U.S. patent application number 15/954942 was filed with the patent office on 2018-08-23 for method for the treatment of pain and osteoarthritis with c-fms antagonists.
The applicant listed for this patent is MorphoSys AG, The University of Melbourne. Invention is credited to Andrew David COOK, John Allan HAMILTON, Stefan STEIDL.
Application Number | 20180237531 15/954942 |
Document ID | / |
Family ID | 47557687 |
Filed Date | 2018-08-23 |
United States Patent
Application |
20180237531 |
Kind Code |
A1 |
STEIDL; Stefan ; et
al. |
August 23, 2018 |
METHOD FOR THE TREATMENT OF PAIN AND OSTEOARTHRITIS WITH C-FMS
ANTAGONISTS
Abstract
The present invention relates generally to a method for the
treatment and/or prophylaxis of osteoarthritis (OA) and/or pain. In
accordance with the present invention, an antagonist of c-Fms is
effective in the treatment of osteoarthritis and/or pain. An
antagonist of M-CSF includes, but is not limited to, an antibody
that is specific for M-CSF, IL-34 or c-Fms.
Inventors: |
STEIDL; Stefan; (Munich,
DE) ; HAMILTON; John Allan; (Aberfeldie, AU) ;
COOK; Andrew David; (North Melbourne, AU) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The University of Melbourne
MorphoSys AG |
Carlton
Planegg |
|
AU
DE |
|
|
Family ID: |
47557687 |
Appl. No.: |
15/954942 |
Filed: |
April 17, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14970578 |
Dec 16, 2015 |
10005840 |
|
|
15954942 |
|
|
|
|
14126878 |
Dec 17, 2013 |
9243066 |
|
|
PCT/EP2012/063998 |
Jul 17, 2012 |
|
|
|
14970578 |
|
|
|
|
61508717 |
Jul 18, 2011 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/76 20130101;
A61K 2039/505 20130101; A61P 43/00 20180101; C07K 16/244 20130101;
C07K 16/243 20130101; C07K 16/249 20130101; A61P 35/00 20180101;
A61P 19/02 20180101; A61P 25/04 20180101; A61P 29/00 20180101; C07K
16/2866 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; C07K 16/24 20060101 C07K016/24 |
Foreign Application Data
Date |
Code |
Application Number |
Jul 18, 2011 |
EP |
11174305.0 |
Claims
1. A method for the treatment of pain or osteoarthritis in a
subject, ais method comprising administering to the subject an
antagonist of c-Fms, wherein said antagonist is an antibody
specific for c-Fms.
2. The method of claim 1, wherein said pain is post-surgical
pain.
3. The method of claim 1, wherein said pain is bone cancer
pain.
4. The method of claim 1, wherein said pain is rheumatoid arthritic
pain.
5. The method of claim 1, wherein said pain is osteoarthritic
pain.
6. The method of claim 1, wherein said pain is inflammatory
pain.
7. The method of claim 1 wherein said subject is a human.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. application Ser.
No. 14/970,578, filed Dec. 16, 2015, which is a divisional of U.S.
application Ser. No. 14/126,878, filed Dec. 17, 2013, now issued as
U.S. Pat. No. 9,243,066, which is the U.S. National Phase of
PCT/EP2012/063998, filed Jul. 17, 2012, which claims the benefit of
priority from U.S. provisional application Ser. No. 61/508,717
filed Jul. 18, 2011, and EP application serial number EP 11174305.0
filed Jul. 18, 2011, each of which is incorporated by reference in
its entirety.
FIELD OF THE INVENTION
[0002] The present invention relates generally to a method for the
treatment and/or prophylaxis of osteoarthritis (OA) and/or pain. In
accordance with the present invention, an antagonist of c-Fms can
be effective in the treatment of osteoarthritis and/or pain. An
antagonist of c-Fms includes, but is not limited to, an antibody
that is specific for c-Fms or a ligand of c-Fms, for example M-CSF
or IL-34.
BACKGROUND OF THE INVENTION
[0003] Osteoarthritis
[0004] Osteoarthritis (OA), also known as degenerative arthritis,
is a disease most prevalent in the old and obese. OA is a disease
of the articular joints, but, unlike rheumatoid arthritis (RA), the
disease is not systemic, usually affecting only one or a few
joints. The disease leads to total destruction of the articular
cartilage, sclerosis of the underlying bones and osteophyte
formation, resulting in loss of movement and pain. The ultimate
result is often the need for a total joint replacement.
[0005] OA affects about .about.21 million people in the US,
comprises 25% of all primary care physician visits and accounts for
50% of all NSAID (non steroidal anti inflammatory drugs)
prescriptions. There is currently no treatment available which
slows or halts disease progression; today's drugs merely treat the
symptoms. The incidence and severity of the disease increase with
age. By the age of 65, 80% of Americans show radiographic evidence
of OA though only 60% of them will be symptomatic. 65% of all joint
disease by the age of 65 are OA. In 2006, there were 735,000
OA-related US hospitalizations.
[0006] Current OA drugs treat the symptoms of OA rather than the
disease itself. Commonly used drugs in the treatment of OA include
Non-steroidal anti-inflammatory drugs (NSAIDs), such as diacerin,
voltaren, mobic and arthrotec (generic names: diclofenac,
misoprostol, meloxicam). NSAIDs are mainly oral compounds which act
by inhibiting prostaglandin synthesis in the central nervous system
(CNS). Other commonly used drugs include non-narcotic analgesics,
such as ultram (tramadol), COX-2 inhibitors, such as celebrax and
arcoxia (celecoxib, etoricoxib), narcotic analgesiscs, such as
duragesic (dextropropoxyphene fentanyl), hyaluraonic acids, such as
suparts, hyalgan, orthovisc and synvisc (Hylan G-F20), and
corticosteroids, such as predinisolone and methyl predinisolone.
Present treatments for OA intend to obviate the need for surgery
through tissue engineering, such as chondrocyte transplantation;
however, these treatments are only applicable for the treatment of
last stage OA. Other approaches in the treatment of OA that are
considered include prolotherapy, in which an irritant, such as
dextrose, is injected into the affected joint, thereby causing an
acute inflammatory reaction, but also strengthening and hopefully
healing the tissues, ligaments, tendons, and cartilage. There is,
thus, a high unmet medical need for the treatment of OA.
[0007] Pain
[0008] Pain of any type is the most frequent reason for physician
consultation in the United States, prompting half of all Americans
to seek medical care annually. It is a major symptom in many
medical conditions, significantly interfering with a person's
quality of life and general functioning. Diagnosis is based on
characterizing pain in various ways, according to duration,
intensity, type (dull, burning or stabbing), source, or location in
body. Usually pain stops without treatment or responds to simple
measures such as resting or taking an analgesic, and it is then
called acute pain. But it may also become intractable and develop
into a condition called chronic pain, in which pain is no longer
considered a symptom but an illness by itself.
[0009] Pain can be classified according to many schemes and
circumstances. There are two basic types of pain: acute and
chronic. Acute pain occurs for brief periods of time and is
associated with temporary disorders. However, it is always an alarm
signal that something may be wrong. Chronic pain is continuous and
recurrent. It is associated with chronic diseases and is one of
their symptoms. Pain intensity not only depends on the type of
stimulus that caused it, but also on the subjective perception of
the pain. Despite a wide range of subjective perception, several
types of pain have been classified according to: [0010] The
stimulus that caused the pain. [0011] The pain's duration. [0012]
The features of pain (intensity, location, etc.).
[0013] Another classification system is as follows: [0014] Gnawing
pain. Continuous with constant intensity. It generally worsens with
movement. [0015] Throbbing pain. This is typical of migraine pain.
It is caused by dilation and constriction of the cerebral blood
vessels. [0016] Stabbing pain. Intense and severe. It is caused by
mechanical stimuli. [0017] Burning pain. A constant, burning
feeling, like, for example, the type of pain caused by heartburn.
[0018] Pressing pain. Caused by constriction of the blood vessels
or muscles.
[0019] There are also specific types of pain: [0020] Muscle pain.
Also known as myalgia, this pain involves the muscles and occurs
after excessive exertion or during inflammation. [0021] Colicky
pain. Caused by muscle contractions of certain organs, such as the
uterus during the menstrual period. Generally cyclic in nature.
[0022] Referred pain. Occurs when the painful sensation is felt in
a site other than the one where it is actually occurring, depending
upon how the brain interprets information it receives from the
body. [0023] Post-surgical or Post-operative pain. Occurs after
surgery and is due to lesions from surgical procedures. [0024] Bone
cancer pain. Certain types of cancers, such as prostate, breast, or
other soft-tissue tumors, may progress to a painful disorder of the
bone known as metastatic bone disease.
[0025] Standard Care for Pain Treatment
[0026] There are many ways to treat pain. Treatment varies
depending on the cause of pain. The main treatment options are as
follows:
[0027] Acetaminophen: Tylenol (Acetaminophen) is used to treat
pain. Unlike several other medications for pain, Tylenol does not
have anti-inflammatory effects. Often, however, in cases of chronic
pain, no inflammation is at the site of the pain, and thus Tylenol
may be an appropriate treatment choice. Tylenol is safe when used
appropriately, but can be dangerous when used excessively. Also,
Tylenol may cause unwanted effects when used with certain other
medicaments.
[0028] Non-Steroidal Anti-Inflammatory Medications (NSAIDs): The
NSAIDs (such as Ibuprofen, Motrin, Aleve, etc.) are most beneficial
in cases of acute pain, or flare-ups in patients with chronic pain.
NSAIDs are also excellent at treating inflammatory conditions
including tendonitis, bursitis, and arthritis. In general, NSAID
use is limited for patients with chronic pain because of concerns
about the development to stomach problems. While the newer,
so-called COX-2 inhibitors, such as Celebrex, were designed to
avoid this complication, caution should still be used when using
these medications for long periods of time.
[0029] Corticosteroids: As with NSAIDs, corticosteroids are
powerful anti-inflammatory medications, and best used for acute
pain or for flare-ups of a chronic inflammatory problem.
Corticosteroids can either be taken orally (such as Medrol,
Prednisone), or injected into the soft tissues or joints (cortisone
injections).
[0030] Narcotics: Narcotics should be considered if pain cannot be
otherwise controlled. Many narcotics can be dangerous and
addicting. While narcotic medications are useful for acute pain,
they also have significant side effects. The short-acting types of
these medications can lead to overuse and the development of
tolerance. Long-acting options have fewer side effects, and better
control of chronic pain. Narcotics can become addictive when they
are used for lengthy times without gradual reduction in the dose,
or if the medications are taken for reasons other than pain.
[0031] Anti-Convulsants: Anti-convulsant medications are the
category of medications that work to relieve nerve pain. These
medications alter the function of the nerve and the signals that
are sent to the brain. The most commonly prescribed anticonvulsant
medication for nerve pain is called Neurontin (Gabapentin). Another
option that has more recently emerged, specifically for the
treatment of fibromyalgia, is called Lyrica (Pregabalin).
[0032] Local Anesthetics: Local anesthetics can provide temporary
pain relief to an area. When used in the setting of chronic pain,
local anesthetics are often applied as a topical patch to the area
of pain. Lidoderm comes in a patch that is applied to the skin and
decreases the sensitivity of this area.
[0033] All of the above mentioned treatment options have drawbacks,
side effects, or use is limited to certain types of pain. Hence,
there is still a high unmet medical need for the treatment of
pain.
[0034] c-Fms and its Ligands
[0035] c-Fms (CSFR1, M-CSFRc-Fms) is the receptor for colony
stimulating factor 1 (see below), a cytokine which controls the
production, differentiation, and function of macrophages. c-Fms
mediates most, if not all, of the biological effects of M-CSF.
Ligand binding activates CSFR1 through a process of oligomerization
and transphosphorylation. The encoded protein is a tyrosine kinase
transmembrane receptor and member of the CSF1/PDGF receptor family
of tyrosine-protein kinases. The first intron of the CSFR1 gene
contains a transcriptionally inactive ribosomal protein L7
processed pseudogene, oriented in the opposite direction to the
CSFR1 gene.
[0036] Mutations in CSF1R are associated with chronic
myelomonocytic leukemia and type M4 acute myeloblastic leukemia.
Increased levels of CSF1R1 are found in microglia in Alzheimer's
disease and after brain injuries. The increased receptor expression
causes microglia to become more active. Both CSF1R, and its ligand
colony stimulating factor 1 play an important role in the
development of the mammary gland and may be involved in the process
of mammary gland carcinogenesis
[0037] M-CSF (CSF-1) is a hematopoietic growth factor that is
involved in the proliferation, differentiation, and surival of
monocytes, macrophages, and bone marrow progenitor cells. High
levels of CSF-1 expression are also observed in the endometrial
epithelium of the pregnant uterus as well as high levels of its
receptor CSF1R in the placental trophoblast. Studies have shown
that activation of trophoblasitc CSF1R by local high levels of
CSF-1 is essential for normal embryonic implantation and placental
development. More recenity, it was discovered that CSF-1 and its
receptor CSF1R are implicated in the mammary gland during normal
development and neoplastic growth.
[0038] IL-34 is an alternative ligand to c-Fms (Lin et al., Science
(2008), 320, 807-11). A role of IL-34 in osteoclastogenesis has
been described (Chen et al., PLoS One (2011)6, e18689). Murine
IL-34 has been shown to compete with murine M-CSF for binding to
c-Fms (Wei et al., J Leukoc Biol (2010) 88, 495-505). This is
consistent with the observation that proliferation induced by
either growth factor, M-CSF or IL-34, is blocked by an anti-c-Fms
antibody. The antibody used by Wei et al., antibody AFS-98, was
also used in the present application.
[0039] Devalaraja et al (US20020141994A1) cursorily mention OA
among a long list of potentially suitable indications suitable for
treatment with antagonists of colony stimulating factors. The list
of indications includes atherosclerosis, sepsis, asthma, autoimmune
disease, osteoporosis and rheumatoid arthritis. M-CSF is one of the
many colony stimulating factors mentioned in Devalaraja et al.
However, no experimental support is provided and there is no
enabling disclosure. Likewise, Patel et al. (Current Topics in
Medicinal Chemistry (2009) 9, 599-610) mention c-Fms in the context
of inflammatory disorders without showing any experimental data or
enabling disclosure. Similarly, WO 06/096461 discloses certain
M-CSF specific antibodies. However, WO 06/096461 only describes the
isolation, purification and formulation of M-CSF specific
antibodies, but does not disclose any in vitro or in vivo data
associated with the binders disclosed. Therefore also WO 06/096461
is not enabling.
[0040] M-CSF/CSF1 (UniProt P09603) has the following amino acid
sequence:
TABLE-US-00001 (SEQ ID NO: 1)
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQS
LQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFR
DNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVK
NVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSS
DPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAK
QRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL
PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEP
GSPRISSLRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRR
SPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFSPQLQESVFHL
LVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQV ELPV
[0041] M-CSF receptor /CSF1R (UniProt P07333) has the following
amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 2)
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEW
DGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLY
VKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMR
HTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIP
GPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQS
DFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPK
LANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRY
PPEVSVIWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVW
DDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIP
ISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRW
KIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLL
GACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYK
NIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPL
ELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLA
RDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFS
LGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEH
LTCCEQGDIAQPLLQPNNYQFC
[0042] IL-34 (UniProt Q6ZMJ4) has the following amino acid
sequence:
TABLE-US-00003 (SEQ ID NO: 3)
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSR
LQYMKHYFPINYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLS
ATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSPKVESVLSLLN
APGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCS
PEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP
SUMMARY OF THE INVENTION
[0043] The present invention, for the first time, demonstrates that
c-Fms, M-CSF and IL-34 are valid targets for the treatment of OA
and pain. M-CSF and IL-34 are ligands of c-Fms, and antagonizing
any of these molecules is effective in the treatment of OA and
pain. This finding is new, and the prior art does not teach,
suggest or provide any rational for such a point of intervention in
the treatment of OA and pain. Accordingly, the invention provides,
e.g., a method for the treatment of osteoarthritis in a subject,
said method comprising the step of administering an effective
amount of a c-Fms antagonist to said subject. The invention also
provides a method for the treatment of pain in a subject, said
method comprising the step of administering an effective amount of
a c-Fms antagonist to said subject.
[0044] In another aspect, the present invention contemplates a
method for the prophylaxis of osteoarthritis in a subject, said
method comprising the step of administering an effective amount of
a c-Fms antagonist to said subject.
[0045] In another aspect, the present invention contemplates a
method for the prophylaxis of pain in a subject, said method
comprising the step of administering an effective amount of a c-Fms
antagonist to said subject.
[0046] In another aspect, the present invention is directed to a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of M-CSF from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from
osteoarthritis, or being suspected of suffering from
osteoarthritis, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents. In another
aspect, the present invention is directed to a composition
comprising a c-Fms antagonist capable of antagonizing the ability
of IL-34 from activating, proliferating, inducing growth and/or
survival of cells in a subject suffering from osteoarthritis, or
being suspected of suffering from osteoarthritis, said composition
further comprising one or more pharmaceutically acceptable carriers
and/or diluents.
[0047] In another aspect, the present invention is directed to a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of M-CSF from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from pain,
or being suspected of suffering from pain, said composition further
comprising one or more pharmaceutically acceptable carriers and/or
diluents. In another aspect, the present invention is directed to a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of IL-34 from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from pain,
or being suspected of suffering from pain, said composition further
comprising one or more pharmaceutically acceptable carriers and/or
diluents.
[0048] In another aspect, the present invention is directed to a
composition comprising a c-Fms antagonist for use in the treatment
of osteoarthritis, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents.
[0049] In another aspect, the present invention is directed to a
composition comprising a c-Fms antagonist for use in the treatment
of pain, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents.
[0050] In other aspects, the present invention is directed to the
use of a c-Fms antagonist in the preparation of a medicament in the
treatment of osteoarthritis.
[0051] In other aspects, the present invention is directed to the
use of a c-Fms antagonist in the preparation of a medicament in the
treatment of pain.
[0052] In other aspects, the present invention provides a method
for the treatment of osteoarthritis, comprising administering to
said subject a c-Fms antagonist.
[0053] In other aspects, the present invention provides a method
for the treatment of pain, comprising administering to said subject
a c-Fms antagonist.
[0054] In particular aspects of the present invention, the c-Fms
antagonist is an antibody specific for M-CSF.
[0055] In alternative aspects of the present invention, the c-Fms
antagonist is an antibody specific for c-Fms.
[0056] In yet alternative aspects of the present invention, the
c-Fms antagonist is an antibody specific for IL-34.
[0057] In certain aspect the present invention provides an
antagonist of c-Fms for use in the treatment of osteoarthritis or
pain.
[0058] In certain aspect the present invention provides an antibody
specific for M-CSF for use in the treatment of osteoarthritis or
pain.
[0059] In other aspect the present invention provides an antibody
specific for c-Fms for use in the treatment of osteoarthritis or
pain.
[0060] In other aspect the present invention provides an antibody
specific for IL-34 for use in the treatment of osteoarthritis or
pain.
[0061] In certain aspects of the present invention the antagonist
of the present invention is used in a human.
[0062] Throughout this specification, unless the context requires
otherwise, the words "comprise", "have" and "include" and their
respective variations such as "comprises", "comprising", "has",
"having", "includes" and "including" will be understood to imply
the inclusion of a stated element or integer or group of elements
or integers but not the exclusion of any other element or integer
or group of elements or integers.
BRIEF DESCRIPTION OF THE DRAWINGS
[0063] FIG. 1 shows the weight distribution as a measure of pain
assessed in mice with collagenase-induced OA. Results are expressed
as the mean+SEM. Mice showed significant pain at day 20. Mice were
treated 2.times./week from day 20 onwards. The two different
treatment groups are statistically different (t-test): Anti-CSFR1
vs. control mAb: p<0.05 on days 28 and 31. Anti-CSFR1 vs. Day 0:
p>0.01, day 20; p<0.05, day24.
[0064] FIG. 2 shows the histological assessment of the
osteoarthritis disease score in mice with collagenase-induced OA.
C57BL/6 mice (n=15 mice/group) received collagenase (days 0 and 2);
mice were treated with, anti-c-Fms or control mAb (2.times./wk)
from day 20 (the first day on which the pain reading was
significantly different to that at t=0). Histology was performed on
day 42. Results are expressed as the mean.+-.SEM. LT=lateral tibia,
LF=lateral femur, MT=medial tibia, MF=medial femur. Anti-cFms vs.
control: MT-p=0.01 (Mann-Whitney two sample rank test).
[0065] FIG. 3 shows the weight distribution as a measure of pain
assessed in mice with collagenase-induced OA. Results are expressed
as the mean+SEM. Mice showed significant pain at day 20. Mice were
treated 2.times./week from day 20 onwards. Mice treated with an
anti-M-CSF antibody showed no increase in the degree of pain as
compared to the isotype control antibody.
DETAILED DESCRIPTION OF THE INVENTION
[0066] The present invention demonstrates that c-Fms, M-CSF and
IL-34 are valid targets for the treatment of OA and pain. M-CSF and
IL-34 are ligands of c-Fms, and antagonizing any of these molecules
is effective in the treatment of OA and pain. In this respect, the
invention provides, in one aspect, methods of using a c-Fms
antagonist to bring about a prophylactic or therapeutic benefit in
the field of OA and/or pain.
[0067] The present invention provides therapeutic methods
comprising the administration of a therapeutically effective amount
of a c-Fms antagonist to a subject in need of such treatment. A
"therapeutically effective amount" or "effective amount", as used
herein, refers to the amount of a c-Fms antagonist necessary to
elicit the desired biological response. In accordance with the
subject invention, the therapeutic effective amount is the amount
of a c-Fms antagonist necessary to treat and/or prevent
osteoarthritis and/or pain.
[0068] In certain aspects the present invention provides a method
for the treatment of post-surgical pain. In other aspects the
present invention provides a method for the treatment of bone
cancer pain. In yet other aspects the present invention provides
c-Fms antagonists which have an analgesic effect. In yet other
aspects the present invention provides a method for the treatment
of rheumatoid arthritis pain. c-Fms antagonists are capable of
inhibiting or blocking the pain associated with rheumatoid
arthritis. In other aspects the invention provides methods for
reducing incidence of rheumatoid arthritis pain, ameliorating
rheumatoid arthritis pain, suppressing rheumatoid arthritis pain,
palliating rheumatoid arthritis pain, and/or delaying the onset,
development, or progression of rheumatoid arthritis pain in a
subject, said method comprising administering an effective amount
of a c-Fms antagonist to the subject. In another aspect the present
invention provides a method for preventing or treating
osteoarthritis pain in an individual by administering an effective
amount of a c-Fms antagonist to the individual. In another aspect,
the invention provides methods for treating inflammatory cachexia
(weight loss) associated with rheumatoid arthritis in an individual
comprising administering an effective amount of a c-Fms antagonist.
In another aspect, the invention provides methods for reducing
incidence of osteoarthritis pain, ameliorating osteoarthritis pain,
suppressing osteoarthritis pain, palliating osteoarthritis pain,
and/or delaying the onset, development, or progression of
osteoarthritis pain in an individual, said method comprising
administering an effective amount of a c-Fms antagonist to the
individual.
[0069] "Palliating" a pain or one or more symptoms of a pain (such
as rheumatoid arthritis pain or osteoarthritis pain) means
lessening the extent of one or more undesirable clinical
manifestations of post-surgical pain in an individual or population
of individuals treated with a c-Fms antagonist in accordance with
the invention.
[0070] In certain aspects the pain is alleviated within about 24
hours after administering M-CSF antagonist. In other aspects, the
pain is alleviated within about 4 days after administering the
c-Fms antagonist. "c-Fms antagonist", as used herein, includes
c-Fms antagonists in its broadest sense; any molecule which
inhibits the activity or function of c-Fms or of any of its
ligands, or which by any other way exerts a therapeutic effect on
c-Fms is included. The term c-Fms antagonist includes any molecule
which interferes or inhibits c-Fms signaling. The term c-Fms
antagonists includes, but is not limited to, antibodies
specifically binding to c-Fms, inhibitory nucleic acids specific
for c-Fms or small organic molecules specific for c-Fms. Also
within the meaning of the term c-Fms antagonist are antibodies
specifically binding M-CSF, inhibitory nucleic acids specific for
M-CSF or small organic molecules specific for M-CSF. Also within
the meaning of the term c-Fms antagonist are antibodies
specifically binding IL-34, inhibitory nucleic acids specific for
IL-34 or small organic molecules specific for IL-34.
[0071] Inhibitory nucleic acids include, but are not limited to,
antisense DNA, triplex-forming oligonucleotides, external guide
sequences, siRNA and microRNA. Useful inhibitory nucleic acids
include those that reduce the expression of RNA encoding c-Fms,
M-CSF or IL-34 by at least 20, 30, 40, 50, 60, 70, 80, 90 or 95
percent compared to controls. Inhibitory nucleic acids and methods
of producing them are well known in the art. siRNA design software
is available.
[0072] Small organic molecules (SMOLs) specific for M-CSF, IL-34 or
the M-CSF receptor may be identified via natural product screening
or screening of chemical libraries. Typically the molecular weight
of SMOLs is below 500 Dalton, more typically from 160 to 480
Daltons. Other typical properties of SMOLs are one or more of the
following: [0073] The partition coefficient log P is in the range
from -0.4 to +5.6 [0074] The molar refractivity is from 40 to 130
[0075] The number of atoms is from 20 to 70
[0076] For reviews see Ghose et al, J Combin Chem: 1:55-68, 1999
and Lipinski et al, Adv Drug Del Rev 23:3-25, 1997.
[0077] Preferably, a c-Fms antagonist for use in the present
invention is an antibody specific for M-CSF, specific for IL-34 or
specific for the M-CSF receptor. Such an antibody may be of any
type, such as a murine, a rat, a chimeric, a humanized or a human
antibody. A "human" antibody or functional human antibody fragment
is hereby defined as one that is not chimeric (e.g., not
"humanized") and not from (either in whole or in part) a non-human
species. A human antibody or functional antibody fragment can be
derived from a human or can be a synthetic human antibody. A
"synthetic human antibody" is defined herein as an antibody having
a sequence derived, in whole or in part, in silico from synthetic
sequences that are based on the analysis of known human antibody
sequences. In silico design of a human antibody sequence or
fragment thereof can be achieved, for example, by analyzing a
database of human antibody or antibody fragment sequences and
devising a polypeptide sequence utilizing the data obtained
therefrom. Another example of a human antibody or functional
antibody fragment is one that is encoded by a nucleic acid isolated
from a library of antibody sequences of human origin (i.e., such
library being based on antibodies taken from a human natural
source). In certain aspects, the antibodies used in the present
invention are human antibodies.
[0078] A "humanized antibody" or functional humanized antibody
fragment is defined herein as one that is (i) derived from a
non-human source (e.g., a transgenic mouse which bears a
heterologous immune system), which antibody is based on a human
germline sequence; or (ii) chimeric, wherein the variable domain is
derived from a non-human origin and the constant domain is derived
from a human origin or (iii) CDR-grafted, wherein the CDRs of the
variable domain are from a non-human origin, while one or more
frameworks of the variable domain are of human origin and the
constant domain (if any) is of human origin. In certain aspects,
the antibodies used in the present invention are humanized
antibodies.
[0079] The term "chimeric antibody" or functional chimeric antibody
fragment is defined herein as an antibody molecule which has
constant antibody regions derived from, or corresponding to,
sequences found in one species and variable antibody regions
derived from another species. Preferably, the constant antibody
regions are derived from, or corresponding to, sequences found in
humans, e.g. in the human germ line or somatic cells, and the
variable antibody regions (e.g. VH , VL , CDR or FR regions) are
derived from sequences found in a non-human animal, e.g. a mouse,
rat, rabbit or hamster. In certain aspects, the antibodies used in
the present invention are chimeric antibodies.
[0080] The term "monoclonal" is to be understood as having the
meaning typically ascribed to it in the art, namely an antibody or
an antibody fragment arising from a single clone of an
antibody-producing cell, such as a B cell, and recognizing a single
epitope on the antigen bound. In certain aspects, the antibodies
used in the present invention are monoclonal antibodies.
[0081] As used herein, an antibody "binds specifically to",
"specifically binds to", is "specific to/for" or "specifically
recognizes" an antigen (here, M-CSF receptor or, alternatively,
M-CSF or IL-34) if such antibody is able to discriminate between
such antigen and one or more reference antigen(s), since binding
specificity is not an absolute, but a relative property. The
reference antigen(s) may be one or more closely related antigen(s),
which are used as reference points, e.g. IL3, IL5, IL-4, IL13 or
GM-CSF. In its most general form (and when no defined reference is
mentioned), "specific binding" is referring to the ability of the
antibody to discriminate between the antigen of interest and an
unrelated antigen, as determined, for example, in accordance with
one of the following methods. Such methods comprise, but are not
limited to Western blots, ELISA-, RIA-,ECL-, IRMA-tests and peptide
scans. For example, a standard ELISA assay can be carried out. The
scoring may be carried out by standard color development (e.g.
secondary antibody with horseradish peroxide and tetramethyl
benzidine with hydrogenperoxide). The reaction in certain wells is
scored by the optical density, for example, at 450 nm. Typical
background (=negative reaction) may be 0.1 OD; typical positive
reaction may be 1 OD. This means the difference positive/negative
can be more than 10-fold. Typically, determination of binding
specificity is performed by using not a single reference antigen,
but a set of about three to five unrelated antigens, such as milk
powder, BSA, transferrin or the like. Additionally, "specific
binding" may relate to the ability of an antibody to discriminate
between different parts of its target antigen, e.g. different
domains or regions of M-CSF, IL-34 or the M-CSF receptor, or
between one or more key amino acid residues or stretches of amino
acid residues of M-CSF, IL-34 or the M-CSF receptor.
[0082] Also, as used herein, an "immunoglobulin" (Ig) hereby is
defined as a protein belonging to the class IgG, IgM, IgE, IgA, or
IgD (or any subclass thereof), and includes all conventionally
known antibodies and functional fragments thereof. A "functional
fragment" of an antibody/immunoglobulin hereby is defined as a
fragment of an antibody/immunoglobulin (e.g., a variable region of
an IgG) that retains the antigen-binding region. An
"antigen-binding region" of an antibody typically is found in one
or more hypervariable region(s) of an antibody, i.e., the CDR-1,
-2, and/or -3 regions; however, the variable "framework" regions
can also play an important role in antigen binding, such as by
providing a scaffold for the CDRs. Preferably, the "antigen-binding
region" comprises at least amino acid residues 4 to 103 of the
variable light (VL) chain and 5 to 109 of the variable heavy (VH)
chain, more preferably amino acid residues 3 to 107 of VL and 4 to
111 of VH, and particularly preferred are the complete VL and VH
chains (amino acid positions 1 to 109 of VL and 1 to 113 of VH;
numbering according to WO 97/08320). A preferred class of
immunoglobulins for use in the present invention is IgG.
"Functional fragments" of the invention include the domain of a
F(ab').sub.2 fragment, a Fab fragment, scFv or constructs
comprising single immunoglobulin variable domains or single domain
antibody polypeptides, e.g. single heavy chain variable domains or
single light chain variable domains. The F(ab').sub.2 or Fab may be
engineered to minimize or completely remove the intermolecular
disulphide interactions that occur between the C.sub.H1 and C.sub.L
domains.
[0083] An antibody of the invention may be derived from a
recombinant antibody library that is based on amino acid sequences
that have been designed in silico and encoded by nucleic acids that
are synthetically created. In silico design of an antibody sequence
is achieved, for example, by analyzing a database of human
sequences and devising a polypeptide sequence utilizing the data
obtained therefrom. Methods for designing and obtaining in
silico-created sequences are described, for example, in Knappik et
al, J. Mol. Biol. 296:57, 2000; Krebs et al, J. Immunol. Methods.
254:67, 2001; Rothe et al, J. Mol. Biol. 376:1182, 2008 and U.S.
Pat. No. 6,300,064 issued to Knappik et al 2000 supra, which hereby
are incorporated by reference in their entirety.
[0084] Any antibody specific for M-CSF may be used with the present
invention. Exemplary antibodies include those disclosed in WO
90/009400, W099/017798, WO 01/30381, WO 05/030124, US 20020141994,
WO 06/096461, WO 06/096490, WO 06/096489, WO 04/045532, WO
07/059135, WO 05/046657, WO 05/068503, WO 07/016240, WO 07/016285
and WO 07/081879, all of which are hereby incorporated by
reference.
[0085] Likewise, any antibody specific for the M-CSF receptor may
be used with the present invention.
[0086] Likewise, any antibody specific for IL-34 may be used with
the present invention.
[0087] In certain aspects, the present invention provides methods
for the treatment of osteoarthritis in a subject, said method
comprising the step of administering a c-Fms antagonist to said
subject. In other aspects, the present invention provides methods
for the treatment of pain in a subject, said method comprising the
step of administering a c-Fms antagonist to said subject.
"Subject", as used in this context refers to any mammal, including
rodents, such as mouse or rat, and primates, such as cynomolgus
monkey (Macaca fascicularis), rhesus monkey (Macaca mulatta) or
humans (Homo sapienss). Preferably the subject is a primate, most
preferably a human.
[0088] In certain aspect, the present invention provides a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of M-CSF from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from
osteoarthritis, or being suspected of suffering from
osteoarthritis, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents. Anti-M-CSF
antibodies of the present invention may antagonize any of the roles
of M-CSF in osteoarthritis.
[0089] In certain aspect, the present invention provides a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of IL-34 from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from
osteoarthritis, or being suspected of suffering from
osteoarthritis, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents. Anti-IL-34
antibodies of the present invention may antagonize any of the roles
of IL-34 in osteoarthritis.
[0090] In certain aspect, the present invention provides a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of c-Fms from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from
osteoarthritis, or being suspected of suffering from
osteoarthritis, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents. Anti-c-Fms
antibodies of the present invention may antagonize any of the roles
of c-Fms in osteoarthritis.
[0091] In certain aspect the present invention provides a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of M-CSF from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from pain,
or being suspected of suffering from pain, said composition further
comprising one or more pharmaceutically acceptable carriers and/or
diluents. Anti-M-CSF antibodies of the present invention may
antagonize any of the roles of M-CSF in pain.
[0092] In certain aspect the present invention provides a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of IL-34 from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from pain,
or being suspected of suffering from pain, said composition further
comprising one or more pharmaceutically acceptable carriers and/or
diluents. Anti-IL-34 antibodies of the present invention may
antagonize any of the roles of IL-34 in pain.
[0093] In certain aspect the present invention provides a
composition comprising a c-Fms antagonist capable of antagonizing
the ability of c-Fms from activating, proliferating, inducing
growth and/or survival of cells in a subject suffering from pain,
or being suspected of suffering from pain, said composition further
comprising one or more pharmaceutically acceptable carriers and/or
diluents. Anti-c-Fms antibodies of the present invention may
antagonize any of the roles of c-Fms in pain.
[0094] In certain aspect the present invention provides an
antagonist of c-Fms for use in the treatment of osteoarthritis. In
other aspect the present invention provides an antagonist of c-Fms
for use in the treatment of pain. In particular aspect the present
invention provides an antagonist of c-Fms for use in the treatment
of osteoarthritis or pain.
[0095] In certain aspect the present invention provides an antibody
specific for M-CSF for use in the treatment of osteoarthritis. In
other aspect the present invention provides an antibody specific
for M-CSF for use in the treatment of pain. In particular aspect
the present invention provides an antibody specific for M-CSF for
use in the treatment of osteoarthritis or pain.
[0096] In certain aspect the present invention provides an antibody
specific for c-Fms for use in the treatment of osteoarthritis. In
other aspect the present invention provides an antibody specific
for c-Fms for use in the treatment of pain. In particular aspect
the present invention provides an antibody specific for c-Fms for
use in the treatment of osteoarthritis or pain.
[0097] In certain aspect the present invention provides an antibody
specific for IL-34 for use in the treatment of osteoarthritis. In
other aspect the present invention provides an antibody specific
for IL-34 for use in the treatment of pain. In particular aspect
the present invention provides an antibody specific for IL-34 for
use in the treatment of osteoarthritis or pain.
[0098] In certain aspects the antagonists and antibodies of the
present invention are used in the treatment of post-surgical pain.
In alternative aspects said antagonists and antibodies are used in
the treatment of bone cancer pain. In alternative aspects said
antagonists and antibodies are used in the treatment of rheumatoid
arthritic pain. In alternative aspects said antagonists and
antibodies are used in the treatment of osteoarthritic pain. In
alternative aspects said antagonists and antibodies are used in the
treatment of inflammatory pain.
[0099] In certain aspects the antagonists and antibodies of the
present invention are used in the treatment of humans.
[0100] In another aspect, the present invention provides a method
for the prophylaxis of osteoarthritis in a subject, said method
comprising administering a c-Fms antagonist to said subject. In
other aspect the present invention provides a method for the
prophylaxis of pain in a subject, said method comprising
administering a c-Fms antagonist to said subject. "Prophylaxis" as
used in this context refers to methods which aim to prevent the
onset of a disease or which delay the onset of a disease.
[0101] In certain aspects, the present invention provides a
composition comprising an c-Fms antagonist for use in the treatment
of osteoarthritis, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents.
[0102] In certain aspect the present invention provides a
composition comprising an c-Fms antagonist for use in the treatment
of pain, said composition further comprising one or more
pharmaceutically acceptable carriers and/or diluents.
[0103] In other aspects, the present invention provides the use of
a c-Fms antagonist in the preparation of a medicament in the
treatment of osteoarthritis.
[0104] In other aspects the present invention provides the use of a
c-Fms antagonist in the preparation of a medicament in the
treatment of pain.
[0105] In other aspects, the present invention provides c-Fms
antagonists for the treatment of osteoarthritis.
[0106] In other aspects the present invention provides c-Fms
antagonists for the treatment of pain.
[0107] The compositions of the present invention are preferably
pharmaceutical compositions comprising a c-Fms antagonist and a
pharmaceutically acceptable carrier, diluent or excipient, for the
treatment of osteoarthritis and/or pain. Such carriers, diluents
and excipients are well known in the art, and the skilled artisan
will find a formulation and a route of administration best suited
to treat a subject with the c-Fms antagonists of the present
invention.
EXAMPLES
Example 1
Therapeutic Effectiveness of c-Fms Antagonists in the Treatment of
OA and Pain
[0108] In this experiment we used a monoclonal antibody specific
for c-Fms to demonstrate that a M-CSF antagonist can be effective
to treat osteoarthritis. The same experiment also demonstrates the
usefulness of the c-Fms antagonists for treatment of pain.
[0109] Collagen-Induced OA Mouse Model:
[0110] The collagenase-induced OA model (Blom et al. (2004)
Osteoarthritis Cartilage.12; 627-35; Blom et al. (2007) Arthritis
Rheum. 56; 147-57) is a model based on induction of joint
instability by unilateral intra-articular injection of collagenase.
This causes weakening of ligaments that normally help stabilize the
joint, which subsequently leads to OA pathology within 6 weeks
after induction. No direct damage of the cartilage by the injected
collagenase is observed in this model. The features of OA pathology
include cartilage destruction, synovial fibrosis and osteophyte
formation. There is activation of the synovial membrane with
synovial macrophages mediating osteophyte formation. During the
early phase of OA development (day 0-14), osteophyte formation and
fibrosis are evident. The positions in the joint where the new
formation of bone first occurs (in the periosteum near the
cartilage surface and at sites of bone-ligament junctions) are
similar to those seen in human OA. The process of new bone
formation is also similar, with activation of the periosteum,
followed by the generation of cartilage-like tissue and
subsequently endochondral ossification. During the first 2 weeks of
disease synovial pathology is also evident, with an influx of
macrophages leading to thickening of the synovial lining, and some
inflammatory cells in the deep synovial layer. Full OA pathology
including cartilage matrix erosion is not seen until 6 weeks post
OA induction.
[0111] Outline of the Experiments:
[0112] C57BL/6 mice were given 1 unit of collagenase type VII
intra-articularly into the right knee on days 0 and 2 to induce
joint instability (see Blom et al. (2004) Osteoarthritis
Cartilage.12; 627-35).
[0113] Pain was used as an indicator in the OA models. The
differential distribution of the body weight as a measure of pain
was recorded using an Incapacitance Meter. This measures changes in
weight distribution between the operated and contralateral,
unoperated hind limb. Mice were allowed to acclimatize to the
equipment on three occasions prior to the experiment. Weight placed
on each hind limb was be measured over a 5 second period. Three
separate measurements were taken per mouse for each time point.
[0114] Once the average pain reading was significantly lower than
at day 0 (i.e. before induction of OA), mice were randomly divided
into 2 groups (15 mice/group), such that the mean pain
reading.+-.SEM was similar for each group and each cage contained
mice from each treatment group (i.e. 6 mice/cage, 2 mice in each
treatment group). This was to avoid all mice from the same
treatment group being from the same cage, which may affect the
results.
[0115] Anti-c-Fms Antibody Treatment:
[0116] 30 mice were randomly divided into 2 groups (15
mice/group):
[0117] Group 1 (n=15): anti-c-Fms antibody
[0118] Group 2 (n=15): IgG2a isotype control antibody.
[0119] Antibody ASF98 (IgG2a isotype) was used as an exemplary
anti-c-Fms antibody (obtained from Prof. S. Nishikawa, Kyoto
University; Oncogene (1995) 11, 2469-76; AFS98 is also available
from eBioscience, San Diego, Calif., USA, Cat. No. 14-1152-81).
ASF98 is a rat antibody reactive with mouse c-Fms. ASF98 was
reported to neztralize M-CSF signaling (Sudo et al., Oncogene
(1995) 11, 2469-76).
[0120] Mice were treated intraperitoneally, two times per week
following the onset of pain on day 20 with 300 .mu.g
anti-c-Fms-antibody/mouse/treatment, until the end of the
experiments after 6 weeks. Both, the control antibody and the
anti-c-Fms antibody were purified to contain less than 10 Endotoxin
Units/ml.
[0121] Results
[0122] The mean pain reading at day 20 post OA induction was
significantly higher (i.e. a significant shift in weight away from
the arthritic knee) than at day 0 (p<0.0001 for all mice). Mice
were divided into 2 treatment groups at day 20 and treated
2.times./week with the appropriate mAb until day 42.
[0123] Following the commencement of mAb treatment (day 20), mice
treated with the control mAb continued to show significant pain
compared to day 0, until the end of the experiment. Following
anti-CSF1R-treatment, the pain readings did not continue to
increase (i.e. there was no increased shift in weight away from the
arthritic knee) such that on days 28 and 31 there was a significant
difference between the anti-CSF1R mAb-treated and control
mAb-treated groups (p50.05).
[0124] Results are shown in FIG. 1. Mice treated with a c-Fms
antagonist showed less disease, as determined by incapacitance,
compared to mice treated with the control antibody. This
demonstrates that c-Fms antagonists are effective in the treatment
of OA and pain.
Example 2
Histological Observations
[0125] The samples of Example 1 were also examined
histologically.
[0126] 6-weeks post final injections, histology was performed on
the mice knee joints. The knee joints were collected, fixed,
de-calcified, embedded in paraffin and cut at 7 .mu.m with a
microtome. Slides were stained with Safranin-O/Fast Green and
Haematoxylin and Eosin to demonstrate joint pathology. Pathology
investigated includes: cartilage damage, synovitis, osteophyte
formation and joint deformation.
[0127] The scoring system used for cartilage pathology is as
follows:
TABLE-US-00004 Grade 0 Normal 1 Irregular but intact 1.5 Irregular
with rough surface 2 Superficial fibrillation 2.5 Superficial
fibrillation with reduced cells in cartilage layer 3 Vertical
fissures 3.5 Branching and/or horizontal fissures, tidemark
ruptures 4 Cartilage loss not extending to the tide mark 4.5
Cartilage loss extending to the tide mark 5 Cartilage loss beyond
the tide mark but not extending to the bone 5.5 Cartilage loss
extending to the bone 6 Bone loss/remodeling/deformation Stage 1
<10% area damaged 2 10-25% area damaged 3 25-50% area damaged 4
50-75% area damaged
[0128] The grade is multiplied by the stage to give the score.
[0129] This scoring system is based on a recognized method to
assess OA histopathology in clinical and experimental OA. See
Pritzker et al. (2006) Osteoarthritis Cartilage; 14; 13-29. Grade
is defined as OA depth progression into cartilage. Stage is defined
as the horizontal extent of cartilage involvement, i.e. how much of
the cartilage is affected. Grade is multiplied by the stage to give
the score to give an overall score, so as to represent a combined
assessment of OA severity and extent. Up to six sections were
scored per mouse.
[0130] Grade is multiplied by the stage to give the score.
[0131] The following scoring system is used for synovitis (Synovial
layer scoring system):
TABLE-US-00005 0 No changes compared to normal joints 1 Thickening
of the synovial lining and some influx of inflammatory cells 2
Thickening of the synovial lining and intermediate influx of
inflammatory cells 3 Profound thickening of the synovial lining and
maximal observed influx of inflammatory cells
[0132] Results:
[0133] To determine whether therapeutic anti-c-Fms antibody
treatment had any effect on arthritis development, histology was
performed on the knee joints at day 42 (see FIG. 2). Anti-c-Fms
antibody treated mice had significantly milder disease in the
medial tibia (p.ltoreq.50.01) compared to control mAb-treated mice.
Generally, less severe disease was observed for all joint areas
analysed histologically in mice treated with the anti-c-Fms
antibody compared to the isotype control antibody (FIG. 2).
Example 3
c-Fms Antagonists are Effective in Treating Post-Surgical Pain
[0134] A pain model is used that mimics post surgical pain to
assess the efficacy of treatment with c-Fms antagonists.
[0135] Animals:
[0136] Male Sprague Dawley rats weighting between 220-240 grams are
acclimated to the animal facility for one week prior to
surgery.
[0137] Surgery:
[0138] The surgery is based on the procedure described in Brennan
et al, Pain 64:493-501, 1996. Animals are anesthetized with a 2%
isoflurane in air mixture that is maintained during surgery via a
nose cone. The planter surface of the right hind paw is prepared
with a povidone-iodine pad, and a 1-cm central longitudinal
incision is made through skin and fascia, starting 0.5 cm from the
edge of the heel and extending toward the toes. Measurements are
made with a ruler with the foot held in a flexed position. The
plantaris muscle is elevated using curved forceps and incised
longitudinally. The muscle is incised through its full depth,
between the origin and insertion. Bleeding is controlled throughout
surgery by pressure applied through a gauze pad. The wound is
closed with two mattress sutures (5-0 ethilon black monofilament).
These sutures are knotted 5-6 times, with the first knot loosely
tied. The wound site is swabbed with bacitracin solution. Animals
are allowed to recover and rest in clean cages for two hours or
more before behavioral testing began.
[0139] Evaluation of Resting Pain:
[0140] A cumulative pain score is used to assess pain related to
weight bearing. Animals are placed on a plastic mesh (grid: 8
mm.sup.2) in clear plastic cages that are elevated on a platform
(h: 18'') allowing inspection of the underside of their paws. After
a 20 minute acclimation period, weight bearing is assessed on a
scale of 0 to 2. A score of 0 is given if the paw is blanched or
pressed against the mesh, indicating full weight bearing. A score
of 1 is given if the paw is favored with the skin just touching the
mesh, with no blanching or indentation of the skin. A score of 2 is
given if the paw is held completely off the mesh. Flinching the paw
is considered a 2 if the rat is still at rest. Each animal is
observed for 1 minute every 5 minutes for minutes. The sum of 6
scores (0-12) obtained during 1/2-hour is used to assess pain in
the incised foot. Frequency of scores of 2 is also calculated and
used to assess the incidence of severe pain or total guarding of
the paw by the animal. Each animal is tested 24 hours before
surgery (baseline), and 2 h, 24 h, 48 h, and 72 h postoperatively.
The results of this experiment show that the cumulative resting
pain score observed in animals treated with c-Fms antagonists is
significantly reduced compared to control animals. Weight bearing
is a good correlate of how willing the animal is to use the limb,
and therefore is an effective measure of pain relief. Preferably,
the c-Fms antagonist is an antibody specific forc-Fms, specific for
IL-34 or specific for M-CSF. Such antibodies are injected intra
peritoneal (i.p.) at various concentrations of the antibody (e.g.
0.004, 0.01, 0.02, 0.1, 0.6, and 1 mg per kilogram of animal
weight) at 15 hours pre-incision. The negative control group
receives no antibody but is injected i.p. with a saline solution.
Fentanyl at 0.01 mg/kg is injected i.p. as a positive control 30
minutes before testing at 24 hours post-surgery. Each experiment
involves 8 animals (n=8 per group) for each condition, and the
control group has 56 animals. Surgery is performed and a cumulative
pain score is measured as described above. Resting pain is
evaluated twenty-four hours after the surgery.
[0141] c-Fms antagonists significantly reduce resting pain after
surgery when administered at 0.02 mg/kg to 1 mg/kg dosage.
[0142] In another experiment, the efficacy of c-Fms antagonists in
reducing post-surgical pain when administered post-surgically is
tested. M-CSF-specific, IL-34-specific or c-Fms-specific antibodies
are injected intravenously (i.v.) two hours after surgery. The
control group receives no antibody but was injected i.v. with a
saline solution. Surgery is performed and resting pain expressed as
a cumulative pain score is assessed 24 hours after surgery.
Treatment with c-Fms antagonist significantly reduces resting pain
at twenty-four hours after incision when the antibody is
administered 2 hours post-incision. These results demonstrates that
c-Fms antagonist effectively alleviated post-surgical pain when
administered after surgery.
[0143] Evaluation of Thermal Hyperalgesia:
[0144] Thermal hyperalgesia is assessed by the rat planter test
(Ugo Basile, Italy) following a modified method of Hargreaves et
al. (1988). Rats are habituated to the apparatus that consisted of
four individual plexiglass boxes on an elevated glass table. A
mobile radiant heat source is located under the table and focused
onto the hind paw. While the animal is still, but not sleeping, the
button on the control box is depressed, the radiant heat source
comes on and the time taken for the animal to withdraw from the
heat source is automatically recorded. This paw withdrawal latency
(POOL) is detected by a light detector embedded in the radiant heat
source that senses the movement of the rat paw by a change in
reflectance of the radiant source. Paw Withdrawal Latencies (PWL),
in seconds, were recorded: There is an automatic cut-off point of
22.5 s to prevent tissue damage. PWL are taken three to four times
for both hind paws of each animal, the mean of which represent base
lines for right and left hind paws. The results are presented as
the ratio of score measured in the right paw (site of surgery) and
the left paw. The apparatus is calibrated once (at the beginning of
the study) and set to intensity of 40 to give a normal PWL of
approximately 6 seconds. Each animal is tested 24 hours before
surgery (baseline), and 3 h, 24 h, 48 h, and 72 h postoperatively.
Thermal hyperalgesia measurements are taken after tactile allodynia
measurements. The results demonstrated that treatment with c-Fms
antagonists significantly reduced post-surgical thermal
hyperalgesia.
Example 4
c-Fms Antagonists are Effective in Treating Bone Cancer Pain
[0145] c-Fms antagonists, such as M-CSF-specific antibodies,
IL-34-specific antibodies or c-Fms-specific antibodies are
effective in treating cancer pain associated with bone
metastasis.
[0146] We use a murine bone cancer pain model to assess the
efficacy of treatment with c-Fms antagonists. This murine model of
bone cancer pain is developed by intramedullary injection of
osteolytic sarcoma cells into the mouse femur and the needle hole
is then filled with dental amalgam to confine the tumor to bone
(see Schwei et al, J: Neuroscience 19:10886-10897, 1999 and Luger
et al, Pain 99:397-406, 2002). Experiments are performed on adult
male C3H/HeJ mice. On day 0, an arthrotomy is performed following
induction of general anesthesia with sodium pentobarbital (50
mg/kg, intraperitoneal (i.p.)). A needle is inserted into the
medullary canal to create a pathway for the sarcoma cells. A
depression is then made using a pneumatic dental high speed
handpiece. In addition to naive animals (n=5), sham animals (n=5)
are generated with an injection of a minimum essential media (20
.mu.l, Sigma, St. Louis, Mo.) into the intramedullary space of the
femur (designated sham) whereas sarcoma animals (n=5 for each
condition tested) are injected with media containing 105 2472
osteolytic sarcoma cells (designated sarcoma or sarc) (20 .mu.l,
ATCC, Rockville, Md.). For all animals, the injection site is
sealed with a dental amalgam plug to confine the cells or injected
media within the intramedullary canal and followed by irrigation
with sterile water (hypotonic solution). Finally, incision closure
is achieved with wound clips. Clips are removed at day 5 so as not
to interfere with behavioral testing. A second group of
sarcoma-injected animals is treated with M-CSF-specific,
IL-34-specific or c-Fms-specific antibodies (e.g.10 mg/kg, i.p.) on
days 6 and 13.
[0147] Behavioral Analysis:
[0148] Animals are tested for pain-related behaviors on day 10 and
day 14 post-tumor implantation. Animals are behaviorally tested
using the following tests: ongoing pain (spontaneous guarding and
flinching), ambulatory pain (limb use and rotarod), and
movement-evoked pain (palpation-evoked guarding and
palpation-evoked flinching). Animals are placed in a clear plastic
observation box with a wire mesh floor and are allowed to habituate
for a period of 30 min. After acclimation, spontaneous guarding,
spontaneous flinching, limb use during normal ambulation in an open
field, and guarding during forced ambulation is assessed.
Palpation-induced guarding and flinching are measured after the 2
min period of normally non-noxious palpation of the distal femur in
sarcoma- and sham-injected animals.
[0149] The number of spontaneous flinches and time to spent
guarding, representative of nociceptive behavior, are recorded
simultaneously during a 2-min observation period. Guarding is
defined as the time the hindpaw is held aloft while ambulatory and
flinches are the number of times the animal held the limb aloft.
Normal limb use during spontaneous ambulation is scored on a scale
of 5 to 0: (5) normal use, and (0) complete lack of limb use.
[0150] Forced ambulatory guarding is determined using a rotarod
(Columbus Instruments, Columbus, Ohio). The rotated machine has a
revolving rod and is equipped with speed, acceleration, and
sensitivity controls. The animals are placed on the rod with
.times.4 speed, 8.0 acceleration, and 2.5 sensitivity. Forced
ambulatory guarding is rated on a scale of 5-0: (5) normal use, and
(0) complete lack of use. After a normally non-noxious palpation of
the distal femur in animals every second for 2 min, the animals are
placed in the observation box and their palpation-induced guarding
and palpation-induced flinching is measured for an additional 2
min.
[0151] Treatment with c-Fms Antagonists:
[0152] On day 6 and day 13, sarcoma-injected animals are
intraperitoneally (i.p.) injected with M-CSF antagonists, such as
an anti-M-CSF, an anti-IL-34 or an anti-c-Fms receptor antibody
(n=5), or sarcoma- and sham-injected animals were injected (i.p.)
with saline (n=5 for each condition). All animals are behaviorally
analyzed on days 10 and 14.
[0153] Evaluation of Ongoing Pain Behaviors:
[0154] Sarcoma-injected animals (administered with saline) develop
statistically significant ongoing pain behaviors, as assessed by
spontaneous guarding and spontaneous, as compared to sham injected
animals (administered with saline).
[0155] Administration of c-Fms antagonists significantly reduce
spontaneous guarding and spontaneous flinching in sarcoma-injected
mice on day 10 and day 14 post-sarcoma implantation as compared to
administration of saline to sarcoma-injected mice. These results
indicate that M-CSF antagonists reduce ongoing pain in
sarcoma-injected mice.
[0156] Evaluation of Ambulator Pain Behaviors:
[0157] Sarcoma-injected animals (administered with saline) develop
ambulatory pain behaviors as assessed by limb use and forced
ambulation guarding (rotarod), as compared to sham-injected animals
(administered with saline). Administration of c-Fms antagonists
significantly increases limb use score and forced ambulatory
guarding score in sarcoma-injected mice on day 10 -and day 14
post-sarcoma implantation, as compared to administration of saline
to sarcoma-injected mice. These results indicate that c-Fms
antagonists reduce ambulatory pain in sarcoma-injected mice.
[0158] Evaluation of Touch-Evoked Pain Behaviors:
[0159] Sarcoma injected animals (administered with saline) develop
touch-evoked pain behaviors as assessed by palpation-induced
guarding and palpation-induced flinching, as compared to
sham-injected animals (administered with saline). Administration of
c-Fms antagonists significantly reduces palpation-induced guarding
and palpation-induced flinching in sarcoma-injected mice on day 10
and day 14 post-sarcoma implantation as compared to administration
of saline to sarcoma-injected mice. These results indicate that
c-Fms antagonists reduce touch-evoked pain in sarcoma-injected
mice.
Example 5
Analgesic Effects of c-Fmsantagonists
[0160] The analgesic effects of c-Fms antagonists in complete
Freund's adjuvant (CFA)-induced chronic arthritis in rats is
investigated using the vocalization test, in comparison with
indomethacine used as reference substance.
[0161] Fifty (50) male Lewis rats (LEWIS LEW/Crl lco) weighing 150
g to 220 g at the beginning of the experimental phase are included
in this study. All animals are kept for at least 5 days before the
experiment, and are housed in a temperature (19.5-24.5.degree. C.),
relative humidity (45-65%) and 12-h light/dark cycle controlled
room with ad libitum access to filtered tap-water and standard
pelleted laboratory chow throughout the study. Animals are
individually identified on the tail.
[0162] On day 0 (D0), arthritis is induced in rats by intradermal
injection into the tail of 0.05 ml of a Mycobacterium butyricum
suspension in mineral oil (10 mg/ml). On day 14 (D14), arthritic
rats are included in the study according to their ability to
vocalize upon gentle flexion of the hindpaw and by their arthritis
index, evaluated using an inflammation score for each hind and
forepaw (see Kuzuna et al, Chem. Pharm. Bull. (Tokyo) 23:1184-1191,
1975 and Pearson et al, Arthritis Rheum. 2:440-459, 1959).
[0163] Animals are scored based on the following criteria: Score 0:
normal aspect; Score 1: erythema; Score 2: erythema with slight
edema; Score 3: strong inflammation without ankylosis; Score 4:
ankylosis. Only animals able to vocalize upon gentle flexion and
presenting a score of 2 or 3 are included in the study.
[0164] Four groups of 10 rats each are included in the study. For
group 1 (vehicle), on day 14 (D14), after selection, rats are
intravenously administered by vehicle (saline). On day 18 (D18),
the nociceptive intensity is evaluated by gentle flexion of the
hindpaw and the intensity of the level of vocalization is recorded
for each animal. For group 2 (4 days), on D 14, after selection,
rats are intravenously administered M-CSF-specific antibody. On day
18 (D18), the nociceptive intensity is evaluated by gentle flexion
of the hindpaw and the intensity of the level of vocalization is
recorded for each animal. For group 3 (24 hours), on day 17 after
injection of CFA, rats are intravenously administered
M-CSF-specific antibody or M-CSF receptor-specific antibody. The
nociceptive intensity is evaluated by gentle flexion of the hindpaw
24 hours later, and the intensity of the level of vocalization is
recorded for each animal. For group 4 (indomethacin), on day 18
(D18), the nociceptive intensity is evaluated by gentle flexion of
the hindpaw one hour after oral administration of indomethacin (10
mg/kg). The intensity of the level of vocalization is also recorded
for each animal. The test substances are administered in a blind
and random manner by intravenous route under a volume of 5 ml/kg,
whereas indomethacin was administered by oral route under a volume
of 10 ml/kg.
[0165] c-Fms antagonists show an significant analgesic effects.
Statistical significance between the treated groups and the vehicle
group are determined with a Dunnett's test using the residual
variance after a one-way analysis of variance. M-CSF-specific
antibody and M-CSF receptor-specific antibody significantly reduces
pain in a rat model of rheumatoid arthritis 24 hours or 4 days
after a single administration of the antibody. The same result will
be achieved with an IL-34-specific antibody.
Example 6
c-Fms Antagonists are Effective in Treating Inflammatory Pain/mBSA
Model
[0166] The following experiment demonstrates that c-Fms antagonists
are also effective in the treatment of inflammatory pain. To do so,
mBSA/IL-1 monoarticular arthritis is induced in M-CSF knock-out
mice and in control mice. Pain is assessed with or without
administration of indomethacin, a pain relieving substance, at
various time points using an incapacitance tester.
[0167] Mice
[0168] 24 male C57BL/6 mice and 24 male M-CSF -/- mice are used in
four treatment groups: [0169] Group 1: M-CSF KO (n=12): methylated
BSA/IL-1 [0170] Group 2: M-CSF KO (n=12): methylated
mBSA/IL-1+indomethacin [0171] Group 3: C57BL/6 wildtype (n=12):
methylated BSA/IL-1 [0172] Group 4: C57BL/6 wildtype (n=12):
methylated BSA/IL-1+indomethacin
[0173] Induction of Monoarticular Arthritis
[0174] Monoarticular arthritis is induced by intraarticular
injection of 10 .mu.l of mBSA (20 mg/ml) in saline into the knee
joint and 10 .mu.l of saline into the contralateral knee joint. 20
.mu.l of IL-1.beta. (250 ng) is subcutaneously administered daily
for 3 days. A response typically develops between days 4 and 7
after injection of mBSA and resolves by day 28. Incapacitance is
tested on days 2, 3, 4, 5 and 7.
[0175] Indomethacin (Sigma) is a non-steroidal anti-inflammatory
drug commonly used to reduce fever, pain, stiffness, and swelling.
It works by inhibiting the production of prostaglandins. 1 mg/kg
i.p. indomethacin is administered to groups 2 and 4 one hour before
pain was assessed using a capacitance meter.
[0176] Read out for Pain
[0177] An Incapacitance Tester (Dual Weight Averager) is used to
automatically and reproducibly assess the analgesic potency by
measuring the weight distribution on the two hind paws. The force
exerted by each limb (measured in grams) is averaged over a user
selectable period thus indicating any tendency for the animal to
shift its weight from one side to another, hence providing a
quantitative measurement of incapacitance.
[0178] Weight placed on each hind limb is measured over a 5 second
period. 3 separate measurements taken per mouse for each time point
are averaged. Results are expressed as injected limb/control
limb.times.100. Thus a value of 100 means that equal weight is
being placed on the right and the left limb. A value below 100
means less weight is being placed on the injected limb (left)
compared with the control limb (right).
[0179] Results
[0180] This model induces synovitis in the knee joint via the
injection of mBSA. At day 7, the knee joints were examined visually
and given a score from 0 (normal) to 3 (severely inflamed). The
left knee, which was injected with mBSA, is significantly more
inflamed compared to the right knee (injected with saline). In
fact, all right knees (injected with saline) received a score of 0.
There is no significant differences between mice treated with
indomethacin and those not for either strain.
[0181] C57BL/6 mice show significantly more pain (as measured by a
shift in weight away from the mBSA-injected knee) compared to
M-CSF-/- mice when mBSA/IL-1 monoarticular arthritis is induced
(FIG. 3).
[0182] C57BL/6 mice treated with indomethacin show significantly
less pain compared with those mice not treated with indomethacin
following mBSA/IL-1 monoarticular arthritis induction, such that
the readings are similar to M-CSF-/- mice. As M-CSF-/- did not
exhibit pain, indomethacin treatment had no effect.
[0183] These results indicate that C57BL/6 mice develop significant
pain from day 4 onwards in a mBSA/IL-1 monoarticular arthritis
model, whereas M-CSF-/- mice do not show any significant signs of
pain. Antagonists of c-Fms are therefore highly effective in the
treatment of inflammatory pain.
Example 7
c-Fms Antagonists are Effective in Treating Inflammatory Pain/CFA
Model
[0184] The following experiment is an additional experiment
demonstrating the effectiveness of c-Fms antagonists in the
treatment of inflammatory pain. Here, inflammatory pain is induced
with Complete Freund's Adjuvant. As in Experiment 6, pain is
assessed with or without administration of indomethacin, a pain
relieving substance, at various time points using an incapacitance
meter.
[0185] Mice
[0186] 12 male C57BU6 mice and 12 male M-CSF -/- mice) are used in
each of the three treatment groups: [0187] Group 1: C57BL/6
wildtype (n=12): CFA [0188] Group 2: C57BL/6 wildtype (n=12):
CFA+indomethacin [0189] Group 3: M-CSF KO (n=12): CFA
[0190] Induction of Inflammatory Pain
[0191] Complete Freund's Adjuvant (CFA) (Sigma) contains the
heat-killed Mycobacterium tuberculosis strain, H37Ra, in mineral
oil at a concentration of 1 mg/ml. CFA is mixed thoroughly by
vortexing to ensure that the heat-killed bacteria are incorporated
in the suspension (Kamala T (Hock immunization: a humane
alternative to mouse footpad injections. J Immunol Methods
328:204-214.2007). Immediately after vortexing, the adjuvant is
drawn into a glass syringe using a 19-gauge needle. Bubbles are
carefully eliminated from the syringe and the needle is removed.
Each mouse is injected subcutaneously in the left hind paw
(footpad) with 20 .mu.l of the CFA emulsion. 1 mg/kg i.p.
indomethacin (see Experiment 6) is administered to mice of Group 2,
one hour before pain assessment.
[0192] Read Out for Pain
[0193] As in Experiment 6 an Incapacitance Tester (Dual Weight
Averager) is used for the automatic and reproducible assessment of
analgesic potency by measuring the weight distribution on the two
hind paws. Weight placed on each hind limb is measured over a 5
second period. 3 separate measurements are taken per mouse for each
time point then averaged. Results are expressed as injected
limb/control limb.times.100. Thus a value of 100 means that equal
weight is being placed on the right and the left limb. A value
below 100 means less weight is being placed on the injected limb
(left) compared with the control limb (right). Incapacitance is
tested after 24, 48 and 72 h hours post injection of CFA.
[0194] Results
[0195] Following s.c. injection of CFA into the left footpad, mice
develop swelling of the left footpad, which is similar in magnitude
in C57BL/6 (Group 1) and M-CSF-/- mice (Group 3). C57BU6 mice
treated with indomethacin (Group 2) also show no difference in the
degree of swelling. There is no swelling of the contralateral
(right) foot in any of the groups.
[0196] Assessment of weight distribution, as a measure of pain,
show that C57BL/6 mice developed pain over time which is
significantly greater than in M-CSF-/- mice at 48 and 72 hours post
CFA injection. Strikingly M-CSF-/- mice do not develop any pain.
Treatment of C57BL/6 mice with indomethacin alleviates the pain
such that the readings are no different to those for M-CSF-/- mice.
At 72 hrs post CFA injection C57BL/6 mice treated with indomethacin
have significantly less pain than C57BL/6 mice not treated with
indomethacin.
[0197] The degree of swelling of the footpad following CFA
injection is no different in M-CSF-/- mice compared with C57BL/6
mice. Furthermore, indomethacin treatment of C57BL/6 mice has no
effect on swelling, which is likely due to the fact that it is only
given one hour prior to the incapacitance readings. Thus the
majority of swelling already occurs before the first indomethacin
injection is given at 24 hours.
[0198] In contrast, following CFA injection, C57BL/6 mice develop
significant pain which is reduced by indomethacin. M-CSF-/- mice,
on the other hand, do not show any signs of pain. Hence these
experiments strikingly show that although the footpads of all mice
are inflamed following CFA injection, M-CSF -/- mice do not show
any signs of pain.
Example 8
Clinical Trial
[0199] A clinical trial is performed in adult patients suffering
from osteoarthritis of the knee. The objective of the randomized,
double-blind, placebo-controlled clinical trial is to determine the
comparative differences between the c-Fms antagonists of the
present invention and placebo in overall pain relief and quality of
life in a total sample of 30 patients with diagnosed osteoarthritis
(OA) of the knee. Another objective is to determine the safety and
tolerability of the c-Fms antagonists of the present invention as
determined by the adverse events, physical examination and vital
signs.
[0200] Methods:
[0201] Thirty patients (about 15 adult males and 15 adult females),
aged 40 and over, with a clinical diagnosis of osteoarthritis of
the knee(s) and verified knee pain for at least 15 days in the
month prior to testing are enrolled in the study. Patients receive
a therapeutically effective amount of c-Fms antagonists or a
placebo (e.g. once every two weeks for about six months).
[0202] The Western Ontario and McMaster Universities Osteoarthritis
Index (WOMAC; Bellamy et al, J Rheumatol 15(12):1833-40, 1988) and
the SF-36v2 Quality of Life instrument scales (Quality Metric
Health Outcomes Solutions, Lincoln, R.I.) are used in the study.
The WOMAC is a disease-specific, self-administered, health status
measure. It probes clinically-important symptoms in the areas of
pain, stiffness and physical function in patients with
osteoarthritis of the hip and/or knee. The index consists of 24
questions (5-pain, 2-stiffness and 17-physical function) and can be
completed in less than 5 minutes. The WOMAC is a valid, reliable
and sensitive instrument for the detection of clinically important
changes in health status following a variety of interventions
(pharmacologic, nutritional, surgical, physiotherapy, etc.). The
WOMAC questionnaire is valid for assessing the effects of
intervention on hip or knee osteoarthritis. The SF-36v2 Quality of
Life instrument is a multi-purpose, short-form health survey with
36 questions. It yields an 8-scale profile of functional health and
well-being scores as well as psychometrically-based physical and
mental health summary measures and a preference-based health
utility index. It is a generic measure, as opposed to one that
targets a specific age, disease, or treatment group. Accordingly,
the SF-36v2 has proven useful in surveys of general and specific
populations, comparing the relative burden of diseases, and in
differentiating the health benefits produced by a wide range of
different treatments. The SF-36v2 yields information on the
following aspects and subsets of health; Physical Health (comprised
of physical functioning, role-physical, bodily pain and general
health) and Mental Health (comprised of vitality, social
functioning, role-emotional and mental health).
[0203] Results:
[0204] Change in bodily pain: The improvement in SF-36v2 bodily
pain is statistically significant in patients treated with the
c-Fms antagonists of the present invention as compared with
placebo. A higher score is better because it means the patient
feels less pain after taking the product. There is a statistical
significant improvement in the bodily-pain score in the group that
received the c-Fms antagonists of the present invention versus the
placebo group.
[0205] Change in role-physical score: The superior effect of the
c-Fms antagonists of the present invention compared with the
placebo is statistically significant in week 8, week 12, and week
20 in terms of role limitations due to physical health (role
physical). A higher score is better because it means that the
patient noticed a physical improvement and a reduction in the
limitations suffered in activities of daily living. There is a
statistical significant improvement in the role-physical score in
the group that received the c-Fms antagonists of the present
invention versus the placebo group.
[0206] Change in the total WOMAC score: The total WOMAC score of
the group treated with the c-Fms antagonists of the present
invention is statistical significantly better than the total WOMAC
score of the placebo group (a lower score is better).
[0207] Change in WOMAC ADL: The improvement in activities of daily
living (measured as a WOMAC ADL sub-score) is greater in the group
treated with the c-Fms antagonists of the present invention than in
the placebo group. There is an statistically significant
improvement in the WOMAC ADL score in the group treated with the
c-Fms antagonists of the present invention compared to the placebo
group (a lower score is better).
[0208] Conclusions:
[0209] The clinical trial shows the efficacy of the c-Fms
antagonists of the present invention in improving the quality of
life of patients with osteoarthritis of the knee. The results of
the clinical trial also show the product's safety and tolerance,
given that no serious adverse effects were found.
[0210] The efficacy of the c-Fms antagonists of the present
invention can also be established through studies in other species
to which the c-Fms antagonists of the present invention are
cross-reactive (e.g. on horses in order to evaluate joint
movement); and by using in vitro studies to determine the ability
of c-Fms antagonists of the present invention to inhibit IL-1
-induced agrecan degradation, conducting the assay on condrocyte
cultures.
Example 9
Therapeutic Effectiveness of an Antibody Specific for M-CSF in the
Treatment of OA and Pain
[0211] Example 1 was repeated utilizing an antibody specific for
M-CSF. As described herein above the collagenase-induced OA model
is based on Blom et al. (2004) Osteoarthritis Cartilage.12; 627-35
and Blom et al. (2007) Arthritis Rheum. 56; 147-57. Unless
indicated, the experimental details are the same as outlined in
Example 1.
[0212] Antibody MOR13503 was used as antibody specific for M-CSF.
MOR13503 is a recombinant anti-mouse M-CSF antibody of IgG2a
isotype. The antibody was generated by MorphoSys AG (Martinsried,
Germany).
[0213] 30 mice were randomly divided into 2 groups (15
mice/group):
[0214] Group 1 (n=15): anti-M-CSF antibody
[0215] Group 2 (n=15): IgG2a isotype control antibody.
[0216] Mice were treated intraperitoneally, two times per week
following the onset of pain on day 20 with 150 .mu.g
anti-M-CSF-antibody/mouse/treatment, until the end of the
experiments after 6 weeks. Both, the control antibody and the
anti-M-CSF antibody were purified to contain less than 10 Endotoxin
Units/ml.
[0217] Pain was evident at day 20 post arthritis induction
(p<0.004, day 20 vs. day 0, all mice). It was observed that
treatment with an anti-M-CSF antibody prevented an increase in the
degree of pain as compared to the isotype control antibody (see
FIG. 3).
[0218] Those skilled in the art will appreciate that the invention
described herein is susceptible to variations and modifications
other than those specifically described. It is to be understood
that the invention includes all such variations and modifications.
The invention also includes all of the steps, features,
compositions and compounds referred to or indicated in this
specification, individually or collectively, and any and all
combinations of any two or more of said steps or features.
Sequence CWU 1
1
31554PRTHomo sapiensSOURCE1..554/mol_type="protein"
/note="M-CSF/CSF1 (UniProt P09603)" /organism="Homo sapiens" 1Met
Thr Ala Pro Gly Ala Ala Gly Arg Cys Pro Pro Thr Thr Trp Leu 1 5 10
15 Gly Ser Leu Leu Leu Leu Val Cys Leu Leu Ala Ser Arg Ser Ile Thr
20 25 30 Glu Glu Val Ser Glu Tyr Cys Ser His Met Ile Gly Ser Gly
His Leu 35 40 45 Gln Ser Leu Gln Arg Leu Ile Asp Ser Gln Met Glu
Thr Ser Cys Gln 50 55 60 Ile Thr Phe Glu Phe Val Asp Gln Glu Gln
Leu Lys Asp Pro Val Cys 65 70 75 80Tyr Leu Lys Lys Ala Phe Leu Leu
Val Gln Asp Ile Met Glu Asp Thr 85 90 95 Met Arg Phe Arg Asp Asn
Thr Pro Asn Ala Ile Ala Ile Val Gln Leu 100 105 110 Gln Glu Leu Ser
Leu Arg Leu Lys Ser Cys Phe Thr Lys Asp Tyr Glu 115 120 125 Glu His
Asp Lys Ala Cys Val Arg Thr Phe Tyr Glu Thr Pro Leu Gln 130 135 140
Leu Leu Glu Lys Val Lys Asn Val Phe Asn Glu Thr Lys Asn Leu Leu 145
150 155 160Asp Lys Asp Trp Asn Ile Phe Ser Lys Asn Cys Asn Asn Ser
Phe Ala 165 170 175 Glu Cys Ser Ser Gln Asp Val Val Thr Lys Pro Asp
Cys Asn Cys Leu 180 185 190 Tyr Pro Lys Ala Ile Pro Ser Ser Asp Pro
Ala Ser Val Ser Pro His 195 200 205 Gln Pro Leu Ala Pro Ser Met Ala
Pro Val Ala Gly Leu Thr Trp Glu 210 215 220 Asp Ser Glu Gly Thr Glu
Gly Ser Ser Leu Leu Pro Gly Glu Gln Pro 225 230 235 240Leu His Thr
Val Asp Pro Gly Ser Ala Lys Gln Arg Pro Pro Arg Ser 245 250 255 Thr
Cys Gln Ser Phe Glu Pro Pro Glu Thr Pro Val Val Lys Asp Ser 260 265
270 Thr Ile Gly Gly Ser Pro Gln Pro Arg Pro Ser Val Gly Ala Phe Asn
275 280 285 Pro Gly Met Glu Asp Ile Leu Asp Ser Ala Met Gly Thr Asn
Trp Val 290 295 300 Pro Glu Glu Ala Ser Gly Glu Ala Ser Glu Ile Pro
Val Pro Gln Gly 305 310 315 320Thr Glu Leu Ser Pro Ser Arg Pro Gly
Gly Gly Ser Met Gln Thr Glu 325 330 335 Pro Ala Arg Pro Ser Asn Phe
Leu Ser Ala Ser Ser Pro Leu Pro Ala 340 345 350 Ser Ala Lys Gly Gln
Gln Pro Ala Asp Val Thr Gly Thr Ala Leu Pro 355 360 365 Arg Val Gly
Pro Val Arg Pro Thr Gly Gln Asp Trp Asn His Thr Pro 370 375 380 Gln
Lys Thr Asp His Pro Ser Ala Leu Leu Arg Asp Pro Pro Glu Pro 385 390
395 400Gly Ser Pro Arg Ile Ser Ser Leu Arg Pro Gln Gly Leu Ser Asn
Pro 405 410 415 Ser Thr Leu Ser Ala Gln Pro Gln Leu Ser Arg Ser His
Ser Ser Gly 420 425 430 Ser Val Leu Pro Leu Gly Glu Leu Glu Gly Arg
Arg Ser Thr Arg Asp 435 440 445 Arg Arg Ser Pro Ala Glu Pro Glu Gly
Gly Pro Ala Ser Glu Gly Ala 450 455 460 Ala Arg Pro Leu Pro Arg Phe
Asn Ser Val Pro Leu Thr Asp Thr Gly 465 470 475 480His Glu Arg Gln
Ser Glu Gly Ser Phe Ser Pro Gln Leu Gln Glu Ser 485 490 495 Val Phe
His Leu Leu Val Pro Ser Val Ile Leu Val Leu Leu Ala Val 500 505 510
Gly Gly Leu Leu Phe Tyr Arg Trp Arg Arg Arg Ser His Gln Glu Pro 515
520 525 Gln Arg Ala Asp Ser Pro Leu Glu Gln Pro Glu Gly Ser Pro Leu
Thr 530 535 540 Gln Asp Asp Arg Gln Val Glu Leu Pro Val 545 550
2972PRTHomo sapiensSOURCE1..972/mol_type="protein" /note="M-CSF
receptor /CSF1R" /organism="Homo sapiens" 2Met Gly Pro Gly Val Leu
Leu Leu Leu Leu Val Ala Thr Ala Trp His 1 5 10 15 Gly Gln Gly Ile
Pro Val Ile Glu Pro Ser Val Pro Glu Leu Val Val 20 25 30 Lys Pro
Gly Ala Thr Val Thr Leu Arg Cys Val Gly Asn Gly Ser Val 35 40 45
Glu Trp Asp Gly Pro Pro Ser Pro His Trp Thr Leu Tyr Ser Asp Gly 50
55 60 Ser Ser Ser Ile Leu Ser Thr Asn Asn Ala Thr Phe Gln Asn Thr
Gly 65 70 75 80Thr Tyr Arg Cys Thr Glu Pro Gly Asp Pro Leu Gly Gly
Ser Ala Ala 85 90 95 Ile His Leu Tyr Val Lys Asp Pro Ala Arg Pro
Trp Asn Val Leu Ala 100 105 110 Gln Glu Val Val Val Phe Glu Asp Gln
Asp Ala Leu Leu Pro Cys Leu 115 120 125 Leu Thr Asp Pro Val Leu Glu
Ala Gly Val Ser Leu Val Arg Val Arg 130 135 140 Gly Arg Pro Leu Met
Arg His Thr Asn Tyr Ser Phe Ser Pro Trp His 145 150 155 160Gly Phe
Thr Ile His Arg Ala Lys Phe Ile Gln Ser Gln Asp Tyr Gln 165 170 175
Cys Ser Ala Leu Met Gly Gly Arg Lys Val Met Ser Ile Ser Ile Arg 180
185 190 Leu Lys Val Gln Lys Val Ile Pro Gly Pro Pro Ala Leu Thr Leu
Val 195 200 205 Pro Ala Glu Leu Val Arg Ile Arg Gly Glu Ala Ala Gln
Ile Val Cys 210 215 220 Ser Ala Ser Ser Val Asp Val Asn Phe Asp Val
Phe Leu Gln His Asn 225 230 235 240Asn Thr Lys Leu Ala Ile Pro Gln
Gln Ser Asp Phe His Asn Asn Arg 245 250 255 Tyr Gln Lys Val Leu Thr
Leu Asn Leu Asp Gln Val Asp Phe Gln His 260 265 270 Ala Gly Asn Tyr
Ser Cys Val Ala Ser Asn Val Gln Gly Lys His Ser 275 280 285 Thr Ser
Met Phe Phe Arg Val Val Glu Ser Ala Tyr Leu Asn Leu Ser 290 295 300
Ser Glu Gln Asn Leu Ile Gln Glu Val Thr Val Gly Glu Gly Leu Asn 305
310 315 320Leu Lys Val Met Val Glu Ala Tyr Pro Gly Leu Gln Gly Phe
Asn Trp 325 330 335 Thr Tyr Leu Gly Pro Phe Ser Asp His Gln Pro Glu
Pro Lys Leu Ala 340 345 350 Asn Ala Thr Thr Lys Asp Thr Tyr Arg His
Thr Phe Thr Leu Ser Leu 355 360 365 Pro Arg Leu Lys Pro Ser Glu Ala
Gly Arg Tyr Ser Phe Leu Ala Arg 370 375 380 Asn Pro Gly Gly Trp Arg
Ala Leu Thr Phe Glu Leu Thr Leu Arg Tyr 385 390 395 400Pro Pro Glu
Val Ser Val Ile Trp Thr Phe Ile Asn Gly Ser Gly Thr 405 410 415 Leu
Leu Cys Ala Ala Ser Gly Tyr Pro Gln Pro Asn Val Thr Trp Leu 420 425
430 Gln Cys Ser Gly His Thr Asp Arg Cys Asp Glu Ala Gln Val Leu Gln
435 440 445 Val Trp Asp Asp Pro Tyr Pro Glu Val Leu Ser Gln Glu Pro
Phe His 450 455 460 Lys Val Thr Val Gln Ser Leu Leu Thr Val Glu Thr
Leu Glu His Asn 465 470 475 480Gln Thr Tyr Glu Cys Arg Ala His Asn
Ser Val Gly Ser Gly Ser Trp 485 490 495 Ala Phe Ile Pro Ile Ser Ala
Gly Ala His Thr His Pro Pro Asp Glu 500 505 510 Phe Leu Phe Thr Pro
Val Val Val Ala Cys Met Ser Ile Met Ala Leu 515 520 525 Leu Leu Leu
Leu Leu Leu Leu Leu Leu Tyr Lys Tyr Lys Gln Lys Pro 530 535 540 Lys
Tyr Gln Val Arg Trp Lys Ile Ile Glu Ser Tyr Glu Gly Asn Ser 545 550
555 560Tyr Thr Phe Ile Asp Pro Thr Gln Leu Pro Tyr Asn Glu Lys Trp
Glu 565 570 575 Phe Pro Arg Asn Asn Leu Gln Phe Gly Lys Thr Leu Gly
Ala Gly Ala 580 585 590 Phe Gly Lys Val Val Glu Ala Thr Ala Phe Gly
Leu Gly Lys Glu Asp 595 600 605 Ala Val Leu Lys Val Ala Val Lys Met
Leu Lys Ser Thr Ala His Ala 610 615 620 Asp Glu Lys Glu Ala Leu Met
Ser Glu Leu Lys Ile Met Ser His Leu 625 630 635 640Gly Gln His Glu
Asn Ile Val Asn Leu Leu Gly Ala Cys Thr His Gly 645 650 655 Gly Pro
Val Leu Val Ile Thr Glu Tyr Cys Cys Tyr Gly Asp Leu Leu 660 665 670
Asn Phe Leu Arg Arg Lys Ala Glu Ala Met Leu Gly Pro Ser Leu Ser 675
680 685 Pro Gly Gln Asp Pro Glu Gly Gly Val Asp Tyr Lys Asn Ile His
Leu 690 695 700 Glu Lys Lys Tyr Val Arg Arg Asp Ser Gly Phe Ser Ser
Gln Gly Val 705 710 715 720Asp Thr Tyr Val Glu Met Arg Pro Val Ser
Thr Ser Ser Asn Asp Ser 725 730 735 Phe Ser Glu Gln Asp Leu Asp Lys
Glu Asp Gly Arg Pro Leu Glu Leu 740 745 750 Arg Asp Leu Leu His Phe
Ser Ser Gln Val Ala Gln Gly Met Ala Phe 755 760 765 Leu Ala Ser Lys
Asn Cys Ile His Arg Asp Val Ala Ala Arg Asn Val 770 775 780 Leu Leu
Thr Asn Gly His Val Ala Lys Ile Gly Asp Phe Gly Leu Ala 785 790 795
800Arg Asp Ile Met Asn Asp Ser Asn Tyr Ile Val Lys Gly Asn Ala Arg
805 810 815 Leu Pro Val Lys Trp Met Ala Pro Glu Ser Ile Phe Asp Cys
Val Tyr 820 825 830 Thr Val Gln Ser Asp Val Trp Ser Tyr Gly Ile Leu
Leu Trp Glu Ile 835 840 845 Phe Ser Leu Gly Leu Asn Pro Tyr Pro Gly
Ile Leu Val Asn Ser Lys 850 855 860 Phe Tyr Lys Leu Val Lys Asp Gly
Tyr Gln Met Ala Gln Pro Ala Phe 865 870 875 880Ala Pro Lys Asn Ile
Tyr Ser Ile Met Gln Ala Cys Trp Ala Leu Glu 885 890 895 Pro Thr His
Arg Pro Thr Phe Gln Gln Ile Cys Ser Phe Leu Gln Glu 900 905 910 Gln
Ala Gln Glu Asp Arg Arg Glu Arg Asp Tyr Thr Asn Leu Pro Ser 915 920
925 Ser Ser Arg Ser Gly Gly Ser Gly Ser Ser Ser Ser Glu Leu Glu Glu
930 935 940 Glu Ser Ser Ser Glu His Leu Thr Cys Cys Glu Gln Gly Asp
Ile Ala 945 950 955 960Gln Pro Leu Leu Gln Pro Asn Asn Tyr Gln Phe
Cys 965 970 3242PRTHomo sapiensSOURCE1..242/mol_type="protein"
/note="IL-34 (UniProt Q6ZMJ4)" /organism="Homo sapiens" 3Met Pro
Arg Gly Phe Thr Trp Leu Arg Tyr Leu Gly Ile Phe Leu Gly 1 5 10 15
Val Ala Leu Gly Asn Glu Pro Leu Glu Met Trp Pro Leu Thr Gln Asn 20
25 30 Glu Glu Cys Thr Val Thr Gly Phe Leu Arg Asp Lys Leu Gln Tyr
Arg 35 40 45 Ser Arg Leu Gln Tyr Met Lys His Tyr Phe Pro Ile Asn
Tyr Lys Ile 50 55 60 Ser Val Pro Tyr Glu Gly Val Phe Arg Ile Ala
Asn Val Thr Arg Leu 65 70 75 80Gln Arg Ala Gln Val Ser Glu Arg Glu
Leu Arg Tyr Leu Trp Val Leu 85 90 95 Val Ser Leu Ser Ala Thr Glu
Ser Val Gln Asp Val Leu Leu Glu Gly 100 105 110 His Pro Ser Trp Lys
Tyr Leu Gln Glu Val Glu Thr Leu Leu Leu Asn 115 120 125 Val Gln Gln
Gly Leu Thr Asp Val Glu Val Ser Pro Lys Val Glu Ser 130 135 140 Val
Leu Ser Leu Leu Asn Ala Pro Gly Pro Asn Leu Lys Leu Val Arg 145 150
155 160Pro Lys Ala Leu Leu Asp Asn Cys Phe Arg Val Met Glu Leu Leu
Tyr 165 170 175 Cys Ser Cys Cys Lys Gln Ser Ser Val Leu Asn Trp Gln
Asp Cys Glu 180 185 190 Val Pro Ser Pro Gln Ser Cys Ser Pro Glu Pro
Ser Leu Gln Tyr Ala 195 200 205 Ala Thr Gln Leu Tyr Pro Pro Pro Pro
Trp Ser Pro Ser Ser Pro Pro 210 215 220 His Ser Thr Gly Ser Val Arg
Pro Val Arg Ala Gln Gly Glu Gly Leu 225 230 235 240Leu Pro
* * * * *