/or the desired therapeutic effect
to be achieved.
[0467] In general, it is expected that additional therapeutically
active agents utilized in combination be utilized at levels that do
not exceed the levels at which they are utilized individually. In
some embodiments, the levels utilized in combination will be lower
than those utilized individually.
[0468] By a "therapeutically active agent" or "active agent" refers
to any substance that is useful for therapy, including prophylactic
and therapeutic treatment.
[0469] The invention encompasses the delivery of Compound 1 and/or
compositions comprising Compound 1 in combination with agents that
may improve the bioavailability, reduce and/or modify the
metabolism, inhibit the excretion, and/or modify the distribution
within the body of Compound 1. It will also be appreciated that the
therapy employed may achieve a desired effect for the same disorder
(for example, Compound 1 may be administered in combination with an
anti-inflammatory, anti-anxiety and/or anti-depressive agent,
etc.), and/or may achieve different effects (e.g., control of any
adverse side-effects).
[0470] Exemplary active agents include, but are not limited to,
anti-cancer agents, antibiotics, anti-viral agents, anesthetics,
anti-coagulants, inhibitors of an enzyme, steroidal agents,
steroidal or non-steroidal anti-inflammatory agents,
antihistamines, immunosuppressant agents, anti-neoplastic agents,
antigens, vaccines, antibodies, decongestants, sedatives, opioids,
pain-relieving agents, analgesics, anti-pyretics, hormones,
prostaglandins, progestational agents, anti-glaucoma agents,
ophthalmic agents, anti-cholinergics, anti-depressants,
anti-psychotics, hypnotics, tranquilizers, anti-convulsants, muscle
relaxants, anti-spasmodics, muscle contractants, channel blockers,
miotic agents, anti-secretory agents, anti-thrombotic agents,
anticoagulants, anti-cholinergics, (3-adrenergic blocking agents,
diuretics, cardiovascular active agents, vasoactive agents,
vasodilating agents, anti-hypertensive agents, angiogenic agents,
modulators of cell-extracellular matrix interactions (e.g., cell
growth inhibitors and anti-adhesion molecules), or
inhibitors/intercalators of DNA, RNA, protein-protein interactions,
protein-receptor interactions, etc. Active agents include small
organic molecules such as drug compounds (e.g., compounds approved
by the Food and Drug Administration as provided in the Code of
Federal Regulations (CFR)), peptides, proteins, carbohydrates,
monosaccharides, oligosaccharides, polysaccharides, nucleoproteins,
mucoproteins, lipoproteins, synthetic polypeptides or proteins,
small molecules linked to proteins, glycoproteins, steroids,
nucleic acids, DNAs, RNAs, nucleotides, nucleosides,
oligonucleotides, antisense oligonucleotides, lipids, hormones,
vitamins and cells.
[0471] In certain embodiments, the additional therapeutically
active agent is a pain-relieving agent. Exemplary pain relieving
agents include, but are not limited to, analgesics such as
non-narcotic analgesics [e.g., salicylates such as aspirin,
ibuprofen (MOTRIN.RTM., ADVIL.RTM.), ketoprofen (ORUDIS.RTM.),
naproxen (NAPROSYN.RTM.), acetaminophen, indomethacin] or narcotic
analgesics [e.g., opioid analgesics such as tramadol, fentenyl,
sufentanil, morphine, hydromorphone, codeine, oxycodone, and
buprenorphine]; non-steroidal anti-inflammatory agents (NSAIDs)
[e.g., aspirin, acetaminophen, COX-2 inhibitors]; steroids or
anti-rheumatic agents; migraine preparations such as beta
adrenergic blocking agents, ergot derivatives; tricyclic
antidepressants (e.g., amitryptyline, desipramine, imipramine);
anti-epileptics (e.g., clonazepam, valproic acid, phenobarbital,
phenytoin, tiagaine, gabapentin, carbamazepine, topiramate, sodium
valproate); .alpha..sub.2 agonists; selective serotonin reuptake
inhibitors (SSRIs), selective norepinephrine uptake inhibitors;
benzodiazepines; mexiletine (MEXITIL.RTM.); flecainide
(TAMBOCOR.RTM.); NMDA receptor antagonists [e.g., ketamine,
detromethorphan, methadone]; and topical agents [e.g., capsaicin
(Zostrix), EMLA cream, lidocaine, prilocaine].
[0472] In other embodiments, the additional therapeutically active
agent is an anti-inflammatory agent. Exemplary anti-inflammatory
agents include, but are not limited to, aspirin; ibuprofen;
ketoprofen; naproxen; etodolac (LODINE.RTM.); COX-2 inhibitors such
as celecoxib (CELEBREX.RTM.), rofecoxib (VIOXX.TM.) valdecoxib
(BEXTRA.RTM.), parecoxib, etoricoxib (MK663), deracoxib,
2-(4-ethoxy-phenyl)-3-(4-methanesulfonyl-phenyl)-pyrazolo[1,5-b]
pyridazine,
4-(2-oxo-3-phenyl-2,3-dihydrooxazol-4-yl)benzenesulfonamide,
darbufelone, flosulide,
4-(4-cyclohexyl-2-methyl-5-oxazolyl)-2-fluorobenzenesulfonamide),
meloxicam, nimesulide,
1-Methylsulfonyl-4-(1,1-dimethyl-4-(4-fluorophenyl)cyclopenta-2,4-dien-3--
yl)benzene,
4-(1,5-Dihydro-6-fluoro-7-methoxy-3-(trifluoromethyl)-(2)-benzothiopyrano-
(4,3-c) pyrazol-1-yl)benzenesulfonamide,
4,4-dimethyl-2-phenyl-3-(4-methylsulfonyl)phenyl)cyclo-butenone,
4-Amino-N-(4-(2-fluoro-5-trifluoromethyl)-thiazol-2-yl)-benzene
sulfonamide,
1-(7-tert-butyl-2,3-dihydro-3,3-dimethyl-5-benzo-furanyl)-4-cyclopropyl
butan-1-one, or their physiologically acceptable salts, esters or
solvates; sulindac (CLINORIL.RTM.); diclofenac (VOLTAREN.RTM.);
piroxicam (FELDENE.RTM.); diflunisal (DOLOBID.RTM.), nabumetone
(RELAFEN.RTM.), oxaprozin (DAYPRO.RTM.), indomethacin
(INDOCIN.RTM.); or steroids such as PEDIPRED.RTM. prednisolone
sodium phosphate oral solution, SOLU-MEDROL.RTM. methylprednisolone
sodium succinate for injection, PRELONE.RTM. brand prednisolone
syrup.
[0473] Further examples of anti-inflammatory agents include
naproxen, which is commercially available in the form of
EC-NAPROSYN.RTM. delayed release tablets, NAPROSYN.RTM.,
ANAPROX.RTM. and ANAPROX.RTM. DS tablets and NAPROSYN.RTM.
suspension from Roche Labs, CELEBREX.RTM. brand of celecoxib
tablets, VIOXX.TM. brand of rofecoxib, CELESTONE.RTM. brand of
betamethasone, CUPRAMINE.RTM. brand penicillamine capsules,
DEPEN.RTM. brand titratable penicillamine tablets, DEPO-MEDROL
brand of methylprednisolone acetate injectable suspension,
ARAVA.TM. leflunomide tablets, AZULFIDINE EN-TABS.RTM. brand of
sulfasalazine delayed release tablets, FELDENE.RTM. brand piroxicam
capsules, CATAFLAM.RTM. diclofenac potassium tablets, VOLTAREN.RTM.
diclofenac sodium delayed release tablets, VOLTAREN.RTM.-XR
diclofenac sodium extended release tablets, or ENBREL.RTM.
etanerecept products.
IMP-4 as an FAAH Inhibitor
[0474] It has also been discovered that IMP-4 is also an inhibitor
of FAAH.
[0475] Accordingly, in some embodiments, the present invention
provides a composition comprising IMP-4 and a pharmaceutically
acceptable carrier, adjuvant, or vehicle.
[0476] In certain embodiments, the present invention provides a
method for inhibiting FAAH in a patient, comprising administering
to the patient IMP-4, or a pharmaceutically acceptable composition
thereof. In some embodiments, the present invention provides a
method for treating an FAAH-mediated disorder in a patient,
comprising administering to the patient IMP-4, or a
pharmaceutically acceptable composition thereof. Such disorders
include pain and those described in detail herein, infra.
[0477] The present disclosure now being generally described, it
will be more readily understood by reference to the following
examples, which are included merely for purposes of illustration of
certain aspects and embodiments of the present invention, and are
not intended to limit the disclosure herein.
EXEMPLIFICATION
[0478] The original procedure for the synthesis of Compound 1 as
disclosed in PCT publication number WO 2008/63300, incorporated
herein by reference, is depicted in Scheme 4. The first step of the
published synthesis involved a Suzuki coupling of
1,4-dibromo-2-fluoro-benzene E-1a and 3-fluorophenylboronic acid
E-2a, followed by concentration and chromatographic purification to
provide E-3a. A Suzuki coupling of E-3a and bis(pinacolato)diboron
followed by workup and chromatographic purification provided
boronate ester E-4a. Hydrolysis of ester E-4a under oxidative
conditions followed by workup and trituration with hexanes provided
the boronic acid, Compound 1, as a white solid.
##STR00032##
Example 1
Optimization of the Synthesis of Compound 1
Step 1: Suzuki Coupling
##STR00033##
[0480] Suzuki Coupling Starting Material: Given the improved
reactivity of aryl halides in the order Cl<Br<I (with aryl
iodides reacting with Pd the most effectively), the Suzuki coupling
to generate E-3a was subsequently improved to use starting material
E-1b (X.dbd.I) instead. This provided a significantly improved
yield for the reaction.
[0481] Generation of Impurities: The two most common impurities for
the Suzuki coupling were 3,3'-difluorobiphenyl IMP-1 and triphenyl
IMP-2 resulting from the Suzuki coupling on both iodine and bromine
in the starting material (FIG. 7). Interestingly,
3,3'-difluorobiphenyl IMP-1 could be generated from either
homocoupling of E-2a or protodebromination of E-3a. Whereas some
literature suggests that oxidation of Pd(0) to Pd(II) by dissolved
oxygen is the reason behind homocoupling, no change in reaction
profile was observed when the reaction was degassed and kept under
an inert atmosphere compared with when it was run under ambient
conditions. In the presence of excess catalyst and absence of
halide coupling partner it was demonstrated that E-2a will produce
IMP-1 in small amounts. However, it was also found that at elevated
temperatures, and extensive reaction times, E-3a will also convert
to IMP-1 independently. Without being bound to any theory, this
reason supports that the formation of IMP-1 may not be attributed
to one or the other mechanism, and it is believed that both are
contributors to this process impurity.
[0482] Also formed in the Suzuki coupling was the dibromide IMP-3
(FIG. 7). The possibility of contamination of 3-fluorophenylboronic
acid E-2a with 4-bromo-3-fluorobenzeneboronic acid was
investigated, but no bromide was detected in the lots tested.
Instead, without being bound to any theory, it was reasoned that
IMP-3 formed through a homocoupling of E-1a in a copper-free
Ullmann reaction. Without being bound to any theory, the presence
of IMP-4 is attributed, in part, IMP-3 reacting in the
metallation/boronation step (FIG. 7). Additional discussion of
IMP-4 is provided in Example 3.
[0483] Suzuki Coupling Solvent Screens: The Suzuki coupling to make
biphenyl E-3a was optimized in stages. Solvents were first screened
among a limited number of process-friendly solvents for the
reaction using PdCl.sub.2(PPh.sub.3).sub.2 as the catalyst and
NaHCO.sub.3 as the base. A sample overlay chromatogram of eight of
the solvent mixtures is presented in FIG. 3. From this sample
overlay, it was surprisingly found that 1-PrOH produced
significantly fewer impurities than the other solvents (e.g.,
1-PrOH:water in approximately an 8:3 ratio).
[0484] Suzuki Coupling Base Screens: Organic and inorganic bases
(FIGS. 4 and 5) were then screened using 1-PrOH or a mixture of
1-PrOH and water as the solvent and PdCl.sub.2(PPh.sub.3).sub.2 as
the catalyst. From this base screen, NaHCO.sub.3 was chosen for
further development based on its superior conversion.
[0485] Suzuki Coupling Catalyst Screens: A number of palladium
catalysts were screened at loadings of 3 mol % relative to
substrate. FIG. 6 shows the multiple chromatogram overlay of an
exemplary catalyst screen for the Suzuki cross-coupling: (a)
Pd(PPh.sub.3).sub.4/K.sub.2CO.sub.3; (b) Pd(OAc).sub.2/PPh.sub.3;
(c) Pd(OAc).sub.2; (d) Pd.sub.2(dba).sub.3/PPh.sub.3; (e)
Pd.sub.2(dba).sub.3; (f) Pd(dppf).sub.2Cl.sub.2; (g)
Pd(PPh.sub.3).sub.4. (dba=dibenzylideneacetone;
dppf=(diphenylphosphoryl) ferrocene). All reactions, except for
(a), used NaHCO.sub.3 as the base. The solvent for all reactions
was 1-PrOH/water. 3 mol % of Pd was used for all reactions except
(b) and (d).
[0486] Suzuki Coupling Temperature Screens: The effect of
temperature and PdCl.sub.2(PPh.sub.3).sub.2 catalyst loading were
studied by varying both reaction temperature and
PdCl.sub.2(PPh.sub.3).sub.2 catalyst loading (e.g., about 50 to
about 85.degree. C. and about 0.5 to about 5.0 mol %,
respectively), and monitoring conversion after 14 hrs, reaction
purity as determined by HPLC, percent yield of E-3a (e.g., using
weight/weight assay) and by-product formation (e.g., formation of
IMP-1). From these experiments, a catalyst load from about 0.3 to
about 0.5 mol % of PdCl.sub.2(PPh.sub.3).sub.2 and a reflux
temperature of about 83.+-.5.degree. C. was employed and
demonstrated to work on 100 g to 2 kg scaled reactions.
[0487] Suzuki Coupling Reaction Workup: The work-up procedure was
optimized in order to remove the 1-PrOH and trace palladium from
the reaction mixture. It was found that n-heptane worked well as
the extraction solvent for this reaction. Workup involved an
initial quench with aqueous 1 M NaOH followed by extraction of the
product E3a into the organic (n-heptane) phase. The aqueous quench
helped dissolve inorganic solids and produced a clean phase
separation with a slight rag layer emulsion at the interphase.
After elimination of that first aqueous phase and its rag layer
emulsion, the organic phase was again washed with aqueous 1 M NaOH.
In order to mitigate emulsions observed during the final water
rinse of an initial scale-up, the final (third) wash was performed
with 2% (w/w) aqueous NaCl. A reduction in the volume of the
organic phase indicated that the washes were very efficient at
removing 1-PrOH from the organic phase as determined by GC.
Subsequent concentration of the n-heptane layer allowed for nearly
complete removal of 1-PrOH (typically <200 ppm of 1-PrOH remains
after distillation). Pd levels of the concentrated n-heptane layer
were found to be >2000 ppm. Silica gel slurry in n-heptane
followed by filtration provided the product E-3a with Pd levels of
less than 16 ppm. In order to further facilitate the manufacturing
of intermediate E-3a and generate a process that was more
seamlessly integrated into the synthesis of Compound 1 as a whole,
the following two improvements were made in the synthesis: 1) the
silica gel treatment to remove trace Pd was optimized to be
performed as an in-line filtration operation (previously, this was
performed as a fed-batch operation); and 2) the yield of E-3a was
determined using a weight/weight assay to better estimate the
charge of the reagents for the subsequent step.
[0488] In order to clean the reactor of starting materials,
products, and palladium impurities, a combination of rinses were
used. The reactor was sequentially rinsed with dichloromethane,
acetone, water, and dilute nitric acid/hydrochloric acid solutions.
The latter allowed for complete removal of the palladium that
adhered onto the reactor walls and eliminated the need for hand
washing of the systems. Final polish rinses and commissioning as
usual were then used to remove trace acids and water from the
reactor.
Step 2: Metallation/Boronation
##STR00034##
[0490] New Metallation/Boronation Step: In scaling up the synthesis
of Compound 1, the two-step palladium-mediated formation of the
pinacolboronate intermediate E-4a followed by oxidative hydrolysis
(as depicted in Scheme 3) became less efficient than on a small
scale. As well, a second Pd-mediated synthesis in the final step of
the synthesis involves additional steps to scavenge the Pd from the
drug product. A one pot lithium-halogen exchange followed by
boronation and hydrolysis from E-3a was considered (e.g., see W. Li
et al., J. Org. Chem. 2002, 67:5394-5397). Additional studies
further improved the stoichiometry of the reagents in the reaction,
the reaction solvent, the reaction temperature, and the workup
conditions to the procedure described below.
[0491] Metallation/Boronation Solvent Conditions: Initial
conditions called for the use of toluene and THF as the reaction
solvents, followed by MTBE as the workup solvent. This solvent
combination required extensive concentration in addition to a
solvent exchange and thus alternative solvent systems were
considered in order to streamline the process to better flow from
step one to the isolation of Compound 1.
[0492] Since bromide E-3a would ideally be telescoped from the
first step as a solution in n-heptane, experiments were performed
to demonstrate that it would be a suitable solvent for use with
MTBE and THF as the workup and reaction co-solvent, respectively.
In order to further simplify the reaction workup transition,
water-miscible THF was replaced with water immiscible 2-MeTHF as
the reaction co-solvent with n-heptane, thus eliminating the need
for MTBE in the workup. A solubility plot indicated that a
solubility of >100 mg/mL of Compound 1 could be obtained in at
least a 2:1 ratio of a mixture of 2-MeTHF:n-heptane. This afforded
a relatively wide solubility range for both the reaction and the
workup while still keeping the solvent volumes at reasonable levels
for the telescoped steps.
[0493] Stoichiometry of the Lithiating Agent and boronating agent
B(OiPr).sub.3: Several experiments were designed to test whether a
local excess of alkyllithium would play an important role in this
reaction. Of course, low amounts (undercharge) of triisopropyl
borate (B(OiPr).sub.3) and n-butyllithium led to incomplete
conversion. A reverse addition approach was also employed wherein
the starting material and borate were added to the n-butyllithium
solution at -45.degree. C. When compared to a control reaction
(slow n-butyllithium addition), the reverse addition approach
resulted in excess unreacted starting material (7% a/a of E-3a
(control) versus 45% a/a of E-3a, respectively). Addition of more
n-butyllithium led to increased formation of IMP-1 and a lower
overall yield. A Design of Experiment (DoE) approach model
suggested that approximately 1.0 equivalent or less of alkyllithium
would be optimal for this reaction. It was further reasoned that an
excess of borate added to the reaction would effectively "protect"
the formed product Compound 1 from adverse reactions in situ with
the alkyllithium.
[0494] It was found that careful addition of the correct amount of
alkyllithium based on the titration of the solution and assay of
the starting material allowed for more controlled use of the
reagent. An initial undercharge of the alkyllithium followed by
In-Process Control (IPC) by HPLC (with micro-workup using 1 M HCl)
allowed for an estimation of the amount of starting material
remaining relative to the product, as well as a calculation of the
necessary n-butyllithium needed to get complete conversion without
any adverse reaction.
[0495] Metallation/Boronation Temperature Screen: While the
lithiation/boronation reaction was initially run at -78.degree. C.,
in order to facilitate scale-up, the temperature was increased to
-40.degree. C. No difference was observed when the reactions were
run at these two temperatures. Additional experiments run at higher
temperatures (e.g., -20.degree. C., -10.degree. C. and 0.degree.
C.) afforded more late-eluting impurities as observed by HPLC.
[0496] Choice of alkyllithium Reagent: Initial work used
n-butyllithium as the reagent for this reaction. It was thought
that the pyrophoric nature of n-butyllithium would not make it a
desired reagent for scale-up beyond the 2 kg mark (scale-up that
would require fixed equipment). Instead, hexyllithium was suggested
as a more suitable reagent for scale-up for safety reasons, as it
exhibits two safety advantages over n-butyllithium: (1) when
formulated in hexanes it is non-pyrophoric, even at concentrations
up to 85%; and (2) the byproduct of the reaction (in this case,
1-bromohexane) has a significantly higher boiling point than its
butyl counterpart. Both lab scale and kilo scale experiments
confirmed that hexyllithium was a good substitute for this
reaction, and in many ways surpassed n-butyllithium for ease of
use.
[0497] Water Tolerability of the Lithiation: Although the amount of
water in the reaction mixture prior to addition of the alkyllithium
reagent had been reliably low (<500 ppm; all reagents except for
hexyllithium/n-butyllithium), it was of interest to determine the
"breaking point" of this reaction and the consequence of excess
water in the reaction mixture. An experiment was designed to
artificially contaminate the reaction mixture with up to .about.1
eq. of water, monitor the water content (ppm), and monitor the
effect on the reaction progress using hexyllithium as the base. It
was found that greater than 1000 ppm of water (approx. 0.15 eq.),
impaired the purity of the reaction. The most significant impurity
identified from this reaction was IMP-1 formed from lithiation and
protonation of intermediate E-3a.
[0498] Rate of Addition of Alkyllithium: In addition to the
alkyllithium amount and water content of the reaction mixture, it
was also found that slower addition rates allowed for the use of
less alkyllithium. Typical addition time, regardless of scale, was
set to be no less than about 1 hour, with proper mixing and heat
exchange being important parameters.
[0499] Isolation and Purification of Compound 1: As described in
Scheme 3, initial discovery efforts provided a reaction mixture
containing Compound 1 which, after workup, were triturated with
hexanes to provide a white solid. Chromatographic purification was
attempted but failed due to Compound 1 precipitating on the column,
presumably due to poor solubility in the eluant and high affinity
to silica gel.
[0500] A number of solvent combinations were tried
(2-propanol/water, acetonitrile/water, ethanol/water,
acetone/water, hexanes, cyclohexane, toluene, ethyl
acetate/hexanes, etc.) for the crystallization of Compound 1. It
was found that all alcoholic solvents formed the corresponding
boronate esters in varying amounts. In later attempts, Compound 1
was recrystallized from acetone/water, and then washed with
n-heptane, to eliminate the non-polar impurities (e.g., IMP-1,
IMP-2 and IMP-3) and to provide crystalline Compound 1. Certain
lots of crystalline Compound 1 contained minor amounts of IMP-4;
for example, compare Ex. A and Ex. B below (LOQ=0.13% a/a;
LOD=0.05% a/a), as determined by HPLC (Table 1). Without being
bound to any theory, the poor solubility of IMP-4 in acetone
(resulting in the removal of the impurity during the clarification
step) and better control of the crystallization are contributing
factors to the low levels of the impurity observed in manufacturing
lots.
TABLE-US-00002 TABLE 1 IMP-4 (% aa) before cryst. IMP-4 (% a/a)
after cryst. 0.35 (Ex. A) 0.18 (Ex. B)
[0501] In order to take advantage of the poor solubility of
Compound 1 and the high solubility of the reaction impurities in
n-heptane, a direct isolation was designed via solvent exchange
from the reaction solution. For example, after workup of the
lithiation/boronation step, the organic solution was concentrated
to small bulk (2.5 vol total), and n-heptane was added to the
suspension that was produced. Distillation was repeated to ensure
complete solvent exchange (i.e., to minimize the amount of 2-MeTHF
in the solution). The material was finally slurried in n-heptane
and filtered. This distillation was performed using the rotovap (20
L). However, in order to accommodate larger scale-up (particularly
in fixed equipment), a more direct isolation would be
beneficial.
[0502] In an effort to eliminate the rotovap and establish a better
understanding of Compound 1, atmospheric distillation and solvent
exchange were attempted. It was found that the elevated temperature
and more efficient azeotrope formed in the absence of reduced
pressure and quantitatively dehydrated Compound 1 to an anhydride
(e.g., structure assigned to Compound 2) (Scheme 5).
##STR00035##
[0503] Formation of the anhydride allowed for straight-forward
distillation of volatile reaction components directly from the
reaction vessel (typically, a reactor). No degradation of Compound
1 or the anhydride thereof was observed during this atmospheric
distillation, which can reach pot temperatures of approximately
100.degree. C. The polar impurity IMP-4 is completely removed from
Compound 1 using this procedure as determined by HPLC, see, e.g.,
for example, Ex. C and D below (LOQ=0.13% a/a; LOD=0.05% a/a)
(Table 2).
[0504] Conversion of the anhydride (e.g., structure assigned to
Compound 2) back to Compound 1 required addition of an aqueous
solvent to enable hydrolysis of the oligomer. Acetone in
combination with water gave the best results. It was surprisingly
found that crystallization from acetone/water generated only the
monomer form of Compound 1 as confirmed by evaporative Karl-Fischer
titration A careful addition of water and heating/cooling profile
produced a solid that had high purity (most impurities were
rejected), gave consistent particle size, and would filter easily
for the final isolation. Drying was performed in a vacuum oven set
to 40.+-.5.degree. C. to avoid reformation of the anhydride.
TABLE-US-00003 TABLE 2 IMP-4 (% a/a) IMP-4 (% a/a) after before
cryst. cryst. Ex. C 0.94 <limits of detection New process
isolating Ex. D 0.31 <limits of detection Compound 2 as an
intermediate
[0505] Depending on the purification protocol used for Compound 1,
different particle sizes will be observed. It is, however, noted
that regardless of the procedure (e.g., organic or aqueous
crystallization), the same crystal form (Form A, evidenced by
identical XRPD patterns) has been isolated. A visual comparison of
crystal shape and size by polarized light microscopy is provided in
FIG. 9. Overall, the crystals isolated from a more controlled
growth in acetone/water are much larger than those from an
uncontrolled growth.
[0506] An overall scheme summarizing the improved processing and
synthesis of Compound 1 is presented in Scheme 6.
##STR00036##
Experimental Section
[0507] HPLC method used: Column Information: YMC-Pack Ph,
50.times.2.0 mm, PH12S05-0502WT; Solvent A: Water with 0.1% (v/v)
formic acid; Solvent B: Acetonitrile with 0.1% (v/v) formic acid;
Flow rate: 1.5 mL/min; Column Temperature: 50.degree. C.;
Wavelength: 220 nm; Gradient: 95% A for 1 min., then 95 to 50% A
over 8 min., 50 to 20% A over 1 min., hold for 1 min., and return
to 95% A over 0.5 min. Stop time: 14 min. Relative purity (% a/a)
was determined by reverse phase high-pressure liquid chromatography
with UV detection (254 nm) using a C18-4.6.times.30 mm, 1.8 .mu.m
column with gradient elution (Solvent A: 0.1 formic acid (FA) in
HPLC grade water Solvent B: 0.1 FA in HPLC grade acetonitrile
(CAN)). Test samples are dissolved in 100% demethylsulfoxide (DMSO)
to an approximate concentration of 0.4 mg/mL. The Limit of
Quantitation (LOQ) for this method is currently.ltoreq.0.13%
a/a.
[0508] The experimental details below provide exemplary procedures
to obtain Compound 1. The scale provided is merely exemplary, and
these procedures have been successfully adapted to be performed on
a kilogram scale to provide kilogram quantities of Compound 1.
[0509] Preparation of 4-bromo-3,3'-difluorobiphenyl E-3a. To an
appropriately sized reactor was charged
1-bromo-2-fluoro-4-iodobenzene (600.55 g, 1.996 mol, 1.0 eq.),
3-fluorophenylboronic acid (282.60 g, 2.020 mol, 1.01 eq.), sodium
bicarbonate (503.91 g, 5.998 mol, 3.0 eq.),
trans-dichlorobis(triphenylphosphine)palladium(II) (4.1947 g, 5.98
mmol, 0.003 eq.), n-propanol (4.8 L, 8 vol. relative to trihalide
amount), and water (2 vol. relative to trihalide amount). The
mixture was stirred at a speed adequate to produce an evenly
dispersed suspension. The reaction solution was evacuated and
degassed, backfilling with nitrogen or argon. The reaction mixture
was heated to a target of 83.+-.5.degree. C. Once the target
temperature was reached, the temperature was maintained for 14-20
hours. Reaction completion was determined using HPLC (trihalide RT:
5.9 min; product RT: 7.6 min), with <1% remaining starting
material being the target for completion. Upon complete reaction,
the mixture was cooled to 25.+-.5.degree. C. The mixture was then
quenched with 1 M NaOH (aq) (6 L, 10 vol) and stirred to mix phases
thoroughly. n-Heptane was added (6 L, 10 vol) and stirred to mix
phases thoroughly. Stirring was stopped and the phases were allowed
to separate. The aqueous phase was drained and discarded. The
organic phase (top) was washed with 1 M NaOH (aq) (6 L, 10 vol) and
2% (w/w) NaCl (aq) (6 L, 0 vol) successively, discarding the
aqueous phase. The organic phase was concentrated in the reaction
vessel using reduced pressure to approximately 2 volumes; the
vessel did not exceed 45.degree. C. for the pot temperature; the
typical vacuum for the distillation was 70-110 torr. n-Heptane (3
L, 5 vol) was added to the mixture and stirred to cool to
25.+-.5.degree. C. The solution was filtered through a column
packed with silica gel (8.5 cm tall.times.5.5 cm diameter pad of
silica gel made using 72 g; loading: 120 g of silica gel per kg of
trihalide added). The reaction flask was rinsed with n-heptane (0.6
L, 1 vol) and the solution was filtered through the silica gel
column. The rinse was repeated once. The solution of crude E-3a in
n-heptane was transferred to the distillation flask. The solution
was distilled to a total of approximately 2 (.about.1.2 L) volumes
relative to the trihalide amount. The pot temperature did not
exceed 45.degree. C. The typical vacuum for the distillation was
70-110 torr. The concentration of the solution was determined using
weight/weight assay. For preparation of a reference marker (high
purity E-3a), the crude solution after workup and filtration was
purified using vacuum distillation and the product was boiled at
approx. 180.degree. C., with 21 mmHg. This reaction may be
performed on a kilogram scale. For example, this reaction has been
successfully performed to obtain approximately 20 kg of
product.
[0510] Characterization: .sup.1H NMR (400 MHz, acetone-d6)
.delta.7.71 (t, J=8.4 Hz, 1 H), 7.58 (dd, J=1.8, 10.2 Hz, 1 H),
7.52-7.44 (m, 4 H), 7.17 (m, 1 H) ppm. .sup.13C NMR (100 MHz,
acetone-d6) .delta. 165.4, 162.9, 161.4, 159.0, 142.0 (ddd), 134.9,
131.8 (d), 125.1 (d), 123.7 (d), 115.9 (dd), 114.5 (d), 108.8 (d)
ppm. mp (by DSC) 35-38.degree. C. Anal. Calcd. for
C.sub.12H.sub.7BrF.sub.2: C, 53.56; H, 2.62. Found: C, 53.62; H,
2.63.
[0511] Preparation of
2,4,6-tris(3,3'-difluorobiphenyl-4-yl)-1,3,5,2,4,6-trioxatriborinane
(2). An inert reactor was charged with solution of E-3a (1.5
L/1.32307 kg of a 37.0 wt % solution, 1.819 mol; 1.0 eq.) in
n-heptane. Triisopropyl borate (0.55 L, 2.369 mol, 1.3 eq. relative
to E-3a from w/w assay) and 2-MeTHF (3 L) were then added to the
reactor. The mixture was stirred at speed adequate to produce a
homogeneous solution. The solution was then evacuated and degassed,
backfilling with nitrogen or argon. The reaction mixture was cooled
to about -45.+-.5.degree. C. A solution of hexyllithium (33 wt %
solution in hexanes) was titrated just prior to reaction and added
to the reaction (0.820 L of a 2.44 M solution in hexane; 1.1 eq.
relative to IPI-487552 from w/w assay) at a rate such that (a)
TRXN<-35.degree. C. and (b) total addition time >1 hour, but
preferably no more than 3 hours. After the addition was complete,
the reaction was stirred for 5 minutes while maintaining cooling.
The reaction mixture was sampled to determine conversion. A
reaction aliquot (1-2 mL) was taken from the reaction mixture and
quenched with 1 M HCl (aq) (2 mL). The phases were mixed and then
allowed to settle. From the (top) organic phase, 10 .mu.L was
diluted with 1 mL MeCN. The sample was analyzed by HPLC. Only the
starting material and products peaks were integrated to determine
conversion. The reaction was complete when the starting material
peak was <1% relative to the product peak. If the reaction was
found to be incomplete, the amount of additional hexyllithium
necessary to push conversion to completion was determined using
direct approximation from the HPLC data: The % a/a of the starting
material was nearly identical to the relative stoichiometry in the
reaction mixture. Additional hexyllithium (40 mL of a 2.44 M
solution in hexane; 0.05 eq.) was added to the reaction at a rate
(mL/min) similar to the rate of addition used for the bulk
solution. After the addition was complete, the reaction was stirred
for 5 minutes and analyzed to confirm the reaction was complete.
The mixture was then quenched by adding 1 M HCl (aq) (3 L). During
the quench, the temperature of the reaction was maintained at
<0.degree. C. The biphasic reaction mixture was then warmed to
25.+-.5.degree. C. and stirring was terminated. The layers were
allowed to separate and the aqueous phase was then discarded. The
organic phase was washed with water (3 L) and kept in the reactor
to start distillation under nitrogen (atmospheric pressure) in
order to concentrate mixture. About 3 L of distillate were
collected. n-Heptane (3 L) was added and the distillation was
continued until approximately 3 L of distillate were collected.
This step was repeated once more, after which one last portion
n-heptane (3 L) was added and the distillation was stopped. The
resulting suspension was cooled to RT as a slurry and the solids
were filtered, wash with n-heptane (1.5 L in three portions), and
dried in a vacuum oven at 40.+-.5.degree. C. and 25-30 in Hg until
constant weight. The resulting dry solids were taken on to the
crystallization step.
[0512] Characterization: .sup.1H NMR (400 MHz, acetone-d6) .delta.
8.28 (t, J=7.2 Hz, 1 H), 7.87 (t, J=7.2 Hz, 1 H), 7.69 (d, J=7.6
Hz, 1 H), 7.64 (d, J=7.6 Hz, 1 H), 7.60-7.45 (m, 7 H), 7.42 (d,
J=1.2, 10.8 Hz, 1H), 7.28 (bs, 1H), 7.20 (m, 2 H) ppm. mp (by DSC)
238-241.degree. C. Anal. Calcd. for
C.sub.36H.sub.21B.sub.3F.sub.6O.sub.3: C, 66.73; H, 3.27. Found: C,
65.88; H, 3.32. A careful data analysis indicates that Compound 2
is being partially hydrolyzed in the process of performing the
analysis (NMR, elemental), to provide a mixture of the linear timer
and Compound 2 (the cyclic trimer), giving varying results. Anal.
Calcd. for C.sub.36H.sub.23B.sub.3F.sub.6O.sub.4 (linear trimer of
Compound 2): C, 64.92; H, 3.48. Found: C, 65.88; H, 3.32.
Evaporative Karl-Fischer titration: 0.8% water.
[0513] Without being bound to any theory, the found elemental
analysis for both Compound 2 suggests that Compound 2 may be
provided as a 1:1 mixture of linear and cyclic trimers, i.e., for
carbon: Calcl: (66.73+64.82)/2=65.82 Found: 65.88, and for
hydrogen: Calcd: (3.27+3.48)/2=3.375, Found: 3.32.
[0514] Compound 2 XRPD parameters: INEL XRG-3000; X-ray tube:
1.54187000 .ANG.; voltage: 40 (kV); amperage: 30 (mA); acquisition
time: 300 sec; Spinning Capillary. Step size: approx.
0.03.degree.2.THETA.. Referred to herein as "Form I." The XRPD
pattern of Compound 2, Form I, is notably different from that of
Compound 1 (compare FIG. 8 to FIG. 1).
TABLE-US-00004 Observed peaks for XRPD of Compound 2, FIG. 8
Intensity (%) .theta.-2.theta. (degrees) 1 75 6.32 .+-. 0.10 2 20
9.64 .+-. 0.10 3 22 11.20 .+-. 0.10 4 17 11.51 .+-. 0.10 5 50 12.69
.+-. 0.10 6 20 13.14 .+-. 0.10 7 25 14.67 .+-. 0.10 8 21 15.19 .+-.
0.10 9 28 16.85 .+-. 0.10 10 26 17.27 .+-. 0.10 11 27 17.44 .+-.
0.10 12 49 17.69 .+-. 0.10 13 20 17.96 .+-. 0.10 14 37 18.55 .+-.
0.10 15 20 19.04 .+-. 0.10 16 33 19.42 .+-. 0.10 17 18 20.36 .+-.
0.10 18 16 20.84 .+-. 0.10 19 31 21.57 .+-. 0.10 20 21 22.47 .+-.
0.10 21 24 22.68 .+-. 0.10 22 19 22.99 .+-. 0.10 23 33 23.37 .+-.
0.10 24 31 24.45 .+-. 0.10 25 22 24.66 .+-. 0.10 26 20 25.14 .+-.
0.10 27 22 25.49 .+-. 0.10 28 100 26.77 .+-. 0.10 29 31 27.71 .+-.
0.10 30 15 28.26 .+-. 0.10 31 17 29.03 .+-. 0.10
[0515] Preparation of 3,3'-difluorobiphenyl-4-ylboronic acid
(Compound 1) from Compound 2. Compound 2 (333.73 g, 515 mmol, 1
eq.) was charged into a suitable reactor/flask equipped with an
overhead stirrer, thermocouple, reflux condenser, and heating
mantle. Acetone (2.34 L. 7 vol) was then added and stirring was
initiated to produce a suspension. The reactor was evacuated and
the reactor inerted. The solution/suspension was degassed, stirred,
and heated to a target of 50.+-.5.degree. C. Water (30 mL, 1.665
mol, 3.2 eq. relative to Compound 2) was then added to produce a
clear solution. The temperature was maintained for 20-60 min. The
solution was then clarified through a 1.0 .mu.m PTFE filter into
the crystallization reactor and heated to reflux (55-60.degree.
C.). Water was charged (3 L, 9 vol.) in portions and heating was
increased to maintain temperature (i.e., to resume reflux
(65-70.degree. C.)). Acetone was then added (0.33 L, 1 vol.)
followed by continued heating to resume reflux (65-70.degree. C.),
then an additional portion of water (0.33 L, 1 vol.) to produce a
clear solution. Reflux was maintained for 15-30 minutes and then
terminated to allow the mixture to slowly cool (i.e., for at least
8 hours) to 25.+-.5.degree. C. At 62.degree. C., the mixture began
to nucleate (haze). The mixture was filtered to collect the
crystalline solid, and the filter cake was washed with 6:4
water:acetone (0.33 L, 1 vol.) three times. The resulting material
were then dried to constant weight in a vacuum oven equilibrated at
40.+-.5.degree. C. and 25-30 in. Hg with a nitrogen bleed. This
procedure may be adapted to a kilogram scale.
[0516] Preparation of 3,3'-difluorobiphenyl-4-ylboronic acid
(Compound 1) from Preparation of 4-bromo-3,3'-difluorobiphenyl
E-3a. An inert reactor was charged with solution of E-3a (4.610 kg
of a 33.7 wt % solution in n-heptane; 5 L; 5.77 mol, 1.0 eq.) in
n-heptane. Triisopropyl borate (1.412 kg, 7.51 mol, 1.3 eq.
relative to E-3a from w/w assay) and 2-MeTHF (5.3 weights) were
then added to the reactor. The mixture was stirred at speed
adequate to produce a homogeneous solution. The solution was then
evacuated and degassed, backfilling with nitrogen or argon. The
reaction mixture was cooled to about -45.+-.5.degree. C. A solution
of n-butyllithium (2.5 M solution in hexanes) was titrated just
prior to reaction and added to the reaction (1.735 kg of a 24.7 wt
% solution in hexanes, 6.69 mol, 1.16 eq.) at a rate such that (a)
TRXN<-35.degree. C. and (b) total addition time >1 hour, but
preferably no more than 3 hours. After the addition was complete,
the reaction was stirred for 5 minutes while maintaining cooling.
The reaction mixture was sampled to determine conversion. A
reaction aliquot (1-2 mL) was taken from the reaction mixture and
quenched with 1 M HCl (aq) (2 mL). The phases were mixed and then
allowed to settle. From the (top) organic phase, 10 .mu.L was
diluted with 1 mL MeCN. The sample was analyzed by HPLC. Only the
starting material and products peaks were integrated to determine
conversion. The reaction was determined to be complete as the
starting material peak was <1% relative to the product peak. The
mixture was then quenched by adding 1 M HCl (aq) (10 L). During the
quench, the temperature of the reaction was maintained at
<0.degree. C. The biphasic reaction mixture was then warmed to
25.+-.5.degree. C. and stirring was terminated. The layers were
allowed to separate and the aqueous phase was then discarded. The
organic phase was washed with water (6.3 weights), then
concentrated under vacuum (on the rotovap or in a suitable reactor)
at reduced pressure (<100 torr) and at a temperature less than
about 45.degree. C. to a total volume of approximately 5 L.
n-Heptane (10 L) was added and the distillation was continued until
approximately 10 L of distillate were collected. This step was
repeated once more, after which one last portion n-heptane (10 L)
was added and the distillation was stopped. The resulting
suspension was cooled to RT and the slurry and the solids were
filtered, washed with n-heptane (5 L), and dried in a vacuum oven
at 40.+-.5.degree. C. and 25-30 in. Hg until constant weight.
[0517] Characterization: .sup.1H NMR (400 MHz, acetone-d6) .delta.
7.85 (dd, J=6.9, 7.5 Hz, 1 H), 7.56 (m, 1 H), 7.54 (m, 2 H), 7.50
(m, 1 H), 7.41 (dd, J=1.7, 11.1 Hz, 1 H), 7.25 (d, J=2.1 Hz, 2
H--B(OH).sub.2), 7.18 (dddd, J=1.5, 2.6, 7.8, 8.8 Hz, 1 H) ppm.
.sup.13C NMR (100 MHz, acetone-d6) .delta. 167.5 (d), 163.3 (d),
143.8 (dd), 141.8 (dd), 136.9 (d), 130.8 (d), 122.9 (d), 122.3 (d),
119.7 (br), 114.8 (d), 113.6 (d), 113.2 (d) ppm. Anal. Calcd. for
C.sub.12H.sub.9BF.sub.2O.sub.2: C, 61.59; H, 3.88. Found: C, 61.60,
H, 3.73. Karl Fischer water (evaporative Karl Fischer): 7.88%
(Theoretical: 7.7%). Metal content of final isolated product is
typically <1 ppm Pd.
[0518] .sup.1H and .sup.13C Chemical Shifts and Assignment for
Compound 1:
##STR00037##
TABLE-US-00005 TABLE 3 .sup.13 C NMR (acetone-d6) .sup.1 H NMR
(acetone-d6) Chemical .sup.13C-.sup.19F Mult..sup.a, Chemical
Mult..sup.a, Shift Splittingb Shift Splitting.sup.b Label (ppm)
(Hz) (ppm) (Hz) 1 119.7 br -- -- 2 167.5 d (244.7) -- -- 3 113.2 d
(26.5) 7.41 dd (11.1, 1.7) 4 143.8 dd (8.9, 1.8) -- -- 5 122.3 d
(2.4) 7.54 m 6 136.9 d (9.3) 7.85 dd (6.9, 7.5) 7 141.8 dd (7.7,
1.8) -- -- 8 113.6 d (22.6) 7.50 m 9 163.3 d (244.7) -- -- 10 114.8
d (21.4) 7.18 dddd (1.5, 2.6, 7.8, 8.8) 11 130.8 d (8.6) 7.54 m 12
122.9 d (2.4) 7.56 m OH -- -- 7.25 d (2.1) .sup.aMultiplicity: d =
doublet; t = triplet; m = multiplet; br = broad .sup.b1H
multiplicity were obtained from the HSQC spectrum for H-11, H-12,
H-5, and H-8 due to overlap in the .sup.1H spectrum.
[0519] Elemental Analysis: Compound 1 was analyzed for C, H, and F
content (Table 4). The percent carbon, hydrogen, and fluorine found
corresponded to the proposed structure for Compound 1 (i.e.,
C.sub.12H.sub.9BF.sub.2O.sub.2). Elemental analysis was performed
using standard combustion analysis (for carbon and hydrogen). The
amount of fluorine was calculated by a nitric acid digestion
followed by ion chromatography analysis.
TABLE-US-00006 TABLE 4 Found (%) Theoretical Actual Compound 1
Compound 1 Theoretical Element monomer monomer Compound 2 carbon
61.59 61.69 66.73 hydrogen 3.88 3.76 3.27 fluorine 16.24 16.00
17.59
[0520] Compound 1 XRPD parameters: INEL XRG-3000; X-ray tube:
1.54187000 .ANG.; voltage: 40 (kV); amperage: 30 (mA); acquisition
time: 300 sec; Spinning Capillary. Step size: approx.
0.03.degree.2.THETA.. Referred to herein as "Form A." The XRPD
pattern of Compound 1, Form A, has been reproduced for all
crystalline lots, regardless of isolation (from heptane/2-MeTHF or
acetone/water) and particle size (see FIG. 1).
TABLE-US-00007 Observed peaks for XRPD of Compound 1, Form A, FIG.
1 Intensity (%) .theta.-2.theta. (degrees) 1 13 4.83 .+-. 0.10 2 19
9.68 .+-. 0.10 3 15 16.12 .+-. 0.10 4 16 16.92 .+-. 0.10 5 100
17.26 .+-. 0.10 6 13 17.75 .+-. 0.10 7 17 18.58 .+-. 0.10 8 10
18.89 .+-. 0.10 9 10 19.34 .+-. 0.10 10 10 19.69 .+-. 0.10 11 10
21.01 .+-. 0.10 12 92 21.60 .+-. 0.10 13 11 22.46 .+-. 0.10 14 10
23.67 .+-. 0.10 15 14 24.33 .+-. 0.10 16 48 24.68 .+-. 0.10 17 17
25.16 .+-. 0.10 18 38 25.48 .+-. 0.10 19 12 25.96 .+-. 0.10 20 10
26.48 .+-. 0.10 21 94 27.73 .+-. 0.10 22 27 29.08 .+-. 0.10 23 17
29.43 .+-. 0.10 24 13 29.84 .+-. 0.10
Example 2
Exemplary Pharmaceutical Compositions of Compound 1
(i) Oral Suspensions
[0521] Compound 1 ("drug product") is supplied as a powder for oral
suspension in USP Type III amber glass bottles. In the clinical
setting, a protocol-specified portion of powder is weighed into an
appropriate container and suspended with freshly prepared vehicle.
The drug product is a single-use vial containing 1.00+/-0.05 g of
the active ingredient, which may be used to prepare doses for
multiple patients on the same day. The remaining unused portion of
the drug product vial is then discarded. The container closure for
the drug product consists of 1-oz. USP Type III glass bottles with
TEFLON.RTM.-lined polypropylene caps.
[0522] The drug product is a crystalline solid that is sparingly
soluble in water. The drug product does not contain excipients. In
the clinic, protocol-specified portions of drug product are
suspended in a vehicle consisting of commercially available medium
viscosity USP carboxymethylcellulose sodium (CMC) in Sterile Water
for Injection (SWFI). CMC is a chemically stable compound that is
commonly used in oral pharmaceutical formulations and appears on
the FDA list of substances that are Generally Recognized As Safe
(GRAS). A recent compatibility study showed that the stability of
the drug product suspended in CMC is at least 48 hours, which
exceeds the clinical dosing window (12 hours).
[0523] The drug product formulation was chosen for its ability to
wet the powder and form a suspension with CMC in SWFI, allowing for
consistent oral dosing. No overages are used in the manufacture of
the drug product. During the drug product manufacturing process,
the drug product is milled prior to filling to generate particles
of consistent size. The drug product undergoes microbial limits
testing as part of release testing.
[0524] Manufacturing of the drug product was performed in
accordance with current Good Manufacturing Practices (cGMP). The
manufacturing process involved milling of drug product, passing the
milled drug product through a 500 .mu.m screen, followed by
weighing 1.00.+-.0.05 g into 1-oz. USP Type III amber glass jars
and capping. Upon labeling and packaging, the drug product was
stored at -20.degree. C..+-.5.degree. C. at the manufacturer and
the clinical site. Material was shipped in an appropriate container
on dry ice.
(ii) Capsules
[0525] The drug product (Compound 1) has been formulated into a
capsule as a direct blend powder fill, using excipients that
consist of the different components such as a filler, disintegrant
and glidant/lubricant, e.g.: [0526] Compound 1: about 25 to about
45% w/w [0527] Filler: AVICEL.RTM. (Microcrystalline Cellulose)
(about 49 to about 75% w/w) [0528] Disintegrant: AcDiSol
(Croscarmellose Sodium) (0% to about 6% w/w) [0529] Glidant:
PRUV.RTM. (Sodium stearyl fumarate) (0% to about 2% w/w)
[0530] Other excipients envisioned being used include, but are not
limited to, fillers such as lactose, mannitol, starch, sorbitol,
sucrose, dicalcium phosphate; disintegrants such as copovidone, and
sodium starch glycolate; glidants such as colloidal silicon
dioxide, silicon dioxide, magnesium silicate, talc; lubricants such
as magnesium stearate and stearic acid; and surfactants such as
sodium lauryl sulphate, sodium dodecyl sulphate, TWEEN.RTM. 80,
LUTROL.RTM.. The choice of the excipients is based on an excipient
compatibility study done under accelerated conditions. The choice
and the percentage of the filler was based on the flowability of
the blend. The choice and the percentage of the superdisintegrant
was based on release profile of the capsule in 0.1 N hydrochloric
acid with 0.8% (lower strength capsules)/1.5% (higher strength
capsules) TWEEN.RTM. 80 media. The particular ratios of API to
filler/disintegrant/lubricant have been chosen to enhance the
powder flowability, blending process and capsule filling
process.
[0531] The current particle size D (0.5) is targeted at about 40 to
about 80 microns.
[0532] Direct blend formulations have been prepared in dosage
strengths of between about 25 mg to about 200 mg of Compound 1 per
unit dosage form.
TABLE-US-00008 mg per mg per Percentage capsule capsule per capsule
Compound 1 100.0 25 27.0 AVICEL .RTM. pH 200 246.0 61.5 66.5
(Microcrystalline Cellulose NF., Ph. Eur., JP) AcDiSol SD-711 22.2
5.6 6.0 (Croscarmellose Sodium NF., Ph. Eur., JP) PRUV .RTM.(Sodium
Stearyl 1.9 0.5 0.5 Fumarate Ph. Eur., NF, JPE) Total 370.0 92.5
100.0 HPMC Capsule Size 0 EL 4 na
TABLE-US-00009 mg per Percentage capsule per capsule Compound 1
200.0 42.6 AVICEL .RTM. pH 112 (Microcrystalline Cellulose 23.5 5.0
NF., Ph. Eur., JP) AVICEL .RTM. pH 200 (Microcrystalline Cellulose
208.9 44.4 NF., Ph. Eur., JP) AcDiSol SD-711 (Croscarmellose Sodium
28.2 6.0 NF., Ph. Eur., JP) PRUV .RTM. (Sodium Stearyl Fumarate 9.4
2.0 Ph. Eur., NF, JPE) Total 470.0 100.0 HPMC capsule Size 00
na
(iii) Tablets
[0533] The drug product can be translated over to a tablet form,
either through direct compression of the direct blend formulation
or via a dry granulation or wet granulation process. Other
excipients can be added, such as binders, and/or surfactants, and
coating films to aid in tablet integrity, taste masking and
aesthetics.
Example 3
Identification and Biological Activity of IMP-4
[0534] Lots containing high levels of impurities were analyzed
using LCMS with ESI-mode, and a parent peak of m/z 277.1
[M-H].sup.- was identified for this material.
[0535] The impurity was isolated using preparative liquid
chromatography. After confirming that the isolated impurity matched
the retention time of the target impurity, the isolated solids were
analyzed by Liquid Chromatography-Mass Spectrometry (LC-MS) and
Nuclear Magnetic Resonance (NMR).
[0536] The ion mass of the isolated impurity matched the ion mass
impurity present in the Compound 1 DS lots by LC-MS using
Electrospray Ionization in negative mode (ESI-MS). The impurity had
a parent/base peak at m/z 277 and an apparent dimer peak at m/z
536.
[0537] By NMR (400 MHz in acetone-d.sub.6), only three resonances
were observed in the proton spectrum. All three integrated equally
and were in the aromatic region. Of the three resonances, one was a
singlet, indicating an isolated proton (no coupling). Based on the
NMR data, the early retention time of the impurity, and the mass
spectrometry data of the isolated impurity, a symmetrical diboronic
acid derivative of Compound 1 was proposed as a structure for this
impurity.
[0538] Synthesis of the proposed impurity is provided below in
Scheme 7. Suzuki coupling with E1b and E2a produced the symmetrical
4,4'-dibromo-3,3'-difluorobiphenyl, IMP-3, followed by double
lithiation and boronation to produce the desired diboronic acid
IMP-4. The largest impurity in this second boronation reaction was
Compound 1, which is formed as a result of rapid addition of
hexyllithium to the starting material.
##STR00038##
[0539] The synthesized impurity matched the isolated impurity by
HPLC retention time (FIG. 10), UV absorption (FIG. 11), LCMS (FIG.
12), and .sup.1H-NMR (FIG. 13, FIG. 14).
[0540] The origin of IMP-4 was determined to be from IMP-3, and it
was reasoned that IMP-3 was generated either: (1) as a homocoupling
product of 1-bromo-2-fluoro-4-iodobenzene (e.g., an Ullmann
coupling, which normally requires stoichiometric amounts of
copper), or (2) from contamination with
4-bromo-3-fluorobenzeneboronic acid in the 3-fluorophenylboronic
acid starting material (Scheme 8).
##STR00039##
[0541] When 1-bromo-2-fluoro-4-iodobenzene was treated with
PdCl.sub.2(PPh.sub.3).sub.2 and NaHCO.sub.3 at reflux in 1-PrOH and
water but in the absence of 3-fluorophenylboronic acid (the Suzuki
coupling partner for making E-3a), IMP-3 was formed with high
conversion, but the product was not isolated to confirm isolated
yield (Scheme 9).
##STR00040##
[0542] Qualitatively, the Ullmann coupling that generates IMP-3 was
observed to proceed more slowly than the corresponding Suzuki
coupling used to make E-3a. It is believed that the lower catalyst
used for the Suzuki coupling (from 5 mol % for the early
development batches to 0.3 mol % for the current synthesis)
combined with the different reaction rates for the Suzuki and
Ullmann couplings in this synthetic operation are significant
contributors to the low levels of IMP-3, and subsequently IMP-4,
observed in recent lots.
[0543] IMP-4 was tested for FAAH inhibitory activity. Using the
FAAH assay as described below the K.sub.i for IMP-4 was measured to
be as follows: K.sub.i (human): 14.1 nm; K.sub.i (rat): 5.1 nM.
[0544] Human FAAH Expression and Isolation. A human FAAH (hFAAH)
cDNA clone was purchased from Origen (Catalog #TC119221, Accession
#NM_001441.1). The clone was in an ORIGENE.RTM. pCMV6-XL5 with an
insert size of .about.2.2 kb. Sequencing of the clone indicated a
conservative mutation of K48R. This point mutation is possibly an
allelic difference, and is far from the active site and unlikely to
effect the activity. This plasmid was amplified in E. coli and
isolated by precipitation.
[0545] Transfection and purification of hFAAH was modified from
published procedures (see Patricelli et al., Biochemistry (1998)
37:15177-15187; Maurelli et al., FEBS Letters (1995) 377:82-86;
Hillard et al., Biochim Biophy Acta. (1995) 1257(3):249-256; and
Giang et al., Proc. Natl. Acad. Aci. USA (1997) 94:2238-2242) and
was adapted to 293 suspension cells (Invitrogen, cat #R790-07) for
scale-up. Briefly, 60 mL of 293 cells were cultured to a density of
1.times.10.sup.6 cells/mL in FreeStyle 293 expression media
(Invitrogen, Gibco Catalogue #12338026) [no penicillin/streptomycin
or fetal bovine serum (FBS)] at 37.degree. C. with 8% CO.sub.2. The
transfection DNA was prepared by premixing 75 .mu.g of hFAAH 1.2 mL
OptiPro SFM (serum free medium) to 75 .mu.L of FreeStyle Max
transfection reagent in 1.2 mL OptiPro SFM. The final 2.4 mL
OptiPro mixture, with 75 .mu.g of hFAAH cDNA, and 75 .mu.L of
FreeStyle Max transfection reagent was incubated for 20 minutes,
and then added slowly with mixing to 60 mL of 293 cell culture. The
293 cells were cultured for 2.5 days post-transfection, harvested
via centrifugation at 5000.times.g, and the resultant cell pellet
snap frozen with liquid nitrogen and stored at -80.degree. C.
[0546] Frozen cell pellets were thawed on ice and resuspended in:
12.5 mM HEPES (pH 8.0), 100 mM NaCl, and 1 mM EDTA at a ratio of 25
mL per gram of cells. All subsequent steps were performed on ice.
The cell suspension was homogenized with a dounce homogenizer for
30 strokes and sonicated to generate cell lysate. The resultant
cell lysate was centrifuged at 1000.times.g to pellet cell debris.
The supernatant was removed and centrifuged at 13,000.times.g to
generate a microsomal membrane pellet. The supernatant was
discarded and the microsomal pellet resuspended in 20 mM HEPES (pH
7.8), 10% vol/vol glycerol, 1 mM EDTA and 1% TRITON.RTM. X-100, for
1 hour to solubilize the membrane bound hFAAH. The enriched hFAAH
preparation was clarified by a further centrifugation step at
13,000.times.g to pellet any membrane components. The supernatant
contained solubilized enriched hFAAH. Total protein concentrations
were determined using a Bio-Rad Protein Assay (Protein Assay Dye
Reagent Concentrate, cat #500-0006) ref. 5. The samples were
aliquotted and snap frozen with liquid nitrogen for storage until
later use.
[0547] Rat FAAH Expression and purification. An N-terminal
transmembrane domain deleted rat FAAH (rFAAH) was cloned as
described in Patricelli et al., Biochemistry (1998) 37:15177-15187,
encoding for amino acids 32-579 and an N-terminal His-tag, herein
referred to as rFAAH. E. coli BL21 (DE3) were transformed according
to manufacturer protocols (Invitrogen) and rFAAH was expressed and
purified from a modified procedure described in Patricelli et al.,
1998.
[0548] Briefly, 8 L of cells were cultured to an OD.sub.600nm of
0.6 at 37.degree. C., and FAAH expression induced by 1 mM IPTG,
followed by 4 hours of growth. Cells were pelleted by
centrifugation at 5000.times.g to generate the cell paste. The cell
paste was resuspended at a ratio of 32 g per 65 mL of lysis buffer
[50 mM Tris pH 8.0, 200 mM NaCl and 1%
n-octoyl-.beta.D-glucopyranoside (LDAO)] plus 10 mM imidazole.
Lysozyme was added to a final concentration of 1 mg/mL and the
sample incubated in ice for 30 minutes. Cell lysate was generated
by sonication followed by centrifugation at 17,000.times.g to
pellet cell debris.
[0549] Soluble rFAAH was purified from the supernatant using nickel
(Ni), heparin and size exclusion chromatography (SEC) columns.
First, the supernatant was added to 10 mL of Ni resin that had been
pre-equilibrated with lysis buffer. The supernatant was incubated
with the resin for 30 minutes with constant stirring. The resin was
poured into a 20 mL column, and non-specifically bound proteins
were removed by washing with lysis buffer plus 20 mM imidazole.
rFAAH was eluted in a batch mode with lysis buffer plus 500 mM
imidazole. Peak fractions were pooled and loaded onto a 20 mL
heparin column that had been pre-equilibrated in heparin buffer [20
mM HEPES (pH 7.5), 1 mM EDTA, 10% glycerol, and 0.015% LDAO]. The
heparin column was washed to baseline with the heparin buffer plus
150 mM NaCl, and rFAAH (32-579aa) was eluted by running a linear
gradient to from 150 mM NaCl to 1M NaCl in heparin buffer. Pooled
rFAAH (32-579aa) samples were dialyzed against SEC buffer (20 mM
EDTA, 1 mM EDTA, 150 mM NaCl, 0.015% LDAO, 1 mM DTT). Following
dialysis, rFAAH was concentrated to 10 mg/mL via an amicon
ultrafiltration unit with a 30 kDa molecular weight cut off. The
concentrated samples were loaded onto a SUPERDEX.RTM. 200 16/60 SEC
column (GE catalogue #17-1069-01), pre-equilibrated with SEC
buffer. The column was run isocratically in SEC buffer, with rFAAH
eluting as a 600 kDa oligomer. Eluted samples were pooled,
concentrated to .about.5 mg/mL and final rFAAH concentrations
determined by measuring the absorbance at 280 nm, using an
extinction coefficient of .epsilon.=60850 M.sup.-1 cm.sup.-1. The
pooled fractions containing rFAAH were aliquotted and snap frozen
with liquid nitrogen for storage until later use.
[0550] K.sub.i determination. The K.sub.i of a test compound was
determined for rat and human FAAH by measuring the dose dependent
inhibition of AMC-Arachidonoyl amide hydrolysis as an end point
read. Assays were carried out in Corning COSTAR.RTM. 384 well flat
black bottom microtiter plates (Catalog #3654) and monitored in an
Envision 2100 multilabel plate reader (Perkin Elmer-Wallac), with a
355 nm (40 nm band pass) excitation filter and 460 nm (25 nm
bandpass) emission filter. The test compound was serially diluted
three-fold in DMSO, from which 1 .mu.L was added to 24 .mu.L of a
2.times. stock solution of rat or human FAAH, and the resulting
enzyme inhibitor mixture incubated for 30 minutes at room
temperature. An enzymatic reaction was initiated by the addition of
25 .mu.L of AMC-arachidonoyl amide, yielding final rFAAH, hFAAH,
and substrate concentrations of 6 nM, 108 .mu.g/mL and 20 .mu.M,
respectively. The final DMSO concentration was 2% and the
concentration of the test compound varied three-fold from 12.5
.mu.M to 0.21 nM. The final reaction mixture was incubated for 4
hours at room temperature after substrate addition, and then
terminated by the addition of 25 .mu.L of the FAAH inhibitor
CAY10435 (Cayman Chemical Company, catalog #10005102) to achieve a
final concentration of 4 .mu.M. The assay plates were centrifuged
and then read on the Envision plate reader. The dose dependent
decrease in fluorescence intensity with respect to test compound
concentration was fitted to Equation 1 to yield the K.sub.i where:
F.sub.i is the experimentally determined fluorescence intensity at
a given test compound concentration; F.sub.max represents the
theoretical maximum fluorescence intensity in the absence of the
test compound and at saturating substrate concentration determined
from the non-linear regression analysis; and B is the baseline
fluorescence of 100% inhibition. The substrate concentration (S)
was constrained to 20 .mu.M and the K.sub.m constrained an
experimentally determined value of to 9 .mu.M for both the rat and
human FAAH. The inhibition constant K.sub.i was floated and
determined via the non-linear regression fit.
F i = F max * S S + Km ( 1 + [ IPI - 940 ] K i ) + B ( 1 )
##EQU00001##
Example 4
Characterization and Properties of Solid Forms
A. General
XRPD
[0551] Unless indicated otherwise, the X-Ray Powder Diffraction
patterns provided in the figures and in the examples were performed
based on one of the following procedures.
1: Inel XRG-3000 Diffractometer
[0552] XRPD patterns were collected with an Inel XRG-3000
diffractometer. An incident beam of Cu K.alpha. radiation was
produced using a fine-focus tube and a parabolically graded
multilayer mirror. Prior to the analysis, a silicon standard (NIST
SRM 640c) was analyzed to verify the Si 111 peak position. A
specimen of the sample was packed into a thin-walled glass
capillary, and a beam-stop was used to minimize the background from
air. Diffraction patterns were collected in transmission geometry
using Windif v. 6.6 software and a curved position-sensitive
Equinox detector with a 2.theta. range of 120.degree..
2: PANalytical.RTM. Expert Pro MPD Diffractometer
[0553] XRPD patterns were collected with a PANALYTICAL.RTM. X'Pert
PRO MPD diffractometer using an incident beam of Cu radiation
produced using an Optix long, fine-focus source. An elliptically
graded multilayer mirror was used to focus Cu K.alpha. X-rays
through the specimen and onto the detector. Prior to the analysis,
a silicon specimen (NIST SRM 640c) was analyzed to verify the Si
111 peak position. A specimen of the sample was sandwiched between
3 .mu.m-thick films and analyzed in transmission geometry. A
beam-stop and short antiscatter extension were used to minimize the
background generated by air. Soller slits for the incident and
diffracted beams were used to minimize broadening from axial
divergence. Diffraction patterns were collected using a scanning
position-sensitive detector (X'CELERATOR.RTM.) located 240 mm from
the specimen and Data Collector software v. 2.2b.
[0554] For samples with limited material, the XRPD pattern was
collected with a PANALYTICAL.RTM. X'Pert PRO MPD diffractometer
using an incident beam of Cu K.alpha. radiation produced using a
long, fine-focus source and a nickel filter. The diffractometer was
configured using the symmetric Bragg-Brentano. Prior to the
analysis, a silicon specimen (NIST SRM 640c) was analyzed to verify
the Si 111 peak position. A specimen of the sample was prepared as
a thin, circular layer centered on a silicon zero-background
substrate. Antiscatter slits (SS) were used to minimize the
background generated by air. Soller slits for the incident and
diffracted beams were used to minimize broadening from axial
divergence. Diffraction patterns were collected using a scanning
position-sensitive detector (X'CELERATOR) located 240 mm from the
sample and Data Collector software v. 2.2b.
3: PANALYTICAL Expert Pro MPD Diffractometer (Variable
Temperature/Humidity Analysis)
[0555] The XRPD pattern was collected with a PANALYTICAL.RTM.
X'Pert PRO MPD diffractometer using an incident beam of Cu K.alpha.
radiation produced using a long, fine-focus source and a nickel
filter. The diffractometer was configured using the symmetric
Bragg-Brentano. Data were collected and analyzed using Prior to the
analysis, a silicon specimen (NIST SRM 640c) was analyzed to verify
the Si 111 peak position. A specimen of the sample was packing into
a nickel-coated copper well. Antiscatter slits (SS) were used to
minimize the background generated by air. Soller slits for the
incident and diffracted beams were used to minimize broadening from
axial divergence. Diffraction patterns were collected using a
scanning position-sensitive detector (X'CELERATOR.RTM.) located 240
mm from the sample and Data Collector software v. 2.2b. An Anton
Paar temperature-humidity chamber (THC) was used to collect in-situ
XRPD patterns as a function of humidity and temperature. The
specimen was heated with a Peltier thermoelectric device located
directly under the specimen holder, and the temperature was
monitored with a platinum 100 resistance sensor located directly
under the specimen. Power to the heater was supplied and controlled
by an Anton Paar TCU 50 interfaced with Data Collector. The
humidity was generated with an RH-200 manufactured by VTI Inc. and
carried by a flow of nitrogen gas. The humidity and temperature was
monitored by a HYGROCLIP.RTM. sensor manufactured by Rotronic
located next to the specimen inside the THC.
Differential Scanning Calorimetry (DSC)
[0556] Unless indicated otherwise, the DSC patterns provided in the
figures and in the examples were performed based on the following
procedure.
[0557] DSC was performed using a TA Instruments Q2000 differential
scanning calorimeter. Temperature calibration was performed using
NIST traceable indium metal. The sample was placed into an aluminum
DSC pan, covered with a lid, and the weight was accurately
recorded. A weighed aluminum pan configured as the sample pan was
placed on the reference side of the cell.
Solution 1D .sup.1H NMR Spectroscopy
[0558] Unless indicated otherwise, the solution NMR spectra
provided in the figures and in the examples were acquired based on
the following procedure. Samples were prepared by dissolving
approximately 4-10 mg of sample in CDCl.sub.3 containing TMS.
Spectra were then obtained with a Varian .sup.UNITYINOVA-400
spectrometer.
Thermogravimetry (TGA)
[0559] Unless indicated otherwise, the TGA thermograms provided in
the figures and in the examples were acquired based on the
following procedure. TG analyses were performed using a TA
Instruments Q5000 IR thermogravimetric analyzer. Temperature
calibration was performed using nickel and ALUMEL.RTM.. Each sample
was placed in an aluminum pan. The sample was hermetically sealed,
the lid pierced, then inserted into the TG furnace. The furnace was
heated under nitrogen.
B. Polymorph Screen of Compound 1
[0560] Compound 1 was subjected various crystallization conditions.
The following procedures were utilized.
Crash Precipitation
[0561] Solutions of Compound 1 were prepared in various solvents
and filtered through a 0.2-.mu.m nylon filter. Aliquots of various
antisolvents were dispensed with stirring until precipitation
occurred. Solids were collected by vacuum filtration or by
decanting the liquid phase and allowing the solids to dry at
ambient conditions or under nitrogen gas.
Fast Evaporation
[0562] Solutions of Compound 1 were prepared in various solvents in
which samples were sonicated with solvent addition. Once a mixture
reached complete dissolution, as judged by visual observation, the
solution was filtered through a 0.2-.mu.m nylon filter. The
solution was allowed to evaporate from an open vial at ambient
conditions. Solutions were allowed to evaporate to dryness unless
designated as partial evaporations (solid present with a small
amount of solvent remaining), in which case solids were isolated by
vacuum filtration or by decanting the liquid phase and allowing the
solids to dry at ambient conditions or under nitrogen gas.
Slow Cool
[0563] Saturated solutions of Compound 1 were prepared in various
solvents at an elevated temperature and filtered warm through a
0.2-.mu.m nylon filter into a warm vial. The vial was capped and
left on the hot plate, and the hot plate was turned off to allow
the sample to slowly cool to ambient temperature. If little or no
solids were present after cooling to ambient temperature, the
sample was placed in the refrigerator (approximately 2 to 8.degree.
C.) for further cooling. Solids were collected by vacuum filtration
or by decanting the liquid phase and allowing the solids to dry at
ambient conditions or under nitrogen gas.
Slow Evaporation
[0564] Solutions of Compound 1. Once a mixture reached complete
dissolution, as judged by visual observation, the solution was
filtered through a 0.2-.mu.m nylon filter. The solution was allowed
to evaporate at ambient conditions from a vial covered with
aluminum foil perforated with pinholes (or a loosely capped vial in
some cases). Solutions were allowed to evaporate to dryness unless
designated as partial slow evaporations (solid present with a small
amount of solvent remaining), in which case solids were isolated by
vacuum filtration or by decanting the liquid phase and allowing the
solids to dry at ambient conditions or under nitrogen gas.
Slurry
[0565] Solutions of Compound 1 were prepared by adding enough
solids to a given solvent at ambient conditions so that undissolved
solids were present. The mixture was then loaded onto an orbit
shaker in a sealed vial at ambient temperature for an extended
period of time, typically approximately 1 week. The solids were
isolated by vacuum filtration or by decanting the liquid phase and
allowing the solids to dry at ambient conditions or under nitrogen
gas.
Vapor Diffusion
[0566] Concentrated solutions of Compound 1 were prepared in
various solvents and filtered through a 0.2-.mu.m nylon filter. The
filtered solution was dispensed into a 1-dram vial, which was then
placed inside a 20-mL vial containing antisolvent. The 1-dram vial
was left uncapped and the 20-mL vial was capped to allow vapor
diffusion to occur. The solids were isolated by vacuum filtration
or by decanting the liquid phase and allowing the solids to dry at
ambient conditions or under nitrogen gas.
TABLE-US-00010 Solvent/Solvent System Conditions Habit/Description
XRPD Result Example acetone SE white, agglomerated Form A 1 plates,
birefringent; possible single crystals (PS) CP white solid in clear
Form A 2 w/heptane solution; white, tiny plates and morphology
unknown, birefringent (PS) ACN SE white, agglomerated and Form A 3
irregular plates, birefringent (PS) SC, ~51.degree. C. solids
present, clear Form A + 4 to RT, stand solution; white, irregular
minor at RT 1 day and rectangular plates, material B morphology
unknown, and aggregates, birefringent (PS) VD w/water, white,
agglomerated Form A 5 8 days plates and few needles, birefringent
(PS) chloroform SE white, aggregates of plates Form A1 6 and
irregular particles, birefringent (PS) SC, ~51.degree. C. small
amount solids on -- to RT, stand walls and in suspension at RT 1
day refrigerator, white solid on bottom and Form A 7 11 days in
suspension; morphology unknown and plates, birefringent (PS) VD
white, agglomerated Form A 8 w/heptane, plates, birefringent (PS)
13 days DCM SE white, rectangular plates Form A1 9 and morphology
unknown, birefringent (PS) CP white precipitate in clear Form A1 10
w/heptane solution; white, tiny needles and aggregates,
birefringent (PS) diethyl ether SE white, rectangular plates Form A
11 and aggregates, birefringent (PS) DMF FE white, agglomerates and
Form A 12 morphology unknown, birefringent p-dioxane SE white,
aggregates of Form A 13 plates, needles, and morphology unknown,
birefringent (PS) EtOAc SE white, small, irregular Form A 14
particles and rectangular plates, birefringent (PS) CP white solid
in clear Form A 15 w/heptane solution; white, tiny rectangular
plates and morphology unknown, birefringent (PS) heptane slurry,
RT, clear solution, white solid; Form A 16 14 days tiny plates and
specks, birefringent heptane:chloroform SE white, rectangular
plates, Form A 17 2:1 needles, and morphology unknown, birefringent
(PS) heptane:THF SE white, needles, rectangular Form A 18 2:1
plates, and agglomerates, birefringent (PS) IPE SE white,
agglomerated, Form A 19 irregular plates, tiny particles, and
rectangular plates, birefringent (PS) slurry, RT, clear solution,
white solid; Form A1 20 14 days specks and morphology unknown,
birefringent SC, ~51.degree. C. solids present, clear Form A 21 to
RT, stand solution; white, at RT 1 day aggregates of rectangular
plates and morphology unknown, birefringent (PS) CP white solid in
hazy Form A 22 w/heptane solution; white, morphology unknown, few
tiny needles and plates, birefringent (PS) MEK SE white, aggregates
of Form A 23 irregular plates and morphology unknown, birefringent
(PS) CP white solid in clear Form A 24 w/heptane solution; white,
aggregates, morphology unknown, and few tiny plates, birefringent
(PS) 2-Me THF SE white, aggregates, Form A 25 morphology unknown,
birefringent MIBK SE white, irregular and Form A1 26 rectangular
plates, morphology unknown, and dendridic formations, birefringent
(PS) MTBE SE white, tiny particles, Form A 27 irregular and
rectangular plates, birefringent (PS) CP white solid in clear Form
A + 28 w/heptane solution; white, minor aggregates, morphology
material B unknown, and few tiny plates, birefringent (PS)
nitromethane SE white, agglomerated Form A 29 plates, birefringent
(PS) slurry, RT, clear solution, white solid; Form A 30 14 days
aggregates and morphology unknown, birefringent SC, ~51.degree. C.
clear solution, very small -- 31 to RT, stand amount solids in at
RT 1 day suspension refrigerator, white solid on bottom and Form A
11 days in suspension; square plates and agglomerates, birefringent
(PS) THF SE white, aggregates of fine material B 32 needles and
morphology unknown, birefringent VD white, needles, specks,
material B 33 w/heptane, and aggregates, 1 day birefringent (PS) VD
w/water, white, aggregates of Form A; no 34 1 day irregular plates
and peak at dendridic formations, ~24.degree. 2.theta.,
birefringent (PS) possible PO toluene FE white, needles and Form A
35 rectangular plates, birefringent (PS) slurry, RT, clear
solution, white solid; Form A 36 14 days aggregates and morphology
unknown, birefringent SC, ~51.degree. C. solids present, clear Form
A 37 to RT, stand solution; white, at RT 1 day spherulites of thick
needles, birefringent (PS) water slurry, RT, clear solution, white
solid; Form A 38 14 days aggregates, plates, and morphology
unknown, birefringent (PS) acetone:water partial SE white,
rectangular plates Form A 39 50:50 and aggregates, birefringent
(PS) slurry, RT, clear solution, white solid; Form A 40 14 days
aggregates and morphology unknown, birefringent SC, ~51.degree. C.
solids present, clear Form A 41 to RT, stand solution; white, at RT
1 day rectangular plates and agglomerates, birefringent (PS)
ACN:water partial SE white, rectangular plates Form A 42 50:50
andmorphology unknown, birefringent (PS) slurry, RT, clear
solution, white solid; Form A 43 14 days aggregates and morphology
unknown, birefringent SC, ~51.degree. C. solids present, clear to
RT, stand solution; white, Form A 44 at RT 1 day rectangular plates
and agglomerates, birefringent (PS) DMF:water FE white, irregular
plates and Form A 45 50:50 aggregates, birefringent (PS) slurry,
RT, clear solution, white solid; Form A 46 14 days morphology
unknown and a few plates, birefringent (PS) SC, ~51.degree. C.
solids present, clear Form A 47 to RT, stand solution; white,
irregular at RT 1 day plates, agglomerates, and morphology unknown,
birefringent (PS) p-dioxane:water SE white, rectangular and Form A
48 50:50 irregular plates, birefringent (PS) SC, ~51.degree. C.
clear solution -- 49 to RT, stand at RT 1 day refrigerator, clear
solution, white solid; Form A 11 days aggregates of plates,
birefringent (PS) THF:water SE white, spherulites of thick material
B + 50 50:50 needles and aggregates, material C birefringent (PS)
add solvent oily solids -- 51 slurry, RT, cloudy solution, oily --
14 days droplets present add solvent solids dissolve, then -- 52 at
~51.degree. C. immediately ppt as oil add solvent clear solution --
stir few hazy solution -- mins. hot filter hazy solution -- soln.
SC, ~51.degree. C. clear solution -- to RT, stand at RT 1 day
refrigerator, clear solution -- 11 days freezer, 1 frozen solid --
day equilibrate to clear solution -- RT partial FE white, dendridic
needles, material B + specks, and aggregates, material C
birefringent material B + material C.sup.a
Abbreviations
TABLE-US-00011 [0567] Type Abbreviations/Acronyms Full
Name/Description Solvent ACN acetonitrile DCM dichloromethane DMF
dimethylformamide EtOAc ethyl acetate IPE isopropyl ether MEK
methyl ethyl ketone 2-Me THF 2-methyltetrahydrofuran MIBK methyl
iso-butyl ketone MTBE tert-butyl methyl ether THF tetrahydrofuran
Methods CP crash precipitation FE fast evaporation SC slow cool SE
slow evaporation VD vapor diffusion Techniques DSC differential
scanning calorimetry .sup.1H NMR proton nuclear magnetic resonance
spectroscopy KF Karl Fischer SC XRD single crystal x-ray
diffraction TG or TGA thermogravimetric analysis VT/VRH variable
temperature/variable relative humidity XRPD x-ray powder
diffraction Other N.sub.2 nitrogen gas PO preferred orientation PS
possible single crystals RH relative humidity RT room (ambient)
temperature Solvent ACN acetonitrile DCM dichloromethane DMF
dimethylformamide EtOAc ethyl acetate IPE isopropyl ether MEK
methyl ethyl ketone 2-Me THF 2-methyltetrahydrofuran MIBK methyl
iso-butyl ketone MTBE tert-butyl methyl ether THF tetrahydrofuran
Methods CP crash precipitation FE fast evaporation SC slow cool SE
slow evaporation VD vapor diffusion Techniques DSC differential
scanning calorimetry .sup.1H NMR proton nuclear magnetic resonance
spectroscopy KF Karl Fischer SC XRD single crystal x-ray
diffraction TG or TGA thermogravimetric analysis VT/VRH variable
temperature/variable relative humidity XRPD x-ray powder
diffraction Other N.sub.2 nitrogen gas PO preferred orientation PS
possible single crystals RH relative humidity RT room (ambient)
temperature
C. Stressing Experiments, Form A, Compound 1
[0568] Form A crystal form of Compound 1 was subjected to (1)
mechanical stressing experiments and (2) relative humidity
stressing experiments, where the material was subjected to
different levels of relative humidity (R.H.) and temperature. Form
A was found to be stable to humidity stressing at 75% and 97% R.H.
at room temperature for 7 days, and 75% R.H. at about 40.degree. C.
for 7 days. The results are summarized in the tables below.
Mechanical Stressing
TABLE-US-00012 [0569] Solvent/Solvent System Conditions
Habit/Description XRPD Result -- mill, 30 Hz, white, tiny particles
and Form A, low 20 min. aggregates, partially crystallinity
birefringent ACN mill, 30 Hz, white, tiny particles and Form A 20
min. aggregates, partially birefringent MEK mill, 30 Hz, white,
tiny particles and Form A 20 min. aggregates, partially
birefringent THF mill, 30 Hz, white, tiny particles and Form A 20
min. aggregates, partially birefringent -- compress, white, tiny
particles and Form A, low 10,000 lb, aggregates, birefringent
crystallinity 5 min.
Relative Humidity Stressing
TABLE-US-00013 [0570] XRPD Conditions Time Observations Result
Example 75% RH, RT 1 day free-flowing white -- A powder 3 days
free-flowing white -- powder 7 days free-flowing white Form powder;
tiny, A irregular particles, birefringent 75% RH, 40.degree. C. 1
day free-flowing white -- B powder 4 days free-flowing white --
powder 7 days free-flowing white Form powder; tiny, A irregular
particles and aggregates, birefringent 97% RH, RT 1 day
free-flowing white -- C powder 3 days free-flowing white -- powder
7 days free-flowing white Form powder; tiny, A irregular particles,
birefringent
D. Single Crystal Structure Determination, Form A, Compound 1
[0571] Single crystal analysis was performed on Form A of Compound
1. The structure was determined by single crystal X-ray
diffraction. In sum, the single crystal structure was determined to
confirm the molecular structure. The structure was determined to be
an anhydrous crystal form. The crystal structure was comprised of a
single molecule in the asymmetric unit. All peaks in the
experimental patterns are represented in the calculated XRPD
pattern, indicating the bulk material is likely a single phase.
Experimental
Preparation of Sample
[0572] Compound 1 was dissolved in a 50:50 mixture of acetone and
water with stirring at 51.degree. C. The solution was then hot
filtered into a warm vial, capped, and left on the hot plate, which
was then turned off to allow the solution to slowly cool to ambient
temperature. After standing at ambient temperature 1 day, crystals
were harvested.
Data Collection
[0573] A colorless plate of C.sub.12H.sub.9BF.sub.2O.sub.2 having
approximate dimensions of 0.20.times.0.20.times.0.04 mm, was
mounted on a fiber in random orientation. Preliminary examination
and data collection were performed with Cu K.sub..alpha. radiation
(.lamda.=1.54184 .ANG.) on a Rigaku Rapid II diffractometer
equipped with confocal optics. Refinements were performed on an
LINUX PC using SHELX97. G. M. Sheldrick, Acta Cryst., 2008, A64,
112.
[0574] Cell constants and an orientation matrix for data collection
were obtained from least-squares refinement using the setting
angles of 11613 reflections in the range
7.degree.<.theta.<66.degree.. The refined mosaicity from
CrystalClear is 0.72.degree. indicating moderate crystal quality.
CrystalClear: An Integrated Program for the Collection and
Processing of Area Detector Data, Rigaku Corporation,
.COPYRGT.1997-2002. The space group was determined by the program
XPREP. Bruker, XPREP in SHELXTL v. 6.12., Bruker AXS Inc., Madison,
Wis., USA, 2002. From the systematic presence of the following
conditions: h01=2n; 0k0 k=2n, and from subsequent least-squares
refinement, the space group was determined to be P2.sub.1/c (no.
14). The data were collected to a max 2.theta. value of
133.18.degree., at a temp of 150.+-.1 K.
Data Reduction
[0575] Frames were integrated with CrystalClear. A total of 11613
reflections were collected, of which 1786 were unique. Lorentz and
polarization corrections were applied to the data. The linear
absorption coefficient is 1.041 mm.sup.-1 for Cu K.sub..alpha.
radiation. An empirical absorption correction using CrystalClear
was applied. Transmission coefficients ranged from 0.743 to 0.959.
A secondary extinction correction was applied. G. M. Sheldrick,
Acta Cryst., 2008, A64, 112. The final coefficient, refined in
least-squares, was 0.0063000 (in absolute units). Intensities of
equivalent reflections were averaged. The agreement factor for the
averaging was 3.84% based on intensity.
Structure Solution and Refinement
[0576] The structure was solved by direct methods using SIR2004. M.
C. Burla, R. Caliandro, M. Camalli, B. Carrozzini, G. L. Cascarano,
L. De Caro, C. Giacovazzo, G. Polidori, and R. Spagna, J. Appl.
Cryst. 2005, 38, 381. The remaining atoms were located in
succeeding difference Fourier syntheses. Hydrogen atoms were
included in the refinement but restrained to ride on the atom to
which they are bonded. The structure was refined in full-matrix
least-squares by minimizing the function:
.SIGMA.w(|F.sub.o|.sup.2-|F.sub.c|.sup.2).sup.2
[0577] The weight w is defined as
1/[.sigma..sup.2(F.sub.o.sup.2)+(0.0702P).sup.2+(0.0000P)], where
P=(F.sub.o.sup.2+2F.sub.c.sup.2)/3.
[0578] Scattering factors were taken from the "International Tables
for Crystallography," International Tables for Crystallography,
Vol. C, Kluwer Academic Publishers: Dordrecht, The Netherlands,
1992, Tables 4.2.6.8 and 6.1.1.4. Of the 1786 reflections used in
the refinements, only the reflections with
F.sub.o.sup.2>2.sigma.(F.sub.o.sup.2) were used in calculating
R. A total of 1378 reflections were used in the calculation. The
final cycle of refinement included 163 variable parameters and
converged (largest parameter shift was <0.01 times its estimated
standard deviation) with unweighted and weighted agreement factors
of:
R=.SIGMA.|F.sub.o-F.sub.c|/.SIGMA.F.sub.o=0.042
R.sub.w= {square root over
((.SIGMA.w(F.sub.o.sup.2-F.sub.c.sup.2).sup.2/.SIGMA.w(F.sub.o.sup.2).sup-
.2))}=0.109
[0579] The standard deviation of an observation of unit weight
(goodness of fit) was 1.123. The highest peak in the final
difference Fourier had a height of 0.23 e/.ANG..sup.3. The minimum
negative peak had a height of -0.27 e/.ANG..sup.3.
Calculated X-ray Powder Diffraction (XRPD) Pattern
[0580] A calculated XRPD pattern was generated for Cu radiation
using PowderCell 2.3 and the atomic coordinates, space group, and
unit cell parameters from the single crystal data. PowderCell for
Windows Version 2.3 W. Kraus; G. Nolze, Federal Institute for
Materials Research and Testing, Berlin Germany, EU, 1999. Since the
single crystal data are collected at low temperatures (150 K) some
shifting between the calculated and experimental powder diffraction
pattern is expected.
ORTEP and Packing Diagrams
[0581] The ORTEP diagram was prepared using ORTEP III (C. K.
Johnson, ORTEPIII, Report ORNL-6895, Oak Ridge National Laboratory,
Tenn., U.S.A. 1996, OPTEP-3 for Windows V1.05, L. J. Farrugia, J.
Appl. Cryst. 1997, 30, 565) program within the PLATON (A.L. Spek,
PLATON, Molecular Graphics Program. Utrecht University, Utrecht,
The Netherlands, 2008; A.L. Spek, J. Appl. Cryst. 2003, 36, 7)
software package. Atoms are represented by 50% probability
anisotropic thermal ellipsoids. Packing diagrams were prepared
using CAMERON 9 modeling software. Additional figures were
generated with the PLATON software package, and with the Mercury
2.3 (C. F. Macrae, P. R. Edgington, P. McCabe, E. Pidcock, G. P.
Shields, R. Taylor, M. Towler and J. van de Streek, J. Appl.
Cryst., 2006, 39, 453-457) visualization package. Hydrogen bonding
is represented as dashed lines.
X-Ray Powder Diffraction (XRPD)
[0582] X-ray powder diffraction (XRPD) analyses were performed
using an Inel XRG-3000 diffractometer equipped with a CPS (Curved
Position Sensitive) detector with a 2.theta. range of 120.degree..
Real time data were collected using Cu-K.alpha. radiation starting
at approximately 4.degree.2.theta. at a resolution of 0.03
.degree.2.theta.. The tube voltage and amperage were set to 40 kV
and 30 mA, respectively. The monochromator slit was set at 5 mm by
160 .mu.m. The pattern is displayed from 2.5-40.degree.2.theta..
Samples were prepared for analysis by packing them into thin-walled
glass capillaries. Each capillary was mounted onto a goniometer
head that is motorized to permit spinning of the capillary during
data acquisition. The samples were analyzed for 300 seconds.
Instrument calibration was performed using a silicon reference
standard. The experimental XRPD pattern was collected at SSCI, a
division of Aptuit, according to cGMP specifications.
Results
[0583] The monoclinic cell parameters and calculated volume are:
a=5.44850(10) .ANG., b=5.16460(10) .ANG., c=36.124(3) .ANG.,
.alpha.=90.00.degree., .beta.=90.490(6).degree.,
.gamma.=90.00.degree., V=1016.48(8) .ANG..sup.3. The molecular
weight of the asymmetric unit in the crystal structure of Compound
1 is 234.01 g mol.sup.-1 with Z=4, resulting in a calculated
density of 1.529 g cm.sup.-3. The space group was determined to be
P2.sub.1/c. A summary of the crystal data and crystallographic data
collection parameters are provided in the Table below.
TABLE-US-00014 Crystal Data and Data Collection Parameters formula
C.sub.12H.sub.9BF.sub.2O.sub.2 formula weight 234.01 space group
P2.sub.1/c (No. 14) a, .ANG. 5.44850(10) b, .ANG. 5.16460(10) c,
.ANG. 36.124(3) .beta., deg 90.490(6) V, .ANG..sup.3 1016.48(8) Z 4
d.sub.calc, g cm.sup.-3 1.529 crystal dimensions, mm 0.20 .times.
0.20 .times. 0.04 temperature, K 150. radiation (wavelength, .ANG.)
Cu K.sub..alpha. (1.54184) monochromator Confocal Optics linear abs
coef, mm.sup.-1 1.041 absorption correction applied empirical.sup.a
transmission factors: min, max 0.743, 0.959 diffractometer Rigaku
Rapid II h, k, l range -6 to 6 -5 to 6 -42 to 42 2.theta. range,
deg 14.71-133.18 mosaicity, deg 0.72 programs used SHELXTL
F.sub.000 480.0 weighting 1/[.sigma..sup.2(F.sub.o.sup.2) +
(0.0702P).sup.2 + 0.0000P] where P = (F.sub.o.sup.2 +
2F.sub.c.sup.2)/3 data collected 11613 unique data 1786 R.sub.int
0.038 data used in refinement 1786 cutoff used in R-factor
calculations F.sub.o.sup.2 > 2.0.sigma.(F.sub.o.sup.2) data with
I > 2.0.sigma.(I) 1378 refined extinction coef 0.0063 number of
variables 163 largest shift/esd in final cycle 0.00 R(F.sub.o)
0.042 R.sub.w(F.sub.o.sup.2) 0.109 goodness of fit 1.123
.sup.aCrystalClear: An Integrated Program for the Collection and
Processing of Area Detector Data, Rigaku Corporation, .COPYRGT.
1997-2002.
[0584] The quality of the structure is indicated by the R-value of
0.042 (4.2%).
[0585] An ORTEP drawing is shown in FIG. 20. One of the phenyl
groups is rotated 180 degrees from the as-drawn molecule. The
asymmetric unit shown in FIG. 20 contains a single Compound 1
molecule.
[0586] Packing diagrams viewed along the a, b, and c
crystallographic axes are shown in FIGS. 24-26, respectively.
Hydrogen bonding between adjacent boronic acid groups creates
infinite one dimensional chains that run along the b axis, shown in
FIG. 21. Without being limited to any theory, this is a commonly
observed hydrogen bonding configuration between Ph--B--(OH).sub.2
groups. The chains run parallel to each other in approximately the
(106) plane.
[0587] FIG. 22 shows a calculated XRPD pattern of Compound 1,
generated from the single crystal data. The experimental XRPD
pattern of Compound 1 is shown in FIG. 23. FIG. 27 shows a
comparison of the calculated XRPD pattern to the experimental
pattern of Compound 1. All peaks in the experimental patterns are
represented in the calculated XRPD pattern, supporting a single
phase. Previously obtained unit cell from XRPD indexing of an
experimental XRPD pattern is in agreement with the single crystal
unit cell, which may indicate the same crystal form.
[0588] Differences in intensities between the calculated and
experimental powder diffraction patterns may be due to preferred
orientation. Preferred orientation may, in some embodiments, be
defined as the tendency for crystals, in some cases plates or
needles, to align themselves with some degree of order. This
preferred orientation of the sample can, in some embodiments,
significantly change peak intensities, but not peak positions, in
the experimental powder diffraction pattern. Without being limited
to any theory, there may be some slight shifting in peak location
between the calculated and experimental powder diffraction patterns
because the experimental powder pattern was collected at ambient
temperature, and the single crystal data was collected at 150
K.
[0589] In sum, the single crystal structure was determined to be an
anhydrous crystal form. The crystal structure was comprised of a
single Compound 1 molecule in the asymmetric unit. All peaks in the
experimental patterns are represented in the XRPD pattern,
indicating the material is likely a single phase.
[0590] Tables of positional parameters and their estimated standard
deviations, anisotropic temperature factor coefficients, bond
distances, bond angles, hydrogen bonds and angles and torsion
angles are provided below.
TABLE-US-00015 Positional Parameters and Their Estimated Standard
Deviations Atom x y z U(.ANG. .sup.2) F13 0.30691(18) 0.4093(2)
0.40498(3) 0.0388(3) F23 1.53596(19) -0.3017(2) 0.30765(3)
0.0419(4) O1 0.1584(2) 0.2260(3) 0.47540(3) 0.0287(4) O2 0.2405(2)
-0.2185(2) 0.47756(3) 0.0298(4) C11 0.8284(3) 0.0464(3) 0.37199(4)
0.0220(5) C12 0.6477(3) 0.2352(3) 0.37506(5) 0.0272(5) C13
0.4849(3) 0.2227(3) 0.40405(5) 0.0249(5) C14 0.4841(3) 0.0349(3)
0.43119(4) 0.0229(5) C15 0.6694(3) -0.1498(3) 0.42766(5) 0.0290(5)
C16 0.8380(3) -0.1441(3) 0.39921(5) 0.0281(5) C21 1.0035(3)
0.0486(3) 0.34018(4) 0.0227(5) C22 1.1926(3) -0.1313(3) 0.33823(5)
0.0278(5) C23 1.3503(3) -0.1249(3) 0.30855(5) 0.0272(5) C24
1.3308(3) 0.0493(3) 0.28025(5) 0.0282(5) C25 1.1432(3) 0.2263(4)
0.28196(5) 0.0351(5) C26 0.9808(3) 0.2263(3) 0.31134(5) 0.0317(5)
B1 0.2864(3) 0.0187(4) 0.46252(5) 0.0247(5) H1 0.207(5) 0.370(6)
0.4691(8) 0.087(10)* H2 0.124(4) -0.217(4) 0.4925(7) 0.059(7)* H12
0.637 0.368 0.358 0.033 H15 0.680 -0.282 0.445 0.035 H16 0.960
-0.270 0.398 0.034 H22 1.213 -0.255 0.357 0.033 H24 1.440 0.048
0.261 0.034 H25 1.125 0.348 0.263 0.042 H26 0.854 0.347 0.312 0.038
Starred atoms were refined isotropically U.sub.eq =
(1/3).SIGMA..sub.i.SIGMA..sub.j U.sub.ija*.sub.ia*.sub.ja.sub.i
a.sub.j Hydrogen atoms are included in calculation of structure
factors but not refined
TABLE-US-00016 Anisotropic Temperature Factor Coefficients - U's
Name U(1,1) U(2,2) U(3,3) U(1,2) U(1,3) U(2,3) F13 0.0412(6)
0.0353(7) 0.0402(6) 0.0201(5) 0.0171(5) 0.0096(5) F23 0.0416(7)
0.0471(7) 0.0372(7) 0.0226(5) 0.0161(5) 0.0066(5) O1 0.0317(7)
0.0211(8) 0.0336(7) 0.0016(6) 0.0146(5) 0.0007(5) O2 0.0308(7)
0.0257(8) 0.0331(7) 0.0041(5) 0.0156(6) 0.0027(5) C11 0.0197(8)
0.0217(10) 0.0246(9) -0.0016(7) 0.0027(6) -0.0011(7) C12 0.0308(10)
0.0252(10) 0.0257(9) 0.0036(8) 0.0055(7) 0.0041(7) C13 0.0232(8)
0.0226(10) 0.0289(9) 0.0074(7) 0.0052(7) -0.0018(7) C14 0.0223(8)
0.0218(10) 0.0247(9) -0.0013(7) 0.0028(7) -0.0007(7) C15 0.0271(9)
0.0286(11) 0.0314(10) 0.0048(8) 0.0079(7) 0.0060(8) C16 0.0236(9)
0.0277(11) 0.0330(10) 0.0058(7) 0.0075(7) 0.0045(7) C21 0.0203(8)
0.0224(10) 0.0253(9) -0.0018(7) 0.0029(7) -0.0019(7) C22 0.0318(9)
0.0268(10) 0.0249(9) 0.0051(8) 0.0060(7) 0.0023(7) C23 0.0236(9)
0.0285(10) 0.0295(9) 0.0070(8) 0.0039(7) -0.0026(7) C24 0.0268(9)
0.0309(11) 0.0272(9) -0.0012(8) 0.0093(7) 0.0012(8) C25 0.0342(10)
0.0345(11) 0.0368(11) 0.0035(9) 0.0114(8) 0.0111(8) C26 0.0273(9)
0.0307(11) 0.0373(11) 0.0074(8) 0.0102(8) 0.0072(8) B1 0.0227(9)
0.0239(12) 0.0274(10) 0.0016(8) 0.0026(8) 0.0019(8) The form of the
anisotropic temperature factor is: exp[-27.pi.
h.sup.2a*.sup.2U(1,1) + k.sup.2b*.sup.2U(2,2) +
1.sup.2c*.sup.2U(3,3) + 2hka*b*U(1,2) + 2hla*c*U(1,3) +
2klb*c*U(2,3)] where a*, b*, and c* are reciprocal lattice
constants.
TABLE-US-00017 Table of Bond Distances in Angstroms Atom 1 Atom 2
Distance F13 C13 1.3680(18) F23 C23 1.3634(18) O1 B1 1.362(2) O1 H1
0.82(3) O2 B1 1.364(2) O2 H2 0.84(2) C11 C12 1.391(2) C11 C16
1.392(2) C11 C21 1.500(2) C12 C13 1.380(2) C12 H12 0.930 C13 C14
1.379(2) C14 C15 1.395(2) C14 B1 1.571(2) C15 C16 1.385(2) C15 H15
0.930 C16 H16 0.930 C21 C22 1.389(2) C21 C26 1.393(2) C22 C23
1.380(2) C22 H22 0.930 C23 C24 1.365(2) C24 C25 1.373(2) C24 H24
0.930 C25 C26 1.388(2) C25 H25 0.930 C26 H26 0.930 Numbers in
parentheses are estimated standard deviations in the least
significant digits.
TABLE-US-00018 Table of Bond Angles in Degrees Atom Atom Atom Atom
Atom 1 2 3 Angle Atom 1 2 3 Angle B1 O1 H1 116.7(18) C22 C21 C11
120.71(15) B1 O2 H2 113.0(15) C26 C21 C11 121.65(15) C12 C11 C16
117.50(14) C23 C22 C21 119.36(16) C12 C11 C21 120.74(15) C23 C22
H22 120.30 C16 C11 C21 121.76(15) C21 C22 H22 120.30 C13 C12 C11
119.18(16) F23 C23 C24 118.48(14) C13 C12 H12 120.40 F23 C23 C22
117.99(15) C11 C12 H12 120.40 C24 C23 C22 123.53(16) F13 C13 C14
118.12(14) C23 C24 C25 117.27(15) F13 C13 C12 116.49(15) C23 C24
H24 121.40 C14 C13 C12 125.37(15) C25 C24 H24 121.40 C13 C14 C15
114.13(14) C24 C25 C26 120.96(17) C13 C14 B1 123.78(15) C24 C25 H25
119.50 C15 C14 B1 122.03(15) C26 C25 H25 119.50 C16 C15 C14
122.60(16) C25 C26 C21 121.24(16) C16 C15 H15 118.70 C25 C26 H26
119.40 C14 C15 H15 118.70 C21 C26 H26 119.40 C15 C16 C11 121.20(16)
O1 B1 O2 118.28(15) C15 C16 H16 119.40 O1 B1 C14 124.09(15) C11 C16
H16 119.40 O2 B1 C14 117.64(15) C22 C21 C26 117.63(15)
[0591] Numbers in parentheses are estimated standard deviations in
the least significant digits.
TABLE-US-00019 Table of Hydrogen Bond Distances in Angstroms and
Angles in Degrees D H A D-H A-H D-A D-H-A O1 H1 O2 0.82(3) 2.15(3)
2.905(2) 152(3) O2 H2 O1 0.84(2) 1.94(2) 2.7706(18) 176(2)
[0592] Numbers in parentheses are estimated standard deviations in
the least significant digits.
TABLE-US-00020 Table of Torsion Angles in Degrees Atom 1 Atom 2
Atom 3 Atom 4 Angle C16 C11 C12 C13 -1.36 (0.23) C21 C11 C12 C13
178.00 (0.15) C12 C11 C16 C15 1.88 (0.24) C21 C11 C16 C15 -177.48
(0.15) C12 C11 C21 C22 176.35 (0.15) C12 C11 C21 C26 -4.81 (0.24)
C16 C11 C21 C22 -4.32 (0.24) C16 C11 C21 C26 174.52 (0.16) C11 C12
C13 F13 -178.12 (0.14) C11 C12 C13 C14 0.04 (0.27) F13 C13 C14 C15
178.91 (0.14) F13 C13 C14 B1 1.66 (0.24) C12 C13 C14 C15 0.77
(0.25) C12 C13 C14 B1 -176.47 (0.16) C13 C14 C15 C16 -0.25 (0.24)
B1 C14 C15 C16 177.05 (0.15) C13 C14 B1 O1 -26.38 (0.25) C13 C14 B1
O2 153.42 (0.15) C15 C14 B1 O1 156.59 (0.16) C15 C14 B1 O2 -23.61
(0.23) C14 C15 C16 C11 -1.09 (0.26) C11 C21 C22 C23 179.79 (0.16)
C26 C21 C22 C23 0.90 (0.24) C11 C21 C26 C25 -179.78 (0.15) C22 C21
C26 C25 -0.90 (0.24) C21 C22 C23 F23 179.16 (0.14) C21 C22 C23 C24
-0.53 (0.26) F23 C23 C24 C25 -179.58 (0.15) C22 C23 C24 C25 0.11
(0.26) C23 C24 C25 C26 -0.09 (0.28) C24 C25 C26 C21 0.51 (0.27)
Numbers in parentheses are estimated standard deviations in the
least significant digits.
E. Characterization of Compound 2, Form I
XRPD Analysis
[0593] XRPD patterns were collected with a PANALYTICAL.RTM. X'Pert
PRO MPD diffractometer using an incident beam of Cu radiation
produced using an Optix long, fine-focus source. An elliptically
graded multilayer mirror was used to focus Cu K.alpha. X-rays
through the specimen and onto the detector. Prior to the analysis,
a silicon specimen (NIST SRM 640c) was analyzed to verify the Si
111 peak position. A specimen of the sample was sandwiched between
3 .mu.m-thick films and analyzed in transmission geometry. A
beam-stop and short antiscatter extension were used to minimize the
background generated by air. Soller slits for the incident and
diffracted beams were used to minimize broadening from axial
divergence. Diffraction patterns were collected using a scanning
position-sensitive detector (X'CELERATOR.RTM.) located 240 mm from
the specimen and Data Collector software v. 2.2b. The
data-acquisition parameters for each pattern are displayed above
the image in the Data section of this report including the
divergence slit (DS) before the mirror and the incident-beam
antiscatter slit (SS).
[0594] The XRPD was indexed using X'Pert High Score Plus 2.2a
(2.2.1).
[0595] XRPD patterns were collected with an Inel XRG-3000
diffractometer. An incident beam of Cu K.alpha. radiation was
produced using a fine-focus tube and a parabolically graded
multilayer mirror. Prior to the analysis, a silicon standard (NIST
SRM 640c) was analyzed to verify the Si 111 peak position. A
specimen of the sample was packed into a thin-walled glass
capillary, and a beam-stop was used to minimize the background from
air. Diffraction patterns were collected in transmission geometry
using Windif v. 6.6 software and a curved position-sensitive
Equinox detector with a 2.theta. range of 120.degree..
[0596] The high-resolution (PANALYTICAL.RTM.) XRPD pattern of
Compound 2 was indexed, and the solution is shown in FIG. 28. The
cell volume obtained from the indexing solution is consistent with
three monomers in the asymmetric unit.
[0597] The INEL XRPD pattern is shown in FIG. 29.
Proton NMR Analysis
[0598] The solution NMR spectra were acquired with a Varian
.sup.UNITYINOVA-400 spectrometer. The samples were prepared by
dissolving approximately 4-10 mg of sample in CDCl.sub.3 containing
TMS.
[0599] The obtained spectrum was consistent with the presence of
Compound 2, as well as Compound 1. Compound 1 and Compound 2 are
distinguishable by proton NMR based on the presence or absence of
hydroxyl protons at approximately 5.1 ppm in deuterated chloroform.
Without being bound by any theory, a small amount of water may been
present in the NMR solvent, and that water may have reacted with
Compound 2 in the NMR sample, thereby forming Compound 1. The
proton NMR spectrum is shown in FIG. 30.
F. Characterization of Compound 1 Material B
[0600] Exemplary XRPD patterns of Material B are provided in FIGS.
19 (row B), 32, and 35.
[0601] Exemplary TGA and DSC thermograms of Material B are provided
in FIG. 34. TGA indicates approximately 10% weight loss from 25 to
130.degree. C.
G. Material B/Form A (Compound 1) Conversion Studies
Relative Humidity Stressing
[0602] A mixture of Form A and Material B was subjected to
approximately 97% R.H. for one week. Conversion of this mixture to
Material B was observed after the one week. In another experiment,
Material B was found to convert to a mixture of Material B and Form
A as early as 1 day at approximately 75% R.H. and 41.degree. C. The
same mixture (with a constant ratio of Material B to Form A based
on relative XRPD intensities) was observed after 4, 7, and 14 days
under those conditions.
Interconversion Studies
[0603] A saturated solution of Compound 1 Form A was prepared by
adding enough solids to a given solvent system at ambient
conditions so that undissolved solids were present. The mixture was
then allowed to stir in a sealed vial at ambient temperature for 3
days to ensure saturation. Solids from a mixture of Form A and
Material B were added to aliquots of the saturated solution
(filtered through a 0.2-.mu.m nylon filter) so that undissolved
solids were present. The mixture was then allowed to stir in a
sealed vial at ambient temperature for an extended period of time.
The solids were isolated by vacuum filtration and analyzed. Form A
was observed by XRPD.
EQUIVALENTS
[0604] The specific examples presented above are merely exemplary
and are non-limiting. While we have presented a number of
embodiments of this invention, it is apparent that our basic
teaching can be altered to provide other embodiments, which utilize
the compounds and methods of this invention. Therefore, it will be
appreciated that the scope of this invention is to be defined by
the appended claims rather than by the specific embodiments, which
have been represented by way of example.
Sequence CWU 1
1
11579PRTHomo sapiens 1Met Val Gln Tyr Glu Leu Trp Ala Ala Leu Pro
Gly Ala Ser Gly Val 1 5 10 15 Ala Leu Ala Cys Cys Phe Val Ala Ala
Ala Val Ala Leu Arg Trp Ser 20 25 30 Gly Arg Arg Thr Ala Arg Gly
Ala Val Val Arg Ala Arg Gln Arg Gln 35 40 45 Arg Ala Gly Leu Glu
Asn Met Asp Arg Ala Ala Gln Arg Phe Arg Leu 50 55 60 Gln Asn Pro
Asp Leu Asp Ser Glu Ala Leu Leu Ala Leu Pro Leu Pro 65 70 75 80 Gln
Leu Val Gln Lys Leu His Ser Arg Glu Leu Ala Pro Glu Ala Val 85 90
95 Leu Phe Thr Tyr Val Gly Lys Ala Trp Glu Val Asn Lys Gly Thr Asn
100 105 110 Cys Val Thr Ser Tyr Leu Ala Asp Cys Glu Thr Gln Leu Ser
Gln Ala 115 120 125 Pro Arg Gln Gly Leu Leu Tyr Gly Val Pro Val Ser
Leu Lys Glu Cys 130 135 140 Phe Thr Tyr Lys Gly Gln Asp Ser Thr Leu
Gly Leu Ser Leu Asn Glu 145 150 155 160 Gly Val Pro Ala Glu Cys Asp
Ser Val Val Val His Val Leu Lys Leu 165 170 175 Gln Gly Ala Val Pro
Phe Val His Thr Asn Val Pro Gln Ser Met Phe 180 185 190 Ser Tyr Asp
Cys Ser Asn Pro Leu Phe Gly Gln Thr Val Asn Pro Trp 195 200 205 Lys
Ser Ser Lys Ser Pro Gly Gly Ser Ser Gly Gly Glu Gly Ala Leu 210 215
220 Ile Gly Ser Gly Gly Ser Pro Leu Gly Leu Gly Thr Asp Ile Gly Gly
225 230 235 240 Ser Ile Arg Phe Pro Ser Ser Phe Cys Gly Ile Cys Gly
Leu Lys Pro 245 250 255 Thr Gly Asn Arg Leu Ser Lys Ser Gly Leu Lys
Gly Cys Val Tyr Gly 260 265 270 Gln Glu Ala Val Arg Leu Ser Val Gly
Pro Met Ala Arg Asp Val Glu 275 280 285 Ser Leu Ala Leu Cys Leu Arg
Ala Leu Leu Cys Glu Asp Met Phe Arg 290 295 300 Leu Asp Pro Thr Val
Pro Pro Leu Pro Phe Arg Glu Glu Val Tyr Thr 305 310 315 320 Ser Ser
Gln Pro Leu Arg Val Gly Tyr Tyr Glu Thr Asp Asn Tyr Thr 325 330 335
Met Pro Ser Pro Ala Met Arg Arg Ala Val Leu Glu Thr Lys Gln Ser 340
345 350 Leu Glu Ala Ala Gly His Thr Leu Val Pro Phe Leu Pro Ser Asn
Ile 355 360 365 Pro His Ala Leu Glu Thr Leu Ser Thr Gly Gly Leu Phe
Ser Asp Gly 370 375 380 Gly His Thr Phe Leu Gln Asn Phe Lys Gly Asp
Phe Val Asp Pro Cys 385 390 395 400 Leu Gly Asp Leu Val Ser Ile Leu
Lys Leu Pro Gln Trp Leu Lys Gly 405 410 415 Leu Leu Ala Phe Leu Val
Lys Pro Leu Leu Pro Arg Leu Ser Ala Phe 420 425 430 Leu Ser Asn Met
Lys Ser Arg Ser Ala Gly Lys Leu Trp Glu Leu Gln 435 440 445 His Glu
Ile Glu Val Tyr Arg Lys Thr Val Ile Ala Gln Trp Arg Ala 450 455 460
Leu Asp Leu Asp Val Val Leu Thr Pro Met Leu Ala Pro Ala Leu Asp 465
470 475 480 Leu Asn Ala Pro Gly Arg Ala Thr Gly Ala Val Ser Tyr Thr
Met Leu 485 490 495 Tyr Asn Cys Leu Asp Phe Pro Ala Gly Val Val Pro
Val Thr Thr Val 500 505 510 Thr Ala Glu Asp Glu Ala Gln Met Glu His
Tyr Arg Gly Tyr Phe Gly 515 520 525 Asp Ile Trp Asp Lys Met Leu Gln
Lys Gly Met Lys Lys Ser Val Gly 530 535 540 Leu Pro Val Ala Val Gln
Cys Val Ala Leu Pro Trp Gln Glu Glu Leu 545 550 555 560 Cys Leu Arg
Phe Met Arg Glu Val Glu Arg Leu Met Thr Pro Glu Lys 565 570 575 Gln
Ser Ser
* * * * *