U.S. patent application number 15/857354 was filed with the patent office on 2018-06-07 for aberrant cell-restricted immunoglobulins provided with a toxic moiety.
This patent application is currently assigned to APO-T B.V.. The applicant listed for this patent is APO-T B.V.. Invention is credited to Johan Renes, Paulus J. Steverink, Ralph Alexander Willemsen.
Application Number | 20180154013 15/857354 |
Document ID | / |
Family ID | 47682044 |
Filed Date | 2018-06-07 |
United States Patent
Application |
20180154013 |
Kind Code |
A1 |
Renes; Johan ; et
al. |
June 7, 2018 |
ABERRANT CELL-RESTRICTED IMMUNOGLOBULINS PROVIDED WITH A TOXIC
MOIETY
Abstract
Described are immunoglobulins provided with a toxic moiety,
comprising at least an immunoglobulin variable region that
specifically binds to an MHC-peptide complex preferentially
associated with aberrant cells. These immunoglobulins provided with
a toxic moiety are preferably used in selectively modulating
biological processes. The provided immunoglobulins provided with a
toxic moiety are of particular use in pharmaceutical compositions
for the treatment of diseases related to cellular aberrancies, such
as cancers and autoimmune diseases.
Inventors: |
Renes; Johan; (Amersfoort,
NL) ; Steverink; Paulus J.; (Huizen, NL) ;
Willemsen; Ralph Alexander; (Rotterdam, NL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
APO-T B.V. |
Oss |
|
NL |
|
|
Assignee: |
APO-T B.V.
Oss
NL
|
Family ID: |
47682044 |
Appl. No.: |
15/857354 |
Filed: |
December 28, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14372094 |
Jul 14, 2014 |
|
|
|
PCT/NL2013/050014 |
Jan 11, 2013 |
|
|
|
15857354 |
|
|
|
|
61586568 |
Jan 13, 2012 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/34 20130101;
A61P 35/00 20180101; A61K 2039/505 20130101; C07K 16/2833 20130101;
C07K 16/30 20130101; C07K 16/32 20130101; C07K 16/3069 20130101;
A61K 47/6813 20170801; C07K 2319/33 20130101; C07K 16/2884
20130101; C07K 2317/76 20130101; A61K 47/6851 20170801; A61K
47/6809 20170801; C07K 2317/569 20130101; C07K 2317/32 20130101;
A61K 47/6883 20170801; C07K 16/3092 20130101; C07K 16/40 20130101;
A61K 47/6849 20170801; C07K 16/085 20130101; C07K 16/084
20130101 |
International
Class: |
A61K 47/68 20170101
A61K047/68; C07K 16/30 20060101 C07K016/30; C07K 16/08 20060101
C07K016/08; C07K 16/28 20060101 C07K016/28; C07K 16/40 20060101
C07K016/40; C07K 16/32 20060101 C07K016/32 |
Claims
1. An immunoglobulin provided with a toxic moiety, comprising at
least an immunoglobulin variable region that specifically binds to
an MHC-peptide complex preferentially associated with aberrant
cells.
2. The immunoglobulin according to claim 1, wherein said
immunoglobulin variable region is a Vh or Vhh.
3. The immunoglobulin according to claim 2, wherein said
immunoglobulin variable region further comprises a Vl.
4. The immunoglobulin according to claim 3, which is a human
IgG.
5. The immunoglobulin of claim 1, wherein the MHC-peptide complex
is specific for aberrant cells.
6. The immunoglobulin of claim 1, wherein the toxic moiety is
chemically linked to the immunoglobulin.
7. The immunoglobulin of claim 1, wherein the toxic moiety is a
fusion protein, fused to the immunoglobulin at the DNA level.
8. A pharmaceutical composition comprising: the immunoglobulin of
claim 1, and suitable diluents and/or excipients.
9. A method of treating a host suffering from a disease associated
with aberrant cells, the method comprising: utilizing an
immunoglobulin provided with a toxic moiety of claim 1, for the
treatment of the host suffering from a disease associated with
aberrant cells.
10. The method according to claim 9, wherein the toxic moiety is
internalized into the aberrant cell.
11. A method of treating a subject determined to be suffering from
cancer, the method comprising: utilizing the immunoglobulin of
claim 1 to treat cancer.
12. The method according to claim 11, wherein at least the toxic
moiety is internalized into an aberrant cell of the subject.
13. An immunoglobulin provided with a toxic moiety according to
FIG. 5B.
14. The immunoglobulin of claim 5, wherein the MHC-peptide complex
is specific for aberrant cells through a peptide derived from
MAGE.
15. The immunoglobulin of claim 14, wherein the MAGE is MAGE-A.
16. The immunoglobulin of claim 7, wherein the toxic moiety is a
fusion protein fused to the immunoglobulin at the DNA level through
a linking sequence.
17. An immunoglobulin chemically linked with a toxic moiety
comprising: at least a Vh or Vhh immunoglobulin variable region
that specifically binds to an MHC-peptide complex, which is derived
from MAGE, preferentially associated with aberrant cells, wherein
the immunoglobulin is a human IgG.
18. The immunoglobulin of claim 17 wherein the immunoglobulin
variable region is a Vl.
19. The immunoglobulin of claim 17, wherein the MAGE is MAGE-A.
20. The immunoglobulin of claim 1, wherein the toxic moiety is a
fusion protein fused to the immunoglobulin at the DNA level through
a linking sequence.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of co-pending U.S. patent
application Ser. No. 14/372,094, filed Jul. 14, 2014, which is a
national phase entry under 35 U.S.C. .sctn. 371 of International
Patent Application PCT/NL2013/050014, filed Jan. 11, 2013,
designating the United States of America and published in English
as International Patent Publication WO2013/105856 A1 on Jul. 18,
2013, which claims the benefit under Article 8 of the Patent
Cooperation Treaty to U.S. Ser. No. 61/586,568, filed Jan. 13,
2012, the contents of each of which is incorporated herein by this
reference.
TECHNICAL FIELD
[0002] The application relates to the field of biotherapeutics.
More specifically, the application relates to immunoglobulins
provided with a toxic moiety. Even more specifically, the
application relates to human antibodies. The application also
relates to the use of these biotherapeutics in the treatment of a
host suffering from a disease associated with aberrant cells, such
as cancers and autoimmune diseases.
BACKGROUND
[0003] The development of immunoglobulin-drug conjugates is one of
the drug development fields that receives high attention nowadays.
Humanized or human antibodies are the largest and most important
class of immunoglobulins under investigation for use in
antibody-drug conjugates (ADCs) and in immunotoxins and
antibody-radionuclide conjugates. These antibodies target binding
sites (over)expressed at aberrant cells, such as those exposed in
cancers and (auto)immune (immune or autoimmune) diseases, and
during infections. Many of the conjugates have a limited degree of
efficacy. For example, the maximum tolerated dose of immunotoxins
is relatively low due to their toxicity towards healthy tissue.
Lowering the dose is one way of protecting healthy cells for the
non-specific toxic activity of the toxin or the drug in ADCs.
Lowering the dose, however, hampers the delivery of an efficacious
amount of conjugate at the site of, e.g., a tumor. The unwanted
side reactions are mainly due to the targeting of the antibodies to
binding sites that are not exclusively exposed by aberrant cells
but also to some extent by healthy cells. Thus, insufficient
specificity for aberrant cells over healthy cells hampers desired
efficacy and hampers obtaining the desired safety profiles of the
nowadays immunoglobulin-drug conjugates.
[0004] Toxic moieties currently in the clinic or under
investigation are numerous and diverse [6]. Amongst the first
toxins that were chemically linked to murine antibodies are plant
derived protein toxins and bacterial toxins such as saporin,
Diphtheria toxin, Pseudomonas exotoxin, gelonin, ricin, ricin A
chain, abrin and pokeweed antiviral protein. Other immunoglobulins
provided with a toxin moiety comprise single chain Fv fused at the
DNA level with toxins. An example is the recombinant protein BL22
consisting of the Fv portion of an anti-human CD22 antibody fused
to a fragment of Pseudomonas exotoxin-A, that targets B-cell
malignancies such as hairy cell leukemia and non-Hodgkin's
lymphoma. Other examples of immunoglobulins conjugated to toxins
are the antibody-radionuclide conjugates. Human CD20 has been
chosen by drug developers as the target for two monoclonal
antibodies, conjugated with 90-Yttrium or with 131-Iodine, for
treatment of non-Hodgkin's lymphomas. In attempts to improve the
tumor selectivity of certain drugs, murine monoclonal antibodies
were conjugated to compounds such as doxorubicin, vinblastine,
methotrexate, providing so-called antibody-drug conjugates.
Insufficient tumor cell specificity, however, still limited the
therapeutic usefulness. Even when selecting tumor cell surface
antigens that are (highly) over-expressed at aberrant cells, still
the low expression levels at healthy cells gives rise to
insufficient selectivity of the antibody-drug conjugates. Current
cytotoxic anti-tumor drugs under investigation are, e.g.,
maytansinoids and dolastatin analogs, that both target
intracellular tubulin, and duocarmycins and calicheamicins that
target DNA structure. These compounds are potent in their cytotoxic
activity, though not selective for aberrant cells. Antibiotic
calicheamicin conjugated to an anti-human CD33 monoclonal antibody
was approved and used in the clinic, but was withdrawn due to
serious side effects. Additional examples of drugs currently under
investigation for their potential beneficial use in antibody-drug
conjugates meant for the treatment of cellular aberrancies are
ozogamicin, hydrazone-calicheamicin, vedotin, emtansine,
mertansine. These toxic moieties are conjugated to immunoglobulins
targeting cell surface markers expressed at tumor cells, though
also expressed to some extent at healthy cells. Typical examples of
immunoglobulin-drug conjugate-targeted cell surface markers present
at both tumor cells and healthy cells are CD19, CD20, CD22, CD25,
CD30, CD33, CD56, CD70, HER2/neu. All these immunoglobulin-drug
conjugate development programs, thus, inherently bear the risk for
unacceptable safety profiles and consequent poor efficacy due to
low maximum tolerated doses. Conjugating drugs, radionuclides or
toxins to immunoglobulins specifically and selectively targeting
aberrant cells and not targeting healthy cells would thus provide
for therapies with improved specificity and selectivity for
aberrant cells and with an improved safety profile.
SUMMARY HEREOF
[0005] Described is the specific and selective delivery of a toxic
moiety in target aberrant cells demands for binding molecules
specific for binding sites preferentially associated with aberrant
cells. These binding molecules then are used as carriers and
transporters of the toxic moieties, specifically and selectively
delivering the toxic moieties at and in the aberrant cells.
Disclosed are immunoglobulin-drug conjugates comprising these
preferred features. The immunoglobulins in the immunoglobulin-drug
conjugates hereof comprise immunoglobulin binding regions with
improved selectivity for aberrant cells by specifically binding to
binding sites preferentially associated with these aberrant cells.
Disclosed as preferred targets for the antibody hereof, are
intracellular proteins that are associated with aberrant cells.
These proteins are available as peptides presented by MHC on the
surface of aberrant cells. The use of MHC-peptide complexes as
targets opens us a new field of tumor targets, because so far,
typically, targets associated with the surface of aberrant cells
have been envisaged. Although it is preferred that the target be
specific for aberrant cells (tumor cells) in many cases upregulated
intracellular proteins are also suitable for at least improving the
therapeutic window of immunotoxins. The most preferred targets are
peptides derived from MAGE presented in the context of MHC-1. In
particular, MAGE peptides that are present in more than one MAGE
protein (multi-MAGE epitope; see, WO2012/091564, incorporated
herein by this reference). The toxic moiety hereof is preferably a
drug compound, a radionuclide or a toxin. The toxic moiety hereof
is a non-proteinaceous molecule or a proteinaceous molecule. In the
immunoglobulin-drug conjugates hereof, the toxic moiety is
preferably conjugated by chemical conjugation. Also preferred are
immunoglobulins hereof fused at the DNA level to a proteinaceous
toxic moiety.
[0006] The immunoglobulins in the immunoglobulin-drug conjugates
hereof are suitable for the specific and selective localization of
a toxic effect inside targeted aberrant cells, leaving healthy
cells essentially unaffected. Immunoglobulins comprise
immunoglobulin binding domains, referred to as immunoglobulin
variable domains, comprising immunoglobulin variable regions.
Maturation of immunoglobulin variable regions results in variable
domains adapted for specific binding to a target binding site.
Immunoglobulins are, therefore, particularly suitable for providing
the immunoglobulin-drug conjugates hereof with the ability to
specifically and selectively target aberrant cells. At their
surface, aberrant cells present aberrant cell-associated antigen
peptides in the context of major histocompatibility complex (MHC).
Therefore, for the immunoglobulins in the immunoglobulin-drug
conjugates hereof, aberrant cell-associated MHC-1 peptide complexes
are a preferred target on aberrant cells. In addition, aberrant
cell-associated MHC-2 peptide complexes are valuable targets on,
e.g., tumors of hematopoietic origin, for the immunoglobulins in
the immunoglobulin-drug conjugates hereof. The disclosure,
therefore, provides immunoglobulins in immunoglobulin-drug
conjugates, with improved specificity and selectivity for aberrant
cells by targeting MHC-peptide complexes, which are preferentially
associated with aberrant cells. This improved specificity and
selectivity for aberrant cells is accompanied with a reduced level
of unintentional targeting of healthy cells by the immunoglobulins
in the immunoglobulin-drug conjugates hereof. Most preferably,
healthy cells are not targeted by the immunoglobulin-drug
conjugates hereof. Thus, in a first embodiment, provided is an
immunoglobulin provided with a toxic moiety, comprising at least an
immunoglobulin variable region that specifically binds to an
MHC-peptide complex preferentially associated with aberrant cells.
Preferred immunoglobulins hereof are antibodies, but fragments
and/or derivatives such as Fab and/or ScFv can also be used. Even
more preferred immunoglobulins hereof are antibodies of the
immunoglobulin G (IgG) type. Other immunoglobulins hereof are,
e.g., heavy-chain (only) antibodies comprising Vh or Vhh and IgA,
and their fragments such as Fab fragments, and Fab fragments of
IgG's. Immunoglobulins bind via their immunoglobulin variable
regions to binding sites on molecules, such as epitopes, with a
higher binding affinity than background interactions between
molecules. In the context hereof, background interactions are
typically interactions with an affinity lower than a K.sub.D of
10E-4 M. Immunoglobulin variable domains in light chains (Vl) and
immunoglobulin variable domains in heavy chains (Vh) of antibodies
typically comprise the aberrant-cell specific immunoglobulin
variable regions hereof. Thus, in one embodiment, provided is an
immunoglobulin provided with a toxic moiety, comprising at least an
immunoglobulin variable region, wherein the immunoglobulin variable
region is a Vh(h) that specifically binds to an MHC-peptide complex
preferentially associated with aberrant cells. Thus, in yet another
embodiment, also provided is an immunoglobulin provided with a
toxic moiety, comprising at least an immunoglobulin variable
region, wherein the immunoglobulin variable region is a Vh that
specifically binds to an MHC-peptide complex preferentially
associated with aberrant cells, and wherein the immunoglobulin
variable region further comprises a Vl.
[0007] As said, immunoglobulins G are particularly suitable binding
molecules for use in therapies specifically and selectively
targeting aberrant cells, for site-specific delivery of a toxic
moiety, according to the disclosure. Because the anticipated
predominant use of the antibodies is in therapeutic treatment
regimes meant for the human body, in a particular embodiment, the
immunoglobulins provided with a toxic moiety have an amino-acid
sequence of human origin. Thus, in one embodiment, provided is a
human IgG provided with a toxic moiety, comprising at least an
immunoglobulin variable region, wherein the immunoglobulin variable
region is a Vh that specifically binds to an MHC-peptide complex
preferentially associated with aberrant cells, and wherein the
immunoglobulin variable region further comprises a Vl. Of course,
humanized antibodies, with the precursor antibodies encompassing
amino acid sequences originating from other species than human, are
also part hereof. Also part hereof are chimeric antibodies,
comprising (parts of) an immunoglobulin variable region hereof
originating from a species other than human, and grafted onto a
human antibody.
[0008] An aberrant cell is defined as a cell that deviates from its
healthy normal counterparts. Aberrant cells are, e.g., tumor cells,
cells invaded by a pathogen such as a virus, and autoimmune
cells.
[0009] Thus, in one embodiment, provided is an immunoglobulin
according to any of the aforementioned embodiments, wherein the
MHC-peptide complex is specific for aberrant cells.
[0010] In the described molecules hereof, the toxic moieties are
preferably chemically linked to the immunoglobulins via any linker
chemistry know in the art, and optionally via an additional spacer.
According to the disclosure, one or several, preferably two to six
toxic moiety molecules are chemically linked to an immunoglobulin
molecule hereof. The number of conjugated toxic moiety molecules
per single immunoglobulin molecule is restricted by boundaries such
as the number of available sites for conjugation on the
immunoglobulin, the stability of the conjugate, the preservation of
the ability of the immunoglobulin to specifically bind to an
aberrant cell, etc. Of course, also two, three, etc., different
toxic moieties can be linked to an immunoglobulin, depending
amongst others on available binding sites and the applied linker
chemistry. Chemical linking of the toxic moieties has several
advantages when working with immunoglobulins. This way, toxic
moieties cannot interfere with expression, folding, assembly and
secretion of the immunoglobulin molecules. Thus, in one embodiment,
provided is an immunoglobulin according to any of the
aforementioned embodiments, wherein the toxic moiety is chemically
linked to the immunoglobulin. It is then also part of the current
disclosure that toxic moieties are covalently bound via peptide
bonds, and preferably via a peptide linker, to the immunoglobulins
hereof. The toxic moiety and the immunoglobulin are then fused at
the DNA level. Thus, in one embodiment, provided is an
immunoglobulin according to any of the aforementioned embodiments,
wherein the toxic moiety is a protein, preferably fused to the
immunoglobulin at the DNA level, preferably through a linker
sequence. In many instances, a simple Gly-Ser linker of 4-15
amino-acid residues may suffice, but if greater flexibility between
the immunoglobulin and the toxic moiety is desired longer or more
complex linkers may be used. Preferred linkers are
(Gly.sub.4Ser).sub.n, (GlySerThrSerGlySer).sub.n,
GlySerThrSerGlySerGlyLysProGlySerGlyGluGlySerThrLysGly (SEQ ID NO:
108),
GlyPheAlaLysThrThrAlaProSerValTyrProLeuAlaProValLeuGluSerSerGlySerGly
(SEQ ID NO:109) or any other linker that provides flexibility
allowing protein folding, stability against undesired proteolytic
activity and flexibility for the immunoglobulins hereof to exert
their activity. Another group of preferred linkers are linkers
based on hinge regions of immunoglobulins. These linkers tend to be
quite flexible and quite resistant to proteases. The most preferred
linkers based on hinge regions are GluProLysSerCysAspLysThrHisThr
[SEQ ID NO:110] (linking Ch1 and Ch2 in IgG1),
GluLeuLysThrProLeuGlyAspThrThrHisThr [SEQ ID NO:111] (IgG3), and
GluSerLysTyrGlyProPro [SEQ ID NO:112] (IgG4). Thus, the role of any
applied chemical linker in conjugates hereof or the role of any
applied peptide linker in fused molecules hereof is aiding the dual
activity of the antibodies hereof, i.e., specific and selective
binding of the immunoglobulin to aberrant cells, and subsequent
delivery of at least the toxic moiety in the targeted aberrant
cells. Thus, in one embodiment, provided is the use of an
immunoglobulin provided with a toxic moiety, according to any of
the aforementioned embodiments, for the treatment of a host
suffering from a disease associated with aberrant cells. In a
further embodiment, provided is the use of an immunoglobulin
provided with a toxic moiety, according to any of the
aforementioned embodiments, for the treatment of a host suffering
from a disease associated with aberrant cells, wherein at least the
toxic moiety is internalized into the aberrant cell. According to
the disclosure, the immunoglobulins provided with a toxic moiety
are, e.g., used for the treatment of cancer. Thus, in a preferred
embodiment, provided is an immunoglobulin provided with a toxic
moiety, according to any of the aforementioned embodiments for use
in the treatment of cancer.
[0011] Preferred toxic moieties are numerous. Several examples of
preferred toxic moieties are drugs such as doxorubicin, cisplatin,
carboplatin, vinblastine, methotrexate, chelated radioactive metal
ions, (synthetic) antineoplastic agents such as monomethyl
auristatin E, radioactive iodine, radionuclides such as 90-Yttrium,
131-Iodine, to name a few, which are chemically conjugated to the
immunoglobulins. Also, preferred toxic moieties are proteinaceous
toxins such as a fragment of Pseudomonas exotoxin-A, statins, ricin
A, gelonin, saporin, interleukin-2, interleukin-12, viral proteins
E4orf4, apoptin and NS1, and non-viral proteins HAMLET, TRAIL and
mda-7. Thus, in one embodiment, antibodies are provided for the
specific targeting of aberrant cells, wherein the toxic moiety is
selected from the list of available toxic moieties comprising
toxins such as a fragment of Pseudomonas exotoxin-A, statins,
chelated radioactive metal ions, radioactive iodine, ricin A,
gelonin, saporin, interleukin-2, interleukin-12, radionuclides such
as 90-Yttrium, 131-Iodine, drugs such as doxorubicin, taxol or
derivatives, 5-FU, anthracyclines, vinca alkaloids, calicheamicins,
cisplatin, carboplatin, vinblastine, methotrexate, (synthetic)
antineoplastic agents such as monomethyl auristatin E, apoptin,
parvovirus-H1 NS1 protein, E4orf4, TRAIL, mda-7, HAMLET.
[0012] Per the disclosure, proteinaceous molecules are molecules
comprising at least a string of amino acid residues. In addition,
the proteinaceous molecules may comprise carbohydrates, disulphide
bonds, phosphorylations, sulphatations, etc.
[0013] When antibodies are designed to first bind to a target
aberrant cell, followed by internalization, the toxic moiety can
then, subsequently, have its intracellular (cytotoxic) function,
i.e., inducing apoptosis.
[0014] For administration to subjects, the antibodies are
formulated. Typically, these antibodies will be given parenterally.
For formulation simply water (saline) for injection may suffice.
For stability reasons more complex formulations may be necessary.
The disclosure contemplates lyophilized compositions as well as
liquid compositions, provided with the usual additives. Thus, in
one embodiment, provided is a pharmaceutical composition comprising
an immunoglobulin provided with a toxic moiety, according to any of
the aforementioned embodiments and suitable diluents and/or
excipients.
[0015] The dosage of the antibodies may be established through
animal studies, (cell-based) in vitro studies and clinical studies
in so-called rising-dose experiments. Typically, the doses will be
comparable with present day antibody dosages (at the molar level).
Typically, such dosages are 3-15 mg/kg body weight, or 25-1000 mg
per dose.
[0016] In addition, especially in the more difficult to treat
cellular aberrancies, the first applications of the antibodies
will, at least initially, probably take place in combination with
other treatments (standard care). Of course, also provided are
antibodies for use in novel or first treatments of any malignancy
accompanied by the occurrence of aberrant cells, for which current
treatments are not efficient enough or for which currently no
treatment options are available. Thus, e.g., also provided is a
pharmaceutical composition comprising an invented immunoglobulin
provided with a toxic moiety and a conventional cytostatic and/or
tumoricidal agent. Moreover, also provided is a pharmaceutical
composition comprising an invented immunoglobulin provided with a
toxic moiety for use in an adjuvant treatment of cancer. Thus, in
one embodiment, an invented immunoglobulin provided with a toxic
moiety for use in an adjuvant treatment of cancer is provided.
Additionally, also provided is a pharmaceutical composition
comprising an invented immunoglobulin provided with a toxic moiety
for use in a combination chemotherapy treatment of cancer. Examples
of chemotherapeutical treatments that are combined with the
pharmaceutical composition of the current disclosure are etoposide,
paclitaxel, cisplatin, doxorubicin and methotrexate.
[0017] The pharmaceutical compositions will typically find their
use in the treatment of cancer, particularly in forms of cancer
where the targets of the preferred antibodies hereof (complexes of
MEW and tumor-specific antigen peptides) are presented by the
tumors. Table 1, e.g., gives a list of tumors on which complexes of
MEW and MAGE-A peptides have been found. It is easy using an
antibody hereof to identify tumors that present these target
MHC-peptide complexes. This can be done in vitro or in vivo
(imaging).
[0018] It is preferred that the cell-surface molecules comprising
the binding sites for the antibodies are internalized into the
targeted aberrant cell, together with the antibodies, or together
with at least the toxic moiety of the antibodies. In a particularly
preferred embodiment, the targeted aberrant cells go into apoptosis
as a result of the internalization. Thus, in one embodiment,
provided is the use of an immunoglobulin provided with a toxic
moiety, according to any of the aforementioned embodiments, for the
treatment of a host suffering from cancer, wherein at least the
toxic moiety is internalized into the aberrant cell.
[0019] Also described is a nucleic acid molecule encoding the
immunoglobulin part of an antibody, according to any of the
embodiments hereof, when the toxic moiety is chemically linked to
the immunoglobulin in the antibody hereof. Thus, the disclosure
also comprises a nucleic acid molecule encoding an immunoglobulin
and a toxic moiety, according to any of the embodiments hereof,
when the toxic moiety is fused to the immunoglobulin at the DNA
level. These molecules can be produced in prokaryotes or
eukaryotes. The codon usage of prokaryotes may be different from
that in eukaryotes. The nucleic acids can be adapted in these
respects. Also, elements that are necessary for secretion may be
added, as well as promoters, terminators, enhancers, etc. Also,
elements that are necessary and/or beneficial for the isolation
and/or purification of the immunoglobulins, or of the antibodies,
may be added. Typically, the nucleic acids are provided in an
expression vector suitable for the host in which they are to be
produced. Choice of a production platform will depend on the size
of the molecule, the expected issues around protein folding,
whether amino-acid sequences are present in the immunoglobulin or
in the antibody that requires glycosylation, expected issues around
isolation and/or purification, etc. For example, the presence of
disulfide bonds in immunoglobulins or proteinaceous toxins hereof
will typically guide the selection of the preferred production
platform. Thus, typically nucleic acids are adapted to the
production and purification platform in which the immunoglobulins
optionally with their fused proteinaceous toxins hereof are to be
produced. Thus, provided is a vector comprising a nucleic acid
molecule encoding an immunoglobulin or an antibody. For stable
expression in an eukaryote, it is preferred that the nucleic acid
encoding the immunoglobulin or the antibody be integrated into the
host cell genome (at a suitable site that is not silenced). In one
embodiment, the disclosure, therefore, comprises: a vector
comprising means for integrating the nucleic acid in the genome of
a host cell. The disclosure further comprises the host cell or the
organism in which the nucleic acid molecule enencoding the
immunoglobulin, optionally with their fused proteinaceous toxins,
is present and which is thus able to produce the immunoglobulin,
optionally with their fused proteinaceous toxins. Thus, in a
preferred embodiment, the disclosure comprises a cell comprising a
nucleic acid molecule hereof preferably integrated in its genome
and/or a vector hereof comprising a nucleic acid molecule encoding
an immunoglobulin optionally with their fused proteinaceous toxins
hereof.
[0020] Also disclosed is a method for producing an immunoglobulin
optionally with their fused proteinaceous toxins, comprising
culturing a cell hereof comprising a nucleic acid molecule encoding
an immunoglobulin optionally with their fused proteinaceous toxins,
preferably integrated in the cell's genome and/or a vector
comprising a nucleic acid molecule encoding an immunoglobulin
optionally with their fused proteinaceous toxins, allowing for
expression of the immunoglobulin optionally with their fused
proteinaceous toxins and separating the immunoglobulin optionally
with their fused proteinaceous toxins from the culture.
[0021] In one embodiment, the immunoglobulin variable domains in
the molecules target one binding site. Also bi-specific
immunoglobulins provided with a toxic moiety are provided that are
specifically binding to two different binding sites associated with
the cell surface of aberrant cells. By targeting with a single
antibody hereof two different binding sites on an aberrant cell
such as a tumor cell, the risk that both targets are also jointly
present on a healthy cell is significantly further diminished. The
affinity of the antibodies for the two different target binding
sites separately, preferably is designed such that K.sub.on and
K.sub.off are very much skewed towards binding to both different
binding sites simultaneously. Thus, the specificity of the
bi-specific antibodies is increased by increasing their specificity
for binding to two different binding sites associated with aberrant
cells. Thus, in one embodiment, the antibody, according to any of
the previous embodiments, is a hetero-dimeric bi-specific
immunoglobulin G or heavy-chain only antibody comprising two
different but complementary heavy chains. The two different but
complementary heavy chains may then be dimerized through their
respective Fc regions. Upon applying preferred pairing
biochemistry, hetero-dimers are preferentially formed over
homo-dimers. For example, two different but complementary heavy
chains are subject to forced pairing upon applying the
"knobs-into-holes" CH3 domain engineering technology as described
[Ridgway et al., Protein Engineering, 1996 (ref 14)]. In a
preferred embodiment, the two different immunoglobulin variable
regions in the bi-specific immunoglobulins hereof specifically bind
to an MHC-peptide complex preferentially associated with aberrant
cells.
[0022] Typical preferred antibodies are exemplified by the
antibodies outlined in this section, in FIG. 5B, and by the
examples provided below and in the Examples section. Thus, provided
is an immunoglobulin provided with a toxic moiety, according to
FIG. 5B.
BRIEF DESCRIPTION OF THE DRAWINGS
[0023] FIG. 1: Specific binding of HLA-A0201/multi-MAGE-A specific
phage clones isolated from a large human non-immune antibody Fab
phage library. Individual antibody Fab expressing phages that were
selected against biotinylated HLA-A0201/multi-MAGE-A were analyzed
by ELISA for their capacity to bind the relevant peptide/MHC
complex only. Streptavidin coated 96 well plates were incubated
with soluble HLA-A0201/multi-MAGE-A (A2/multiMage) or HLA-A0201/JCV
(A2/JC) peptide/MHC complexes (10 .mu.g/ml), washed to remove
non-bound complexes and incubated with individual phage clones.
Non-binding phages were first removed by three washes with
PBS/Tween, followed by incubation with anti-M13 antibody (1
.mu.g/ml, Amersham) for one hour by room temperature. Finally, the
wells were incubated with an HRP-labeled secondary antibody and
bound phages detected.
[0024] FIG. 2: Phages AH5, CB1 and CG1 specifically bind cells
presenting the multi-MAGE-A peptide. Phages AH5, CB1, CG1, BD5 and
BC7 that had shown specific binding in ELISA using the relevant
HLA-A201/multi-MAGE-A complex and an irrelevant HLA-A201 complex
loaded with a JCV peptide were analyzed for their capacity to bind
cells presenting the multi-MAGE-A peptide in HLA-A0201 molecules.
To this end, human B-LCL (BSM) were loaded with multi-MAGE-A
peptide (10 .mu.g in 100 .mu.l PBS) for 30 minutes at 37.degree.
C., followed by incubation with the Fab phages AH5, CB1, CG1, BD5
and BC7 and analyzed by flow-cytometry using anti-phage antibodies
and a fluorescently labeled secondary antibody.
[0025] FIG. 3: Phages expressing HLA-A2/multi-MAGE-A specific Fab
bind tumor cells of distinct histologic origin. Phages AH5, CB1 and
CG1 specific for HLA-A0201/multi-MAGE-A and a positive control
phage specific for HA-0101/MAGE-A1 were used for staining of
distinct tumor cell lines. To this end the prostate cancer cell
line LNCaP, the multiple myeloma cell line MDN, the melanoma cell
lines MZ2-MEL43 and G43, and the breast cancer cell line MDA-MD157
were incubated with the different phages (30 minutes at 4.degree.
C.), bound phages were then detected by flow cytometry using
anti-phage antibodies and fluorescently labeled secondary
antibodies.
[0026] FIG. 4: Phage AH5 specifically binds HLA-A0201/multi-MAGE-A
complexes only. To determine specificity of the phage AH5 an ELISA
was performed using relevant and irrelevant peptide/MHC complexes.
HLA-A0201 with multi-MAGE-A, gp100, JCV and MAGE-C2 peptides, as
well as HLA-A1 with MAGE-A1 peptide were coated on streptavidin 96
well plates and incubated with phage AH5.
[0027] FIG. 5: Cartoon displaying examples of preferred
immunoglobulins provided with a toxic moiety, according to the
disclosure.
[0028] A. Cartoon displaying the topology of the twelve
immunoglobulin domains assembled in an immunoglobulin G. B.
Examples are provided of preferred immunoglobulins provided with a
toxic moiety, according to the disclosure. Shown are
immunoglobulins provided with a single toxic moiety such as, e.g.,
a cytostatic agent, linked to the immunoglobulin with a chemical
linker (exemplified by I. and II.; immunoglobulin-toxic moiety
conjugates), or immunoglobulins provided with a single toxic
moiety, linked to the immunoglobulin with a peptide linker
(exemplified by III.; fused immunoglobulin-toxic moiety molecule).
In IV., an immunoglobulin provided with a toxic moiety hereof is
shown, comprising one immunoglobulin heavy chain comprising a fused
proteinaceous toxic moiety, comprising immunoglobulin variable
regions specific for a certain binding site, and comprising a
second immunoglobulin heavy chain comprising immunoglobulin
variable regions specific for a different binding site. Of course,
also part hereof are bi-specific immunoglobulins provided with a
toxic moiety hereof comprising two heavy chains comprising
different immunoglobulin variable regions specific for different
binding sites and further comprising the same or different
proteinaceous toxic moieties fused two the heavy chains. Of course,
as part hereof, more than one and typically two to six toxic moiety
molecules can be fused or conjugated to an immunoglobulin
molecule.
[0029] FIG. 6: Human Fab phage F9 specifically binds
HLA-A2/FLWGPRALV positive CMT64 mouse lung tumor cells.
[0030] Human Fab clone F9 was analyzed for its capacity to bind
mouse lung tumor cells (CMT64) stably expressing the
HLA-A2/FLWGPRALV [SEQ ID NO:23] complex. Purified Clone F9 Fab
fragments (3 .mu.g total) were incubated with 0.5.times.10.sup.6
CMT64 cells that do not express human HLA, that express
HLA-A2/YLEYRQVPG [SEQ ID NO:3] or that express HLA-A2/FLWGPRALV
[SEQ ID NO:23]. After one hour incubation on ice CMT64 cells were
incubated with a fluorescently labeled secondary antibody and
analyzed by flow cytometry.
[0031] FIG. 7: Llama VHH specifically binds CMT64 mouse lung tumor
cells expressing human HLA-A2/multi-MAGE-A.
[0032] Llama VHH specific for A2/FLW or A2/YLE were analyzed by
flow cytometry for their binding capacity to CMT64 cells expressing
these human HLA-A0201/multi-MAGE-A complexes. Purified VHH
fragments (3 .mu.g total) were incubated with 0.5.times.10.sup.6
CMT64 cells that do not express human HLA, that express
HLA-A2/YLEYRQVPG [SEQ ID NO:3] or that express HLA-A2/FLWGPRALV
[SEQ ID NO:23]. After one hour incubation on ice CMT64 cells were
incubated with a fluorescently labeled secondary antibody and
analyzed by flow cytometry.
DETAILED DESCRIPTION
[0033] One aspect of the disclosure relates to a method for
providing the described antibodies. As described herein above, it
typically involves providing a nucleic acid construct encoding the
desired immunoglobulin part of antibodies hereof, or encoding the
desired immunoglobulin fused to a proteinaceous toxic moiety. The
nucleic acid construct can be introduced, preferably via a plasmid
or expression vector, into a prokaryotic host cell and/or in a
plant cell and/or in a eukaryotic host cell capable of expressing
the construct. In one embodiment, a method hereof to provide an
immunoglobulin or to provide an immunoglobulin fused to a
proteinaceous toxic moiety, comprises the steps of providing a host
cell with the nucleic acid(s) encoding the immunoglobulin or the
immunoglobulin fused to a proteinaceous toxic moiety, and allowing
the expression of the nucleic acid(s) by the host cell.
[0034] Included herein is that nucleic acids encoding selected
(human) immunoglobulin Vh(h) domains, according to any of the
described embodiments, are combined with nucleic acids encoding
human immunoglobulin heavy chain constant domains, providing
nucleic acid molecules hereof enencoding a heavy chain of a human
antibody. The human antibody heavy chain protein product of such a
nucleic acid molecule hereof then may be hetero-dimerized with a
universal human antibody light chain. It is also part of the
disclosure that nucleic acids encoding (jointly) selected human
immunoglobulin Vl domains and Vh domains, according to any of the
described embodiments, are combined with nucleic acids encoding a
human immunoglobulin light chain constant domain and are combined
with nucleic acids encoding human immunoglobulin heavy chain
constant domains, respectively, providing nucleic acid molecules
enencoding a light chain and for a heavy chain of a human antibody.
In yet another embodiment, the nucleic acids encoding the
complementarity determining regions 1, 2 and 3 (CDR1, CDR2, CDR3),
forming together the immunoglobulin variable region of a selected
immunoglobulin Vh domain and/or a selected immunoglobulin Vl
domain, according to any of the described embodiments, are combined
with nucleic acids encoding human immunoglobulin Vh domain frame
work regions and/or human immunoglobulin Vl domain frame work
regions, respectively, providing nucleic acid molecules hereof
enencoding a heavy chain variable domain (Vh) of a human antibody
and/or enencoding a light chain variable domain (Vl) of a human
antibody (a method known in the art as "grafting"). These nucleic
acid molecules enencoding variable domains Vh and/or Vl are, as
part hereof, then combined with nucleic acids encoding human
immunoglobulin constant domains, providing a nucleic acid molecule
enencoding a human antibody heavy chain and/or providing a nucleic
acid molecule enencoding a human antibody light chain.
[0035] Immunoglobulins or immunoglobulins fused to a proteinaceous
toxic moiety are, e.g., expressed in plant cells, eukaryotic cells
or in prokaryotic cells. Non-limited examples of suitable
expression systems are tobacco plants, Pichia pastoris,
Saccharomyces cerevisiae. Also cell-free recombinant protein
production platforms are suitable. Preferred host cells are
bacteria, like, e.g., bacterial strain BL21 or strain SE1, or
mammalian host cells, more preferably human host cells. Suitable
mammalian host cells include human embryonic kidney (HEK-293)
cells, PerC6 cells or preferably Chinese hamster ovary (CHO) cells,
which can be commercially obtained. Insect cells, such as S2 or S9
cells, may also be used using baculovirus or insect cell expression
vectors, although they are less suitable when the immunoglobulins
or the fused immunoglobulins-toxic moiety molecules hereof include
elements that involve glycosylation. The produced immunoglobulins
or fused immunoglobulin-toxic moiety molecules hereof can be
extracted or isolated from the host cell or, if they are secreted,
from the culture medium of the host cell. Thus, in one embodiment,
a method hereof comprises providing a host cell with one or more
nucleic acid(s) encoding the immunoglobulin or the fused
immunoglobulin-toxic moiety molecule, allowing the expression of
the nucleic acids by the host cell. In another preferred
embodiment, a method hereof comprises providing a host cell with
one or more nucleic acid(s) encoding two or more different
immunoglobulins or two or more different fused immunoglobulin-toxic
moiety molecules, allowing the expression of the nucleic acids by
the host cell. For example, in one embodiment, nucleic acids
enencoding a so-called universal immunoglobulin light chain and
nucleic acids enencoding two or more different immunoglobulin heavy
chains are provided, enabling isolation of mono-specific
immunoglobulins or mono-specific fused immunoglobulin-toxic moiety
molecules comprising homo-dimers of heavy chains and/or enabling
isolation of bi-specific immunoglobulins or bi-specific fused
immunoglobulin-toxic moiety molecules comprising hetero-dimers of
heavy chains, with all different heavy chains complexed with a
universal light chain. Methods for the recombinant expression of
(mammalian) proteins in a (mammalian) host cell are well known in
the art.
[0036] As said, it is preferred that the immunoglobulins hereof are
linked with the toxic moieties via bonds and/or binding
interactions other than peptide bonds. Methods for linking
proteinaceous molecules such as immunoglobulins to other
proteinaceous molecules or non-proteinaceous molecules are numerous
and well known to those skilled in the art of protein linkage
chemistry. Protein linkage chemistry not based on peptide bonds can
be based on covalent interactions and/or on non-covalent
interactions. A typical example of linkage chemistries applicable
for linking toxic moieties to immunoglobulins hereof are the
various applications of the Universal Linkage System disclosed in
patent applications WO92/01699, WO96/35696, WO98/45304,
WO03040722.
[0037] As will be clear, an antibody finds its use in many
therapeutic applications and non-therapeutic applications, e.g.,
diagnostics, or scientific applications. Antibodies, or more
preferably the immunoglobulin part of the antibodies hereof,
suitable for diagnostic purposes are of particular use for
monitoring the expression levels of molecules exposing binding
sites on aberrant cells that are targeted by antibodies hereof. In
this way, it is monitored whether the therapy remains efficacious
or whether other antibodies hereof targeting one or two different
binding sites on the aberrant cells should be applied instead. This
is beneficial when the expression levels of the first or the first
two targeted binding site(s) are below a certain threshold, whereas
another or new binding sites (still) can serve as newly targeted
binding sites for antibodies hereof comprising the appropriate
specific immunoglobulin variable regions for these alternative
binding site(s). Antibodies hereof may also be used for the
detection of (circulating) tumor cells, and for the target-cell
specific delivery of immune-stimulatory molecules. For these later
two uses, the sole immunoglobulins hereof without the fused or
conjugated toxic moiety may also be used.
[0038] Provided herein is a method for inducing ex vivo or in vivo
a modulating effect on a biological process in a target cell,
comprising contacting the cell with an antibody hereof in an amount
that is effective to induce the modulating effect. Preferably, the
antibody hereof is used for a modulating effect on a biological
process of aberrant cells in a subject, more preferably a human
subject. For therapeutic applications in humans, it is, of course,
preferred that an antibody hereof does not contain amino acid
sequences of non-human origin. More preferred are antibodies
hereof, which only contain human amino acid sequences. Therefore, a
therapeutically effective amount of an antibody hereof capable of
recognizing and binding to one or two disease-specific binding
sites and subsequently inducing a modulating effect on a biological
process in the cell, can be administered to a patient to stimulate
eradication of aberrant cells expressing the binding site(s)
without affecting the viability of (normal) cells not expressing
the disease-specific binding site(s). The specific killing of
aberrant cells while minimizing or even avoiding the deterioration
or even death of healthy cells will generally improve the
therapeutic outcome of a patient after administration of the
antibodies hereof.
[0039] Accordingly, also provided is the use of an antibody hereof
as medicament. In another aspect, provided is the use of an
antibody hereof for the manufacture of a medicament for the
treatment of cancer, autoimmune disease, infection or any other
disease of which the symptoms are reduced upon targeting aberrant
cells expressing disease-specific binding sites with antibodies
hereof. For example, an antibody hereof is advantageously used for
the manufacture of a medicament for the treatment of various
cancers (e.g., solid tumors, hematologic malignancies).
[0040] An example of a preferred antibody is an antibody comprising
at least an immunoglobulin variable region specifically binding to
the complex between MHC-1 HLA-0201 and a multi-MAGE-A epitope,
conjugated with a toxic moiety, using, e.g., Universal Linkage
System linker chemistry for conjugation. A second example of a
preferred antibody is an antibody comprising at least an
immunoglobulin variable region specifically binding to the complex
between MHC-1 HLA-CW7 and a multi-MAGE-A epitope, conjugated with a
toxic moiety, using, e.g., Universal Linkage System linker
chemistry for conjugation. With the bi-specific antibodies hereof,
difficult to target and/or difficult to reach aberrant cells have a
higher chance of being "hit" by at least one of the two different
immunoglobulin variable regions in the bi-specific antibodies
hereof, thereby providing at least in part the therapeutic
activity. An example of a preferred bi-specific antibody hereof is
an immunoglobulin comprising an immunoglobulin variable region
specific for the complex between MHC-1 HLA-0201 and a multi-MAGE-A
epitope and comprising a second immunoglobulin variable region
specific for the complex between MHC-1 HLA-CW7 and a second
multi-MAGE-A epitope, conjugated with a toxic moiety.
[0041] Antibody fragments of human origin can be isolated from
large antibody repertoires displayed by phages. Included herein is
the use of human antibody phage display libraries for the selection
of human antibody fragments specific for a selected binding site,
e.g., an epitope. Examples of such libraries are phage libraries
comprising human Vh repertoires, human Vh-Vl repertoires, and human
Vh-Ch1 or human antibody Fab fragment repertoires.
[0042] Although the disclosure contemplates many different
combinations of MHC and antigenic peptides, the most preferred is
the combination of MHC-1 and an antigenic peptide from a tumor
related antigen presented by the MHC-1, exclusively expressed by
aberrant cells and not by healthy cells. Because of HLA
restrictions, there are many combinations of MHC-1-peptide
complexes as well as of MHC-2-peptide complexes that can be
designed based on the rules for presentation of peptides in MHC.
These rules include size limits on peptides that can be presented
in the context of MHC, restriction sites that need to be present
for processing of the antigen in the cell, anchor sites that need
to be present on the peptide to be presented, etc. The exact rules
differ for the different HLA classes and for the different MHC
classes. We have found that MAGE derived peptides are very suitable
for presentation in an MHC context. An MHC-1 presentable antigenic
peptide with the sequence Y-L-E-Y-R-Q-V-P-G in MAGE-A [SEQ ID NO:3]
was identified, that is present in almost every MAGE-A variant
(multi MAGE peptide) and that will be presented by one of the most
prevalent MHC-1 alleles in the Caucasian population (namely
HLA-A0201). A second MAGE peptide that is presented by another
MHC-1 allele (namely HLA-CW7) and that is present in many MAGE
variants, like, e.g., MAGE-A2, -A3, -A6 and -A12, is
E-G-D-C-A-P-E-E-K [SEQ ID NO:4]. These two combinations of MHC-1
and MAGE peptides together would cover 80% of the Caucasian
population. The same approach can be followed for other MHC
molecules, other HLA restrictions and other antigenic peptides
derived from tumor-associated antigens. Relevant is that the chosen
antigenic peptide to elicit the response to must be presented in
the context of an MHC molecule and recognized in that context only.
Furthermore, the antigenic peptide must be derived from a
sufficiently tumor specific antigen and the HLA restriction must
occur in a relevant part of the population. One of the important
advantages of the disclosure is that tumors that down regulate
their targeted MHC-peptide complex can be treated with a second
immunoglobulin comprising at least one variable region binding to a
different MHC-peptide complex based on the same antigen. If this
one is down regulated, a third one will be available. For
heterozygotes six different targets on MHC-1 may be available.
Since cells need to be "inspected" by the immune system from time
to time, escape through down regulation of all MHC molecules does
not seem a viable escape route. In the case that MAGE is the
antigen from which the peptide is derived escape through down
regulation of the antigen is also not possible, because MAGE seems
important for survival of the tumor [8]. Thus, the disclosure, in
an important aspect reduces or even prevents escape of the tumor
from the therapy. Thus, provided is in a preferred embodiment an
antibody hereof whereby the immunoglobulin variable region is
capable of binding to an MHC-I-peptide complex. In a further
preferred embodiment, provided is an immunoglobulin whereby the
immunoglobulin variable region is capable of binding to
MHC-I-peptide complexes comprising an antigenic peptide derived
from a tumor related antigen, in particular MHC-I-peptide complexes
comprising an antigenic peptide present in a variety of MAGE
antigens, whereby the immunoglobulin is provided with a toxic
moiety.
[0043] Because in one embodiment, the disclosure uses MHC molecules
as a target, and individuals differ in the availability of MHC
targets, also provided is a so-called companion diagnostic to
determine the HLA composition of an individual. Although the
disclosure preferably uses a more or less universal (MAGE) peptide,
also provided is a diagnostic for determining the expression of the
particular antigen by the tumor. In this manner the therapy can be
geared to the patient (personalized medicine, patient
stratification), particularly, also in the set-up to prevent
escape, as described hereinbefore. It is known that the HLA
restriction patterns of the Asian population and the black
population are different from the Caucasian population. For
different populations different MHC-peptide complexes can be
targeted.
[0044] Although the disclosure presents more specific disclosure on
tumors, it must be understood that other aberrant cells can also be
targeted by the antibodies of the disclosure. These other aberrant
cells are typically cells that also proliferate without sufficient
control. This occurs in autoimmune diseases. It is typical that
these cells start to show expression of tumor antigens. In
particular, MAGE polypeptides have been identified in rheumatoid
arthritis [7].
[0045] In literature it is shown that a single nine amino-acid
(A.A.) peptide in MAGE-A2, -A3, -A4, -A6, -A10, and -A12 is
presented by HLA-A0201 on tumor cells, and can be recognized by
cytotoxic T-lymphocytes [1]. This nine amino acid residues peptide
with sequence Y-L-E-Y-R-Q-V-P-G [SEQ ID NO:3] is almost identical
to the HLA-A0201 presented MAGE-A1 peptide Y-L-E-Y-R-Q-V-P-D [SEQ
ID NO:5], except for the anchor residue at position 9. Replacement
of the anchor residue with Valine results in a 9 amino acid
residues peptide with enhanced binding capacity to HLA-A0201
molecules [1]. Human and mouse T-lymphocytes recognizing the
Y-L-E-Y-R-Q-V-P-V [SEQ ID NO:6] peptide presented by HLA-0201 also
recognize the original MAGE-A Y-L-E-Y-R-Q-V-P-G [SEQ ID NO:3] and
Y-L-E-Y-R-Q-V-P-D [SEQ ID NO:5] peptides presented on tumors of
distinct origin. As diverse tumors may each express at least one
MAGE-A gene, targeting of this so-called multi-MAGE-A epitope
includes the vast majority of tumors. As an example, MAGE-A
expression in human prostate tumor cell lines and in human
xenographs was analyzed and shown to be highly diverse, but in each
individual sample tested at least one MAGE-A gene was expressed
(Table 2), confirming that targeting this multi-MAGE-A epitope
serves as a universal HLA-A0201 restricted target for therapy.
[0046] Of course, several other multi-MAGE or multi-target epitopes
may be designed. In principle, the disclosure contemplates
combinations of tumor specific antigen derived MHC presented
epitopes in different HLA restrictions of both MHC-I and MHC-II,
targeted by immunoglobulins linked to a toxic moiety, to induce
apoptosis in aberrant cells. Examples of MHC-MAGE peptide
combinations that can be targeted by antibodies hereof are peptide
IMPKAGLLI (MAGE-A3) [SEQ ID NO:8] and HLA-DP4 or peptide
243-KKLLTQHFVQENYLEY-258 (MAGE-A3) [SEQ ID NO:9] and HLA-DQ6. Other
non-limiting examples of tumor specific complexes of HLA and
antigen peptide are: HLA A1-MAGE-A1 peptide EADPTGHSY [SEQ ID
NO:10], HLA A3-MAGE-A1 SLFRAVITK [SEQ ID NO:11], HLA A24-MAGE-A1
NYKHCFPEI [SEQ ID NO:12], HLA A28-MAGE-A1 EVYDGREHSA [SEQ ID
NO:13], HLA B37-MAGE-A1/A2/A3/A6 REPVTKAEML [SEQ ID NO:14],
expressed at aberrant cells related to melanoma, breast carcinoma,
SCLC, sarcoma, NSCLC, colon carcinoma (Renkvist, N. et al., Cancer
Immunol. Immunother. (2001) V50:3-15 (ref 13)). Further examples
are HLA B53-MAGE-A1 DPARYEFLW [SEQ ID NO:15], HLA Cw2-MAGE-A1
SAFPTTINF [SEQ ID NO:16], HLA Cw3-MAGE-A1 SAYGEPRKL [SEQ ID NO:17],
HLA Cw16-MAGE-A1 SAYGEPRKL [SEQ ID NO:18], HLA A2-MAGE A2 KMVELVHFL
[SEQ ID NO:19], HLA A2-MAGE-A2 YLQLVFGIEV [SEQ ID NO:20], HLA
A24-MAGE-A2 EYLQLVFGI [SEQ ID NO:21], HLA-A1-MAGE-A3 EADPIGHLY [SEQ
ID NO:22], HLA A2-MAGE-A3 FLWGPRALV [SEQ ID NO:23], HLA B44-MAGE-A3
MEVDPIGHLY [SEQ ID NO:24], HLA B52-MAGE-A3 WQYFFPVIF [SEQ ID
NO:25], HLA A2-MAGE-A4 GVYDGREHTV [SEQ ID NO:26], HLA A34-MAGE-A6
MVKISGGPR [SEQ ID NO:27], HLA A2-MAGE-A10 GLYDGMEHL [SEQ ID NO:28],
HLA Cw7-MAGE-A12 VRIGHLYIL [SEQ ID NO:29], HLA Cw16-BAGE AARAVFLAL
[SEQ ID NO:30], expressed by, e.g., melanoma, bladder carcinoma,
NSCLC, sarcoma, HLA A2-DAM-6/-10 FLWGPRAYA [SEQ ID NO:31],
expressed by, e.g., skin tumors, lung carcinoma, ovarian carcinoma,
mammary carcinoma, HLA Cw6-GAGE-1/-2/-8 YRPRPRRY [SEQ ID NO:32],
HLA A29-GAGE-3/-4/-5/-6/-7B YYWPRPRRY [SEQ-ID 33], both expressed
by, e.g., melanoma, leukemia cells, bladder carcinoma, HLA
B13-NA88-A MTQGQHFLQKV [SEQ ID NO:34], expressed by melanoma, HLA
A2-NY-ESO-1 SLLMWITQCFL [SEQ ID NO:35], HLA A2-NY-ESO-1a SLLMWITQC
[SEQ ID NO:36], HLA A2-NY-ESO-1a QLSLLMWIT [SEQ ID NO:37], HLA
A31-NY-ESO-1a ASGPGGGAPR [SEQ ID NO:38], the latter four expressed
by, e.g., melanoma, sarcoma, B-lymphomas, prostate carcinoma,
ovarian carcinoma, bladder carcinoma.
[0047] The disclosure is further exemplified by the non-limiting
Examples.
Abbreviations Used
[0048] A.A., amino acid; Ab, antibody; .beta.2-M, CDR,
complementarity determining region; CHO, Chinese hamster ovary; CT,
cancer testis antigens; CTL, cytotoxic T-lymphocyte; E4orf4,
adenovirus early region 4 open reading frame; EBV, Epstein-Barr
virus; ELISA, enzyme linked immunosorbent assay; HAMLET, human
.alpha.-lactalbumin made lethal to tumor cells; HEK, human
embryonic kidney; HLA, human leukocyte antigen; Ig, immunoglobulin;
i.v., intravenously; kDa, kilo Dalton; MAGE, melanoma-associated
antigen; Mda-7, melanoma differentiation-associated gene-7; MHC,
major histocompatibility complex; MHC-p, MHC-peptide; NS1,
parvovirus-H1 derived non-structural protein 1; PBSM, PBS
containing 2% non-fat dry milk; TCR, T-cell receptor; VH, Vh or
V.sub.H, amino-acid sequence of an immunoglobulin variable heavy
domain; Vl, amino-acid sequence of an immunoglobulin variable light
domain; TRAIL, tumor necrosis factor-related apoptosis-inducing
ligand.
EXAMPLES
Example 1
[0049] Non-exhaustive examples of immunoglobulins comprising at
least an immunoglobulin variable region that specifically binds to
an MHC-peptide complex preferentially associated with aberrant
cells or to an aberrant cell surface marker preferentially
associated with aberrant cells, with domain topologies as outlined,
e.g., in FIG. 5B, are:
[0050] Antibodies hereof comprising immunoglobulin variable regions
that specifically bind to:
[0051] a. a complex comprising a T-cell epitope selected from
146-KLQCVDLHV-154 [SEQ ID NO:74], 141-FLTPKKLQCV-150 [SEQ ID
NO:75], 154-VISNDVCAQV-163 [SEQ ID NO:76], 154-YISNDVCAQV-163 [SEQ
ID NO:77] of PSA, presented by HLA-A2 and/or 162-QVHPQKVTK-170 [SEQ
ID NO:78] of PSA, presented by HLA-A3, and/or 152-CYASGWGSI-160
[SEQ ID NO:79], 248-HYRKWIKDTI-257 [SEQ ID NO:80] of PSA, presented
by HLA-A24, and/or 4-LLHETDSAV-12 [SEQ ID NO:81], 711-ALFDIESKV-719
[SEQ ID NO:82], 27-VLAGGFFLL-35 [SEQ ID NO:83] of PSMA, presented
by HLA-A2, and/or 178-NYARTEDFF-186 [SEQ ID NO:84],
227-LYSDPADYF-235 [SEQ ID NO:85], 624-TYSVSFDSL-632 [SEQ ID NO:86]
of PSMA, presented by HLA-A24, and/or 299-ALDVYNGLL-307 [SEQ ID
NO:87] of PAP, presented by HLA-A2 and/or 213-LYCESVHNF-221 [SEQ ID
NO:88] of PAP, presented by HLA-A24 and/or 199-GQDLFGIWSKVYDPL-213
[SEQ ID NO:89], 228-TEDTMTKLRELSELS-242 [SEQ ID NO:90] of PAP,
presented by MHC-2 and/or 14-ALQPGTALL-22 [SEQ ID NO:91],
105-AILALLPAL-113 [SEQ ID NO:92], 7-ALLMAGLAL-15 [SEQ ID NO:93],
21-LLCYSCKAQV-30 [SEQ ID NO:94] of PSCA, presented by HLA-A2 and/or
155-LLANGRMPTVLQCVN-169 [SEQ ID NO:95] of Kallikrein 4, presented
by DRB1*0404 and/or 160-RMPTVLQCVNVSVVS-174 [SEQ ID NO:96] of
Kallikrein 4, presented by DRB1*0701 and/or 125-SVSESDTIRSISIAS-139
[SEQ ID NO:97] of Kallikrein 4, presented by DPB1*0401, for the
treatment of prostate cancer;
[0052] b. the HLA B8 restricted epitope from EBV nuclear antigen 3,
FLRGRAYGL [SEQ ID NO:98], complexed with MHC I, for the clearance
of EBV infected cells;
[0053] c. the MAGE-A peptide YLEYRQVPG [SEQ ID NO:3] presented by
MHC 1 HLA-A0201, for treatment of cancers accompanied by tumor
cells expressing these MHC-peptide complexes (see Table 1);
[0054] d. the MAGE-A peptide EGDCAPEEK [SEQ ID NO:4] presented by
MHC-1 HLA-CW7, for treatment of cancers accompanied by tumor cells
expressing these MHC-peptide complexes (see Table 1);
[0055] e. complexes of HLA-A2 and HLA-A2 restricted CD8.sup.+
T-cell epitopes, e.g., nonamer peptides FLFLLFFWL [SEQ ID NO:99]
(from prostatic acid phosphatase (PAP, also prostatic specific acid
phosphatase (PSAP))), TLMSAMTNL [SEQ ID NO:100] (from PAP),
ALDVYNGLL [SEQ ID NO:101] (from PAP), human HLA-A2.1-restricted CTL
epitope ILLWQPIPV [SEQ ID NO:102] (from PAP-3), six-transmembrane
epithelial antigen of prostate (STEAP), or complexes of HLA-A2.1
and HLA-A2.1-restricted CTL epitope LLLGTIHAL [SEQ ID NO:103] (from
STEAP-3), epitopes from mucin (MUC-1 and MUC-2), MUC-1-32mer
(CHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPA [SEQ ID NO:104]), epitopes from
Globo H, Lewis.sup.y, Tn(c), TF(c) clusters, GM2, prostate-specific
membrane antigen (PSMA), Kallikrein 4, prostein, or complexes of
HLA-A2.1 and HLA-A2.1-restricted epitopes from BA46, PTH-rP,
HER-2/neu, hTERT, and MAGE-A8, for the treatment of prostate
cancer;
[0056] f. an aberrant cell specific epitope in aberrant
cell-specific altered MUC-1 complexed with MHC, or to an aberrant
cell specific epitope in aberrant cell-specific altered MUC-1 for,
the targeting of aberrant cells in, e.g., breast cancer or for the
treatment of colorectal cancer;
[0057] g. an aberrant cell specific epitope of the aberrant-cell
specific epidermal growth factor receptor mutant form vIII
complexed with MHC, or to an aberrant cell specific epitope of the
epidermal growth factor receptor mutant form vIII, for the
treatment of the brain neoplasm glioblastoma multiforme;
[0058] h. the complex of MHC with T-cell epitope peptide 369-376
from human Her-2/neu, for the treatment of malignancies related to
Her-2 and/or Her-1 over-expression; and
[0059] i. an epitope of the aberrant-cell specific surface marker
CD44 splice variants known as CD44-v6, CD44-v9, CD44-v10, complexed
with MHC, or to an aberrant cell specific epitope of an
aberrant-cell specific CD44 splice variant, for the treatment of
multiple myeloma.
[0060] Target binding sites suitable for specific and selective
targeting of infected aberrant cells by antibodies hereof are
pathogen-derived antigen peptides complexed with MHC molecules.
Examples of T-cell epitopes of the E6 and E7 protein of human
papilloma virus, complexed with indicated HLA molecules, are
provided below. Any combination of an HLA molecule complexed with a
pathogen-derived T-cell epitope provides a specific target on
infected aberrant cells for antibodies hereof. An example of an
infected aberrant cell is a keratinocyte in the cervix infected by
human papilloma virus (HPV), presenting T-cell epitopes derived
from, for example E6 or E7 protein, in the context of MHC. Examples
of suitable target HPV 16 E6 T-cell epitopes are peptides FQDPQERPR
[SEQ ID NO:39], TTLEQQYNK [SEQ ID NO:40], ISEYRHYCYS [SEQ ID NO:41]
and GTTLEQQYNK [SEQ ID NO:42] binding to HLA A1, KISEYRHYC [SEQ ID
NO:43] and YCYSIYGTTL [SEQ ID NO:44] binding to HLA A2, LLRREVYDF
[SEQ ID NO:45] and IVYRDGNPY [SEQ ID NO:46] binding to HLA A3,
TTLEQQYNK [SEQ ID NO:47] binding to HLA A11, CYSLYGTTL [SEQ ID
NO:48], KLPQLCTEL [SEQ ID NO:49], HYCYSLYGT [SEQ ID NO:50],
LYGTTLEQQY [SEQ ID NO:51], EVYDFAFRDL [SEQ ID NO:52] and VYDFAFRDLC
[SEQ ID NO:53] binding to HLA A24, 29-TIHDIILECV-38 [SEQ ID NO:54]
binding to HLA A*0201. Equally suitable are HPV 16 E7 T-cell
epitopes such as 86-TLGIVCPI-93 [SEQ ID NO:55], 82-LLMGTLGIV-90
[SEQ ID NO:56], 85-GTLGIVCPI-93 [SEQ ID NO:57] and 86-TLGIVCPIC-94
[SEQ ID NO:58] binding to HLA A*0201, HPV 18 E6 T-cell epitopes and
HPV 18 E7 T-cell epitopes, binding to HLA A1, A2, A3, A11 or A24.
Yet additional examples of T-cell epitopes related to HPV infected
cells are HPV E7 derived peptides 1-MHGDTPTLHEYD-12 [SEQ ID NO:59],
48-DRAHYNIVTFCCKCD-62 [SEQ ID NO:60] and 62-DSTLRLCVQSTHVD-75 [SEQ
ID NO:61] binding to HLA DR, 7-TLHEYMLDL-15 [SEQ ID NO:62],
11-YMLDLQPETT-20 [SEQ ID NO:63], 11-YMLDLQPET-19 [SEQ ID NO:64] and
12-MLDLQPETT-20 [SEQ ID NO:65] binding to HLA A*201,
16-QPETTDLYCY-25 [SEQ ID NO:66], 44-QAEPDRAHY-52 [SEQ ID NO:67] and
46-EPDRAHYNIV-55 [SEQ ID NO:68] binding to HLA B18,
35-EDEIDGPAGQAEPDRA-50 [SEQ ID NO:69] binding to HLA DQ2,
43-GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR-77 [SEQ ID NO:70] binding to
HLA DR3, 50-AHYNIVTFCCKCD-62 [SEQ ID NO:71] binding to HLA DR15,
58-CCKCDSTLRLC-68 [SEQ ID NO:72] binding to HLA DR17 and
61-CDSTLRLCVQSTHVDIRTLE-80 [SEQ ID NO:73] binding to
HLA-DRB1*0901.
[0061] A good source for selecting binding sites suitable for
specific and selective targeting of aberrant cells by antibodies
hereof, is the Peptide Database listing T-cell defined tumor
antigens and the HLA's binding the T-cell epitopes [9-12; on the
World Wide Web at
cancerimmunity.org/peptidedatabase/Tcellepitopes.htm]. The database
provides combinations of antigen peptides complexed with MHC
molecules comprising the indicated class of HLA, unique to tumor
cells or over-expressed by tumor cells.
Example 2: Selection of Human Antibody Fragments Specific for
HLA-A0201/Multi-MAGE-A
[0062] To obtain human antibody fragments comprising immunoglobulin
variable regions specific for the HLA-A0201 presented multi-MAGE-A
epitope Y-L-E-Y-R-Q-V-P-V [SEQ ID NO:6] and FLWGPRALV [SEQ ID
NO:23] a Human Fab phage display library was constructed according
to the procedure previously described by de Haard et al. (2) and
used for selections 1) essentially as described by Chames et al.
using biotinylated MHC/p complexes (3), or 2) on cells expressing
the relevant antigen.
[0063] 2.1: Selection of Human Antibody Fragments Specific for
HLA-A0201/YLEYRQVPV [SEQ ID NO:6] Using Biotinylated MHC-Peptide
Complexes:
[0064] Human Fab phages (10.sup.13 colony forming units) were first
pre-incubated for one hour at room temperature in PBS containing 2%
non-fat dry milk (PBSM). In parallel, 20 .mu.l Streptavidin-coated
beads (DYNAL.TM.) were equilibrated for one hour in PB SM. For
subsequent rounds, 100 .mu.l beads were used. To deplete for
pan-MHC binders, each selection round, 200 nM of biotinylated MHC
class I-peptide (MHC-p) complexes containing an irrelevant peptide
(Sanquin, the Netherlands) were added to the phages and incubated
for 30 minutes under rotation. Equilibrated beads were added, and
the mixture was incubated for 15 minutes under rotation. Beads were
drawn to the side of the tube using magnetic force. To the depleted
phage fraction, subsequently decreasing amounts of biotinylated
MHC-p complexes (200 nM for the first round, and 20 nM for the
second and third round) were added and incubated for one hour at
room temperature, with continuous rotation. Simultaneously, a
pan-MHC class I binding soluble Fab (D3) was added to the
phage-MHC-p complex mixture (50, 10, and 5 .mu.g for rounds 1-3,
respectively). Equilibrated streptavidin-coated beads were added,
and the mixture was incubated for 15 minutes under rotation. Phages
were selected by magnetic force. Non-bound phages were removed by 5
washing steps with PBSM, 5 steps with PBS containing 0.1% Tween,
and 5 steps with PBS. Phages were eluted from the beads by 10
minutes incubation with 500 .mu.l freshly prepared tri-ethylamine
(100 mM). The pH of the solution was neutralized by the addition of
500 .mu.l 1 M Tris (pH 7.5). The eluted phages were incubated with
logarithmic growing E. Coli TG1 cells (OD.sub.600 nm of 0.5) for 30
minutes at 37.degree. C. Bacteria were grown overnight on
2.times.TYAG plates. Next day, colonies were harvested, and a 10
.mu.l inoculum was used in 50 ml 2.times.TYAG. Cells were grown
until an OD.sub.600 nm of 0.5, and 5 ml of this suspension was
infected with M13k07 helper phage (5.times.10.sup.11 colony forming
units). After 30 minutes incubation at 37.degree. C., the cells
were centrifuged, resuspended in 25 ml 2.times.TYAK, and grown
overnight at 30.degree. C. Phages were collected from the culture
supernatant, as described previously, and were used for the next
round panning. After three selection rounds a 261-fold enrichment
was obtained, and 46 out of 282 analyzed clones were shown to be
specific for the HLA-A2-multi-MAGE-A complex (FIG. 1). ELISA using
the HLA-A0201/multi-MAGE-A complexes as well as HLA-A0201 complexes
with a peptide derived from JC virus was used to determine the
specificity of the selected Fab.
[0065] 2.2: Selection of Human Fab Specific for HLA-A0201/FLWGPRALV
[SEQ ID NO:23] Using Cells.
[0066] Selections of Fab phages specifically binding to
HLA-A0201/FLWGPRALV [SEQ ID NO:23] were performed using mouse CMT64
lung tumor cells. To obtain CMT64 cells stably expressing
HLA-A0201/FLWGPRALV [SEQ ID NO:23] (A2/FLW) complexes, the CMT64
cells were retroviral infected with a vector encoding a single
chain peptide-.beta.2M-HLA-A0201 heavy chain construct [SEQ ID
No:105]. Human Fab phages (10.sup.13 colony forming units) were
first pre-incubated for one hour at room temperature in PBS
containing 2% FCS (PBSF). In parallel, 1.0.times.10.sup.6
CMT64-A2/FLW cells were equilibrated for one hour in PBSF. The
phages were first incubated for one hour with 10.times.10.sup.6 CMT
64 cells expressing HLA-A0210/YLEYRQVPG [SEQ ID NO:3] to deplete
non-specifically binding phages. The non-bound fraction was then
incubated (1 hr at 4.degree. C.) with HLA-A0201/FLWGPRALV [SEQ ID
NO:23] expressing CMT64 cells. After extensive washing, bound
phages were eluted by adding 500 .mu.l freshly prepared
tri-ethylamine (100 mM). The pH of the solution was neutralized by
the addition of 500 .mu.l 1 M Tris (pH 7.5). The eluted phages were
incubated with logarithmic growing E. Coli TG1 cells (OD.sub.600 nm
of 0.5) for 30 minutes at 37.degree. C. Bacteria were grown
overnight on 2.times.TYAG plates. Next day, colonies were
harvested. After four rounds of selection individual clones were
selected and tested for specificity of binding.
[0067] 2.3: Human Fab Specific for HLA-A0201/Multi-MAGE-A Epitopes
Bind Antigen Positive Cells.
[0068] Multi-MAGE-A; Y-L-E-Y-R-Q-V-P-V [SEQ ID NO:6]
[0069] Fab phages were analyzed for their capacity to bind
HLA-A0201 positive EBV-transformed B-LCL loaded with the
multi-MAGE-A peptide Y-L-E-Y-R-Q-V-P-V [SEQ ID NO:6]. The B-LCL
line BSM (0.5.times.10.sup.6) was loaded with multi-MAGE-A peptide
(10 .mu.g in 100 .mu.l PBS) for 30 minutes at 37.degree. C.,
followed by incubation with the Fab phages AH5, CB1, CG1, BD5 and
BC7 and analyzed by flow-cytometry. As shown in FIG. 2, Fab AH5,
CB1 and CG1, specifically bound to the peptide loaded cells only,
whereas Fab BD5 and BC7 displayed non-specific binding to BSM that
was not loaded with the multi-MAGE-A peptide. No binding was
observed by AH5, CB1 and CG1 to non-peptide loaded cells.
[0070] Phages presenting AH5, CB1 and CG1, as well as the
HLA-A0101/MAGE-A1 specific Fab phage G8 (4) were then used to stain
tumor cell lines of distinct histologic origin. To this end
prostate cancer cells (LNCaP), multiple myeloma cells (MDN),
melanoma cells (MZ2-MEL43 and G43), and breast cancer cells
(MDA-MB157) were stained and analyzed by flow cytometry (FIG. 3).
The Fab AH5 specifically bound multiple myeloma cells MDN, and not
the HLA-A0201 negative melanoma and breast cancer cells. Both CB1
and CG1 displayed non-specific binding on the melanoma cell line
G43. The positive control Fab G8 demonstrated binding to all cell
lines tested.
[0071] Multi-MAGE-A: F-L-W-G-P-R-A-L-V [SEQ ID NO:23]
[0072] To determine the cell-binding capacity of the
HLA-A0201/FLWGPRALV selected Fab clone F9 soluble Fab fragments
were made by induction of TG-1 bacteria. TG-1 containing pCes-F9
were grown until OD=0.8 and Fab production was induced by addition
of 1 mM IPTG. After 13 hours induction the bacterial periplasmic
fraction was isolated and dialyzed overnight. Next day soluble Fab
F9 fragments were purified by IMAC.
[0073] Purified Fab F9 was added to 0.5.times.10.sup.6 CMT 64 cells
expressing either HLA-A0210/YLEYRQVPG [SEQ ID NO:3],
HLA-A0201/FLWGPRALV [SEQ ID NO:23], or CMT 64 cells that do not
express human HLA. As shown in FIG. 6 the Fab clone F9 specifically
binds HLA-A02011 FLWGPRALV [SEQ ID NO:23] expressing CMT64 cells
and not CMT 64 cells that do not express human HLA or that do
express the irrelevant HLA-A02011 YLEYRQVPG [SEQ ID NO:3]
molecules.
[0074] 2.4: Fab AH5 Binds HLA-A0201/Multi-MAGE-A Complexes
Only.
[0075] ELISA using multiple peptide/MHC complexes then confirmed
the specificity of Fab-AH5. To this end HLA-A0201 complexes
presenting peptides multi-MAGE-A, gp100, JCV and MAGE-C2, as well
as a HLA-A1/MAGE-A1 complex were immobilized on 96 well plates and
incubated with phages displaying Fab AH5 and control Fab G8. As
shown in FIG. 4, AH5 only binds HLA-A0201/multi-MAGE-A and not the
irrelevant complexes HLA-A0201/gp100, HLA-A0201/MAGE-C2,
HLA-A0201/JCV and HLA-A0101/MAGE-A1. The positive control Fab G8
only binds to its relevant target HLA-A0101/MAGE-A1.
[0076] The nucleic acids enencoding the HLA-A0201-multi-MAGE-A
complex binding Fab AH5 will be combined with nucleic acids
enencoding human antibody Ch2-Ch3 domains, providing nucleic acid
molecules enencoding a human antibody light chain encompassing the
selected Cl-Vl encoding nucleic acids and enencoding a human
antibody heavy chain encompassing the selected Ch-Vh encoding
nucleic acids. These nucleic acid molecules encoding the desired
immunoglobulin will be introduced, via a plasmid or via an
expression vector, into a eukaryotic host cell such as a CHO cell.
After expression of the immunoglobulin, it will be isolated from
the cell culture and purified. Then, a selected toxic moiety will
be linked to the immunoglobulin, e.g., using Universal Linkage
System linker chemistry.
Example 3: Cell Binding and Internalization of an Immunoglobulin
Provided with a Toxic Moiety
[0077] Binding capacity of an antibody hereof is analyzed by
flow-cytometry. For example, an antibody comprising immunoglobulin
variable regions specific for complexes of HLA-A0201 and the
multi-MAGE-A peptide is analyzed. HLA-A0201/multi-MAGE-A positive
tumor cells (Daju, MDN and mel 624) and HLA-A0201/multi-MAGE-A
negative cells (BSM, G43 and 293) are incubated on ice with
purified antibody and detected by addition of fluorescently labeled
antibodies. Cells bound by the antibody are quantified and
visualized by flow-cytometry. Internalization of antibody is
analyzed by confocal microscopy. To this end cells are incubated
with the antibody, kept on ice for 30 minutes to allow binding but
no internalization. Next, fluorescently labeled antibodies specific
for the antibody are added. To induce internalization cells are
transferred to 37.degree. C. and fixed with 1% PFA after 5, 10 and
15 minutes.
Example 4: Apoptosis Induction by Antibodies Hereof in Diverse
Tumor Cells
[0078] 4.1: Killing of Diverse Tumor Cells by Immunoglobulin
Provided with a Toxic Moiety.
[0079] Antibodies hereof are analyzed for their capacity to induce
apoptosis by incubation with diverse tumor cells, known to express
the antigens comprising the binding sites for the immunoglobulin
variable regions. For example, an antibody comprising
immunoglobulin variable region VH specific for complexes of
HLA-A0201 and the multi-MAGE-A peptide, AH5-BTX, is coupled to a
synthetic HPMA polymer containing the BTX peptide and Doxorubicin
(as we described in WO2009131435) and analyzed. To this end
antibodies hereof coupled to doxorubicin are analyzed for their
capacity to induce apoptosis by incubation with diverse tumor cells
known to express both HLA-A0201 and MAGE-A genes. The cell-lines
Daju, Mel 624 (melanoma), PC346C (prostate cancer), and MDN
(multiple myeloma) as well as MAGE-A negative cells (911 and
HEK293T) are incubated with different concentrations of the
antibodies (in DMEM medium, supplemented with pen/strep, Glutamine
and non-essential amino acids). Several hours later, cells are
visually inspected for classical signs of apoptosis such as
detachment of the cells from tissue culture plates and membrane
blebbing. In addition, cells are stained for active caspase-3 to
demonstrate apoptosis. It is accepted that the antibodies induce
apoptosis in the Daju Mel 624, PC346C and MDN cells. Cells that are
not treated with the antibodies are not affected, as well as cells
that do not express HLA-A0201 (HEK293T) and MAGE-A genes (911 and
HEK293T).
[0080] Another antibody, comprising Vh and Vl domains (scFv) with
specificity for complexes of HLA-A01, presenting a MAGE-A1 peptide
was also analyzed. The scFv-BTX construct was coupled to the HPMA
polymer containing doxorubicin and incubated with MAGE-A1 positive
and MAGE-A1 negative cells. Apoptosis is shown by staining for
active caspase-3.
[0081] 4.2: Detection of Active Caspase-3.
[0082] A classical intra-cellular hallmark for apoptosis is the
presence of active caspase-3. To determine whether or not the
antibodies induce active caspase-3, Daju, Mel624 and MDN cells are
incubated with various concentrations of antibodies hereof After
four and 13 hours FAM-DEVD-FMK, a fluorescently caspase-3/7
inhibitor, is added and positively stained cells are visualized by
fluorescent microscopy and flow-cytometry. Caspase-3 activity is
shown in antigen positive cells and not in antigen negative cells,
with the (fragment of the) antigen providing the specific
target-binding site for the antibodies hereof.
[0083] 4.3 Treatment of Tumor Bearing Mice with Immunoglobulins
Provided with a Toxic Moiety.
[0084] Nude mice (NOD-scid, 8 per group) with a palpable
subcutaneous transplantable human tumor (Daju or MDN) are injected
with different doses of immunoglobulins provided with a toxic
moiety. As a control mice are treated with standard chemotherapy or
receive an injection with PBS. Mice receiving an optimal dose of
the immunoglobulins provided with a toxic moiety survive
significantly longer that those mice receiving chemotherapy or PBS,
when the aberrant cells expose the target binding sites for the
antibodies hereof.
Example 5: Selection of Llama VHH with Specificity for
HLA-A0201/FLWGPRALV and HLA-A0201/YLEYRQVPG
[0085] Selection of Llama VHH fragments with specificity for
HLA-A0201/FLWGPRALV [SEQ ID NO:23] (A2/FLW) and HLA-A0201/YLEYRQVPG
[SEQ ID NO:3] (A2/YLE) were performed on CMT64 cells stably
expressing these HLA/peptide complexes. Llama VHH phages (10.sup.11
colony forming units) were first pre-incubated for one hour at room
temperature in PBS containing 2% FCS (PBSF). In parallel,
1.0.times.10.sup.6 CMT64-A2/FLW and 1.0.times.10.sup.6 CMT64 A2/YLE
cells were equilibrated for one hour in PBSF. To deplete for
non-specific binding phages 10.times.10.sup.6 CMT 64 cells
expressing either A2/FLW or A2/YLE were incubated for one hour with
the llama VHH. The non-bound fractions were then incubated (1 hr at
4.degree. C.) with A2/FLW or A2/YLE expressing CMT64 cells. After
extensive washing, bound phages were eluted by adding 500 .mu.l
freshly prepared tri-ethylamine (100 mM). The pH of the solution
was neutralized by the addition of 500 .mu.l 1 M Tris (pH 7.5). The
eluted phages were incubated with logarithmic growing E. Coli TG1
cells (OD.sub.600 nm of 0.5) for 30 minutes at 37.degree. C.
Bacteria were grown overnight on 2.times.TYAG plates. Next day,
colonies were harvested. After four rounds of selection individual
clones were selected and tested for specificity of binding.
[0086] 5.2: Llama VHH Specific for HLA-A0201/Multi-MAGE-A Epitopes
Bind Antigen Positive Cells.
[0087] To determine the cell-binding capacity of the A2/FLW and
A2/YLE selected VHH soluble VHH fragments were made by induction of
TG-1 bacteria. TG-1 containing pHen-VHH were grown until OD=0.8 and
Fab production was induced by addition of 1 mM IPTG. After 13 hours
induction, the bacterial periplasmic fraction was isolated and
dialyzed overnight. Next day soluble VHH fragments were purified by
IMAC.
[0088] CMT 64 cells (0.5.times.10.sup.6) expressing either
HLA-A0210/YLEYRQVPG [SEQ ID NO:3], HLA-A0201/FLWGPRALV [SEQ ID
NO:23], or CMT 64 cells that do not express human HLA were
incubated with purified VHH fragments for one hour at 4.degree. C.
As shown in FIG. 7 the A2/FLW specific VHH bind HLA-A0201/FLWGPRALV
[SEQ ID NO:23] expressing CMT64 cells and not CMT 64 cells that do
not express human HLA or that do express the irrelevant
HLA-A0201/YLEYRQVPG [SEQ ID NO:23] molecules. The A2/YLE specific
VHH only bind HLA-A2/YLEYRQVPG [SEQ ID NO:23] expressing CMT64
cells and not A2/FLW positive CMT64 cells and CMT64 cells that do
not express human HLA.
TABLE-US-00001 TABLE 1 Examples of the frequency of MAGE-A
expression by human cancers. Frequency of expression (%) MAGE-
MAGE- MAGE- MAGE- MAGE- MAGE- MAGE- Cancer A1 A2 A3 A4 A6 A10 A11
Melanoma 16 E 36 E 64 E 74 Head and neck 25 42 33 8 N N N Bladder
21 30 35 33 15 N 9 Breast 6 19 10 13 5 N N Colorectal N 5 5 N 5 N N
Lung 21 30 46 11 8 N N Gastric 30 22 57 N N N N Ovarian 55 32 20 E
20 N N Osteosarcoma 62 75 62 12 62 N N hepatocarcinoma 68 30 68 N
30 30 30 Renal cell 22 16 76 30 N N N carcinoma E, expressed but
the frequency is not known; N, expression by tumors has never been
observed
TABLE-US-00002 TABLE 2 MAGE-A expression in human prostate cancer
cell lines and prostate cancer xenografts. Cellline/ MAGE-
Xenograft A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 LNCaP + ++ ++ ++ +
PC346C + ++ ++ + ++ + + ++ OVCAR + + + + JON ++ ++ ++ + + PNT 2 C2
+ + + + + SD48 + + + + PC-3 + + + PC 374 + PC 346p + ++ ++ ++ + ++
+ PC 82 + + PC 133 ++ + + PC 135 + PC 295 + PC 324 + + + PC 310 +
++ + ++ + PC 339 ++ ++ + ++ + + + Expression of the MAGE-A1, A2,
A3, A4, A5, A6, A7, A8, A9, A10, A11 and A12 genes in diverse
prostate tumor cell lines and prostate xenografts was analyzed by
RT-PCR. Shown are expression levels in individual samples tested.
Blank = no expression, + = low expression, ++ = high expression.
All cell lines/xenografts express at least one MAGE-A gene.
TABLE-US-00003 SEQUENCE IDENTIFIERS SEQ ID NO: 1. Amino acid
sequence Vh AH5 QLQLQESGGG VVQPGRSLRL SCAASGFTFS SYGMHWVRQA
PGKEREGVAV ISYDGSNKYY ADSVKGRFTI SRDNSKNTLY LQMNSLRAED TAVYYCAGGS
YYVPDYWGQG TLVTVSSGST SGS SEQ ID NO: 3. Amino acid sequence MHC-1
HLA-A0201 presentable peptide in MAGE-A YLEYRQVPG SEQ ID NO: 4.
Amino acid sequence MHC-1 HLA-CW7 presentable peptide in MAGE-A
EGDCAPEEK SEQ ID NO: 5. Amino acid sequence MHC-1 HLA-A0201
presentable peptide in MAGE-A1 YLEYRQVPD SEQ ID NO: 6. Amino acid
sequence MHC-1 HLA-A0201 presentable peptide in MAGE-A1, with
enhanced binding capacity for HLA-A0201 YLEYRQVPV SEQ ID NO: 7.
Amino acid sequence Vh binding domain 11H EVQLVQSGGG LVKPGGSLRL
SCAASGFTFS DYYMSWIRQA PGKGLEWLSY ISSDGSTIYY ADSVKGRFTV SRDNAKNSLS
LQMNSLRADD TAVYYCAVSP RGYYYYGLDL WGQGTTVTVS S SEQ ID NO: 8, amino
acid sequence of MAGE-A3 peptide epitope binding to HLA IMPKAGLLI
SEQ ID NO: 9, amino acid sequence of MAGE-A3 peptide epitope
binding to HLA KKLLTQHFVQENYLEY SEQ ID NO: 10, amino acid sequence
of MAGE peptide epitope binding to HLA EADPTGHSY SEQ ID NO: 11,
amino acid sequence of MAGE peptide epitope binding to HLA
SLFRAVITK SEQ ID NO: 12, amino acid sequence of MAGE peptide
epitope binding to HLA NYKHCFPEI SEQ ID NO: 13, amino acid sequence
of MAGE peptide epitope binding to HLA EVYDGREHSA SEQ ID NO: 14,
amino acid sequence of MAGE peptide epitope binding to HLA
REPVTKAEML SEQ ID NO: 15, amino acid sequence of MAGE peptide
epitope binding to HLA DPARYEFLW SEQ ID NO: 16 amino acid sequence
of MAGE peptide epitope binding to HLA SAFPTTINF SEQ ID NO: 17,
amino acid sequence of MAGE peptide epitope binding to HLA
SAYGEPRKL SEQ ID NO: 18, amino acid sequence of MAGE peptide
epitope binding to HLA SAYGEPRKL SEQ ID NO: 19, amino acid sequence
of MAGE peptide epitope binding to HLA KMVELVHFL SEQ ID NO: 20,
amino acid sequence of MAGE peptide epitope binding to HLA
YLQLVFGIEV SEQ ID NO: 21, amino acid sequence of MAGE peptide
epitope binding to HLA EYLQLVFGI SEQ ID NO: 22, amino acid sequence
of MAGE peptide epitope binding to HLA EADPIGHLY SEQ ID NO: 23,
amino acid sequence of MAGE peptide epitope binding to HLA
FLWGPRALV SEQ ID NO: 24, amino acid sequence of MAGE peptide
epitope binding to HLA MEVDPIGHLY SEQ ID NO: 25, amino acid
sequence of MAGE peptide epitope binding to HLA WQYFFPVIF SEQ ID
NO: 26, amino acid sequence of MAGE peptide epitope binding to HLA
GVYDGREHTV SEQ ID NO: 27, amino acid sequence of MAGE peptide
epitope binding to HLA MVKISGGPR SEQ ID NO: 28, amino acid sequence
of MAGE peptide epitope binding to HLA GLYDGMEHL SEQ ID NO: 29,
amino acid sequence of MAGE peptide epitope binding to HLA
VRIGHLYIL SEQ ID NO: 30, amino acid sequence of BAGE peptide
epitope binding to HLA AARAVFLAL SEQ ID NO: 31, amino acid sequence
of DAM-6 and DAM-10 peptide epitope binding to HLA FLWGPRAYA SEQ ID
NO: 32, amino acid sequence of GAGE-1/-2/-8 peptide epitope binding
to HLA YRPRPRRY SEQ ID NO: 33, amino acid sequence of
GAGE-3/-4/-5/-6/-7B peptide epitope binding to HLA YYWPRPRRY SEQ ID
NO: 34, amino acid sequence of NA88-A peptide epitope binding to
HLA MTQGQHFLQKV SEQ ID NO: 35, amino acid sequence of NY-ESO-1
peptide epitope binding to HLA SLLMWITQCFL SEQ ID NO: 36, amino
acid sequence of NY-ESO-1a peptide epitope binding to HLA SLLMWITQC
SEQ ID NO: 37, amino acid sequence of NY-ESO-1a peptide epitope
binding to HLA QLSLLMWIT SEQ ID NO: 38, amino acid sequence of
NY-ESO-1a peptide epitope binding to HLA ASGPGGGAPR SEQ ID NO: 39,
HPV 16 E6 T-cell epitope binding to HLA A1 FQDPQERPR SEQ ID NO: 40,
HPV 16 E6 T-cell epitope binding to HLA A1 TTLEQQYNK SEQ ID NO: 41,
HPV 16 E6 T-cell epitope binding to HLA A1 ISEYRHYCYS SEQ ID NO:
42, HPV 16 E6 T-cell epitope binding to HLA A1 GTTLEQQYNK SEQ ID
NO: 43, HPV 16 E6 T-cell epitope binding to HLA A2 KISEYRHYC SEQ ID
NO: 44, HPV 16 E6 T-cell epitope binding to HLA A2 YCYSIYGTTL SEQ
ID NO: 45, HPV 16 E6 T-cell epitope binding to HLA A3 LLRREVYDF SEQ
ID NO: 46, HPV 16 E6 T-cell epitope binding to HLA A3 IVYRDGNPY SEQ
ID NO: 47, HPV 16 E6 T-cell epitope binding to HLA A11 TTLEQQYNK
SEQ ID NO: 48, HPV 16 E6 T-cell epitope binding to HLA A24
CYSLYGTTL SEQ ID NO: 49, HPV 16 E6 T-cell epitope binding to HLA
A24 KLPQLCTEL SEQ ID NO: 50, HPV 16 E6 T-cell epitope binding to
HLA A24 HYCYSLYGT SEQ ID NO: 51, HPV 16 E6 T-cell epitope binding
to HLA A24 LYGTTLEQQY SEQ ID NO: 52, HPV 16 E6 T-cell epitope
binding to HLA A24 EVYDFAFRDL SEQ ID NO: 53, HPV 16 E6 T-cell
epitope binding to HLA A24 VYDFAFRDLC SEQ ID NO: 54, HPV 16 E6
T-cell epitope binding to HLA A*0201 29-TIHDIILECV-38 SEQ ID NO:
55, HPV 16 E7 T-cell epitope binding to HLA A*0201 86-TLGIVCPI-93
SEQ ID NO: 56, HPV 16 E7 T-cell epitope binding to HLA A*0201
82-LLMGTLGIV-90 SEQ ID NO: 57, HPV 16 E7 T-cell epitope binding to
HLA A*0201 85-GTLGIVCPI-93 SEQ ID NO: 58, HPV 16 E7 T-cell epitope
binding to HLA A*0201 86-TLGIVCPIC-94 SEQ ID NO: 59, HPV E7 T-cell
epitope binding to HLA DR 1-MHGDTPTLHEYD-12 SEQ ID NO: 60, HPV E7
T-cell epitope binding to HLA DR 48-DRAHYNIVTFCCKCD-62 SEQ ID NO:
61, HPV E7 T-cell epitope binding to HLA DR 62-DSTLRLCVQSTHVD-75
SEQ ID NO: 62, HPV E7 T-cell epitope binding to HLA A*201
7-TLHEYMLDL-15 SEQ ID NO: 63, HPV E7 T-cell epitope binding to HLA
A*201 11-YMLDLQPETT-20 SEQ ID NO: 64, HPV E7 T-cell epitope binding
to HLA A*201 11-YMLDLQPET-19 SEQ ID NO: 65, HPV E7 T-cell epitope
binding to HLA A*201 12-MLDLQPETT-20 SEQ ID NO: 66, HPV E7 T-cell
epitope binding to HLA B18 16-QPETTDLYCY-25 SEQ ID NO: 67, HPV E7
T-cell epitope binding to HLA B18 44-QAEPDRAHY-52 SEQ ID NO: 68,
HPV E7 T-cell epitope binding to HLA B18 46-EPDRAHYNIV-55 SEQ ID
NO: 69, HPV E7 T-cell epitope binding to HLA DQ2
35-EDEIDGPAGQAEPDRA-50 SEQ ID NO: 70, HPV E7 T-cell epitope binding
to HLA DR3 43-GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR-77 SEQ ID NO: 71,
HPV E7 T-cell epitope binding to HLA DR15 50-AHYNIVTFCCKCD-62 SEQ
ID NO: 72, HPV E7 T-cell epitope binding to HLA DR17
58-CCKCDSTLRLC-68 SEQ ID NO: 73, HPV E7 T-cell epitope binding to
HLA-DRB1*0901 61-CDSTLRLCVQSTHVDIRTLE-80 SEQ ID NO: 74, PSA T-cell
epitope binding to HLA-A2 146-KLQCVDLHV-154 SEQ ID NO: 75, PSA
T-cell epitope binding to HLA-A2 141-FLTPKKLQCV-150 SEQ ID NO: 76,
PSA T-cell epitope binding to HLA-A2 154-VISNDVCAQV-163 SEQ ID NO:
77, PSA T-cell epitope binding to HLA-A2 154-YISNDVCAQV-163
SEQ ID NO: 78, PSA T-cell epitope binding to HLA-A3
162-QVHPQKVTK-170 SEQ ID NO: 79, PSA T-cell epitope binding to
HLA-A24 152-CYASGWGSI-160 SEQ ID NO: 80, PSA T-cell epitope binding
to HLA-A24 248-HYRKWIKDTI-257 SEQ ID NO: 81, PSMA T-cell epitope
binding to HLA-A2 4-LLHETDSAV-12 SEQ ID NO: 82, PSMA T-cell epitope
binding to HLA-A2 711-ALFDIESKV-719 SEQ ID NO: 83, PSMA T-cell
epitope binding to HLA-A2 27-VLAGGFFLL-35 SEQ ID NO: 84, PSMA
T-cell epitope binding to HLA-A24 178-NYARTEDFF-186 SEQ ID NO: 85,
PSMA T-cell epitope binding to HLA-A24 227-LYSDPADYF-235 SEQ ID NO:
86, PSMA T-cell epitope binding to HLA-A24 624-TYSVSFDSL-632 SEQ ID
NO: 87, PAP T-cell epitope binding to HLA-A2 299-ALDVYNGLL-307 SEQ
ID NO: 88, PAP T-cell epitope binding to HLA-A24 213-LYCESVHNF-221
SEQ ID NO: 89, PAP T-cell epitope binding to MHC-2
199-GQDLFGIWSKVYDPL-213 SEQ ID NO: 90, PAP T-cell epitope binding
to MHC-2 228-TEDTMTKLRELSELS-242 SEQ ID NO: 91, PSCA T-cell epitope
binding to HLA-A2 14-ALQPGTALL-22 SEQ ID NO: 92, PSCA T-cell
epitope binding to HLA-A2 105-AILALLPAL-113 SEQ ID NO: 93, PSCA
T-cell epitope binding to HLA-A2 7-ALLMAGLAL-15 SEQ ID NO: 94, PSCA
T-cell epitope binding to HLA-A2 21-LLCYSCKAQV-30 SEQ ID NO: 95,
Kallikrein 4 T-cell epitope binding to DRB1*0404
155-LLANGRMPTVLQCVN-169 SEQ ID NO: 96, Kallikrein 4 T-cell epitope
binding to DRB1*0701 160-RMPTVLQCVNVSVVS-174 SEQ ID NO: 97,
Kallikrein 4 T-cell epitope binding to DPB1*0401
125-SVSESDTIRSISIAS-139 SEQ ID NO: 98, EBV nuclear antigen 3 T-cell
epitope binding to MHC I HLA B8 FLRGRAYGL SEQ ID NO: 99, HLA-A2
restricted CD8.sup.+ T-cell epitope of PAP binding to HLA-A2
FLFLLFFWL SEQ ID NO: 100, HLA-A2 restricted CD8.sup.+ T-cell
epitope of PAP binding to HLA-A2 TLMSAMTNL SEQ ID NO: 101, HLA-A2
restricted CD8.sup.+ T-cell epitope of PAP binding to HLA-A2
ALDVYNGLL SEQ ID NO: 102, human HLA-A2.1-restricted CTL epitope of
PAP-3 binding to HLA A2.1 ILLWQPIPV SEQ ID NO: 103,
HLA-A2.1-restricted CTL epitope of STEAP-3 binding to HLA-A2.1
LLLGTIHAL SEQ ID NO: 104, HLA-A2.1-restricted CTL epitope of MUC-1
and MUC-2 binding to HLA-A2.1 CHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPA SEQ
ID NO: 105, single chain HLA-A0201/FLWGPRALV construct.
MAVMAPRTLVLLLSGALALTQTWAFLWGPRALVGGGGSGGGGSGGGGSGGGSGIQRTPKIQVYSRHPAENGKSN-
FLNCYVSGFHPSDI
EVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSGGGGS-
GGGGSGSHSMRYFF
TSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRG-
YYNQSESHTVQRMY
GCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLE-
NGKETLQRTDSPKA
HVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRV-
YHEGLPEPLTLRWE
PPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGGDYALAPGSQSSEMSLRDCKA
REFERENCES
[0089] 1. Stephanie Graff-Dubois, Olivier Faure, David-Alexandre
Gross, Pedro Alves, Antonio Scardino, Salem Chouaib, Francois A.
Lemonnier and Kostas Kosmatopoulos. Generation of CTL Recognizing
an HLA-A*0201-Restricted Epitope Shared by MAGE-A1, -A2, -A3, -A4,
-A6, -A10, and -A12 Tumor Antigens: Implication in a Broad-Spectrum
Tumor Immunotherapy. The Journal of Immunology, 2002, 169: 575-580.
[0090] 2. Hans J. de Haard, Nicole van Neer, Anneke Reurs, Simon E.
Hufton, Rob C. Roovers, Paula Henderikx, Adriaan P. de Brume,
Jan-Willem Arends, and Hennie R. Hoogenboom. A Large Non-immunized
Human Fab Fragment Phage Library That Permits Rapid Isolation and
Kinetic Analysis of High Affinity Antibodies. The Journal of
Biological Chemistry. 1999, 274: 18218-18230. [0091] 3. Chames P,
Hoogenboom H. R, Henderikx P. Selection of antigens against
biotinylated antigens. In Antibody phage display, methods and
protocols, Edited by P. M. O'Brien and R. Aitken. Methods in
Molecular Biology 2002, 178:147-159. [0092] 4. Patrick Chames,
Simon E. Hufton, Pierre G. Coulie, Barbara Uchanska-Ziegler, Hennie
R. Hoogenboom. Direct selection of a human antibody fragment
directed against the tumor T-cell epitope HLA-A1-MAGE-A1 from a
nonimmunized phage-Fab library. PNAS, 2000. 97: 7969-7974. [0093]
5. H. M. Noteborn, Proteins selectively killing tumor cells. Eur.
J. Pharmacol., 2009. 625: 165-173. [0094] 6. Teicher, B. A. &
Chari, R. V. J., Antibody conjugate therapeutics: challenges and
potential. Clin. Cancer Res., 2011, 17(20):6389-97. [0095] 7.
McCurdy D K, Tai L Q, Imfeld K L, Schwartz M, Zaldivar F, Berman M
A, Expression of melanoma antigen gene by cells from inflamed
joints in juvenile rheumatoid arthritis, J. Rheumatol. 2002,
29:2219-2224. [0096] 8. Marcar L, Maclaine N J, Hupp T R, Meek D W,
Mage-A cancer/testis antigens inhibit p53 function by blocking its
interaction with chromatin, Cancer Res. 2010, 70:10362-10370.
[0097] 9. Van den Eynde B. J., van der Bruggen P., T cell-defined
tumor antigens. Curr. Opin. Immunol. 1997; 9: 684-93. [0098] 10.
Houghton A. N., Gold J. S., Blachere N. E., Immunity against
cancer: lessons learned from melanoma. Curr. Opin. Immunol. 2001;
13: 134-40. [0099] 11. van der Bruggen P., Zhang Y., Chaux P.,
Stroobant V., Panichelli C., Schultz E. S., Chapiro J., Van den
Eynde B. J., Brasseur F., Boon T., Tumor-specific shared antigenic
peptides recognized by human T cells. Immunol. Rev. 2002; 188:
51-64. [0100] 12. Parmiani G., De Filippo A., Novellino L.,
Castelli C., Unique human tumor antigens: immunobiology and use in
clinical trials. J. Immunol. 2007; 178: 1975-9. [0101] 13.
Renkvist, N., Castelli, C., Robbins, P. F., Parmiani, G., A listing
of human tumor antigens recognized by T-cells, Cancer Immunol.
Immunother. 2001; 50: 3-15. [0102] 14. Ridgway, J. B. B., Presta,
L. G., Carter, P., `Knobs-into-holes` engineering of antibody CH3
domains for heavy chain heterodimerization Protein Engineering,
1996; 9, no. 7: 617-621.
Sequence CWU 1 SEQUENCE LISTING <160> NUMBER OF SEQ ID
NOS: 112 <210> SEQ ID NO 1 <211> LENGTH: 123
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide3 <400>
SEQUENCE: 1 Gln Leu Gln Leu Gln Glu Ser Gly Gly Gly Val Val Gln Pro
Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr
Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val Arg Gln Ala Pro Gly
Lys Glu Arg Glu Gly Val 35 40 45 Ala Val Ile Ser Tyr Asp Gly Ser
Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Gly
Gly Ser Tyr Tyr Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110
Val Thr Val Ser Ser Gly Ser Thr Ser Gly Ser 115 120 <210> SEQ
ID NO 2 <400> SEQUENCE: 2 000 <210> SEQ ID NO 3
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 3 Tyr Leu Glu Tyr Arg Gln Val Pro Gly
1 5 <210> SEQ ID NO 4 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 4 Glu
Gly Asp Cys Ala Pro Glu Glu Lys 1 5 <210> SEQ ID NO 5
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 5 Tyr Leu Glu Tyr Arg Gln Val Pro Asp
1 5 <210> SEQ ID NO 6 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 6 Tyr
Leu Glu Tyr Arg Gln Val Pro Val 1 5 <210> SEQ ID NO 7
<211> LENGTH: 121 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 7 Glu Val Gln Leu Val Gln Ser Gly Gly
Gly Leu Val Lys Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Asp Tyr 20 25 30 Tyr Met Ser Trp Ile
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Ser Tyr Ile
Ser Ser Asp Gly Ser Thr Ile Tyr Tyr Ala Asp Ser Val 50 55 60 Lys
Gly Arg Phe Thr Val Ser Arg Asp Asn Ala Lys Asn Ser Leu Ser 65 70
75 80 Leu Gln Met Asn Ser Leu Arg Ala Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95 Ala Val Ser Pro Arg Gly Tyr Tyr Tyr Tyr Gly Leu Asp
Leu Trp Gly 100 105 110 Gln Gly Thr Thr Val Thr Val Ser Ser 115 120
<210> SEQ ID NO 8 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 8 Ile Met Pro Lys
Ala Gly Leu Leu Ile 1 5 <210> SEQ ID NO 9 <211> LENGTH:
16 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 9 Lys Lys Leu Leu Thr Gln His Phe Val Gln Glu
Asn Tyr Leu Glu Tyr 1 5 10 15 <210> SEQ ID NO 10 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 10 Glu Ala Asp Pro Thr Gly His Ser Tyr 1 5
<210> SEQ ID NO 11 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 11 Ser
Leu Phe Arg Ala Val Ile Thr Lys 1 5 <210> SEQ ID NO 12
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 12 Asn Tyr Lys His Cys Phe Pro Glu
Ile 1 5 <210> SEQ ID NO 13 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 13 Glu
Val Tyr Asp Gly Arg Glu His Ser Ala 1 5 10 <210> SEQ ID NO 14
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 14 Arg Glu Pro Val Thr Lys Ala Glu
Met Leu 1 5 10 <210> SEQ ID NO 15 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 15 Asp Pro Ala Arg Tyr Glu Phe Leu Trp 1 5 <210>
SEQ ID NO 16 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 16 Ser Ala Phe Pro
Thr Thr Ile Asn Phe 1 5 <210> SEQ ID NO 17 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 17 Ser Ala Tyr Gly Glu Pro Arg Lys Leu 1 5
<210> SEQ ID NO 18 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 18 Ser
Ala Tyr Gly Glu Pro Arg Lys Leu 1 5 <210> SEQ ID NO 19
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 19 Lys Met Val Glu Leu Val His Phe
Leu 1 5 <210> SEQ ID NO 20 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 20 Tyr
Leu Gln Leu Val Phe Gly Ile Glu Val 1 5 10 <210> SEQ ID NO 21
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 21 Glu Tyr Leu Gln Leu Val Phe Gly
Ile 1 5 <210> SEQ ID NO 22 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 22 Glu
Ala Asp Pro Ile Gly His Leu Tyr 1 5 <210> SEQ ID NO 23
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 23 Phe Leu Trp Gly Pro Arg Ala Leu
Val 1 5 <210> SEQ ID NO 24 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 24 Met
Glu Val Asp Pro Ile Gly His Leu Tyr 1 5 10 <210> SEQ ID NO 25
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 25 Trp Gln Tyr Phe Phe Pro Val Ile
Phe 1 5 <210> SEQ ID NO 26 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 26 Gly
Val Tyr Asp Gly Arg Glu His Thr Val 1 5 10 <210> SEQ ID NO 27
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 27 Met Val Lys Ile Ser Gly Gly Pro
Arg 1 5 <210> SEQ ID NO 28 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 28 Gly
Leu Tyr Asp Gly Met Glu His Leu 1 5 <210> SEQ ID NO 29
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 29 Val Arg Ile Gly His Leu Tyr Ile
Leu 1 5 <210> SEQ ID NO 30 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 30 Ala
Ala Arg Ala Val Phe Leu Ala Leu 1 5 <210> SEQ ID NO 31
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 31 Phe Leu Trp Gly Pro Arg Ala Tyr
Ala 1 5 <210> SEQ ID NO 32 <211> LENGTH: 8 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 32 Tyr
Arg Pro Arg Pro Arg Arg Tyr 1 5 <210> SEQ ID NO 33
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 33 Tyr Tyr Trp Pro Arg Pro Arg Arg
Tyr 1 5 <210> SEQ ID NO 34 <211> LENGTH: 11 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 34 Met
Thr Gln Gly Gln His Phe Leu Gln Lys Val 1 5 10 <210> SEQ ID
NO 35 <211> LENGTH: 11 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 35 Ser Leu Leu Met Trp
Ile Thr Gln Cys Phe Leu 1 5 10 <210> SEQ ID NO 36 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 36 Ser Leu Leu Met Trp Ile Thr Gln Cys 1 5
<210> SEQ ID NO 37 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 37 Gln
Leu Ser Leu Leu Met Trp Ile Thr 1 5 <210> SEQ ID NO 38
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 38 Ala Ser Gly Pro Gly Gly Gly Ala
Pro Arg 1 5 10 <210> SEQ ID NO 39 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 39 Phe Gln Asp Pro Gln Glu Arg Pro Arg 1 5 <210>
SEQ ID NO 40 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 40 Thr Thr Leu Glu
Gln Gln Tyr Asn Lys 1 5 <210> SEQ ID NO 41 <211>
LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 41 Ile Ser Glu Tyr Arg His Tyr Cys Tyr Ser 1
5 10 <210> SEQ ID NO 42 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 42 Gly
Thr Thr Leu Glu Gln Gln Tyr Asn Lys 1 5 10 <210> SEQ ID NO 43
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 43 Lys Ile Ser Glu Tyr Arg His Tyr
Cys 1 5 <210> SEQ ID NO 44 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 44 Tyr
Cys Tyr Ser Ile Tyr Gly Thr Thr Leu 1 5 10 <210> SEQ ID NO 45
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 45 Leu Leu Arg Arg Glu Val Tyr Asp
Phe 1 5 <210> SEQ ID NO 46 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 46 Ile
Val Tyr Arg Asp Gly Asn Pro Tyr 1 5 <210> SEQ ID NO 47
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 47 Thr Thr Leu Glu Gln Gln Tyr Asn
Lys 1 5 <210> SEQ ID NO 48 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 48 Cys
Tyr Ser Leu Tyr Gly Thr Thr Leu 1 5 <210> SEQ ID NO 49
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 49 Lys Leu Pro Gln Leu Cys Thr Glu
Leu 1 5 <210> SEQ ID NO 50 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 50 His
Tyr Cys Tyr Ser Leu Tyr Gly Thr 1 5 <210> SEQ ID NO 51
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 51 Leu Tyr Gly Thr Thr Leu Glu Gln
Gln Tyr 1 5 10 <210> SEQ ID NO 52 <211> LENGTH: 10
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 52 Glu Val Tyr Asp Phe Ala Phe Arg Asp Leu 1 5 10
<210> SEQ ID NO 53 <211> LENGTH: 10 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 53 Val
Tyr Asp Phe Ala Phe Arg Asp Leu Cys 1 5 10 <210> SEQ ID NO 54
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 54 Thr Ile His Asp Ile Ile Leu Glu
Cys Val 1 5 10 <210> SEQ ID NO 55 <211> LENGTH: 8
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 55 Thr Leu Gly Ile Val Cys Pro Ile 1 5 <210> SEQ ID
NO 56 <211> LENGTH: 9 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 56 Leu Leu Met Gly Thr
Leu Gly Ile Val 1 5 <210> SEQ ID NO 57 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 57 Gly Thr Leu Gly Ile Val Cys Pro Ile 1 5 <210>
SEQ ID NO 58 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 58 Thr Leu Gly Ile
Val Cys Pro Ile Cys 1 5 <210> SEQ ID NO 59 <211>
LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 59 Met His Gly Asp Thr Pro Thr Leu His Glu
Tyr Asp 1 5 10 <210> SEQ ID NO 60 <211> LENGTH: 15
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 60 Asp Arg Ala His Tyr Asn Ile Val Thr Phe Cys Cys Lys
Cys Asp 1 5 10 15 <210> SEQ ID NO 61 <211> LENGTH: 14
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 61 Asp Ser Thr Leu Arg Leu Cys Val Gln Ser Thr His Val
Asp 1 5 10 <210> SEQ ID NO 62 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 62 Thr Leu His Glu Tyr Met Leu Asp Leu 1 5 <210>
SEQ ID NO 63 <211> LENGTH: 10 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 63 Tyr Met Leu Asp
Leu Gln Pro Glu Thr Thr 1 5 10 <210> SEQ ID NO 64 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 64 Tyr Met Leu Asp Leu Gln Pro Glu Thr 1 5
<210> SEQ ID NO 65 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 65 Met
Leu Asp Leu Gln Pro Glu Thr Thr 1 5 <210> SEQ ID NO 66
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 66 Gln Pro Glu Thr Thr Asp Leu Tyr
Cys Tyr 1 5 10 <210> SEQ ID NO 67 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 67 Gln Ala Glu Pro Asp Arg Ala His Tyr 1 5 <210>
SEQ ID NO 68 <211> LENGTH: 10 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 68 Glu Pro Asp Arg
Ala His Tyr Asn Ile Val 1 5 10 <210> SEQ ID NO 69 <211>
LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 69 Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln
Ala Glu Pro Asp Arg Ala 1 5 10 15 <210> SEQ ID NO 70
<211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 70 Gly Gln Ala Glu Pro Asp Arg Ala
His Tyr Asn Ile Val Thr Phe Cys 1 5 10 15 Cys Lys Cys Asp Ser Thr
Leu Arg Leu Cys Val Gln Ser Thr His Val 20 25 30 Asp Ile Arg 35
<210> SEQ ID NO 71 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 71 Ala
His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp 1 5 10 <210>
SEQ ID NO 72 <211> LENGTH: 11 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 72 Cys Cys Lys Cys
Asp Ser Thr Leu Arg Leu Cys 1 5 10 <210> SEQ ID NO 73
<211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 73 Cys Asp Ser Thr Leu Arg Leu Cys
Val Gln Ser Thr His Val Asp Ile 1 5 10 15 Arg Thr Leu Glu 20
<210> SEQ ID NO 74 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 74 Lys
Leu Gln Cys Val Asp Leu His Val 1 5 <210> SEQ ID NO 75
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 75 Phe Leu Thr Pro Lys Lys Leu Gln
Cys Val 1 5 10 <210> SEQ ID NO 76 <211> LENGTH: 10
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 76 Val Ile Ser Asn Asp Val Cys Ala Gln Val 1 5 10
<210> SEQ ID NO 77 <211> LENGTH: 10 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 77 Tyr
Ile Ser Asn Asp Val Cys Ala Gln Val 1 5 10 <210> SEQ ID NO 78
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 78 Gln Val His Pro Gln Lys Val Thr
Lys 1 5 <210> SEQ ID NO 79 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 79 Cys
Tyr Ala Ser Gly Trp Gly Ser Ile 1 5 <210> SEQ ID NO 80
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 80 His Tyr Arg Lys Trp Ile Lys Asp
Thr Ile 1 5 10 <210> SEQ ID NO 81 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 81 Leu Leu His Glu Thr Asp Ser Ala Val 1 5 <210>
SEQ ID NO 82 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 82 Ala Leu Phe Asp
Ile Glu Ser Lys Val 1 5 <210> SEQ ID NO 83 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 83 Val Leu Ala Gly Gly Phe Phe Leu Leu 1 5
<210> SEQ ID NO 84 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 84 Asn
Tyr Ala Arg Thr Glu Asp Phe Phe 1 5 <210> SEQ ID NO 85
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 85 Leu Tyr Ser Asp Pro Ala Asp Tyr
Phe 1 5 <210> SEQ ID NO 86 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 86 Thr
Tyr Ser Val Ser Phe Asp Ser Leu 1 5 <210> SEQ ID NO 87
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 87 Ala Leu Asp Val Tyr Asn Gly Leu
Leu 1 5 <210> SEQ ID NO 88 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 88 Leu
Tyr Cys Glu Ser Val His Asn Phe 1 5 <210> SEQ ID NO 89
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 89 Gly Gln Asp Leu Phe Gly Ile Trp
Ser Lys Val Tyr Asp Pro Leu 1 5 10 15 <210> SEQ ID NO 90
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 90 Thr Glu Asp Thr Met Thr Lys Leu
Arg Glu Leu Ser Glu Leu Ser 1 5 10 15 <210> SEQ ID NO 91
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 91 Ala Leu Gln Pro Gly Thr Ala Leu
Leu 1 5 <210> SEQ ID NO 92 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 92 Ala
Ile Leu Ala Leu Leu Pro Ala Leu 1 5 <210> SEQ ID NO 93
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 93 Ala Leu Leu Met Ala Gly Leu Ala
Leu 1 5 <210> SEQ ID NO 94 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 94 Leu
Leu Cys Tyr Ser Cys Lys Ala Gln Val 1 5 10 <210> SEQ ID NO 95
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 95 Leu Leu Ala Asn Gly Arg Met Pro
Thr Val Leu Gln Cys Val Asn 1 5 10 15 <210> SEQ ID NO 96
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 96 Arg Met Pro Thr Val Leu Gln Cys
Val Asn Val Ser Val Val Ser 1 5 10 15 <210> SEQ ID NO 97
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 97 Ser Val Ser Glu Ser Asp Thr Ile
Arg Ser Ile Ser Ile Ala Ser 1 5 10 15 <210> SEQ ID NO 98
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 98 Phe Leu Arg Gly Arg Ala Tyr Gly
Leu 1 5 <210> SEQ ID NO 99 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 99 Phe
Leu Phe Leu Leu Phe Phe Trp Leu 1 5 <210> SEQ ID NO 100
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 100 Thr Leu Met Ser Ala Met Thr Asn
Leu 1 5 <210> SEQ ID NO 101 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 101
Ala Leu Asp Val Tyr Asn Gly Leu Leu 1 5 <210> SEQ ID NO 102
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 102 Ile Leu Leu Trp Gln Pro Ile Pro
Val 1 5 <210> SEQ ID NO 103 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 103
Leu Leu Leu Gly Thr Ile His Ala Leu 1 5 <210> SEQ ID NO 104
<211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 104 Cys His Gly Val Thr Ser Ala Pro
Asp Thr Arg Pro Ala Pro Gly Ser 1 5 10 15 Thr Ala Pro Pro Ala His
Gly Val Thr Ser Ala Pro Asp Thr Arg Pro 20 25 30 Ala <210>
SEQ ID NO 105 <211> LENGTH: 501 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 105 Met Ala Val
Met Ala Pro Arg Thr Leu Val Leu Leu Leu Ser Gly Ala 1 5 10 15 Leu
Ala Leu Thr Gln Thr Trp Ala Phe Leu Trp Gly Pro Arg Ala Leu 20 25
30 Val Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
35 40 45 Gly Gly Gly Ser Gly Ile Gln Arg Thr Pro Lys Ile Gln Val
Tyr Ser 50 55 60 Arg His Pro Ala Glu Asn Gly Lys Ser Asn Phe Leu
Asn Cys Tyr Val 65 70 75 80 Ser Gly Phe His Pro Ser Asp Ile Glu Val
Asp Leu Leu Lys Asn Gly 85 90 95 Glu Arg Ile Glu Lys Val Glu His
Ser Asp Leu Ser Phe Ser Lys Asp 100 105 110 Trp Ser Phe Tyr Leu Leu
Tyr Tyr Thr Glu Phe Thr Pro Thr Glu Lys 115 120 125 Asp Glu Tyr Ala
Cys Arg Val Asn His Val Thr Leu Ser Gln Pro Lys 130 135 140 Ile Val
Lys Trp Asp Arg Asp Met Gly Gly Gly Gly Ser Gly Gly Gly 145 150 155
160 Gly Ser Gly Gly Gly Gly Ser Gly Ser His Ser Met Arg Tyr Phe Phe
165 170 175 Thr Ser Val Ser Arg Pro Gly Arg Gly Glu Pro Arg Phe Ile
Ala Val 180 185 190 Gly Tyr Val Asp Asp Thr Gln Phe Val Arg Phe Asp
Ser Asp Ala Ala 195 200 205 Ser Gln Arg Met Glu Pro Arg Ala Pro Trp
Ile Glu Gln Glu Gly Pro 210 215 220 Glu Tyr Trp Asp Gly Glu Thr Arg
Lys Val Lys Ala His Ser Gln Thr 225 230 235 240 His Arg Val Asp Leu
Gly Thr Leu Arg Gly Tyr Tyr Asn Gln Ser Glu 245 250 255 Ser His Thr
Val Gln Arg Met Tyr Gly Cys Asp Val Gly Ser Asp Trp 260 265 270 Arg
Phe Leu Arg Gly Tyr His Gln Tyr Ala Tyr Asp Gly Lys Asp Tyr 275 280
285 Ile Ala Leu Lys Glu Asp Leu Arg Ser Trp Thr Ala Ala Asp Met Ala
290 295 300 Ala Gln Thr Thr Lys His Lys Trp Glu Ala Ala His Val Ala
Glu Gln 305 310 315 320 Leu Arg Ala Tyr Leu Glu Gly Thr Cys Val Glu
Trp Leu Arg Arg Tyr 325 330 335 Leu Glu Asn Gly Lys Glu Thr Leu Gln
Arg Thr Asp Ser Pro Lys Ala 340 345 350 His Val Thr His His Pro Arg
Ser Lys Gly Glu Val Thr Leu Arg Cys 355 360 365 Trp Ala Leu Gly Phe
Tyr Pro Ala Asp Ile Thr Leu Thr Trp Gln Leu 370 375 380 Asn Gly Glu
Glu Leu Thr Gln Asp Met Glu Leu Val Glu Thr Arg Pro 385 390 395 400
Ala Gly Asp Gly Thr Phe Gln Lys Trp Ala Ser Val Val Val Pro Leu 405
410 415 Gly Lys Glu Gln Asn Tyr Thr Cys Arg Val Tyr His Glu Gly Leu
Pro 420 425 430 Glu Pro Leu Thr Leu Arg Trp Glu Pro Pro Pro Ser Thr
Asp Ser Tyr 435 440 445 Met Val Ile Val Ala Val Leu Gly Val Leu Gly
Ala Met Ala Ile Ile 450 455 460 Gly Ala Val Val Ala Phe Val Met Lys
Arg Arg Arg Asn Thr Gly Gly 465 470 475 480 Gly Asp Tyr Ala Leu Ala
Pro Gly Ser Gln Ser Ser Glu Met Ser Leu 485 490 495 Arg Asp Cys Lys
Ala 500 <210> SEQ ID NO 106 <211> LENGTH: 5 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <220> FEATURE:
<221> NAME/KEY: REPEAT <222> LOCATION: (1)..(5)
<223> OTHER INFORMATION: Linker consisting of (GGGGS)n
<400> SEQUENCE: 106 Gly Gly Gly Gly Ser 1 5 <210> SEQ
ID NO 107 <211> LENGTH: 6 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <220> FEATURE: <221> NAME/KEY:
REPEAT <222> LOCATION: (1)..(6) <223> OTHER
INFORMATION: Linker consiting of (GSTSGS)n <400> SEQUENCE:
107 Gly Ser Thr Ser Gly Ser 1 5 <210> SEQ ID NO 108
<211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 108 Gly Ser Thr Ser Gly Ser Gly Lys
Pro Gly Ser Gly Glu Gly Ser Thr 1 5 10 15 Lys Gly <210> SEQ
ID NO 109 <211> LENGTH: 23 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 109 Gly Phe Ala Lys Thr
Thr Ala Pro Ser Val Tyr Pro Leu Ala Pro Val 1 5 10 15 Leu Glu Ser
Ser Gly Ser Gly 20 <210> SEQ ID NO 110 <211> LENGTH: 10
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 110 Glu Pro Lys Ser Cys Asp Lys Thr His Thr 1 5 10
<210> SEQ ID NO 111 <211> LENGTH: 12 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 111
Glu Leu Lys Thr Pro Leu Gly Asp Thr Thr His Thr 1 5 10 <210>
SEQ ID NO 112 <211> LENGTH: 7 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 112 Glu Ser Lys
Tyr Gly Pro Pro 1 5
1 SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 112
<210> SEQ ID NO 1 <211> LENGTH: 123 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide3 <400> SEQUENCE: 1 Gln
Leu Gln Leu Gln Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30 Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Glu Arg Glu
Gly Val 35 40 45 Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr
Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Gly Gly Ser Tyr Tyr
Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser
Ser Gly Ser Thr Ser Gly Ser 115 120 <210> SEQ ID NO 2
<400> SEQUENCE: 2 000 <210> SEQ ID NO 3 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 3 Tyr Leu Glu Tyr Arg Gln Val Pro Gly 1 5
<210> SEQ ID NO 4 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 4 Glu Gly Asp Cys
Ala Pro Glu Glu Lys 1 5 <210> SEQ ID NO 5 <211> LENGTH:
9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 5 Tyr Leu Glu Tyr Arg Gln Val Pro Asp 1 5
<210> SEQ ID NO 6 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 6 Tyr Leu Glu Tyr
Arg Gln Val Pro Val 1 5 <210> SEQ ID NO 7 <211> LENGTH:
121 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 7 Glu Val Gln Leu Val Gln Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asp Tyr 20 25 30 Tyr Met Ser Trp Ile Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Ser Tyr Ile Ser Ser
Asp Gly Ser Thr Ile Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg
Phe Thr Val Ser Arg Asp Asn Ala Lys Asn Ser Leu Ser 65 70 75 80 Leu
Gln Met Asn Ser Leu Arg Ala Asp Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Val Ser Pro Arg Gly Tyr Tyr Tyr Tyr Gly Leu Asp Leu Trp Gly
100 105 110 Gln Gly Thr Thr Val Thr Val Ser Ser 115 120 <210>
SEQ ID NO 8 <211> LENGTH: 9 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 8 Ile Met Pro Lys Ala
Gly Leu Leu Ile 1 5 <210> SEQ ID NO 9 <211> LENGTH: 16
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 9 Lys Lys Leu Leu Thr Gln His Phe Val Gln Glu Asn Tyr Leu
Glu Tyr 1 5 10 15 <210> SEQ ID NO 10 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 10 Glu Ala Asp Pro Thr Gly His Ser Tyr 1 5 <210>
SEQ ID NO 11 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 11 Ser Leu Phe Arg
Ala Val Ile Thr Lys 1 5 <210> SEQ ID NO 12 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 12 Asn Tyr Lys His Cys Phe Pro Glu Ile 1 5
<210> SEQ ID NO 13 <211> LENGTH: 10 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 13 Glu
Val Tyr Asp Gly Arg Glu His Ser Ala 1 5 10 <210> SEQ ID NO 14
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 14 Arg Glu Pro Val Thr Lys Ala Glu
Met Leu 1 5 10 <210> SEQ ID NO 15 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 15 Asp Pro Ala Arg Tyr Glu Phe Leu Trp 1 5 <210>
SEQ ID NO 16 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 16 Ser Ala Phe Pro
Thr Thr Ile Asn Phe 1 5
<210> SEQ ID NO 17 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 17 Ser
Ala Tyr Gly Glu Pro Arg Lys Leu 1 5 <210> SEQ ID NO 18
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 18 Ser Ala Tyr Gly Glu Pro Arg Lys
Leu 1 5 <210> SEQ ID NO 19 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 19 Lys
Met Val Glu Leu Val His Phe Leu 1 5 <210> SEQ ID NO 20
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 20 Tyr Leu Gln Leu Val Phe Gly Ile
Glu Val 1 5 10 <210> SEQ ID NO 21 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 21 Glu Tyr Leu Gln Leu Val Phe Gly Ile 1 5 <210>
SEQ ID NO 22 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 22 Glu Ala Asp Pro
Ile Gly His Leu Tyr 1 5 <210> SEQ ID NO 23 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 23 Phe Leu Trp Gly Pro Arg Ala Leu Val 1 5
<210> SEQ ID NO 24 <211> LENGTH: 10 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 24 Met
Glu Val Asp Pro Ile Gly His Leu Tyr 1 5 10 <210> SEQ ID NO 25
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 25 Trp Gln Tyr Phe Phe Pro Val Ile
Phe 1 5 <210> SEQ ID NO 26 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 26 Gly
Val Tyr Asp Gly Arg Glu His Thr Val 1 5 10 <210> SEQ ID NO 27
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 27 Met Val Lys Ile Ser Gly Gly Pro
Arg 1 5 <210> SEQ ID NO 28 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 28 Gly
Leu Tyr Asp Gly Met Glu His Leu 1 5 <210> SEQ ID NO 29
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 29 Val Arg Ile Gly His Leu Tyr Ile
Leu 1 5 <210> SEQ ID NO 30 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 30 Ala
Ala Arg Ala Val Phe Leu Ala Leu 1 5 <210> SEQ ID NO 31
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 31 Phe Leu Trp Gly Pro Arg Ala Tyr
Ala 1 5 <210> SEQ ID NO 32 <211> LENGTH: 8 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 32 Tyr
Arg Pro Arg Pro Arg Arg Tyr 1 5 <210> SEQ ID NO 33
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 33 Tyr Tyr Trp Pro Arg Pro Arg Arg
Tyr 1 5 <210> SEQ ID NO 34 <211> LENGTH: 11 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 34 Met
Thr Gln Gly Gln His Phe Leu Gln Lys Val 1 5 10 <210> SEQ ID
NO 35 <211> LENGTH: 11 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 35 Ser Leu Leu Met Trp
Ile Thr Gln Cys Phe Leu 1 5 10 <210> SEQ ID NO 36 <211>
LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 36 Ser Leu Leu Met Trp Ile Thr Gln Cys 1 5
<210> SEQ ID NO 37 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 37 Gln
Leu Ser Leu Leu Met Trp Ile Thr 1 5 <210> SEQ ID NO 38
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 38 Ala Ser Gly Pro Gly Gly Gly Ala
Pro Arg 1 5 10 <210> SEQ ID NO 39 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 39 Phe Gln Asp Pro Gln Glu Arg Pro Arg 1 5 <210>
SEQ ID NO 40 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 40 Thr Thr Leu Glu
Gln Gln Tyr Asn Lys 1 5 <210> SEQ ID NO 41 <211>
LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 41 Ile Ser Glu Tyr Arg His Tyr Cys Tyr Ser 1
5 10 <210> SEQ ID NO 42 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 42 Gly
Thr Thr Leu Glu Gln Gln Tyr Asn Lys 1 5 10 <210> SEQ ID NO 43
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 43 Lys Ile Ser Glu Tyr Arg His Tyr
Cys 1 5 <210> SEQ ID NO 44 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 44 Tyr
Cys Tyr Ser Ile Tyr Gly Thr Thr Leu 1 5 10 <210> SEQ ID NO 45
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 45 Leu Leu Arg Arg Glu Val Tyr Asp
Phe 1 5 <210> SEQ ID NO 46 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 46 Ile
Val Tyr Arg Asp Gly Asn Pro Tyr 1 5 <210> SEQ ID NO 47
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 47 Thr Thr Leu Glu Gln Gln Tyr Asn
Lys 1 5 <210> SEQ ID NO 48 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 48 Cys
Tyr Ser Leu Tyr Gly Thr Thr Leu 1 5 <210> SEQ ID NO 49
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 49 Lys Leu Pro Gln Leu Cys Thr Glu
Leu 1 5 <210> SEQ ID NO 50 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 50 His
Tyr Cys Tyr Ser Leu Tyr Gly Thr 1 5 <210> SEQ ID NO 51
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 51 Leu Tyr Gly Thr Thr Leu Glu Gln
Gln Tyr 1 5 10 <210> SEQ ID NO 52 <211> LENGTH: 10
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 52 Glu Val Tyr Asp Phe Ala Phe Arg Asp Leu 1 5 10
<210> SEQ ID NO 53 <211> LENGTH: 10 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 53 Val
Tyr Asp Phe Ala Phe Arg Asp Leu Cys 1 5 10 <210> SEQ ID NO 54
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 54 Thr Ile His Asp Ile Ile Leu Glu
Cys Val 1 5 10 <210> SEQ ID NO 55 <211> LENGTH: 8
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 55
Thr Leu Gly Ile Val Cys Pro Ile 1 5 <210> SEQ ID NO 56
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 56 Leu Leu Met Gly Thr Leu Gly Ile
Val 1 5 <210> SEQ ID NO 57 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 57 Gly
Thr Leu Gly Ile Val Cys Pro Ile 1 5 <210> SEQ ID NO 58
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 58 Thr Leu Gly Ile Val Cys Pro Ile
Cys 1 5 <210> SEQ ID NO 59 <211> LENGTH: 12 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 59 Met
His Gly Asp Thr Pro Thr Leu His Glu Tyr Asp 1 5 10 <210> SEQ
ID NO 60 <211> LENGTH: 15 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 60 Asp Arg Ala His Tyr
Asn Ile Val Thr Phe Cys Cys Lys Cys Asp 1 5 10 15 <210> SEQ
ID NO 61 <211> LENGTH: 14 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <400> SEQUENCE: 61 Asp Ser Thr Leu Arg
Leu Cys Val Gln Ser Thr His Val Asp 1 5 10 <210> SEQ ID NO 62
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 62 Thr Leu His Glu Tyr Met Leu Asp
Leu 1 5 <210> SEQ ID NO 63 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 63 Tyr
Met Leu Asp Leu Gln Pro Glu Thr Thr 1 5 10 <210> SEQ ID NO 64
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 64 Tyr Met Leu Asp Leu Gln Pro Glu
Thr 1 5 <210> SEQ ID NO 65 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 65 Met
Leu Asp Leu Gln Pro Glu Thr Thr 1 5 <210> SEQ ID NO 66
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 66 Gln Pro Glu Thr Thr Asp Leu Tyr
Cys Tyr 1 5 10 <210> SEQ ID NO 67 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 67 Gln Ala Glu Pro Asp Arg Ala His Tyr 1 5 <210>
SEQ ID NO 68 <211> LENGTH: 10 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 68 Glu Pro Asp Arg
Ala His Tyr Asn Ile Val 1 5 10 <210> SEQ ID NO 69 <211>
LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 69 Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln
Ala Glu Pro Asp Arg Ala 1 5 10 15 <210> SEQ ID NO 70
<211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 70 Gly Gln Ala Glu Pro Asp Arg Ala
His Tyr Asn Ile Val Thr Phe Cys 1 5 10 15 Cys Lys Cys Asp Ser Thr
Leu Arg Leu Cys Val Gln Ser Thr His Val 20 25 30 Asp Ile Arg 35
<210> SEQ ID NO 71 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 71 Ala
His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp 1 5 10 <210>
SEQ ID NO 72 <211> LENGTH: 11 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 72 Cys Cys Lys Cys
Asp Ser Thr Leu Arg Leu Cys 1 5 10 <210> SEQ ID NO 73
<211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 73 Cys Asp Ser Thr Leu Arg Leu Cys
Val Gln Ser Thr His Val Asp Ile 1 5 10 15 Arg Thr Leu Glu 20
<210> SEQ ID NO 74 <211> LENGTH: 9 <212> TYPE:
PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 74 Lys Leu Gln Cys
Val Asp Leu His Val 1 5 <210> SEQ ID NO 75 <211>
LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 75 Phe Leu Thr Pro Lys Lys Leu Gln Cys Val 1
5 10 <210> SEQ ID NO 76 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 76 Val
Ile Ser Asn Asp Val Cys Ala Gln Val 1 5 10 <210> SEQ ID NO 77
<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 77 Tyr Ile Ser Asn Asp Val Cys Ala
Gln Val 1 5 10 <210> SEQ ID NO 78 <211> LENGTH: 9
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 78 Gln Val His Pro Gln Lys Val Thr Lys 1 5 <210>
SEQ ID NO 79 <211> LENGTH: 9 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 79 Cys Tyr Ala Ser
Gly Trp Gly Ser Ile 1 5 <210> SEQ ID NO 80 <211>
LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 80 His Tyr Arg Lys Trp Ile Lys Asp Thr Ile 1
5 10 <210> SEQ ID NO 81 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 81 Leu
Leu His Glu Thr Asp Ser Ala Val 1 5 <210> SEQ ID NO 82
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 82 Ala Leu Phe Asp Ile Glu Ser Lys
Val 1 5 <210> SEQ ID NO 83 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 83 Val
Leu Ala Gly Gly Phe Phe Leu Leu 1 5 <210> SEQ ID NO 84
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 84 Asn Tyr Ala Arg Thr Glu Asp Phe
Phe 1 5 <210> SEQ ID NO 85 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 85 Leu
Tyr Ser Asp Pro Ala Asp Tyr Phe 1 5 <210> SEQ ID NO 86
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 86 Thr Tyr Ser Val Ser Phe Asp Ser
Leu 1 5 <210> SEQ ID NO 87 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 87 Ala
Leu Asp Val Tyr Asn Gly Leu Leu 1 5 <210> SEQ ID NO 88
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 88 Leu Tyr Cys Glu Ser Val His Asn
Phe 1 5 <210> SEQ ID NO 89 <211> LENGTH: 15 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 89 Gly
Gln Asp Leu Phe Gly Ile Trp Ser Lys Val Tyr Asp Pro Leu 1 5 10 15
<210> SEQ ID NO 90 <211> LENGTH: 15 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 90 Thr
Glu Asp Thr Met Thr Lys Leu Arg Glu Leu Ser Glu Leu Ser 1 5 10 15
<210> SEQ ID NO 91 <211> LENGTH: 9 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 91 Ala
Leu Gln Pro Gly Thr Ala Leu Leu 1 5 <210> SEQ ID NO 92
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 92 Ala Ile Leu Ala Leu Leu Pro Ala
Leu 1 5 <210> SEQ ID NO 93 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide
<400> SEQUENCE: 93 Ala Leu Leu Met Ala Gly Leu Ala Leu 1 5
<210> SEQ ID NO 94 <211> LENGTH: 10 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 94 Leu
Leu Cys Tyr Ser Cys Lys Ala Gln Val 1 5 10 <210> SEQ ID NO 95
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 95 Leu Leu Ala Asn Gly Arg Met Pro
Thr Val Leu Gln Cys Val Asn 1 5 10 15 <210> SEQ ID NO 96
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 96 Arg Met Pro Thr Val Leu Gln Cys
Val Asn Val Ser Val Val Ser 1 5 10 15 <210> SEQ ID NO 97
<211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 97 Ser Val Ser Glu Ser Asp Thr Ile
Arg Ser Ile Ser Ile Ala Ser 1 5 10 15 <210> SEQ ID NO 98
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 98 Phe Leu Arg Gly Arg Ala Tyr Gly
Leu 1 5 <210> SEQ ID NO 99 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 99 Phe
Leu Phe Leu Leu Phe Phe Trp Leu 1 5 <210> SEQ ID NO 100
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 100 Thr Leu Met Ser Ala Met Thr Asn
Leu 1 5 <210> SEQ ID NO 101 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 101
Ala Leu Asp Val Tyr Asn Gly Leu Leu 1 5 <210> SEQ ID NO 102
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 102 Ile Leu Leu Trp Gln Pro Ile Pro
Val 1 5 <210> SEQ ID NO 103 <211> LENGTH: 9 <212>
TYPE: PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 103
Leu Leu Leu Gly Thr Ile His Ala Leu 1 5 <210> SEQ ID NO 104
<211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 104 Cys His Gly Val Thr Ser Ala Pro
Asp Thr Arg Pro Ala Pro Gly Ser 1 5 10 15 Thr Ala Pro Pro Ala His
Gly Val Thr Ser Ala Pro Asp Thr Arg Pro 20 25 30 Ala <210>
SEQ ID NO 105 <211> LENGTH: 501 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 105 Met Ala Val
Met Ala Pro Arg Thr Leu Val Leu Leu Leu Ser Gly Ala 1 5 10 15 Leu
Ala Leu Thr Gln Thr Trp Ala Phe Leu Trp Gly Pro Arg Ala Leu 20 25
30 Val Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
35 40 45 Gly Gly Gly Ser Gly Ile Gln Arg Thr Pro Lys Ile Gln Val
Tyr Ser 50 55 60 Arg His Pro Ala Glu Asn Gly Lys Ser Asn Phe Leu
Asn Cys Tyr Val 65 70 75 80 Ser Gly Phe His Pro Ser Asp Ile Glu Val
Asp Leu Leu Lys Asn Gly 85 90 95 Glu Arg Ile Glu Lys Val Glu His
Ser Asp Leu Ser Phe Ser Lys Asp 100 105 110 Trp Ser Phe Tyr Leu Leu
Tyr Tyr Thr Glu Phe Thr Pro Thr Glu Lys 115 120 125 Asp Glu Tyr Ala
Cys Arg Val Asn His Val Thr Leu Ser Gln Pro Lys 130 135 140 Ile Val
Lys Trp Asp Arg Asp Met Gly Gly Gly Gly Ser Gly Gly Gly 145 150 155
160 Gly Ser Gly Gly Gly Gly Ser Gly Ser His Ser Met Arg Tyr Phe Phe
165 170 175 Thr Ser Val Ser Arg Pro Gly Arg Gly Glu Pro Arg Phe Ile
Ala Val 180 185 190 Gly Tyr Val Asp Asp Thr Gln Phe Val Arg Phe Asp
Ser Asp Ala Ala 195 200 205 Ser Gln Arg Met Glu Pro Arg Ala Pro Trp
Ile Glu Gln Glu Gly Pro 210 215 220 Glu Tyr Trp Asp Gly Glu Thr Arg
Lys Val Lys Ala His Ser Gln Thr 225 230 235 240 His Arg Val Asp Leu
Gly Thr Leu Arg Gly Tyr Tyr Asn Gln Ser Glu 245 250 255 Ser His Thr
Val Gln Arg Met Tyr Gly Cys Asp Val Gly Ser Asp Trp 260 265 270 Arg
Phe Leu Arg Gly Tyr His Gln Tyr Ala Tyr Asp Gly Lys Asp Tyr 275 280
285 Ile Ala Leu Lys Glu Asp Leu Arg Ser Trp Thr Ala Ala Asp Met Ala
290 295 300 Ala Gln Thr Thr Lys His Lys Trp Glu Ala Ala His Val Ala
Glu Gln 305 310 315 320 Leu Arg Ala Tyr Leu Glu Gly Thr Cys Val Glu
Trp Leu Arg Arg Tyr 325 330 335 Leu Glu Asn Gly Lys Glu Thr Leu Gln
Arg Thr Asp Ser Pro Lys Ala 340 345 350 His Val Thr His His Pro Arg
Ser Lys Gly Glu Val Thr Leu Arg Cys 355 360 365 Trp Ala Leu Gly Phe
Tyr Pro Ala Asp Ile Thr Leu Thr Trp Gln Leu 370 375 380 Asn Gly Glu
Glu Leu Thr Gln Asp Met Glu Leu Val Glu Thr Arg Pro 385 390 395 400
Ala Gly Asp Gly Thr Phe Gln Lys Trp Ala Ser Val Val Val Pro Leu 405
410 415 Gly Lys Glu Gln Asn Tyr Thr Cys Arg Val Tyr His Glu Gly Leu
Pro 420 425 430 Glu Pro Leu Thr Leu Arg Trp Glu Pro Pro Pro Ser Thr
Asp Ser Tyr 435 440 445 Met Val Ile Val Ala Val Leu Gly Val Leu Gly
Ala Met Ala Ile Ile 450 455 460 Gly Ala Val Val Ala Phe Val Met Lys
Arg Arg Arg Asn Thr Gly Gly
465 470 475 480 Gly Asp Tyr Ala Leu Ala Pro Gly Ser Gln Ser Ser Glu
Met Ser Leu 485 490 495 Arg Asp Cys Lys Ala 500 <210> SEQ ID
NO 106 <211> LENGTH: 5 <212> TYPE: PRT <213>
ORGANISM: Artificial <220> FEATURE: <223> OTHER
INFORMATION: peptide <220> FEATURE: <221> NAME/KEY:
REPEAT <222> LOCATION: (1)..(5) <223> OTHER
INFORMATION: Linker consisting of (GGGGS)n <400> SEQUENCE:
106 Gly Gly Gly Gly Ser 1 5 <210> SEQ ID NO 107 <211>
LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<220> FEATURE: <221> NAME/KEY: REPEAT <222>
LOCATION: (1)..(6) <223> OTHER INFORMATION: Linker consiting
of (GSTSGS)n <400> SEQUENCE: 107 Gly Ser Thr Ser Gly Ser 1 5
<210> SEQ ID NO 108 <211> LENGTH: 18 <212> TYPE:
PRT <213> ORGANISM: Artificial <220> FEATURE:
<223> OTHER INFORMATION: peptide <400> SEQUENCE: 108
Gly Ser Thr Ser Gly Ser Gly Lys Pro Gly Ser Gly Glu Gly Ser Thr 1 5
10 15 Lys Gly <210> SEQ ID NO 109 <211> LENGTH: 23
<212> TYPE: PRT <213> ORGANISM: Artificial <220>
FEATURE: <223> OTHER INFORMATION: peptide <400>
SEQUENCE: 109 Gly Phe Ala Lys Thr Thr Ala Pro Ser Val Tyr Pro Leu
Ala Pro Val 1 5 10 15 Leu Glu Ser Ser Gly Ser Gly 20 <210>
SEQ ID NO 110 <211> LENGTH: 10 <212> TYPE: PRT
<213> ORGANISM: Artificial <220> FEATURE: <223>
OTHER INFORMATION: peptide <400> SEQUENCE: 110 Glu Pro Lys
Ser Cys Asp Lys Thr His Thr 1 5 10 <210> SEQ ID NO 111
<211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM:
Artificial <220> FEATURE: <223> OTHER INFORMATION:
peptide <400> SEQUENCE: 111 Glu Leu Lys Thr Pro Leu Gly Asp
Thr Thr His Thr 1 5 10 <210> SEQ ID NO 112 <211>
LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial
<220> FEATURE: <223> OTHER INFORMATION: peptide
<400> SEQUENCE: 112 Glu Ser Lys Tyr Gly Pro Pro 1 5
* * * * *