U.S. patent application number 15/436596 was filed with the patent office on 2018-05-31 for 4-aminoquinazolin compounds as prolyl hydroxylase inhibitors.
The applicant listed for this patent is JANSSEN PHARMACEUTICA NV. Invention is credited to Michael H. RABINOWITZ, Mark D. ROSEN, Kyle T. TARANTINO, Hariharan VENKATESAN.
Application Number | 20180148435 15/436596 |
Document ID | / |
Family ID | 44533176 |
Filed Date | 2018-05-31 |
United States Patent
Application |
20180148435 |
Kind Code |
A9 |
RABINOWITZ; Michael H. ; et
al. |
May 31, 2018 |
4-AMINOQUINAZOLIN COMPOUNDS AS PROLYL HYDROXYLASE INHIBITORS
Abstract
Aminoquinazolinyl compounds of formula (I) are described,
##STR00001## which are useful as prolyl hydroxylase inhibitors.
Such compounds may be used in pharmaceutical compositions and
methods for the treatment of disease states, disorders, and
conditions mediated by prolyl hydroxylase activity. Thus, the
compounds may be administered to treat, e.g., anemia, vascular
disorders, metabolic disorders, and wound healing.
Inventors: |
RABINOWITZ; Michael H.; (San
Diego, CA) ; ROSEN; Mark D.; (San Diego, CA) ;
TARANTINO; Kyle T.; (San Diego, CA) ; VENKATESAN;
Hariharan; (San Diego, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
JANSSEN PHARMACEUTICA NV |
Beerse |
|
BE |
|
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20170320859 A1 |
November 9, 2017 |
|
|
Family ID: |
44533176 |
Appl. No.: |
15/436596 |
Filed: |
February 17, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14670352 |
Mar 26, 2015 |
9573940 |
|
|
15436596 |
|
|
|
|
14313892 |
Jun 24, 2014 |
9006251 |
|
|
14670352 |
|
|
|
|
13816747 |
Feb 13, 2013 |
8796263 |
|
|
PCT/US2011/047626 |
Aug 12, 2011 |
|
|
|
14313892 |
|
|
|
|
61373664 |
Aug 13, 2010 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 31/517 20130101;
C07D 417/14 20130101; A61P 9/00 20180101; A61P 43/00 20180101; A61P
31/00 20180101; A61P 17/02 20180101; A61P 7/06 20180101; A61P 3/04
20180101; C07D 403/04 20130101; C07D 413/14 20130101; C07D 403/14
20130101; A61P 3/10 20180101; C07D 405/14 20130101; A61P 19/00
20180101; A61P 1/04 20180101; A61P 9/10 20180101; C07D 401/14
20130101 |
International
Class: |
C07D 405/14 20060101
C07D405/14; C07D 417/14 20060101 C07D417/14; C07D 413/14 20060101
C07D413/14; A61K 31/517 20060101 A61K031/517; C07D 403/04 20060101
C07D403/04; C07D 401/14 20060101 C07D401/14; C07D 403/14 20060101
C07D403/14 |
Claims
1. A compound of the formula (I): ##STR00223## wherein: n is 0-3
R.sup.1 is a member independently selected from the group
consisting of halo, --O--R.sup.c, --C.sub.1-4alkyl, cyclohexyl,
phenyl optionally substituted with --C.sub.1-4alkyl, benzyl
optionally substituted with --C.sub.1-4alkyl, and
--NR.sup.aR.sup.b; R.sup.a is H and R.sup.b is benzyl optionally
substituted with --C.sub.1-4alkyl, or R.sup.a and R.sup.b are taken
together with the nitrogen to which they are attached to form a
piperidine ring; R.sup.c is cyclohexyl, phenyl optionally
substituted with one or more R.sup.d members; R.sup.d is a member
independently selected from the group consisting of --H, halo, and
--C.sub.1-4alkyl; R.sup.2 is a member independently selected from
the group consisting of --H, and --C.sub.1-4alkyl, R.sup.3 is a
member independently selected from the group consisting of --H,
--C.sub.1-4alkyl optionally substituted with --OCH.sub.3 or
--N(C.sub.1-4alkyl).sub.2, cyano, --SO.sub.2CH.sub.3,
tetrahydropyran, --(CH.sub.2).sub.mC.sub.3-8cycloalkyl,
--(CH.sub.2).sub.mphenyl optionally substituted with one or more
halo, or --C.sub.1-4alkyl; m is 0-1; R.sup.2 and R.sup.3 can be
taken together with the nitrogen to which they are attached to form
a 4 to 7 membered heterocycloalkyl ring optionally containing O, N,
S optionally substituted with --OH, cyano, halo,
--N--C(O)C.sub.1-4alkyl, and --C.sub.1-4alkyl; and enantiomers,
diastereomers, racemates, and pharmaceutically acceptable salts
thereof.
2. A compound as defined in claim 1, where R.sup.1 is a member
independently selected from the group consisting of bromo, chloro,
fluoro, methyl, isopropyl, cyclohexyl, cyclohexyloxy, phenyl,
2-methylphenyl, benzyl, phenoxy, 4-chlorophenoxy,
2,6-dimethyl-phenoxy, piperidinyl, and
(2,6-dimethylbenzyl)amino.
3. A compound of claim 1 where n is 1.
4. A compound of claim 1 where n is 2.
5. A compound of claim 1 where n is 3.
6. A compound as defined in claim 1, where R.sup.a is H and R.sup.b
is 2,6-dimethylbenzyl.
7. A compound as defined in claim 1, where R.sup.c is a member
selected from the group consisting of phenyl, cyclohexyl,
4-chlorophenyl, and 2,6-dimethyl-phenyl.
8. A compound as defined in claim 1, where R.sup.d is a member
selected from the group consisting of --H, chloro, and
--CH.sub.3.
9. A compound as defined in claim 1, where R.sup.2 is --H and
R.sup.3 is a member selected from the group consisting of H, cyano,
methyl, ethyl, propyl, tertbutyl, cyclopropyl, cyclopropylmethyl,
tetrahydropyranyl, cyclohexylmethyl, phenyl, 2-chlorophenyl,
2,6-dimethylbenzyl, and --SO.sub.2CH.sub.3.
10. A compound as defined in claim 1, where R.sup.2 is selected
from the group consisting of methyl, ethyl, propyl, and butyl.
11. A compound as defined in claim 1, where R.sup.3 is selected
from the group consisting of methyl, ethyl, propyl, butyl,
tertbutyl, 2-methoxyethyl, 2-methoxy-1-methyl-ethyl and
diethylamino-ethyl.
12. A compound as defined in claim 1, where R.sup.2 and R.sup.3 are
taken together with the nitrogen to which they are attached to form
pyrrolidine, piperidine, 4-methyl-1,4-diazepane, thiomorpholine,
4-hydroxypiperidine, morpholine, 4-acetamidopiperidine,
4-cyanopiperidine, 4-fluoropiperidine, azepane, or
4-isopropylpiperidine.
13. A compound as defined in claim 1, where n is 2, R.sup.1 is a
member independently selected from the group consisting of halo,
cyclohexyl, and 2,6-dimethyl-phenoxy, and R.sup.2 and R.sup.3 are
C.sub.1-4alkyl, or R.sup.2 and R.sup.3 are taken together with the
nitrogen to which they are attached to form morpholine.
14. A compound selected from the group consisting of:
1-[4-Amino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazole-
-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-methylamino-quinazolin-2-yl]-1H-py-
razole-4-carboxylic acid;
1-[4-Dimethylamino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H--
pyrazole-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-piperidin-1-yl-quinazolin-2-yl]-1H-
-pyrazole-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-pyrrolidin-1-yl-quinazolin-2-yl]-1-
H-pyrazole-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-phenylamino-quinazolin-2-yl]-1H-py-
razole-4-carboxylic acid;
1-[4-(2-Chloro-phenylamino)-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin--
2-yl]-1H-pyrazole-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-propylamino-quinazolin-2-yl]-1H-py-
razole-4-carboxylic acid;
(rac)-1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-(2-methoxy-1-methyl-ethylami-
no)-quinazolin-2-yl]-1H-pyrazole-4-carboxylic acid;
1-[4-(2-Diethylamino-ethylamino)-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinaz-
olin-2-yl]-1H-pyrazole-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-4-dibutylamino-7-fluoro-quinazolin-2-yl]-1H-p-
yrazole-4-carboxylic acid;
1-[6-(2,6-Dimethyl-phenoxy)-4-dipropylamino-7-fluoro-quinazolin-2-yl]-1H--
pyrazole-4-carboxylic acid;
1-(4-((Cyclohexylmethyl)amino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin-
-2-yl)-1H-pyrazole-4-carboxylic acid;
1-((4-Cyclopropylamino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin-2-yI)--
1H-pyrazole-4-carboxylic acid;
1-((4-Cyclopropanemethylamino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin-
-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-((tetrahydro-2
H-pyran-4-yl)amino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-(4-methyl-1,4-diazepan-1-yl)quinazo-
lin-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-thiomorpholinoquinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid;
1-(6-(2,6-dimethylphenoxy)-7-fluoro-4-(4-hydroxypiperidin-1-yl)quinazolin-
-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(4-(4-Acetamidopiperidin-1-yl)-6-(2,6-dimethylphenoxy)-7-fluoroquinazol-
in-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-Cyclohexyl-4-methylamino-quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-[6-Cyclohexyl-4-(2,6-dimethyl-benzylamino)-quinazolin-2-yl]-1H-py-
razole-4-carboxylic acid;
1-(4-Amino-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Cyclohexyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid;
1-(6-Cyclohexyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(6-Cyclohexyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Cyclohexyl-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(4-((2-Chlorophenyl)amino)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(4-(4-Cyanopiperidin-1-yl)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(6-Cyclohexyl-4-(4-fluoropiperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(6-Cyclohexyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(6-Cyclohexyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(6-Cyclohexyl-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-Cyanamido-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid;
1-(4-(tert-Butylamino)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(4-(Azepan-1-yl)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Cyclohexyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid;
1-(6-Cyclohexyl-4-((cyclohexylmethyl)amino)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(6-Cyclohexyl-4-(methylsulfonamido)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(4-(Dimethylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Ethyl(methyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(6-Phenyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Phenyl-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid
1-(6-Phenyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(4-(Diethylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(4-((2-Chlorophenyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(4-(Azepan-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-((Cyclohexylmethyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(4-Cyanamido-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Cyclopropylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(tert-Butylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(4-Amino-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-Phenyl-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid;
1-(4-(4-Acetamidopiperidin-1-yl)-6-phenylquinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid;
1-(6-Phenyl-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(4-(4-Methyl-1,4-diazepan-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(4-Morpholino-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(4-Cyanopiperidin-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(6-(4-Chlorophenoxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid;
1-(6-(4-Chlorophenoxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(6-(4-Chlorophenoxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(6-(4-Chlorophenoxy)-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(6-(4-Chlorophenoxy)-4-((cyclohexylmethyl)amino)quinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(6-(4-chlorophenoxy)-4-(4-cyanopiperidin-1-yl)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(4-(Azepan-1-yl)-6-(4-chlorophenoxy)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(6-(4-Chlorophenoxy)-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid;
1-(6-(4-Chlorophenoxy)-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl-
)-1H-pyrazole-4-carboxylic acid;
1-(6-(4-Chlorophenoxy)-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(4-(4-Acetamidopiperidin-1-yl)-6-(4-chlorophenoxy)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid;
1-(6-(4-Chlorophenoxy)-4-(4-methyl-1,4-diazepan-1-yl)quinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid;
1-(4-(tert-Butylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Phenoxy-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(4-(Diethylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Cyclopropylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid;
1-(6-Phenoxy-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(4-(Dimethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(7-Phenoxy-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(7-Phenoxy-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Dimethylamino)-7-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid;
1-(7-Phenyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(7-Phenyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Diethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid;
1-(4-((Cyclohexylmethyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid;
1-(4-(4-Isopropylpiperidin-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(4-(Cyclopropylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid;
1-(4-(Azepan-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid;
1-(4-(Diethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(4-Morpholino-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(7-Phenoxy-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(4-Fluoropiperidin-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(4-(Dibutylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Dipropylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(4-(Ethyl(methyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(4-((2-Methoxyethyl)(methyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(7-Bromo-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Cyclohexylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(4-((Cyclopropylmethyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(4-(tert-Butylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-(Cyclohexyloxy)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(dimethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(diethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-7-fluoro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(ethyl(methyl)amino)-7-fluoroquinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(cyclopropylamino)-7-fluoroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(6-Benzyl-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid;
1-(6-Benzyl-4-(dimethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(6-Benzyl-4-(diethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(6-Benzyl-7-fluoro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(6-Benzyl-4-(ethyl(methyl)amino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(6-Benzyl-4-(cyclopropylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-
-pyrazole-4-carboxylic acid;
1-(4-(Dimethylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylic acid;
1-(4-(Diethylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin-2-yl-
)-1H-pyrazole-4-carboxylic acid;; 1
1-(6-((2,6-Dimethylbenzyl)amino)-7-fluoro-4-(pyrrolidin-1-yl)quinazolin-2-
-yl)-1H-pyrazole-4-carboxylic acid;
1-(6((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)-7-fluoroquinazolin-
-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(4-(Cyclopropylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin--
2-yl)-1H-pyrazole-4-carboxylic acid;
1-(7-Fluoro-4-morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(4-(Dimethylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(4-(Diethylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid
1-(7-Fluoro-4-(pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(4-(Cyclopropylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole--
4-carboxylic acid;
1-(7-Fluoro-6-isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(4-(Dimethylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(4-(Diethylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(7-Fluoro-6-isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(4-(Cyclopropylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole--
4-carboxylic acid;
1-(7-Fluoro-4-morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(4-(Dimethylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(4-(Diethylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(7-Fluoro-6-(piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid;
1-(4-(Cyclopropylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-7-chloro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(dimethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(diethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(ethyl(methyl)amino)-7-chloroquinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(cyclopropylamino)-7-chloroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(6-Benzyl-7-chloro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid;
1-(6-Benzyl-4-(dimethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(6-Benzyl-4-(diethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(6-Benzyl-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(6-Benzyl-4-(ethyl(methyl)amino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(6-Benzyl-4-(cyclopropylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-7-chloro-4-morpholinoquinazolin-2-yl)-1H-
-pyrazole-4-carboxylic acid;
1-(4-(Dimethylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylic acid;;
1-(4-(Diethylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin-2-yl-
)-1H-pyrazole-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2-
-yl)-1H-pyrazole-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)-7-chloroquinazoli-
n-2-yl)-1H-pyrazole-4-carboxylic acid;
1-(4-(Cyclopropylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin--
2-yl)-1H-pyrazole-4-carboxylic acid;
1-(7-Chloro-4-morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(4-(Dimethylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(4-(Diethylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(7-Chloro-4-(pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(4-(Ethyl(methyl)amino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(4-(Cyclopropylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole--
4-carboxylic acid;
1-(7-Chloro-6-isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid;
1-(4-(Dimethylamino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(4-(Diethylamino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(7-Chloro-6-isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(4-(Ethyl(methyl)amino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(4-(Cyclopropylamino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyrazole--
4-carboxylic acid;
1-(7-Chloro-4-morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(4-(Dimethylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(4-(Diethylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(7-Chloro-6-(piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(4-(Ethyl(methyl)amino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid;
1-(4-(Cyclopropylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid;
1-(6-(Cyclohexyloxy)-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(6-(Cyclohexyloxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid;
1-(6-(Cyclohexyloxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(6-(Cyclohexyloxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(6-(Cyclohexyloxy)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid;
1-(6-Benzyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Benzyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Benzyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid;
1-(6-Benzyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid;
1-(6-Benzyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Benzyl-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(6-Isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Isopropyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(6-Isopropyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(6-Isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(6-Isopropyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid;
1-(6-Isopropyl-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-morpholinoquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-(dimethylamino)quinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-(diethylamino)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-(cyclopropylamino)quinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid;
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1-
H-pyrazole-4-carboxylic acid;
1-(4-Morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Dimethylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(4-(Diethylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid;
1-(4-(Pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid;
1-(4-(Cyclopropylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid;
1-(4-(ethyl(methyl)amino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid;
1-(4-Morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid;
1-(4-(Dimethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid;
1-(4-(Diethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid;
1-(6-(Piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid;
1-(4-(Cyclopropylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid;
1-(4-(Ethyl(methyl)amino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole--
4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-morpholinoquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-dimethylaminoquinazolin-2-yl)-1H-py-
razole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-diethylaminoquinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1-
H-pyrazole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-cyclopropylaminoquinazolin-2-yl)-1H-
-pyrazole-4-carboxylic acid;
1-(6-(2,6-Dimethylphenoxy)-4-(ethyl(methyl)amino)-7-methylquinazolin-2-yl-
)-1H-pyrazole-4-carboxylic acid; and pharmaceutically acceptable
salts thereof.
15. A pharmaceutical composition comprising a pharmaceutically
acceptable excipient and an effective amount of compound having PHD
inhibitor activity of formula (I): ##STR00224## wherein: n is 0-3
R.sup.1 is a member independently selected from the group
consisting of halo, --O--R.sup.c, --C.sub.1-4alkyl, cyclohexyl,
phenyl optionally substituted with --C.sub.1-4alkyl, benzyl
optionally substituted with --C.sub.1-4alkyl, and
--NR.sup.aR.sup.b; R.sup.a is H and R.sup.b is benzyl optionally
substituted with --C.sub.1-4alkyl, or R.sup.a and R.sup.b are taken
together with the nitrogen to which they are attached to form a
piperidine ring; R.sup.c is cyclohexyl, phenyl optionally
substituted with one or more R.sup.d members; R.sup.d is a member
independently selected from the group consisting of --H, halo, and
--C.sub.1-4alkyl; R.sup.2 is a member independently selected from
the group consisting of --H, and --C.sub.1-4alkyl, R.sup.3 is a
member independently selected from the group consisting of --H,
--C.sub.1-4alkyl optionally substituted with --OCH.sub.3 or
--N(C.sub.1-4alkyl).sub.2, cyano, --SO.sub.2CH.sub.3,
tetrahydropyran, --(CH.sub.2).sub.mC.sub.3-8cycloalkyl,
--(CH.sub.2).sub.mphenyl optionally substituted with one or more
halo, or --C.sub.1-4alkyl; m is 0-1; R.sup.2 and R.sup.3 can be
taken together with the nitrogen to which they are attached to form
a 4 to 7 membered heterocycloalkyl ring optionally containing O, N,
S optionally substituted with --OH, cyano, halo,
--N--C(O)C.sub.1-4alkyl, and --C.sub.1-4alkyl; and enantiomers,
diastereomers, racemates, and pharmaceutically acceptable salts
thereof.
16. A pharmaceutical composition comprising and effective amount of
at least one chemical entity of claim 14.
17. A method for the treatment of anemia, hypoxia, ischemia,
peripheral vascular disease, myocardial infarction, stroke,
diabetes, obesity, inflammatory bowel disease, ulcerative colitis,
Crohn's disease, wounds, infection, burns and bone fracture
comprising the step of administering to a patient in need thereof a
therapeutically effective amount of compound having PHD inhibitor
activity of formula (I): ##STR00225## wherein: n is 0-3 R.sup.1 is
a member independently selected from the group consisting of halo,
--O--R.sup.c, --C.sub.1-4alkyl, cyclohexyl, phenyl optionally
substituted with --C.sub.1-4alkyl, benzyl optionally substituted
with --C.sub.1-4alkyl, and --NR.sup.aR.sup.b; R.sup.a is H and
R.sup.b is benzyl optionally substituted with --C.sub.1-4alkyl, or
R.sup.a and R.sup.b are taken together with the nitrogen to which
they are attached to form a piperidine ring; R.sup.c is cyclohexyl,
phenyl optionally substituted with one or more R.sup.d members;
R.sup.d is a member independently selected from the group
consisting of --H, halo, and --C.sub.1-4alkyl; R.sup.2 is a member
independently selected from the group consisting of --H,
--C.sub.1-4alkyl, R.sup.3 is a member independently selected from
the group consisting of --H, --C.sub.1-4alkyl optionally
substituted with --OCH.sub.3 or --N(C.sub.1-4alkyl).sub.2, cyano,
--SO.sub.2CH.sub.3, tetrahydropyran,
--(CH.sub.2).sub.mC.sub.3-8cycloalkyl, --(CH.sub.2).sub.mphenyl
optionally substituted with one or more halo, or --C.sub.1-4alkyl;
m is 0-1; R.sup.2 and R.sup.3 can be taken together with the
nitrogen to which they are attached to form a 4 to 7 membered
heterocycloalkyl ring optionally containing O, N, S optionally
substituted with --OH, cyano, halo, --N--C(O)C.sub.1-4alkyl, and
--C.sub.1-4alkyl; and enantiomers, diastereomers, racemates, and
pharmaceutically acceptable salts thereof.
18. A method for treating a hypoxic disorder comprising the step of
administering to a patient in need thereof a therapeutically
effective amount of compound having PHD inhibitor activity of
formula (I): ##STR00226## wherein: n is 0-3 R.sup.1 is a member
independently selected from the group consisting of halo,
--O--R.sup.c, --C.sub.1-4alkyl, cyclohexyl, phenyl optionally
substituted with --C.sub.1-4alkyl, benzyl optionally substituted
with --C.sub.1-4alkyl, and --NR.sup.aR.sup.b, R.sup.a is H and
R.sup.b is benzyl optionally substituted with --C.sub.1-4alkyl, or
R.sup.a and R.sup.b are taken together with the nitrogen to which
they are attached to form a piperidine ring; R.sup.c is cyclohexyl,
phenyl optionally substituted with one or more R.sup.d members;
R.sup.d is a member independently selected from the group
consisting of --H, halo, and --C.sub.1-4alkyl, R.sup.2 is a member
independently selected from the group consisting of --H, and
--C.sub.1-4alkyl, R.sup.3 is a member independently selected from
the group consisting of --H, --C.sub.1-4alkyl optionally
substituted with --OCH.sub.3 or --N(C.sub.1-4alkyl).sub.2, cyano,
--SO.sub.2CH.sub.3, tetrahydropyran,
--(CH.sub.2).sub.mC.sub.3-8cycloalkyl, --(CH.sub.2).sub.mphenyl
optionally substituted with one or more halo, or --C.sub.1-4alkyl;
m is 0-1; R.sup.2 and R.sup.3 can be taken together with the
nitrogen to which they are attached to form a 4 to 7 membered
heterocycloalkyl ring optionally containing O, N, S optionally
substituted with --OH, cyano, halo, --N--C(O)C.sub.1-4alkyl, and
--C.sub.1-4alkyl, and enantiomers, diastereomers, racemates, and
pharmaceutically acceptable salts thereof.
19. The method of claim 18, wherein said hypoxic disorder is
selected from the group consisting of anemia, ischemia, stroke,
myocardial infarction, and coronary artery disease.
20. A method for treating diabetes comprising administering a
therapeutically effective amount of a compound of claim 1 to a
patient in need thereof.
21. A method for wound treatment comprising administering a
therapeutically effective amount of a compound of claim 1 to a
patient in need thereof.
22. A method for treating a metabolic disorder comprising
administering a therapeutically effective amount of a compound of
claim 1 to a patient in need thereof.
23. The method of claim 22 wherein said metabolic disorder is
obesity or diabetes.
Description
CROSS REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. provisional
patent application Ser. No. 61/373,664, filed Aug. 13, 2010.
FIELD OF THE INVENTION
[0002] The present invention relates to certain aminoquinazolinyl
compounds, pharmaceutical compositions containing them, and methods
of using them for the treatment of disease states, disorders, and
conditions mediated by prolyl hydroxylase activity.
BACKGROUND OF THE INVENTION
[0003] Cells respond to hypoxia by activating the transcription of
genes involved in cell survival, oxygen delivery and utilization,
angiogenesis, cellular metabolism, regulation of blood pressure,
hematopoiesis, and tissue preservation. Hypoxia-inducible factors
(HIFs) are key transcriptional regulators of these genes (Semenza
et al., 1992, Mol. Cell Biol., 12(12):5447-54; Wang et al., 1993, J
Biol Chem., 268(29):21513-18; Wang et al., 1993, Proc Natl Acad
Sci., 90:4304-08; Wang et al., 1995, J Biol Chem., 270(3):1230-37).
Three forms of HIF-.alpha. have been described: HIF-1.alpha.,
HIF-2.alpha. and HIF-3.alpha. (Scheuermann et al., 2007, Methods
Enzymol., 435:3-24). Pairing of a HIF.alpha. sub-unit with
HIF-1.beta. forms a functional heterodimeric protein that
subsequently recruits other transcriptional factors such as p300
and CBP (Semenza, 2001, Trends Mol Med., 7(8):345-50).
[0004] A family of highly conserved oxygen, iron, and
2-oxoglutarate-dependent prolyl hydroxylase (PHD) enzymes mediate
the cells response to hypoxia via post-translational modification
of HIF (Ivan et al., 2001, Science, 292:464-68; Jaakkola et al.,
2001, Science, 292:468-72). Under normoxic conditions, PHD
catalyzes the hydroxylation of two conserved proline residues
within HIF. Von Hippel Lindau (VHL) protein binds selectively to
hydroxylated HIF. The binding of VHL renders HIF a target for
polyubiquitination by the E3 ubiquitin ligase complex and its
subsequent degradation by the 26S proteasome (Ke et al., 2006, Mol.
Pharmacol. 70(5):1469-80; Semenza, Sci STKE., 2007, 407(cm8):1-3).
As the affinity of PHD for oxygen is within the physiological range
of oxygen and oxygen is a necessary co-factor for the reaction, PHD
is inactivated when oxygen tension is reduced. In this way, HIF is
rapidly degraded under normoxic conditions but accumulates in cells
under hypoxic conditions or when PHD is inhibited.
[0005] Four isotypes of PHD have been described: PHD1, PHD2, PHD3,
and PHD4 (Epstein et al., 2001, Cell, 107:43-54; Kaelin, 2005, Annu
Rev Biochem., 74:115-28; Schmid et al., 2004, J Cell Mol Med.,
8:423-31). The different isotypes are ubiquitously expressed but
are differentially regulated and have distinct physiological roles
in the cellular response to hypoxia. There is evidence that the
various isotypes have different selectivity for the three different
HIF.alpha. sub-types (Epstein et al., supra). In terms of cellular
localization, PHD1 is primarily nuclear, PHD2 is primarily
cytoplasmic, and PHD3 appears to be both cytoplasmic and nuclear
(Metzen E, et al. 2003, J Cell Sci., 116(7):1319-26). PHD2 appears
to be the predominant HIF.alpha. prolyl hydroxylase under normoxic
conditions (Ivan et al., 2002. Proc Natl Acad Sci. USA,
99(21):13459-64; Berra et al., 2003, EMBO J., 22:4082-90). The
three isotypes have a high degree of amino-acid homology and the
active site of the enzyme is highly conserved.
[0006] The HIF target gene products are involved in a number of
physiological and pathophysiological processes including but not
limited to: erythropoiesis, angiogenesis, regulation of energy
metabolism, vasomotor function, and cell apoptosis/proliferation.
The first gene described as a HIF target was that encoding
erythropoietin (EPO) (Wang et al., 1993, supra). It was recognized
that a reduction in the oxygen carrying capacity of the blood is
sensed in the kidney and that the kidney and liver respond by
releasing more EPO, the hormone that stimulates red blood cell
proliferation and maturation. EPO has a number of other important
effects on non-hematopoietic cell types and has emerged as a key
tissue-protective cytokine (Arcasoy, 2008, Br J Haematol.,
141:14-31). Thus EPO is now implicated in wound healing and
angiogenesis as well as the response of tissues to ischemic insult.
Most of the enzymes involved in anaerobic glycolysis are encoded by
HIF target genes and as a result glycolysis is increased in hypoxic
tissues (Shaw, 2006, Curr Opin Cell Biol., 18(6):598-608). The
known HIF target gene products in this pathway include but are not
limited to: glucose transporters such as GLUT-1 (Ebert et al.,
1995, J Biol Chem., 270(49):29083-89), enzymes involved in the
breakdown of glucose to pyruvate such as hexokinase and
phosphoglycerate kinase 1 (Firth et al., 1994, Proc Nati Acad Sci.
USA, 91:6496-6500) as well as lactate dehydrogenase (Firth et al.,
supra). HIF target gene products are also involved in the
regulation of cellular metabolism. For example, pyruvate
dehydrogenase kinase-1 is a target HIF gene product and regulates
the entry of pyruvate into the Kreb's cycle by reducing the
activity of pyruvate dehydrogenase by phosphorylation (Kim et al.,
2006, Cell Metab., 3:177-85; Papandreou et al., 2006, Cell Metab.,
3:187-197). HIF target gene products are also involved in
angiogenesis. For example, vascular endothelial growth factor
(VEGF) (Liu et al., 1995, Circ Res., 77(3):638-43) is a known
regulator of angiogenesis and vasculogenesis. HIF target gene
products also function in the regulation of vascular tone and
include heme oxygenase-1 (Lee et al., 1997, J Biol Chem.,
272(9):5375-81). A number of HIF regulated gene products such as
platelet-derived growth factor (PDGF) (Yoshida et al., 2006, J
Neurooncol., 76(1):13-21), vascular endothelial growth factor
(Breen, 2007, J Cell Biochem., 102(6):1358-67) and EPO (Arcasoy,
supra) also function in the coordinated response to wound
healing.
[0007] Targeted disruption of the prolyl hydroxylase (PHD) enzyme
activity by small molecules has potential utility in the treatment
of disorders of oxygen sensing and distribution. Examples include
but are not limited to: anemia; sickle cell anemia; peripheral
vascular disease; coronary artery disease; heart failure;
protection of tissue from ischemia in conditions such as myocardial
ischemia, myocardial infarction and stroke; preservation of organs
for transplant; treatment of tissue ischemia by regulating and/or
restoring blood flow, oxygen delivery and/or energy utilization;
acceleration of wound healing particularly in diabetic and aged
patients; treatment of burns; treatment of infection; bone healing,
and bone growth. In addition, targeted disruption of PHD is
expected to have utility in treating metabolic disorders such as
diabetes, obesity, ulcerative colitis, inflammatory bowel disease
and related disorders such as Crohn's disease. (Recent Patents on
Inflammation & Allergy Drug Discovery, 2009, 3, 1-16).
[0008] HIF has been shown to be the primary transcriptional factor
that leads to increased erythropoietin production under conditions
of hypoxia (Wang et al., 1993, supra). While treatment with
recombinant human erythropoietin has been demonstrated to be an
effective method of treating anemia, small molecule mediated PHD
inhibition can be expected to offer advantages over treatment with
erythropoietin. Specifically, the function of other HIF gene
products are necessary for hematopoesis and regulation of these
factors increases the efficiency of hematopoesis. Examples of HIF
target gene products that are critical for hematopoesis include:
transferrin (Rolfs et al., 1997, J Biol Chem., 272(32):20055-62),
transferrin receptor (Lok et al., 1999, J Biol Chem.,
274(34):24147-52; Tacchini et al., 1999, J Biol Chem.,
274(34):24142-46) and ceruloplasmin (Mukhopadhyay et al., 2000, J
Biol Chem., 275(28):21048-54). Hepcidin expression is also
suppressed by HIF (Peyssonnaux et al., 2007, J Clin Invest.,
117(7):1926-32) and small molecule inhibitors of PHD have been
shown to reduce hepcidin production (Braliou et al., 2008, J
Hepatol., 48:801-10). Hepcidin is a negative regulator of the
availability of the iron that is necessary for hematopoesis, so a
reduction in hepcidin production is expected to be beneficial to
the treatment of anemia. PHD inhibition may also be useful when
used in conjunction with other treatments for anemia including iron
supplementation and/or exogenous erythropoietin. Studies of
mutations in the PHD2 gene occurring naturally in the human
population provide further evidence for the use of PHD inhibitors
to treat anemia. Two recent reports have shown that patients with
dysfunctional mutations in the PHD2 gene display increased
erythrocytosis and elevated blood hemoglobin (Percy et al., 2007,
PNAS, 103(3):654-59; Al-Sheikh et al., 2008, Blood Cells Mol Dis.,
40:160-65). In addition, a small molecule PHD inhibitor has been
evaluated in healthy volunteers and patients with chronic kidney
disease (U.S. pat. appl. US2006/0276477, Dec. 7, 2006). Plasma
erythropoietin was increased in a dose-dependent fashion and blood
hemoglobin concentrations were increased in the chronic kidney
disease patients.
[0009] Metabolic adaptation and preservation of tissues are
jeopardized by ischemia. PHD inhibitors increase the expression of
genes that lead to changes in metabolism that are beneficial under
ischemic conditions (Semenza, 2007, Biochem J., 405:1-9). Many of
the genes encoding enzymes involved in anaerobic glycolysis are
regulated by HIF and glycolysis is increased by inhibiting PHD
(Shaw, supra). Known HIF target genes in this pathway include but
are not limited to: GLUT-1 (Ebert et al., supra), hexokinase,
phosphoglycerate kinase 1, lactate dehydrogenase (Firth et al.,
supra), pyruvate dehydrogenase kinase-1 (Kim et al., supra;
Papandreou et al., supra). Pyruvate dehydrogenase kinase-1
suppresses the entry of pyruvate into the Kreb's cycle. HIF
mediates a switch in the expression of the cytochromes involved in
electron transport in the mitochondria (Fukuda et al., 2007,
Cell,129(1):111-22). This change in the cytochrome composition
optimizes the efficiency in ATP production under hypoxic conditions
and reduces the production of injurious oxidative phosphorylation
by-products such as hydrogen peroxide and superoxide. With
prolonged exposure to hypoxia, HIF drives autophagy of the
mitochondria resulting in a reduction in their number (Zhang H et
al., 2008, J Biol Chem. 283: 10892-10903). This adaptation to
chronic hypoxia reduces the production of hydrogen peroxide and
superoxide while the cell relies on glycolysis to produce energy. A
further adaptive response produced by HIF elevation is
up-regulation of cell survival factors. These factors include:
Insulin-like growth factor (IGF) 2, IGF-binding protein 2 and 3
(Feldser et al., 1999, Cancer Res. 59:3915-18). Overall
accumulation of HIF under hypoxic conditions governs an adaptive
up-regulation of glycolysis, a reduction in oxidative
phosphorylation resulting in a reduction in the production of
hydrogen peroxide and superoxide, optimization of oxidative
phosphorylation protecting cells against ischemic damage. Thus, PHD
inhibitors are expected to be useful in organ and tissue transplant
preservation (Bernhardt et al., 2007, Methods Enzymol.,
435:221-45). While benefit may be achieved by administering PHD
inhibitors before harvesting organs for transplant, administration
of an inhibitor to the organ/tissue after harvest, either in
storage (e.g., cardioplegia solution) or post-transplant, may also
be of therapeutic benefit.
[0010] PHD inhibitors are expected to be effective in preserving
tissue from regional ischemia and/or hypoxia. This includes
ischemia/hypoxia associated with inter alia: angina, myocardial
ischemia, stroke, ischemia of skeletal muscle. There are a number
of lines of experimental evidence that support the concept that PHD
inhibition and subsequent elevation of HIF as a useful method for
preserving ischemic tissue. Recently, ischemic pre-conditioning has
been demonstrated to be a HIF-dependent phenomenon (Cai et al.,
2008, Cardiovasc Res., 77(3):463-70). Ischemic pre-conditioning is
a well known phenomenon whereby short periods of hypoxia and/or
ischemia protect tissue from subsequent longer periods of ischemia
(Murry et al., 1986, Circulation, 74(5):1124-36; Das et al., 2008,
IUBMB Life, 60(4):199-203). Ischemic pre-conditioning is known to
occur in humans as well as experimental animals (Darling et al.,
2007, Basic Res Cardiol., 102(3):274-8; Kojima I et al., 2007, J Am
Soc Nephroi., 18:1218-26). While the concept of pre-conditioning is
best known for its protective effects in the heart, it also applies
to other tissues including but not limited to: liver, skeletal
muscle, liver, lung, kidney, intestine and brain (Pasupathy et al.,
2005, Eur J Vasc Endovasc Surg., 29:106-15; Mallick et al., 2004,
Dig Dis Sci., 49(9):1359-77). Experimental evidence for the tissue
protective effects of PHD inhibition and elevation of HIF have been
obtained in a number of animal models including: germ-line knock
out of PHD1 which conferred protection of the skeletal muscle from
ischemic insult (Aragones et al., 2008, Nat Genet., 40(2):170-80),
silencing of PHD2 through the use of siRNA which protected the
heart from ischemic insult (Natarajan et al., 2006, Circ Res.,
98(1):133-40), inhibition of PHD by administering carbon monoxide
which protected the myocardium from ischemic injury (Chin et al.,
2007, Proc Natl Acad Sci. U.S.A., 104(12):5109-14), hypoxia in the
brain which increased the tolerance to ischemia (Bernaudin et al.,
2002, J Cereb Blood Flow Metab., 22(4):393-403). In addition, small
molecule inhibitors of PHD protect the brain in experimental stroke
models (Siddiq et al., 2005, J Biol Chem., 280(50):41732-43).
Moreover, HIF up-regulation has also been shown to protect the
heart of diabetic mice, where outcomes are generally worse
(Natarajan et al., 2008, J Cardiovasc Pharmacol., 51(2):178-187).
The tissue protective effects may also be observed in Buerger's
disease, Raynaud's disease, and acrocyanosis.
[0011] The reduced reliance on aerobic metabolism via the Kreb's
cycle in the mitochondria and an increased reliance on anaerobic
glycolysis produced by PHD inhibition may have beneficial effects
in normoxic tissues. It is important to note that PHD inhibition
has also been shown to elevate HIF under normoxic conditions. Thus,
PHD inhibition produces a pseudohypoxia associated with the hypoxic
response being initiated through HIF but with tissue oxygenation
remaining normal. The alteration of metabolism produced by PHD
inhibition can also be expected to provide a treatment paradigm for
diabetes, obesity and related disorders, including
co-morbidities.
[0012] Globally, the collection of gene expression changes produced
by PHD inhibition reduce the amount of energy generated per unit of
glucose and will stimulate the body to burn more fat to maintain
energy balance. The mechanisms for the increase in glycolysis are
discussed above. Other observations link the hypoxic response to
effects that are expected to be beneficial for the treatment of
diabetes and obesity. Thus, high altitude training is well known to
reduce body fat (Armellini et al., 1997, Horm Metab Res.,
29(9):458-61). Hypoxia and hypoxia mimetics such as desferrioxamine
have been shown to prevent adipocyte differentiation (Lin et al.,
2006, J Biol Chem., 281(41):30678-83; Carriere et al., 2004, J Biol
Chem., 279(39):40462-69). The effect is reversible upon returning
to normoxic conditions. Inhibition of PHD activity during the
initial stages of adipogenesis inhibits the formation of new
adipocytes (Floyd et al., 2007, J Cell Biochem., 101:1545-57).
Hypoxia, cobalt chloride and desferrioxamine elevated HIF and
inhibited PPAR gamma 2 nuclear hormone receptor transcription (Yun
et al., 2002, Dev Cell., 2:331-41). As PPAR gamma 2 is an important
signal for adipocyte differentiation, PHD inhibition can be
expected to inhibit adipocyte differentiation. These effects were
shown to be mediated by the HIF-regulated gene DEC1/Stra13 (Yun et
al., supra).
[0013] Small molecular inhibitors of PHD have been demonstrated to
have beneficial effects in animal models of diabetes and obesity
(Intl. Pat. Appl. Publ. WO2004/052284, Jun. 24, 2004;
WO2004/052285, Jun. 24, 2004). Among the effects demonstrated for
PHD inhibitors in mouse diet-induced obesity, db/db mouse and
Zucker fa/fa rat models were lowering of: blood glucose
concentration, fat mass in both abdominal and visceral fat pads,
hemoglobin A1c, plasma triglycerides, body weight as well as
changes in established disease bio-markers such as increases in the
levels of adrenomedullin and leptin. Leptin is a known HIF target
gene product (Grosfeld et al., 2002, J Biol Chem.,
277(45):42953-57). Gene products involved in the metabolism in fat
cells were demonstrated to be regulated by PHD inhibition in a
HIF-dependent fashion (Intl. Pat. Appl. Publ. WO2004/052285,
supra). These include apolipoprotein A-IV, acyl CoA thioesterase,
carnitine acetyl transferase, and insulin-like growth factor
binding protein (IGFBP)-1.
[0014] PHD inhibitors are expected to be therapeutically useful as
stimulants of vasculogenesis, angiogenesis, and arteriogenesis.
These processes establish or restore blood flow and oxygenation to
the tissues under ischemia and/or hypoxia conditions (Semenza et
al., 2007, J Cell Biochem., 102:840-47; Semenza, 2007, Exp
Physiol., 92(6):988-91). It has been shown that physical exercise
increases HIF-1 and vascular endothelial growth factor in
experimental animal models and in humans (Gustafsson et al. 2001,
Front Biosci., 6:D75-89) and consequently the number of blood
vessels in skeletal muscle. VEGF is a well-known HIF target gene
product that is a key driver of angiogenesis (Liu et al., supra).
While administration of various forms of VEGF receptor activators
are potent stimuli for angiogenesis, the blood vessel resulting
from this potential form of therapy are leaky. This is considered
to limit the potentially utility of VEGF for the treatment of
disorders of oxygen delivery. The increased expression of a single
angiogenic factor may not be sufficient for functional
vascularization (Semenza, 2007, supra). PHD inhibition offers a
potential advantage over other such angiogenic therapies in that it
stimulates a controlled expression of multiple angiogenic growth
factors in a HIF-dependent fashion including but not limited to:
placental growth factor (PLGF), angiopoietin-1 (ANGPT1),
angiopoietin-2 (ANGPT2), platelet-derived growth factor beta
(PDGFB) (Carmeliet, 2004, J Intern Med., 255:538-61; Kelly et al.,
2003, Circ Res., 93:1074-81) and stromal cell derived factor 1
(SDF-1) (Ceradini et al., 2004, Nat Med., 10(8):858-64). Expression
of angiopoietin-1 during angiogenesis produces leakage-resistant
blood vessels, in contrast to the vessels produced by
administration of VEGF alone (Thurston et al., 1999, Science,
286:2511-14; Thurston et al., 2000, Nat Med., 6(4):460-3; Elson et
al., 2001, Genes Dev., 15(19):2520-32). Stromal cell derived factor
1 (SDF-1) has been shown to be critical to the process of
recruiting endothelial progenitor cells to the sites of tissue
injury. SDF-1 expression increased the adhesion, migration and
homing of circulating CXCR4-positive progenitor cells to ischemic
tissue. Furthermore inhibition of SDF-1 in ischemic tissue or
blockade of CXCR4 on circulating cells prevents progenitor cell
recruitment to sites of injury (Ceradini et al., 2004, supra;
Ceradini et al., 2005, Trends Cardiovasc Med., 15(2):57-63).
Importantly, the recruitment of endothelial progenitor cells to
sites of injury is reduced in aged mice and this is corrected by
interventions that increase HIF at the wound site (Chang et al.,
2007, Circulation, 116(24):2818-29). PHD inhibition offers the
advantage not only of increasing the expression of a number of
angiogenic factions but also a co-ordination in their expression
throughout the angiogenesis process and recruitment of endothelial
progenitor cells to ischemic tissue.
[0015] Evidence for the utility of PHD inhibitors as pro-angiogenic
therapies is provided by the following observations.
Adenovirus-mediated over-expression of HIF has been demonstrated to
induce angiogenesis in non-ischemic tissue of an adult animal
(Kelly et al., 2003, Circ Res., 93(11):1074-81) providing evidence
that therapies that elevate HIF, such as PHD inhibition, will
induce angiogenesis. Placental growth factor (PLGF), also a HIF
target gene, has been show to play a critical role in angiogenesis
in ischemic tissue (Carmeliet, 2004, J Intern Med., 255(5):538-61;
Luttun et al., 2002, Ann N.Y. Acad Sci., 979:80-93). The potent
pro-angiogenic effects of therapies that elevate HIF have been
demonstrated, via HIF over-expression, in skeletal muscle (Pajusola
et al., 2005, FASEB J., 19(10):1365-7; Vincent et al., 2000,
Circulation, 102:2255-61) and in the myocardium (Shyu et al., 2002,
Cardiovasc Res., 54:576-83). The recruitment of endothelial
progenitor cells to the ischemic myocardium by the HIF target gene
SDF-1 has also been demonstrated (Abbott et al., 2004, Circulation,
110(21):3300-05). These findings support the general concept that
PHD inhibitors will be effective in stimulating angiogenesis in the
setting of tissue ischemia, particularly muscle ischemia. It is
expected that therapeutic angiogenesis produced by PHD inhibitors
will be useful in restoring blood flow to tissues and therefore the
treatment of disease including but not restricted to angina
pectoris, myocardial ischemia and infarction, peripheral ischemic
disease, claudication, gastric and duodenal ulcers, ulcerative
colitis, and inflammatory bowel disease.
[0016] PHD and HIF play a central role in tissue repair and
regeneration including healing of wounds and ulcers. Recent studies
have demonstrated that an increased expression of all three PHDs at
wound sites in aged mice with a resulting reduction in HIF
accumulation (Chang et al., supra). Thus, elevation of HIF in aged
mice by administering desferrioxamine increased the degree of wound
healing back to levels observed in young mice. Similarly, in a
diabetic mouse model, HIF elevation was suppressed compared to
non-diabetic litter mates (Mace et al., 2007, Wound Repair Regen.,
15(5):636-45). Topical administration of cobalt chloride, a hypoxia
mimetic, or over-expression of a murine HIF that lacks the
oxygen-dependent degradation domain and thus provides for a
constitutively active form of HIF, resulted in increased HIF at the
wound site, increased expression of HIF target genes such as VEGF,
Nos2, and Hmox1 and accelerated wound healing. The beneficial
effect of PHD inhibition is not restricted to the skin and small
molecule inhibitors of PHD have recently been demonstrated to
provide benefit in a mouse model of colitis (Robinson et al., 2008,
Gastroenterology, 134(1):145-55).
[0017] PHD inhibition resulting in accumulation of HIF is expected
to act by at least four mechanisms to contribute to accelerated and
more complete healing of wounds: 1) protection of tissue
jeopardized by hypoxia and/or ischemia, 2) stimulation of
angiogenesis to establish or restore appropriate blood flow to the
site, 3) recruitment of endothelial progenitor cells to wound
sites, 4) stimulation of the release of growth factors that
specifically stimulate healing and regeneration.
[0018] Recombinant human platelet-derived growth factor (PDGF) is
marketed as becaplermin (Regranex.TM.) and has been approved by the
Food and Drug Administration of the United States of America for
"Treatment of lower extremity diabetic neuropathic ulcers that
extend into the subcutaneous tissue or beyond, and have adequate
blood supply". Becaplermin has been shown to be effective in
accelerating wound healing in diabetic patients (Steed, 2006, Plast
Reconstr Surg., 117(7 Suppl):143S-149S, Nagai et al., 2002, Expert
Opin Biol Ther., 2(2):211-8). As PDGF is a HIF gene target (Schultz
et al., 2006, Am J Physiol Heart Circ Physiol., 290(6):H2528-34;
Yoshida et al., 2006, J Neurooncol., 76(1):13-21), PHD inhibition
is expected to increase the expression of endogenous PDGF and
produce a similar or more beneficial effect to those produced with
becaplermin alone. Studies in animals have shown that topical
application of PDGF results in increased wound DNA, protein, and
hydroxyproline amounts; formation of thicker granulation and
epidermal tissue; and increased cellular repopulation of wound
sites. PDGF exerts a local effect on enhancing the formation of new
connective tissue. The effectiveness of PHD inhibition is expected
to be greater than that produced by becaplermin due to the
additional tissue protective and pro-angiogenic effects mediated by
HIF.
[0019] The beneficial effects of inhibition of PHD are expected to
extend not only to accelerated wound healing in the skin and colon
but also to the healing of other tissue damage including but not
limited to gastrointestinal ulcers, skin graft replacements, burns,
chronic wounds and frost bite.
[0020] Stem cells and progenitor cells are found in hypoxic niches
within the body and hypoxia regulates their differentiation and
cell fate (Simon et al., 2008, Nat Rev Mol Cell Biol., 9:285-96).
Thus PHD inhibitors may be useful to maintain stem cells and
progenitor cells in a pluripotent state and to drive
differentiation to desired cell types. Stem cells may be useful in
culturing and expanding stem cell populations and may hold cells in
a pluripotent state while hormones and other factors are
administered to the cells to influence the differentiation and cell
fate.
[0021] A further use of PHD inhibitors in the area of stem cell and
progenitor cell therapeutics relates to the use of PHD inhibitors
to condition these cells to withstand the process of implantation
into the body and to generate an appropriate response to the body
to make the stem cell and progenitor cell implantation viable (Hu
et al., 2008, J Thorac Cardiovasc Surg., 135(4):799-808). More
specifically PHD inhibitors may facilitate the integration of stem
cells and draw in an appropriate blood supply to sustain the stem
cells once they are integrated. This blood vessel formation will
also function to carry hormones and other factors released from
these cells to the rest of the body.
[0022] PHD inhibitors may also be useful in the treatment of
infection (Peyssonnaux et al., 2005, J Invest Dermatol.,
115(7):1806-15; Peyssonnaux et al., 2008 J Invest Dermatol., 2008
August;128(8):1964-8). HIF elevation has been demonstrated to
increase the innate immune response to infection in phagocytes and
in keratinocytes. Phagocytes in which HIF is elevated show
increased bacteriacidal activity, increased nitric oxide production
and increased expressed of the anti-bacterial peptide cathelicidin.
These effects may also be useful in treating infection from
burns.
[0023] HIF has also been shown to be involved in bone growth and
healing (Pfander D et al., 2003 J Cell Sci., 116(Pt 9):1819-26.,
Wang et al., 2007 J Clin Invest., 17(6):1616-26.) and may therefore
be used to heal or prevent fractures. HIF stimulates of glycolysis
to provide energy to allow the synthesis of extracellular matrix of
the epiphyseal chondrocytes under a hypoxic environment. HIF also
plays a role in driving the release of VEGF and angiogenesis in
bone healing process. The growth of blood vessels into growing or
healing bone can be the rate limiting step in the process.
[0024] Certain small molecules with prolyl hydroxylase inhibitory
activities have been described in the literature. These include,
but are not limited to, certain imidazo[1,2-a]pyridine derivatives
(Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5598-601),
substituted pyridine derivatives (Warshakoon et al., 2006, Bioorg
Med Chem Lett., 16(21):5616-20), certain pyrazolopyridines
(Warshakoon et al., 2006, Bioorg Med Chem Lett., 16(21):5687-90),
certain bicyclic heteroaromatic N-substituted glycine derivatives
(Intl. Pat. Appl. Publ. WO2007/103905, Sep. 13, 2007), quinoline
based compounds (Intl. Pat. Appl. Publ. WO2007/070359, Jun. 21,
2007), certain pyrimidinetrione N-substituted glycine derivatives
(Intl. Pat. Appl. Publ. WO2007/150011, Dec. 27, 2007), substituted
aryl or heteroaryl amide compounds (U.S. Pat. Appl. Publ. No.: US
2007/0299086, Dec. 27, 2007) and substituted
4-hydroxypyrimidine-5-carboxamides (Intl. Pat. Appl. Publ.
WO2009/117269, Sep. 24, 2009).
[0025] However, there remains a need for potent prolyl hydroxylase
modulators with desirable pharmaceutical properties. Certain
aminoquinazolinyl derivatives have been found in the context of
this invention to have prolyl hydroxylase modulating activity.
SUMMARY OF THE INVENTION
[0026] The present invention is directed to compounds which are
useful inhibitors of PHD. The compounds of the present invention
are of general Formula (I),
##STR00002##
wherein: [0027] n is 0-3 [0028] R.sup.1 is a member independently
selected from the group consisting of halo, --O--R.sup.c,
--C.sub.1-4alkyl, cyclohexyl, phenyl optionally substituted with
--C.sub.1-4alkyl, benzyl optionally substituted with
--C.sub.1-4alkyl, and --NR.sup.aR.sup.b. [0029] R.sup.a is H and
R.sup.b is benzyl optionally substituted with --C.sub.1-4alkyl, or
R.sup.a and R.sup.b are taken together with the nitrogen to which
they are attached to form a piperidine ring; [0030] R.sup.c is
cyclohexyl, phenyl optionally substituted with one or more R.sup.d
members; [0031] R.sup.d is a member independently selected from the
group consisting of --H, halo, and --C.sub.1-4alkyl; [0032] R.sup.2
is a member independently selected from the group consisting of
--H, and --C.sub.1-4alkyl, [0033] R.sup.3 is a member independently
selected from the group consisting of --H, --C.sub.1-4alkyl
optionally substituted with --OCH.sub.3 or
--N(C.sub.1-4alkyl).sub.2, cyano, --SO.sub.2CH.sub.3,
tetrahydropyran, --(CH.sub.2).sub.mC.sub.3-8cycloalkyl,
--(CH.sub.2).sub.mphenyl optionally substituted with one or more
halo, or --C.sub.1-4alkyl; [0034] m is 0-1; [0035] R.sup.2 and
R.sup.3 can be taken together with the nitrogen to which they are
attached to form a 4 to 7 membered heterocycloalkyl ring optionally
containing O, N, S optionally substituted with --OH, cyano, halo,
--N--C(O)C.sub.1-4alkyl, and --C.sub.1-4alkyl; and enantiomers,
diastereomers, racemates, and pharmaceutically acceptable salts
thereof.
[0036] Isomeric forms of the compounds of formula (I), and of their
pharmaceutically acceptable salts, are encompassed within the
present invention, and reference herein to one of such isomeric
forms is meant to refer to at least one of such isomeric forms. One
of ordinary skill in the art will recognize that compounds
according to this invention may exist, for example, in a single
isomeric form whereas other compounds may exist in the form of a
regioisomeric mixture.
[0037] The invention also relates to pharmaceutically acceptable
salts, pharmaceutically acceptable prodrugs, and pharmaceutically
active metabolites of compounds of Formula (I). In certain
preferred embodiments, the compound of Formula (I) is a compound
selected from those species described or exemplified in the
detailed description below.
[0038] In a further general aspect, the invention relates to
pharmaceutical compositions each comprising: (a) an effective
amount of a compound of Formula (I), or a pharmaceutically
acceptable salt, pharmaceutically acceptable prodrug, or
pharmaceutically active metabolite thereof; and (b) a
pharmaceutically acceptable excipient.
[0039] In another general aspect, the invention is directed to a
method of treating a subject suffering from or diagnosed with a
disease, disorder, or medical condition mediated by a prolyl
hydroxylase enzyme activity, comprising administering to the
subject in need of such treatment an effective amount of a compound
of Formula (I), or a pharmaceutically acceptable salt,
pharmaceutically acceptable prodrug, or pharmaceutically active
metabolite thereof.
[0040] In certain preferred embodiments of the inventive method,
the disease, disorder, or medical condition is selected from:
anemia, vascular disorders, metabolic disorders, and wound
healing.
[0041] Additional embodiments, features, and advantages of the
invention will be apparent from the following detailed description
and through practice of the invention.
DETAILED DESCRIPTION
[0042] The invention may be more fully appreciated by reference to
the following description, including the following glossary of
terms and the concluding examples. For the sake of brevity, the
disclosures of the publications, including patents, cited in this
specification are herein incorporated by reference.
[0043] As used herein, the terms "including", "containing" and
"comprising" are used herein in their open, non-limiting sense.
[0044] The term "alkyl" refers to a straight- or branched-chain
alkyl group having from 1 to 12 carbon atoms in the chain. Examples
of alkyl groups include methyl (Me, which also may be structurally
depicted by the symbol, "I"), ethyl (Et), n-propyl, isopropyl,
butyl, isobutyl, sec-butyl, tert-butyl (tBu), pentyl, isopentyl,
tert-pentyl, hexyl, isohexyl, and groups that in light of the
ordinary skill in the art and the teachings provided herein would
be considered equivalent to any one of the foregoing examples.
[0045] The term "alkenyl" refers to a straight- or branched-chain
alkenyl group having from 2 to 12 carbon atoms in the chain. (The
double bond of the alkenyl group is formed by two sp.sup.2
hybridized carbon atoms.) Illustrative alkenyl groups include
prop-2-enyl, but-2-enyl, but-3-enyl, 2-methylprop-2-enyl,
hex-2-enyl, and the like.
[0046] The term "alkynyl" refers to a straight- or branched-chain
alkynyl group having from 2 to 12 carbon atoms in the chain. (The
triple bond of the alkynyl group is formed by two sp hybridized
carbon atoms.) Illustrative alkynyl groups include prop-2-ynyl,
but-2-ynyl, but-3-ynyl, 2-methylbut-2-ynyl, hex-2-ynyl, and the
like.
[0047] The term "cycloalkyl" refers to a saturated or partially
saturated, monocyclic, fused polycyclic, or spiro polycyclic
carbocycle having from 3 to 12 ring atoms per carbocycle.
Illustrative examples of cycloalkyl groups include the following
entities, in the form of properly bonded moieties:
##STR00003##
[0048] A "heterocycloalkyl" refers to a monocyclic ring structure
that is saturated or partially saturated, monocyclic, fused
polycyclic, and has from 3 to 8 ring atoms per ring structure
selected from carbon atoms and up to two heteroatoms selected from
nitrogen, oxygen, and sulfur. The ring structure may optionally
contain up to two oxo groups on sulfur ring members. Illustrative
entities, in the form of properly bonded moieties, include:
##STR00004##
[0049] The term "heteroaryl" refers to a monocyclic, fused
bicyclic, or fused polycyclic aromatic heterocycle (ring structure
having ring atoms selected from carbon atoms and up to four
heteroatoms selected from nitrogen, oxygen, and sulfur) having from
3 to 12 ring atoms per heterocycle. Illustrative examples of
heteroaryl groups include the following entities, in the form of
properly bonded moieties:
##STR00005##
[0050] Those skilled in the art will recognize that the species of
cycloalkyl, heterocycloalkyl, and heteroaryl groups listed or
illustrated above are not exhaustive, and that additional species
within the scope of these defined terms may also be selected.
[0051] The term "halogen" represents chlorine, fluorine, bromine or
iodine. The term "halo" represents chloro, fluoro, bromo or
iodo.
[0052] The term "substituted" means that the specified group or
moiety bears one or more substituents. The term "unsubstituted"
means that the specified group bears no substituents. The term
"optionally substituted" means that the specified group is
unsubstituted or substituted by one or more substituents. Where the
term "substituted" is used to describe a structural system, the
substitution is meant to occur at any valency-allowed position on
the system. In cases where a specified moiety or group is not
expressly noted as being optionally substituted or substituted with
any specified substituent, it is understood that such a moiety or
group is intended to be unsubstituted.
[0053] Any formula given herein is intended to represent compounds
having structures depicted by the structural formula as well as
certain variations or forms. In particular, compounds of any
formula given herein may have asymmetric centers and therefore
exist in different enantiomeric forms. All optical isomers and
stereoisomers of the compounds of the general formula, and mixtures
thereof, are considered within the scope of the formula. Thus, any
formula given herein is intended to represent a racemate, one or
more enantiomeric forms, one or more diastereomeric forms, one or
more atropisomeric forms, and mixtures thereof. Furthermore,
certain structures may exist as geometric isomers (i.e., cis and
trans isomers), as tautomers, or as atropisomers. Additionally, any
formula given herein is intended to embrace hydrates, solvates, and
polymorphs of such compounds, and mixtures thereof.
[0054] Additionally, any formula given herein is intended to refer
also to hydrates, solvates, and polymorphs of such compounds, and
mixtures thereof, even if such forms are not listed explicitly.
Certain compounds of Formula (I) or pharmaceutically acceptable
salts of compounds of Formula (I) may be obtained as solvates.
Solvates include those formed from the interaction or complexation
of compounds of the invention with one or more solvents, either in
solution or as a solid or crystalline form. In some embodiments,
the solvent is water and then the solvates are hydrates. In
addition, certain crystalline forms of compounds of Formula (I) or
pharmaceutically acceptable salts of compounds of Formula (I) may
be obtained as co-crystals. In certain embodiments of the
invention, compounds of Formula (I) were obtained in a crystalline
form. In other embodiments, crystalline forms of compounds of
Formula (I) were cubic in nature. In other embodiments,
pharmaceutically acceptable salts of compounds of Formula (I) were
obtained in a crystalline form. In still other embodiments,
compounds of Formula (I) were obtained in one of several
polymorphic forms, as a mixture of crystalline forms, as a
polymorphic form, or as an amorphous form. In other embodiments,
compounds of Formula (I) convert in solution between one or more
crystalline forms and/or polymorphic forms.
[0055] To provide a more concise description, some of the
quantitative expressions given herein are not qualified with the
term "about". It is understood that, whether the term "about" is
used explicitly or not, every quantity given herein is meant to
refer to the actual given value, and it is also meant to refer to
the approximation to such given value that would reasonably be
inferred based on the ordinary skill in the art, including
equivalents and approximations due to the experimental and/or
measurement conditions for such given value. Whenever a yield is
given as a percentage, such yield refers to a mass of the entity
for which the yield is given with respect to the maximum amount of
the same entity that could be obtained under the particular
stoichiometric conditions. Concentrations that are given as
percentages refer to mass ratios, unless indicated differently.
[0056] Reference to a chemical entity herein stands for a reference
to any one of: (a) the actually recited form of such chemical
entity, and (b) any of the forms of such chemical entity in the
medium in which the compound is being considered when named. For
example, reference herein to a compound such as R--COOH,
encompasses reference to any one of, for example, R--COOH.sub.(S),
R--COOH.sub.(sol), and R--COO.sup.-.sub.(sol). In this example,
R--COOH.sub.(S) refers to the solid compound, as it could be for
example in a tablet or some other solid pharmaceutical composition
or preparation; R--COOH.sub.(sol) refers to the undissociated form
of the compound in a solvent; and R--COO.sup.-.sub.(sol) refers to
the dissociated form of the compound in a solvent, such as the
dissociated form of the compound in an aqueous environment, whether
such dissociated form derives from R--COOH, from a salt thereof, or
from any other entity that yields R--COO.sup.- upon dissociation in
the medium being considered. In another example, an expression such
as "exposing an entity to compound of formula R--COOH" refers to
the exposure of such entity to the form, or forms, of the compound
R--COOH that exists, or exist, in the medium in which such exposure
takes place. In still another example, an expression such as
"reacting an entity with a compound of formula R--COOH" refers to
the reacting of (a) such entity in the chemically relevant form, or
forms, of such entity that exists, or exist, in the medium in which
such reacting takes place, with (b) the chemically relevant form,
or forms, of the compound R--COOH that exists, or exist, in the
medium in which such reacting takes place. In this regard, if such
entity is for example in an aqueous environment, it is understood
that the compound R--COOH is in such same medium, and therefore the
entity is being exposed to species such as R--COOH.sub.(aq) and/or
R--COO.sup.-.sub.(aq), where the subscript "(aq)" stands for
"aqueous" according to its conventional meaning in chemistry and
biochemistry. A carboxylic acid functional group has been chosen in
these nomenclature examples; this choice is not intended, however,
as a limitation but it is merely an illustration. It is understood
that analogous examples can be provided in terms of other
functional groups, including but not limited to hydroxyl, basic
nitrogen members, such as those in amines, and any other group that
interacts or transforms according to known manners in the medium
that contains the compound. Such interactions and transformations
include, but are not limited to, dissociation, association,
tautomerism, solvolysis, including hydrolysis, solvation, including
hydration, protonation, and deprotonation.
[0057] In another example, a zwitterionic compound is encompassed
herein by referring to a compound that is known to form a
zwitterion, even if it is not explicitly named in its zwitterionic
form. Terms such as zwitterion, zwitterions, and their synonyms
zwitterionic compound(s) are standard IUPAC-endorsed names that are
well known and part of standard sets of defined scientific names.
In this regard, the name zwitterion is assigned the name
identification CHEBI:27369 by the Chemical Entities of Biological
Inerest (ChEBI) dictionary of molecular entities. As generally well
known, a zwitterion or zwitterionic compound is a neutral compound
that has formal unit charges of opposite sign. Sometimes these
compounds are referred to by the term "inner salts". Other sources
refer to these compounds as "dipolar ions", although the latter
term is regarded by still other sources as a misnomer. As a
specific example, aminoethanoic acid (the amino acid glycine) has
the formula H.sub.2NCH.sub.2COOH, and it exists in some media (in
this case in neutral media) in the form of the zwitterion
.sup.+H.sub.3NCH.sub.2COO.sup.-. Zwitterions, zwitterionic
compounds, inner salts and dipolar ions in the known and well
established meanings of these terms are within the scope of this
invention, as would in any case be so appreciated by those of
ordinary skill in the art. Because there is no need to name each
and every embodiment that would be recognized by those of ordinary
skill in the art, no structures of the zwitterionic compounds that
are associated with the compounds of this invention are given
explicitly herein. They are, however, part of the embodiments of
this invention. No further examples in this regard are provided
herein because the interactions and transformations in a given
medium that lead to the various forms of a given compound are known
by any one of ordinary skill in the art.
[0058] Any formula given herein is also intended to represent
unlabeled forms as well as isotopically labeled forms of the
compounds. Isotopically labeled compounds have structures depicted
by the formulas given herein except that one or more atoms are
replaced by an atom having a selected atomic mass or mass number.
Examples of isotopes that can be incorporated into compounds of the
invention include isotopes of hydrogen, carbon, nitrogen, oxygen,
phosphorous, fluorine, and chlorine, such as .sup.2H, .sup.3H,
.sub.11C, .sup.13C, .sup.14C, .sup.15N, .sup.18O, .sup.17O,
.sup.31P, .sup.32P, .sub., .sup.35S, .sup.18F, .sup.36Cl,
.sup.125I, respectively. Such isotopically labeled compounds are
useful in metabolic studies (preferably with .sup.14C), reaction
kinetic studies (with, for example .sup.2H or .sup.3H), detection
or imaging techniques [such as positron emission tomography (PET)
or single-photon emission computed tomography (SPECT)] including
drug or substrate tissue distribution assays, or in radioactive
treatment of patients. In particular, an .sup.18F or .sup.11C
labeled compound may be particularly preferred for PET or SPECT
studies. Further, substitution with heavier isotopes such as
deuterium (i.e., .sup.2H) may afford certain therapeutic advantages
resulting from greater metabolic stability, for example increased
in vivo half-life or reduced dosage requirements. Isotopically
labeled compounds of this invention and prodrugs thereof can
generally be prepared by carrying out the procedures disclosed in
the schemes or in the examples and preparations described below by
substituting a readily available isotopically labeled reagent for a
non-isotopically labeled reagent.
[0059] By way of a first example on substituent terminology, if
substituent S.sup.1.sub.example is one of S.sub.1 and S.sub.2, and
substituent S.sup.2.sub.example is one of S.sub.3 and S.sub.4, then
these assignments refer to embodiments of this invention given
according to the choices S.sup.1.sub.example is S.sub.1 and
S.sup.2.sub.example is S.sub.3; S.sup.1.sub.example is S.sub.1and
S.sup.2.sub.example is S.sub.4; S.sup.1.sub.example is S.sub.2 and
S.sup.2.sub.example is S.sub.3; S.sup.1.sub.example is S.sub.2 and
S.sup.2.sub.example is S.sub.4; and equivalents of each one of such
choices. The shorter terminology "S.sup.1.sub.example is one of
S.sub.1 and S.sub.2, and S.sup.2.sub.example is one of S.sub.3 and
S.sub.4" is accordingly used herein for the sake of brevity, but
not by way of limitation. The foregoing first example on
substituent terminology, which is stated in generic terms, is meant
to illustrate the various substituent assignments described herein.
The foregoing convention given herein for substituents extends,
when applicable, to members such as R.sup.1, R.sup.2, R.sup.3, A,
X.sup.4, X.sup.5, X.sup.6, X.sup.7, R.sup.a, R.sup.b, R.sup.c, and
R.sup.d and any other generic substituent symbol used herein.
[0060] Furthermore, when more than one assignment is given for any
member or substituent, embodiments of this invention comprise the
various groupings that can be made from the listed assignments,
taken independently, and equivalents thereof. By way of a second
example on substituent terminology, if it is herein described that
substituent S.sub.example is one of S.sub.1, S.sub.2, and S.sub.3,
this listing refers to embodiments of this invention for which
S.sub.example is S.sub.1; S.sub.example is S.sub.2, S.sub.example
is S.sub.3, S.sub.example is one of S.sub.1 and S.sub.2,
S.sub.example is one of S.sub.1 and S.sub.3; S.sub.example is one
of S.sub.2 and S.sub.3; S.sub.example is one of S.sub.1, S.sub.2
and S.sub.3; and S.sub.example is any equivalent of each one of
these choices. The shorter terminology "S.sub.example is one of
S.sub.1, S.sub.2, and S.sub.3" is accordingly used herein for the
sake of brevity, but not by way of limitation. The foregoing second
example on substituent terminology, which is stated in generic
terms, is meant to illustrate the various substituent assignments
described herein. The foregoing convention given herein for
substituents extends, when applicable, to members such as R.sup.1,
R.sup.2, R.sup.3, A, X.sup.4, X.sup.5, X.sup.6, X.sup.7, R.sup.a,
R.sup.b, R.sup.c and R.sup.d and any other generic substituent
symbol used herein.
[0061] The nomenclature "C.sub.i-j" with J>i, when applied
herein to a class of substituents, is meant to refer to embodiments
of this invention for which each and every one of the number of
carbon members, from i to J including i and j, is independently
realized. By way of example, the term C.sub.1-3 refers
independently to embodiments that have one carbon member (C.sub.1),
embodiments that have two carbon members (C.sub.2), and embodiments
that have three carbon members (C.sub.3).
[0062] The term C.sub.n-malkyl refers to an aliphatic chain,
whether straight or branched, with a total number N of carbon
members in the chain that satisfies n.ltoreq.N.ltoreq.m, with
m>n.
[0063] Any disubstituent referred to herein is meant to encompass
the various attachment possibilities when more than one of such
possibilities are allowed. For example, reference to disubstituent
-A-B-, where A.noteq.B, refers herein to such disubstituent with A
attached to a first substituted member and B attached to a second
substituted member, and it also refers to such disubstituent with A
attached to the second substituted member and B attached to the
first substituted member.
[0064] According to the foregoing interpretive considerations on
assignments and nomenclature, it is understood that explicit
reference herein to a set implies, where chemically meaningful and
unless indicated otherwise, independent reference to embodiments of
such set, and reference to each and every one of the possible
embodiments of subsets of the set referred to explicitly.
[0065] Chemical depictions are intended to portray the compound
portions containing the orientations as written.
[0066] The present invention includes the use of compounds of
Formula (I),
##STR00006##
[0067] the use of compounds of Formula (I) and pharmaceutical
compositions containing such compounds thereof to treat patients
(humans or other mammals) with disorders related to the modulation
of the prolyl hydroxylase enzyme. The instant invention also
includes methods of making such a compound, pharmaceutical
composition, pharmaceutically acceptable salt, pharmaceutically
acceptable prodrug, and pharmaceutically active metabolites
thereof.
[0068] In the present invention described by of Formula (I), where
n is 0-3, and R.sup.1 is independently bromo, chloro, fluoro,
methyl, isopropyl, cyclohexyl, cyclohexyloxy, phenyl,
2-methylphenyl, benzyl, phenoxy, 4-chlorophenoxy,
2,6-dimethyl-phenoxy, piperidinyl, and
(2,6-dimethylbenzyl)amino.
[0069] In further preferred embodiments, n is 1.
[0070] In further preferred embodiments, n is 2.
[0071] In further preferred embodiments, n is 3.
[0072] In further preferred embodiments, R.sup.a is --H and R.sup.b
is 2,6-dimethylbenzyl.
[0073] In further preferred embodiments, R.sup.a and R.sup.b can be
taken together with the nitrogen to which they are attached to form
a piperidine ring.
[0074] In further preferred embodiments, R.sup.c can be phenyl,
cyclohexyl, 4-chlorophenyl, or 2,6-dimethyl-phenyl.
[0075] In further preferred embodiments, R.sup.d can independently
be --H, chloro, and --CH.sub.3.
[0076] In further preferred embodiments, R.sup.2 is --H and R.sup.3
can independently be --H, cyano, methyl, ethyl, propyl, tertbutyl,
cyclopropyl, cyclopropylmethyl, tetrahydropyranyl,
cyclohexylmethyl, phenyl, 2-chlorophenyl, 2,6-dimethylbenzyl, and
--SO.sub.2CH.sub.3.
[0077] In further preferred embodiments, R.sup.2 can be methyl,
ethyl, propyl, or butyl.
[0078] In further preferred embodiments, R.sup.3 can be methyl,
ethyl, propyl, butyl, tertbutyl, 2-methoxyethyl,
2-methoxy-1-methyl-ethyl or diethylamino-ethyl.
[0079] In further preferred embodiments, R.sup.2 and R.sup.3 can be
taken together with the nitrogen to which they are attached to form
pyrrolidine, piperidine, 4-methyl-1,4-diazepane, thiomorpholine,
4-hydroxypiperidine, morpholine, 4-acetamidopiperidine,
4-cyanopiperidine, 4-fluoropiperidine, azepane, or
4-isopropylpiperidine.
[0080] In certain preferred embodiments, the compound of Formula
(I) is selected from the group consisting of:
TABLE-US-00001 Ex. Chemical Name 1
1-[4-Amino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazol-
e- 4-carboxylic acid; 2
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-methylamino-quinazolin-2-yl]-1H-
pyrazole-4-carboxylic acid; 3
1-[4-Dimethylamino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-
- pyrazole-4-carboxylic acid; 4
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-piperidin-1-yl-quinazolin-2-yl]-1-
H- pyrazole-4-carboxylic acid; 5
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-pyrrolidin-1-yl-quinazolin-2-yl]--
1H- pyrazole-4-carboxylic acid; 6
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-phenylamino-quinazolin-2-yl]-1H-
pyrazole-4-carboxylic acid; 7
1-[4-(2-Chloro-phenylamino)-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-
- 2-yl]-1H-pyrazole-4-carboxylic acid; 8
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-propylamino-quinazolin-2-yl]-1H-
pyrazole-4-carboxylic acid; 9
(rac)-1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-(2-methoxy-1-methyl-
ethylamino)-quinazolin-2-yl]-1H-pyrazole-4-carboxylic acid; 10
1-[4-(2-Diethylamino-ethylamino)-6-(2,6-dimethyl-phenoxy)-7-fluoro-
quinazolin-2-yl]-1H-pyrazole-4-carboxylic acid; 11
1-[6-(2,6-Dimethyl-phenoxy)-4-dibutylamino-7-fluoro-quinazolin-2-yl]-1H-
- pyrazole-4-carboxylic acid; 12
1-[6-(2,6-Dimethyl-phenoxy)-4-dipropylamino-7-fluoro-quinazolin-2-yl]-1-
H- pyrazole-4-carboxylic acid; 13
1-(4-((Cyclohexylmethyl)amino)-6-(2,6-dimethylphenoxy)-7-
fluoroquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 14
1-((4-Cyclopropylamino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin-2-yl-
)- 1H-pyrazole-4-carboxylic acid; 15
1-((4-Cyclopropanemethylamino)-6-(2,6-dimethylphenoxy)-7-
fluoroquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 16
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-((tetrahydro-2H-pyran-4-
yl)amino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 17
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-(4-methyl-1,4-diazepan-1-
yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 18
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-thiomorpholinoquinazolin-2-yl)-1H-
- pyrazole-4-carboxylic acid; 19
1-(6-(2,6-dimethylphenoxy)-7-fluoro-4-(4-hydroxypiperidin-1-yl)quinazol-
in- 2-yl)-1H-pyrazole-4-carboxylic acid; 20
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 21
1-(4-(4-Acetamidopiperidin-1-yl)-6-(2,6-dimethylphenoxy)-7-
fluoroquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 22
1-(6-Cyclohexyl-4-methylamino-quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 23
1-[6-Cyclohexyl-4-(2,6-dimethyl-benzylamino)-quinazolin-2-yl]-1H-pyrazo-
le- 4-carboxylic acid; 24
1-(4-Amino-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 25
1-(6-Cyclohexyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid; 26
1-(6-Cyclohexyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid; 27
1-(6-Cyclohexyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 28
1-(6-Cyclohexyl-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid; 29
1-(4-((2-Chlorophenyl)amino)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 30
1-(4-(4-Cyanopiperidin-1-yl)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 31
1-(6-Cyclohexyl-4-(4-fluoropiperidin-1-yl)quinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 32
1-(6-Cyclohexyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 33
1-(6-Cyclohexyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 34
1-(6-Cyclohexyl-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 35
1-(4-Cyanamido-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 36
1-(4-(tert-Butylamino)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 37
1-(4-(Azepan-1-yl)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid; 38
1-(6-Cyclohexyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 39
1-(6-Cyclohexyl-4-((cyclohexylmethyl)amino)quinazolin-2-yl)-1H-pyrazole-
- 4-carboxylic acid; 40
1-(6-Cyclohexyl-4-(methylsulfonamido)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 41
1-(4-(Dimethylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 42
1-(4-(Ethyl(methyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 43
1-(6-Phenyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid; 44
1-(6-Phenyl-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid 45
1-(6-Phenyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 46
1-(4-(Diethylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 47
1-(4-((2-Chlorophenyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 48
1-(4-(Azepan-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 49
1-(4-((Cyclohexylmethyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 50
1-(4-Cyanamido-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 51
1-(4-(Cyclopropylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 52
1-(4-(tert-Butylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid; 53
1-(4-Amino-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid;
54
1-(6-Phenyl-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 55
1-(4-(4-Acetamidopiperidin-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 56
1-(6-Phenyl-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 57
1-(4-(4-Methyl-1,4-diazepan-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 58
1-(4-Morpholino-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 59
1-(4-(4-Cyanopiperidin-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 60
1-(6-(4-Chlorophenoxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 61
1-(6-(4-Chlorophenoxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 62
1-(6-(4-Chlorophenoxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-
- 4-carboxylic acid; 63
1-(6-(4-Chlorophenoxy)-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 64
1-(6-(4-Chlorophenoxy)-4-((cyclohexylmethyl)amino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 65
1-(6-(4-chlorophenoxy)-4-(4-cyanopiperidin-1-yl)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 66
1-(4-(Azepan-1-yl)-6-(4-chlorophenoxy)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 67
1-(6-(4-Chlorophenoxy)-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 68
1-(6-(4-Chlorophenoxy)-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-
yl)-1H-pyrazole-4-carboxylic acid; 69
1-(6-(4-Chlorophenoxy)-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 70
1-(4-(4-Acetamidopiperidin-1-yl)-6-(4-chlorophenoxy)quinazolin-2-yl)-1H-
- pyrazole-4-carboxylic acid; 71
1-(6-(4-Chlorophenoxy)-4-(4-methyl-1,4-diazepan-1-yl)quinazolin-2-yl)-1-
H- pyrazole-4-carboxylic acid; 72
1-(4-(tert-Butylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 73
1-(6-Phenoxy-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 74
1-(4-(Diethylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 75
1-(4-(Cyclopropylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 76
1-(6-Phenoxy-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 77
1-(4-(Dimethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 78
1-(7-Phenoxy-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 79
1-(7-Phenoxy-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid; 80
1-(4-(Dimethylamino)-7-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 81
1-(7-Phenyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid; 82
1-(7-Phenyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 83
1-(4-(Diethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 84
1-(4-((Cyclohexylmethyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 85
1-(4-(4-Isopropylpiperidin-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 86
1-(4-(Cyclopropylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 87
1-(4-(Azepan-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 88
1-(4-(Diethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 89
1-(4-Morpholino-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 90
1-(7-Phenoxy-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 91
1-(4-(4-Fluoropiperidin-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 92
1-(4-(Dibutylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 93
1-(4-(Dipropylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 94
1-(4-(Ethyl(methyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 95
1-(4-((2-Methoxyethyl)(methyl)amino)-7-phenoxyquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 96
1-(7-Bromo-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 97
1-(4-(Cyclohexylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 98
1-(4-((Cyclopropylmethyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 99
1-(4-(tert-Butylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid. 100
1-(6-(Cyclohexyloxy)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-
-4- carboxylic acid; 101
1-(6-(Cyclohexyloxy)-4-(dimethylamino)-7-fluoroquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 102
1-(6-(Cyclohexyloxy)-4-(diethylamino)-7-fluoroquinazolin-2-yl)-1H-pyra-
zole-
4-carboxylic acid; 103
1-(6-(Cyclohexyloxy)-7-fluoro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 104
1-(6-(Cyclohexyloxy)-4-(ethyl(methyl)amino)-7-fluoroquinazolin-2-yl)-1-
H- pyrazole-4-carboxylic acid; 105
1-(6-(Cyclohexyloxy)-4-(cyclopropylamino)-7-fluoroquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 106
1-(6-Benzyl-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid; 107
1-(6-Benzyl-4-(dimethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 108
1-(6-Benzyl-4-(diethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 109
1-(6-Benzyl-7-fluoro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 110
1-(6-Benzyl-4-(ethyl(methyl)amino)-7-fluoroquinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 111
1-(6-Benzyl-4-(cyclopropylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 112
1-(6-((2,6-Dimethylbenzyl)amino)-7-fluoro-4-morpholinoquinazolin-2-yl)-
-1H- pyrazole-4-carboxylic acid; 113
1-(4-(Dimethylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin--
2- yl)-1H-pyrazole-4-carboxylic acid; 114
1-(4-(Diethylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin-2-
-yl)- 1H-pyrazole-4-carboxylic acid;; 115 1
1-(6-((2,6-Dimethylbenzyl)amino)-7-fluoro-4-(pyrrolidin-1-yl)quinazo-
lin-2- yl)-1H-pyrazole-4-carboxylic acid; 116
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)-7-
fluoroquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 117
1-(4-(Cyclopropylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazol-
in- 2-yl)-1H-pyrazole-4-carboxylic acid; 118
1-(7-Fluoro-4-morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 119
1-(4-(Dimethylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 120
1-(4-(Diethylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid 121
1-(7-Fluoro-4-(pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 122
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyra-
zole-4- carboxylic acid; 123
1-(4-(Cyclopropylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazo-
le-4- carboxylic acid; 124
1-(7-Fluoro-6-isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 125
1-(4-(Dimethylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 126
1-(4-(Diethylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 127
1-(7-Fluoro-6-isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 128
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyra-
zole- 4-carboxylic acid; 129
1-(4-(Cyclopropylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazo-
le- 4-carboxylic acid; 130
1-(7-Fluoro-4-morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 131
1-(4-(Dimethylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 132
1-(4-(Diethylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyr-
azole- 4-carboxylic acid; 133
1-(7-Fluoro-6-(piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H--
pyrazole- 4-carboxylic acid; 134
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)--
1H- pyrazole-4-carboxylic acid; 135
1-(4-(Cyclopropylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-
- pyrazole-4-carboxylic acid; 136
1-(6-(Cyclohexyloxy)-7-chloro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-
-4- carboxylic acid; 137
1-(6-(Cyclohexyloxy)-4-(dimethylamino)-7-chloroquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 138
1-(6-(Cyclohexyloxy)-4-(diethylamino)-7-chloroquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 139
1-(6-(Cyclohexyloxy)-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 140
1-(6-(Cyclohexyloxy)-4-(ethyl(methyl)amino)-7-chloroquinazolin-2-yl)-1-
H- pyrazole-4-carboxylic acid; 141
1-(6-(Cyclohexyloxy)-4-(cyclopropylamino)-7-chloroquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 142
1-(6-Benzyl-7-chloro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 143
1-(6-Benzyl-4-(dimethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 144
1-(6-Benzyl-4-(diethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 145
1-(6-Benzyl-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 146
1-(6-Benzyl-4-(ethyl(methyl)amino)-7-chloroquinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 147
1-(6-Benzyl-4-(cyclopropylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 148
1-(6-((2,6-Dimethylbenzyl)amino)-7-chloro-4-morpholinoquinazolin-2-yl)-
- 1H-pyrazole-4-carboxylic acid; 149
1-(4-(Dimethylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin--
2- yl)-1H-pyrazole-4-carboxylic acid;; 150
1-(4-(Diethylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin-2-
-yl)- 1H-pyrazole-4-carboxylic acid; 151
1-(6-((2,6-Dimethylbenzyl)amino)-7-chloro-4-(pyrrolidin-1-yl)quinazoli-
n-2- yl)-1H-pyrazole-4-carboxylic acid; 152
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)-7-
chloroquinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 153
1-(4-(Cyclopropylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazol-
in- 2-yl)-1H-pyrazole-4-carboxylic acid; 154
1-(7-Chloro-4-morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 155
1-(4-(Dimethylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 156
1-(4-(Diethylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 157
1-(7-Chloro-4-(pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 158
1-(4-(Ethyl(methyl)amino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyra-
zole- 4-carboxylic acid; 159
1-(4-(Cyclopropylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazo-
le-4- carboxylic acid; 160
1-(7-Chloro-6-isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 161
1-(4-(Dimethylamino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 162
1-(4-(Diethylamino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 163
1-(7-Chloro-6-isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 164
1-(4-(Ethyl(methyl)amino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyra-
zole- 4-carboxylic acid; 165
1-(4-(Cyclopropylamino)-7-chloro-6-isopropylquinazolin-2-yl)-1H-pyrazo-
le- 4-carboxylic acid; 166
1-(7-Chloro-4-morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 167
1-(4-(Dimethylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 168
1-(4-(Diethylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyr-
azole- 4-carboxylic acid; 169
1-(7-Chloro-6-(piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 170
1-(4-(Ethyl(methyl)amino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)--
1H- pyrazole-4-carboxylic acid; 171
1-(4-(Cyclopropylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-
- pyrazole-4-carboxylic acid; 172
1-(6-(Cyclohexyloxy)-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 173
1-(6-(Cyclohexyloxy)-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 174
1-(6-(Cyclohexyloxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 175
1-(6-(Cyclohexyloxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
- carboxylic acid; 176
1-(6-(Cyclohexyloxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 177
1-(6-(Cyclohexyloxy)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazol-
e-4- carboxylic acid; 178
1-(6-Benzyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 179
1-(6-Benzyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 180
1-(6-Benzyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 181
1-(6-Benzyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 182
1-(6-Benzyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid; 183
1-(6-Benzyl-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 184
1-(6-Isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 185
1-(6-Isopropyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid; 186
1-(6-Isopropyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 187
1-(6-Isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid; 188
1-(6-Isopropyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 189
1-(6-Isopropyl-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 190
1-(6-((2,6-Dimethylbenzyl)amino)-4-morpholinoquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 191
1-(6-((2,6-Dimethylbenzyl)amino)-4-(dimethylamino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 192
1-(6-((2,6-Dimethylbenzyl)amino)-4-(diethylamino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 193
1-(6-((2,6-Dimethylbenzyl)amino)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1-
H- pyrazole-4-carboxylic acid; 194
1-(6-((2,6-Dimethylbenzyl)amino)-4-(cyclopropylamino)quinazolin-2-yl)--
1H- pyrazole-4-carboxylic acid; 195
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)quinazolin-2-yl-
)-
1H-pyrazole-4-carboxylic acid; 196
1-(4-Morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid; 197
1-(4-(Dimethylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid; 198
1-(4-(Diethylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid; 199
1-(4-(Pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid; 200
1-(4-(Cyclopropylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 201
1-(4-(ethyl(methyl)amino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 202
1-(4-Morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid; 203
1-(4-(Dimethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 204
1-(4-(Diethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 205
1-(6-(Piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole--
4- carboxylic acid; 206
1-(4-(Cyclopropylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-
-4- carboxylic acid; 207
1-(4-(Ethyl(methyl)amino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4- carboxylic acid; 208
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-morpholinoquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 209
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-dimethylaminoquinazolin-2-yl)-1H-
- pyrazole-4-carboxylic acid; 210
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-diethylaminoquinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 211
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-(pyrrolidin-1-yl)quinazolin-2-yl-
)-1H- pyrazole-4-carboxylic acid; 212
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-cyclopropylaminoquinazolin-2-yl)-
- 1H-pyrazole-4-carboxylic acid; 213
1-(6-(2,6-Dimethylphenoxy)-4-(ethyl(methyl)amino)-7-methylquinazolin-2-
- yl)-1H-pyrazole-4-carboxylic acid;
and pharmaceutically acceptable salts thereof.
[0081] The invention includes also pharmaceutically acceptable
salts of the compounds of Formula (I), preferably of those
described above and of the specific compounds exemplified herein,
and methods of treatment using such salts.
[0082] A "pharmaceutically acceptable salt" is intended to mean a
salt of a free acid or base of a compound represented by Formula
(I) that is non-toxic, biologically tolerable, or otherwise
biologically suitable for administration to the subject. See,
generally, G. S. Paulekuhn, et al., "Trends in Active
Pharmaceutical Ingredient Salt Selection based on Analysis of the
Orange Book Database", J. Med. Chem., 2007, 50:6665-72, S. M.
Berge, et al., "Pharmaceutical Salts", J Pharm Sci., 1977, 66:1-19,
and Handbook of Pharmaceutical Salts, Properties, Selection, and
Use, Stahl and Wermuth, Eds., Wiley-VCH and VHCA, Zurich, 2002.
Examples of pharmaceutically acceptable salts are those that are
pharmacologically effective and suitable for contact with the
tissues of patients without undue toxicity, irritation, or allergic
response. A compound of Formula (I) may possess a sufficiently
acidic group, a sufficiently basic group, or both types of
functional groups, and accordingly react with a number of inorganic
or organic bases, and inorganic and organic acids, to form a
pharmaceutically acceptable salt.
[0083] Examples of pharmaceutically acceptable salts include
sulfates, pyrosulfates, bisulfates, sulfites, bisulfites,
phosphates, monohydrogen-phosphates, dihydrogenphosphates,
metaphosphates, pyrophosphates, chlorides, bromides, iodides,
acetates, propionates, decanoates, caprylates, acrylates, formates,
isobutyrates, caproates, heptanoates, propiolates, oxalates,
malonates, succinates, suberates, sebacates, fumarates, maleates,
butyne-1,4-dioates, hexyne-1,6-dioates, benzoates, chlorobenzoates,
methyl benzoates, dinitrobenzoates, hydroxybenzoates,
methoxybenzoates, phthalates, sulfonates, xylenesulfonates,
phenylacetates, phenylpropionates, phenylbutyrates, citrates,
lactates, .gamma.-hydroxybutyrates, glycolates, tartrates,
methane-sulfonates, propanesulfonates, naphthalene-1-sulfonates,
naphthalene-2-sulfonates, and mandelates.
[0084] When the compound of Formula (I) contains a basic nitrogen,
the desired pharmaceutically acceptable salt may be prepared by any
suitable method available in the art, for example, treatment of the
free base with an inorganic acid, such as hydrochloric acid,
hydrobromic acid, sulfuric acid, sulfamic acid, nitric acid, boric
acid, phosphoric acid, and the like, or with an organic acid, such
as acetic acid, phenylacetic acid, propionic acid, stearic acid,
lactic acid, ascorbic acid, maleic acid, hydroxymaleic acid,
isethionic acid, succinic acid, valeric acid, fumaric acid, malonic
acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid,
oleic acid, palmitic acid, lauric acid, a pyranosidyl acid, such as
glucuronic acid or galacturonic acid, an alpha-hydroxy acid, such
as mandelic acid, citric acid, or tartaric acid, an amino acid,
such as aspartic acid, glutaric acidor glutamic acid, an aromatic
acid, such as benzoic acid, 2-acetoxybenzoic acid, naphthoic acid,
or cinnamic acid, a sulfonic acid, such as laurylsulfonic acid,
p-toluenesulfonic acid, methanesulfonic acid, ethanesulfonic acid,
any compatible mixture of acids such as those given as examples
herein, and any other acid and mixture thereof that are regarded as
equivalents or acceptable substitutes in light of the ordinary
level of skill in this technology.
[0085] When the compound of Formula (I) is an acid, such as a
carboxylic acid or sulfonic acid, the desired pharmaceutically
acceptable salt may be prepared by any suitable method, for
example, treatment of the free acid with an inorganic or organic
base, such as an amine (primary, secondary or tertiary), an alkali
metal hydroxide, alkaline earth metal hydroxide, any compatible
mixture of bases such as those given as examples herein, and any
other base and mixture thereof that are regarded as equivalents or
acceptable substitutes in light of the ordinary level of skill in
this technology. Illustrative examples of suitable salts include
organic salts derived from amino acids, such as
N-methyl-D-glucamine, lysine, choline, glycine and arginine,
ammonia, carbonates, bicarbonates, primary, secondary, and tertiary
amines, and cyclic amines, such as tromethamine, benzylamines,
pyrrolidines, piperidine, morpholine, and piperazine, and inorganic
salts derived from sodium, calcium, potassium, magnesium,
manganese, iron, copper, zinc, aluminum, and lithium.
[0086] Exemplary prodrugs include compounds having an amino acid
residue, or a polypeptide chain of two or more (e.g., two, three or
four) amino acid residues, covalently joined through an amide or
ester bond to a free amino, hydroxy, or carboxylic acid group of a
compound of Formula (I). Examples of amino acid residues include
the twenty naturally occurring amino acids, commonly designated by
three letter symbols, as well as 4-hydroxyproline, hydroxylysine,
demosine, isodemosine, 3-methylhistidine, norvalin, beta-alanine,
gamma-aminobutyric acid, citrulline homocysteine, homoserine,
ornithine and methionine sulfone.
[0087] Additional types of prodrugs may be produced, for instance,
by derivatizing free carboxyl groups of structures of Formula (I)
as amides or alkyl esters. Examples of amides include those derived
from ammonia, primary C.sub.1-6alkyl amines and secondary
di(C.sub.1-6alkyl) amines. Secondary amines include 5- or
6-membered heterocycloalkyl or heteroaryl ring moieties. Examples
of amides include those that are derived from ammonia,
C.sub.1-3alkyl primary amines, and di(C.sub.1-2alkyl)amines.
Examples of esters of the invention include C.sub.1-7alkyl,
C.sub.5-7cycloalkyl, phenyl, and phenyl(C.sub.1-6alkyl) esters.
Preferred esters include methyl esters. Prodrugs may also be
prepared by derivatizing free hydroxy groups using groups including
hemisuccinates, phosphate esters, dimethylaminoacetates, and
phosphoryloxymethyloxycarbonyls, following procedures such as those
outlined in Fleisher et al., Adv. Drug Delivery Rev. 1996, 19,
115-130. Carbamate derivatives of hydroxy and amino groups may also
yield prodrugs. Carbonate derivatives, sulfonate esters, and
sulfate esters of hydroxy groups may also provide prodrugs.
Derivatization of hydroxy groups as (acyloxy)methyl and
(acyloxy)ethyl ethers, wherein the acyl group may be an alkyl
ester, optionally substituted with one or more ether, amine, or
carboxylic acid functionalities, or where the acyl group is an
amino acid ester as described above, is also useful to yield
prodrugs. Prodrugs of this type may be prepared as described in
Robinson et al., J Med Chem. 1996, 39 (1), 10-18. Free amines can
also be derivatized as amides, sulfonamides or phosphonamides. All
of these prodrug moieties may incorporate groups including ether,
amine, and carboxylic acid functionalities.
[0088] The present invention also relates to pharmaceutically
active metabolites of the compounds of Formula (I), which may also
be used in the methods of the invention. A "pharmaceutically active
metabolite" means a pharmacologically active product of metabolism
in the body of a compound of Formula (I) or salt thereof. Prodrugs
and active metabolites of a compound may be determined using
routine techniques known or available in the art. See, e.g.,
Bertolini, et al., J Med Chem. 1997, 40, 2011-2016; Shan, et al., J
Pharm Sci. 1997, 86 (7), 765-767; Bagshawe, Drug Dev Res. 1995, 34,
220-230; Bodor, Adv Drug Res. 1984, 13, 224-331; Bundgaard, Design
of Prodrugs (Elsevier Press, 1985); and Larsen, Design and
Application of Prodrugs, Drug Design and Development
(Krogsgaard-Larsen, et al., eds., Harwood Academic Publishers,
1991).
[0089] The compounds of Formula (I) and their pharmaceutically
acceptable salts, pharmaceutically acceptable prodrugs, and
pharmaceutically active metabolites of the present invention are
useful as modulators of PHD in the methods of the invention.
"Modulators" include both inhibitors and activators, where
"inhibitors" refer to compounds that decrease, prevent, inactivate,
desensitize or down-regulate PHD expression or activity, and
"activators" are compounds that increase, activate, facilitate,
sensitize, or up-regulate PHD expression or activity.
[0090] The term "treat" or "treating" as used herein is intended to
refer to administration of an active agent or composition of the
invention to a subject for the purpose of effecting a therapeutic
or prophylactic benefit through modulation of prolyl hydroxylase
activity. Treating includes reversing, ameliorating, alleviating,
inhibiting the progress of, lessening the severity of, or
preventing a disease, disorder, or condition, or one or more
symptoms of such disease, disorder or condition mediated through
modulation of PHD activity. The term "subject" refers to a
mammalian patient in need of such treatment, such as a human.
[0091] Accordingly, the invention relates to methods of using the
compounds described herein to treat subjects diagnosed with or
suffering from a disease, disorder, or condition mediated by Prolyl
Hydroxylase, such as: Anemia, vascular disorders, metabolic
disorders, and wound healing. Symptoms or disease states are
intended to be included within the scope of "medical conditions,
disorders, or diseases."
[0092] As used herein the term "hypoxia" or "hypoxic disorder"
refers to a condition where there is an insufficient level of
oxygen provided in the blood or to tissues and organs. Hypoxic
disorders can occur through a variety of mechanisms including where
there is an insufficient capacity of the blood to carry oxygen
(i.e. anemia), where there is an inadequate flow of blood to the
tissue and/or organ caused by either heart failure or blockage of
blood vessels and/or arteries (i.e. ischemia), where there is
reduced barometric pressure (i.e. elevation sickness at high
altitudes), or where dysfunctional cells are unable to properly
make use of oxygen (i.e. hystotoxic conditions). Accordingly, one
of skill in the art would readily appreciate the present invention
to be useful in the treatment of a variety of hypoxic conditions
including anemia, heart failure, coronary artery disease,
thromboembolism, stroke, angina and the like.
[0093] In a preferred embodiment, molecules of the present
invention are useful in the treatment or prevention of anemia
comprising treatment of anemic conditions associated with chronic
kidney disease, polycystic kidney disease, aplastic anemia,
autoimmune hemolytic anemia, bone marrow transplantation anemia,
Churg-Strauss syndrome, Diamond Blackfan anemia, Fanconi's anemia,
Felty syndrome, graft versus host disease, hematopoietic stem cell
transplantation, hemolytic uremic syndrome, myelodysplastic
syndrome, nocturnal paroxysmal hemoglobinuria, osteomyelofibrosis,
pancytopenia, pure red-cell aplasia, purpura Schoenlein-Henoch,
refractory anemia with excess of blasts, rheumatoid arthritis,
Shwachman syndrome, sickle cell disease, thalassemia major,
thalassemia minor, thrombocytopenic purpura, anemic or non-anemic
patients undergoing surgery, anemia associated with or secondary to
trauma, sideroblastic anemia, anemic secondary to other treatment
including: reverse transcriptase inhibitors to treat HIV,
corticosteroid hormones, cyclic cisplatin or
non-cisplatin-containing chemotherapeutics, vinca alkaloids,
mitotic inhibitors, topoisomerase II inhibitors, anthracyclines,
alkylating agents, particularly anemia secondary to inflammatory,
aging and/or chronic diseases. PHD inhibition may also be used to
treat symptoms of anemia including chronic fatigue, pallor and
dizziness.
[0094] In another preferred embodiment, molecules of the present
invention are useful for the treatment or prevention of diseases of
metabolic disorders, including but not limited to diabetes and
obesity. In another preferred embodiment, molecules of the present
invention are useful for the treatment or prevention of vascular
disorders. These include but are not limited to hypoxic or wound
healing related diseases requiring pro-angiogenic mediators for
vasculogenesis, angiogenesis, and arteriogenesis
[0095] In treatment methods according to the invention, an
effective amount of a pharmaceutical agent according to the
invention is administered to a subject suffering from or diagnosed
as having such a disease, disorder, or condition. An "effective
amount" means an amount or dose sufficient to generally bring about
the desired therapeutic or prophylactic benefit in patients in need
of such treatment for the designated disease, disorder, or
condition. Effective amounts or doses of the compounds of the
present invention may be ascertained by routine methods such as
modeling, dose escalation studies or clinical trials, and by taking
into consideration routine factors, e.g., the mode or route of
administration or drug delivery, the pharmacokinetics of the
compound, the severity and course of the disease, disorder, or
condition, the subject's previous or ongoing therapy, the subject's
health status and response to drugs, and the judgment of the
treating physician. An example of a dose is in the range of from
about 0.001 to about 200 mg of compound per kg of subject's body
weight per day, preferably about 0.05 to 100 mg/kg/day, or about 1
to 35 mg/kg/day, in single or divided dosage units (e.g., BID, TID,
QID). Fora 70-kg human, an illustrative range for a suitable dosage
amount is from about 0.05 to about 7 g/day, or about 0.2 to about
2.5 g/day.
[0096] Once improvement of the patient's disease, disorder, or
condition has occurred, the dose may be adjusted for preventative
or maintenance treatment. For example, the dosage or the frequency
of administration, or both, may be reduced as a function of the
symptoms, to a level at which the desired therapeutic or
prophylactic effect is maintained. Of course, if symptoms have been
alleviated to an appropriate level, treatment may cease. Patients
may, however, require intermittent treatment on a long-term basis
upon any recurrence of symptoms.
[0097] In addition, the agents of the invention may be used in
combination with additional active ingredients in the treatment of
the above conditions. The additional compounds may be
co-administered separately with an agent of Formula (I) or included
with such an agent as an additional active ingredient in a
pharmaceutical composition according to the invention. In an
exemplary embodiment, additional active ingredients are those that
are known or discovered to be effective in the treatment of
conditions, disorders, or diseases mediated by PHD enzyme or that
are active against another targets associated with the particular
condition, disorder, or disease, such as an alternate PHD
modulator. The combination may serve to increase efficacy (e.g., by
including in the combination a compound potentiating the potency or
effectiveness of a compound according to the invention), decrease
one or more side effects, or decrease the required dose of the
compound according to the invention.
[0098] The compounds of the invention are used, alone or in
combination with one or more other active ingredients, to formulate
pharmaceutical compositions of the invention. A pharmaceutical
composition of the invention comprises: (a) an effective amount of
a compound of Formula (I), or a pharmaceutically acceptable salt,
pharmaceutically acceptable prodrug, or pharmaceutically active
metabolite thereof; and (b) a pharmaceutically acceptable
excipient.
[0099] A "pharmaceutically acceptable excipient" refers to a
substance that is non-toxic, biologically tolerable, and otherwise
biologically suitable for administration to a subject, such as an
inert substance, added to a pharmacological composition or
otherwise used as a vehicle, carrier, or diluent to facilitate
administration of a compound of the invention and that is
compatible therewith. Examples of excipients include calcium
carbonate, calcium phosphate, various sugars and types of starch,
cellulose derivatives, gelatin, vegetable oils, and polyethylene
glycols.
[0100] Delivery forms of the pharmaceutical compositions containing
one or more dosage units of the compounds of the invention may be
prepared using suitable pharmaceutical excipients and compounding
techniques now or later known or available to those skilled in the
art. The compositions may be administered in the inventive methods
by oral, parenteral, rectal, topical, or ocular routes, or by
inhalation.
[0101] The preparation may be in the form of tablets, capsules,
sachets, dragees, powders, granules, lozenges, powders for
reconstitution, liquid preparations, or suppositories. Preferably,
the compositions are formulated for intravenous infusion, topical
administration, or oral administration. A preferred mode of use of
the invention is local administration of PHD inhibitors
particularly to sites where tissue has become or has been made
ischemic. This may be achieved via a specialized catheter,
angioplasty balloon or stent placement balloon.
[0102] For oral administration, the compounds of the invention can
be provided in the form of tablets or capsules, or as a solution,
emulsion, or suspension. To prepare the oral compositions, the
compounds may be formulated to yield a dosage of, e.g., from about
0.05 to about 100 mg/kg daily, or from about 0.05 to about 35 mg/kg
daily, or from about 0.1 to about 10 mg/kg daily.
[0103] Oral tablets may include a compound according to the
invention mixed with pharmaceutically acceptable excipients such as
inert diluents, disintegrating agents, binding agents, lubricating
agents, sweetening agents, flavoring agents, coloring agents and
preservative agents. Suitable inert fillers include sodium and
calcium carbonate, sodium and calcium phosphate, lactose, starch,
sugar, glucose, methyl cellulose, magnesium stearate, mannitol,
sorbitol, and the like. Exemplary liquid oral excipients include
ethanol, glycerol, water, and the like. Starch,
polyvinyl-pyrrolidone (PVP), sodium starch glycolate,
microcrystalline cellulose, and alginic acid are suitable
disintegrating agents. Binding agents may include starch and
gelatin. The lubricating agent, if present, may be magnesium
stearate, stearic acid or talc. If desired, the tablets may be
coated with a material such as glyceryl monostearate or glyceryl
distearate to delay absorption in the gastrointestinal tract, or
may be coated with an enteric coating.
[0104] Capsules for oral administration include hard and soft
gelatin capsules. To prepare hard gelatin capsules, compounds of
the invention may be mixed with a solid, semi-solid, or liquid
diluent. Soft gelatin capsules may be prepared by mixing the
compound of the invention with water, an oil such as peanut oil or
olive oil, liquid paraffin, a mixture of mono and di-glycerides of
short chain fatty acids, polyethylene glycol 400, or propylene
glycol.
[0105] Liquids for oral administration may be in the form of
suspensions, solutions, emulsions or syrups or may be presented as
a dry product for reconstitution with water or other suitable
vehicle before use. Such liquid compositions may optionally
contain: pharmaceutically-acceptable excipients such as suspending
agents (for example, sorbitol, methyl cellulose, sodium alginate,
gelatin, hydroxyethylcellulose, carboxymethylcellulose, aluminum
stearate gel and the like); non-aqueous vehicles, e.g., oil (for
example, almond oil or fractionated coconut oil), propylene glycol,
ethyl alcohol, or water; preservatives (for example, methyl or
propyl p-hydroxybenzoate or sorbic acid); wetting agents such as
lecithin; and, if desired, flavoring or coloring agents.
[0106] The active agents of this invention may also be administered
by non-oral routes. For example, the compositions may be formulated
for rectal administration as a suppository. For parenteral use,
including intravenous, intramuscular, intraperitoneal, or
subcutaneous routes, the compounds of the invention may be provided
in sterile aqueous solutions or suspensions, buffered to an
appropriate pH and isotonicity or in parenterally acceptable oil.
Suitable aqueous vehicles include Ringer's solution and isotonic
sodium chloride. Such forms will be presented in unit-dose form
such as ampules or disposable injection devices, in multi-dose
forms such as vials from which the appropriate dose may be
withdrawn, or in a solid form or pre-concentrate that can be used
to prepare an injectable formulation. Illustrative infusion doses
may range from about 1 to 1000 .mu.g/kg/minute of compound, admixed
with a pharmaceutical carrier over a period ranging from several
minutes to several days.
[0107] For topical administration, the compounds may be mixed with
a pharmaceutical carrier at a concentration of about 0.1% to about
10% of drug to vehicle. Examples include lotions, creams, ointments
and the like and can be formulated by known methods. Another mode
of administering the compounds of the invention may utilize a patch
formulation to affect transdermal delivery.
[0108] Compounds of the invention may alternatively be administered
in methods of this invention by inhalation, via the nasal or oral
routes, e.g., in a spray formulation also containing a suitable
carrier.
[0109] Abbreviations and acronyms used herein including the
following:
TABLE-US-00002 Term Acronym Diisopropylethylamine DIEA
Tetrahydrofuran THF Dichloromethane DCM Dimethyl Sulfoxide DMSO
Dimethylacetamide DMA N,N-Dimethylformamide DMF Ethanol EtOH
Acetonitrile ACN Ethyl Acetate EtOAc N-(3-Dimethylaminopropyl)-N-
EDCI ethylcarbodiimide N,N'-Diisopropylcarbodiimide DIC
Dichloroethane DCE
[0110] Exemplary compounds useful in methods of the invention will
now be described by reference to the illustrative synthetic schemes
for their general preparation below and the specific examples that
follow. Artisans will recognize that, to obtain the various
compounds herein, starting materials may be suitably selected so
that the ultimately desired substituents will be carried through
the reaction scheme with or without protection as appropriate to
yield the desired product. Alternatively, it may be necessary or
desirable to employ, in the place of the ultimately desired
substituent, a suitable group that may be carried through the
reaction scheme and replaced as appropriate with the desired
substituent. Unless otherwise specified, the variables are as
defined above in reference to Formula (I). Reactions may be
performed between the melting point and the reflux temperature of
the solvent, and preferably between 0.degree. C. and the reflux
temperature of the solvent. Reactions may also be conducted in
sealed pressure vessels above the normal reflux temperature of the
solvent.
##STR00007## ##STR00008##
[0111] Compounds of Formula (I) are prepared according to Scheme A
from appropriately substituted commercially available or
synthetically accessible anilines of formula (II) or (III),
prepared using known methods, methods described in Scheme B, or
methods as described in the Journal of Organic Chemistry, 2008, 73
(6), 2473-75. Referring to Scheme A, functionalized anilines of
formula (II) or (III) are condensed with isothiocyanates such as
ethyl isothiocyanatoformate in a solvent such as dichloromethane
(DCM) at temperatures between room temperature and the reflux
temperature of the solvent, to provide compounds of formula (IV).
Subsequent coupling with commercially available substituted
pyrazole-4-carboxylates of formula (V), in the presence of a
coupling reagent such as EDCI, DIC and the like, with or without an
amine base such as triethylamine provides compounds of formula
(VI). Cyclization of compounds of formula (VI) with an appropriate
Lewis acid such as chlorotrimethylsilane, titanium (IV) chloride,
and the like, in a solvent such as DCE or DMF, toluene and the
like, at temperatures between room temperature and the reflux
temperature of the solvent, provides compounds of formula (VII).
Treatment of compounds of the formula (VII) with an appropriate
chlorinating agent such as POCI.sub.3 in the presence of a base
such as DIEA in an appropriate solvent such as acetonitrile at
temperatures between rt and reflux provide compounds of the formula
(VIII). In certain cases it may be advantageous to add chloride ion
from an appropriate source such as LiCI. Compounds of the formula
(VIII) are treated with amines to afford compounds of the formula
(IX). Saponification with a suitable base such as aq. NaOH, aq.
LiOH or aq. KOH or a mixture thereof in a solvent such as THF at
temperatures between rt and reflux provides compounds of Formula
(I). There are an abundance of known and commercially available
anilines that may be employed in the schemes herein. The schemes
illustrated herein also provide guidance for synthesizing a variety
of intermediates that are not readily available and are useful for
making compounds of the present invention
##STR00009##
[0112] Ether intermediates of formula (II) are prepared according
to Scheme B, where HAL is F, Cl. Commercially available
appropriately substituted halo-nitro-benzenes of formula (X) are
allowed to react with substituted phenols (XI) in the presence of a
base such as potassium carbonate, in a solvent such as DMSO, DMF,
DMA, and the like, at temperatures between room temperature and the
reflux temperature of the solvent, providing nitro intermediates of
formula (XII). Reduction of the nitro group, employing methods
known to one skilled in the art, for example zinc powder in the
presence of a saturated aqueous solution of NH.sub.4Cl in a solvent
such as acetone, and the like, affords aniline intermediates of
formula (II).
[0113] Amino intermediates of formula (III) may be prepared
similarly to the methods utilized for the ether intermediates as
described above, by replacing phenols with substituted alkyl
amines, heterocycloalkyl amines and aryl amines of formula
(XIII).
EXAMPLES
Chemistry:
[0114] In obtaining the compounds described in the examples below
and the corresponding analytical data, the following experimental
and analytical protocols were followed unless otherwise
indicated.
[0115] Unless otherwise stated, reaction mixtures were magnetically
stirred at room temperature (rt). Where solutions were "dried,"
they were generally dried over a drying agent such as
Na.sub.2SO.sub.4 or MgSO.sub.4. Where mixtures, solutions, and
extracts were "concentrated", they were typically concentrated on a
rotary evaporator under reduced pressure.
[0116] Thin-layer chromatography (TLC) was performed using Merck
silica gel 60 F.sub.254 2.5 cm.times.7.5 cm 250 .mu.m or 5.0
cm.times.10.0 cm 250 .mu.m pre-coated silica gel plates.
Preparative thin-layer chromatography was performed using EM
Science silica gel 60 F.sub.254 20 cm.times.20 cm 0.5 mm pre-coated
plates with a 20 cm.times.4 cm concentrating zone.
[0117] Normal-phase flash column chromatography (FCC) was performed
on silica gel (SiO.sub.2) eluting with hexanes/ethyl acetate,
unless otherwise noted.
[0118] Reversed-phase HPLC was performed on a Hewlett Packard HPLC
Series 1100, with a Phenomenex Luna C.sub.18 (5 .mu.m,
4.6.times.150 mm) column. Detection was done at .lamda.=230, 254
and 280 nm. The gradient was 10 to 99% acetonitrile/water (0.05%
trifluoroacetic acid) over 5.0 min with a flow rate of 1 mL/min.
Alternately, preparative HPLC purification was performed on a
Gilson automated HPLC system running Gilson Unipoint LC software
with uv peak detection done at .lamda.=220 nm and fitted with a
reverse phase YMC-Pack ODS-A (5 .mu.m, 30.times.250 mm) column;
mobile gradient of 10-99% of acetonitrile/water (0.05%
trifluoroacetic acid) over 15-20 min and flow rates of 10-20
mL/min.
[0119] Mass spectra (MS) were obtained on an Agilent series 1100
MSD equipped with a ESI/APCI positive and negative multimode source
unless otherwise indicated.
[0120] Nuclear magnetic resonance (NMR) spectra were obtained on
Bruker model DRX spectrometers. The format of the .sup.1H NMR data
below is: chemical shift in ppm downfield of the tetramethylsilane
reference (apparent multiplicity, coupling constant J in Hz,
integration).
[0121] Chemical names were generated using ChemDraw Version 6.0.2
(CambridgeSoft, Cambridge, Mass.) or ACD/Name Version 9 (Advanced
Chemistry Development, Toronto, Ontario, Canada).
Example 1
1-[4-Amino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazole--
4-carboxylic acid.
##STR00010##
[0123] Step A: Preparation of
3-fluoro-4-(2,6-dimethyl-phenoxy)aniline. Solid 2,6-dimethylphenol
(42.4 g, 346 mmol) was added in portions to a stirred mixture of
3,4-difluoronitrobenzene (50.0 g, 314 mmol), K.sub.2CO.sub.3 (65.0
g, 138 mmol), and DMSO (500 mL). After the addition was complete,
the mixture was heated to 80.degree. C. for 8 h and then allowed to
cool to rt. The mixture was poured into ice water, and the
resulting precipitate was collected and dried. This material was
dissolved in acetone (1 L), then 150 mL of saturated aqueous
NH.sub.4Cl was added and the mixture was immersed in an ice bath
with mechanical stirring. Solid Zn powder (204 g, 65.4 mmol) was
added in portions at such a rate that the internal temperature of
the reaction mixture did not rise above 20.degree. C. Following
completion of the addition, the mixture was allowed to warm to rt
and stirring was maintained for 6 h. EtOAc (ethyl acetate) (1.5 L)
and anhydrous sodium sulfate (500 g) were added, and stirring was
continued for 30 min. The mixture was then filtered though a pad of
Celite.RTM., rinsing well with EtOAc, and the filtrate was
concentrated. The residue was triturated with hexanes to afford a
solid (64.5 g, 90%). .sup.1H NMR (400 MHz, CDCl.sub.3): 7.10-6.99
(m, 3H), 6.55 (ddd, J=12.5, 2.1, 0.8 Hz, 1H), 6.25-6.19 (m, 2H),
3.50 (s, 2H), 2.15 (s, 6H).
[0124] Step B: Preparation of
1-(4-(2,6-dimethylphenoxy)-3-fluorophenyl)-3-ethoxycarbonylthiourea.
A mixture of 3-fluoro-4-(2,6-dimethyl-phenoxy)aniline (15.4 g, 66.6
mmol) and DCM (250 mL) was cooled in an ice bath, then neat ethyl
isocyanatoformate (9.61 g, 73.2 mmol) was added over 10 min. The
resulting solution was allowed to warm to rt and was maintained for
2 h. The solution was concentrated, and the residue was triturated
with 50:50 hexanes/ether, affording the titled compound as a solid
(21.8 g, 90%). MS (ESI): mass calcd. for
C.sub.18H.sub.19FN.sub.2O.sub.3S, 362.1; m/z found, 363.1
[M+H].sup.+.
[0125] Step C: Preparation of
1-(6-(2,6-dimethylphenoxy)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid, ethyl ester. Neat
diisopropylcarbodiimide (45.4 g, 290 mmol) was added to a solution
of
1-(4-(2,6-dimethylphenoxy)-3-fluorophenyl)-3-ethoxycarbonylthiourea
(100 g, 276 mmol), ethyl pyrazole-4-carboxylate (45.4 g, 290 mmol),
and DCM (1 L). The solution was maintained at rt for 24 h, then
concentrated. The residue was stirred with ether (500 mL) for 3 h
in an ice bath, then filtered. The filtrate was concentrated to a
thick orange oil (180 g, ca. 70% purity, 97%). A portion of this
material (20 g, ca. 30 mmol) was dissolved in DCE (150 mL), then
neat TiCl.sub.4 was added. The mixture was then heated to reflux
for 6 h, then cooled in an ice bath. EtOH (750 mL) was added, and
the mixture was stirred for 3 h. The resulting precipitate was
collected by filtration, washed with cold EtOH, and dried to
provide the titled compound (3.9 g, 31%). 1H NMR (500 MHz, DMSO):
13.03 (s, 1H), 8.95 (d, J=0.6 Hz, 1H), 8.29 (s, 1H), 7.75 (d,
J=11.5 Hz, 1H), 7.31-7.24 (m, 2H), 7.22 (dd, J=8.5, 6.4 Hz, 1H),
6.96 (d, J=9.1Hz, 1H), 4.29 (q, J=7.1Hz, 2H), 2.11 (s, 6H), 1.32
(t, J=7.1Hz, 3H).
[0126] Step D: Preparation of
1-[4-chloro-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazol-
e-4-carboxylic acid, ethyl ester. A mixture of the above
1-[6-(2,6-di
methyl-phenoxy)-7-fluoro-4-oxo-3,4-dihydro-quinazolin-2-yl]-1H-pyrazole-4-
-carboxylic acid ethyl ester (5.0 g, 12 mmol), LiCl (2.5 g, 59
mmol), POCl.sub.3 (5.5 ml, 59 mmol), DIEA (10 mL, 59 mmol), and
acetonitrile (ACN) (50 mL) was heated to reflux for 6 h. The
mixture was allowed to cool to rt and then concentrated. The
residue was taken up in a minimal amount of DCM and passed through
a pad of silica gel, eluting with 50:50 hexanes/EtOAc. The
resulting solution was concentrated to provide the titled compound.
(5.2 g, >99%). .sup.1H NMR (500 MHz, DMSO-d.sub.6): 9.13 (d,
J=0.6 Hz, 1H), 8.23 (d, J=0.6 Hz, 1H), 7.92 (d, J=10.7 Hz, 1H),
7.23-7.19 (m, 3H), 7.07 (d, J=8.6 Hz, 1H), 4.36 (q, J=7.1Hz, 2H),
2.19 (s, 6H), 1.40 (t, J=7.1 Hz, 3H).
[0127] Step E: Preparation of
1-[4-amino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazole-
-4-carboxylic acid, ethyl ester. A methanol solution of ammonia
(7M, 0.39 mL, 2.7 mmol) was added to a solution of the above
1-[4-chloro-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazol-
e-4-carboxylic acid, ethyl ester (120 mg, 0.27 mmol) and THF (2
mL). The mixture was stirred 6 h, then concentrated. The residue
was triturated with Et.sub.2O, providing the titled compound (72
mg, 64%). .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.96 (d, J=0.8 Hz,
1H), 8.44-8.02 (m, 3H), 7.71 (d, J=11.9 Hz, 1H), 7.37 (d, J=9.0 Hz,
1H), 7.24-7.20 (m, 2H), 7.17 (dd, J=8.6, 6.2 Hz, 1H), 4.27 (q,
J=7.1Hz, 2H), 2.12 (s, 6H), 1.31 (t, J=7.1Hz, 3H).
[0128] Step F: Preparation of
1-[4-amino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazole-
-4-carboxylic acid. A mixture of
1-[4-amino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-pyrazole-
-4-carboxylic acid, ethyl ester (65 mg, 0.15 mmol), 1M aqueous LiOH
(1.5 mL, 1.5 mmol), and THF (3 mL) was heated to 40.degree. C. for
16 h with rapid stirring. The mixture was then cooled in an ice
bath, and 1M HCl (1.5 mL, 1.5 mmol) was added. The resulting
precipitate was collected by filtration, washed with water, and
dried to furnish the titled compound (45 mg, 74%). MS (ESI): mass
calcd. for C.sub.20H.sub.16FN.sub.5O.sub.3, 393.1; m/z found, 394.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.72 (s, 1H),
8.91 (d, J=0.7 Hz, 1H), 8.42-7.98 (m, 3H), 7.70 (d, J=11.9 Hz, 1H),
7.37 (d, J=9.0 Hz, 1H), 7.25-7.20 (m, 2H), 7.17 (dd, J=8.6, 6.2 Hz,
1H), 2.12 (s, 6H).
Example 2
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-methylamino-quinazolin-2-yl]-1H-pyr-
azole-4-carboxylic acid.
##STR00011##
[0130] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using methylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.18FN.sub.5O.sub.3, 407.1; m/z found, 408.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
8.99 (d, J=0.7 Hz, 1H), 8.60 (d, J=4.5 Hz, 1H), 8.08 (d, J=0.7 Hz,
1H), 7.71 (d, J=11.9 Hz, 1H), 7.34 (d, J=8.9 Hz, 1H), 7.27-7.22 (m,
2H), 7.19 (dd, J=8.6, 6.2 Hz, 1H), 3.00 (d, J=4.5 Hz, 3H), 2.12 (s,
6H).
Example 3
1-[4-Dimethylamino-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-yl]-1H-p-
yrazole-4-carboxylic acid.
##STR00012##
[0132] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.20FN.sub.5O.sub.3, 421.2; m/z found, 422.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.77 (s, 1H),
8.97 (d, J=0.7 Hz, 1H), 8.09 (d, J=0.7 Hz, 1H), 7.79 (d, J=11.9 Hz,
1H), 7.32-7.16 (m, 3H), 6.99 (d, J=9.1Hz, 1H), 3.12 (s, 6H), 2.13
(s, 6H).
Example 4
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-piperidin-1-yl-quinazolin-2-yl]-1H--
pyrazole-4-carboxylic acid.
##STR00013##
[0134] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using piperidine in step E. MS (ESI): mass calcd. for
C.sub.25H.sub.24FN.sub.5O.sub.3, 461.2; m/z found, 462.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.77 (s, 1H),
8.96 (d, J=0.7 Hz, 1H), 8.09 (d, J=0.7 Hz, 1H), 7.83 (d, J=11.8 Hz,
1H), 7.31-7.19 (m, 3H), 6.70 (d, J=9.1 Hz, 1H), 3.58-3.48 (m, 4H),
2.13 (s, 6H), 1.66-1.53 (m, 2H), 1.47-1.35 (m, 4H).
Example 5
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-pyrrolidin-1-yl-quinazolin-2-yl]-1H-
-pyrazole-4-carboxylic acid.
##STR00014##
[0136] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.22FN.sub.5O.sub.3, 447.2; m/z found, 448.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.74 (s, 1H),
8.95 (s, 1H), 8.08 (s, 1H), 7.75 (d, J=12.0 Hz, 1H), 7.30-7.12 (m,
4H), 3.66-3.48 (m, 4H), 2.14 (s, 6H), 1.91-1.80 (m, 4H).
Example 6
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-phenylamino-quinazolin-2-yl]-1H-pyr-
azole-4-carboxylic acid.
##STR00015##
[0138] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using aniline in step E with heating to 80.degree. C.
for 16 h. MS (ESI): mass calcd. for
C.sub.26H.sub.20FN.sub.5O.sub.3, 469.2; m/z found, 470.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
10.14 (s, 1H), 8.69 (d, J=0.7 Hz, 1H), 8.07 (d, J=0.7 Hz, 1H), 7.82
(d, J=11.8 Hz, 1H), 7.71-7.59 (m, 3H), 7.47-7.39 (m, 2H), 7.28-7.15
(m, 4H), 2.16 (s, 6H).
Example 7
1-[4-(2-Chloro-phenylamino)-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazolin-2-
-yl]-1H-pyrazole-4-carboxylic acid.
##STR00016##
[0140] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using 2-chloroaniline in step E and heating to
80.degree. C. for 16 h. MS (ESI): mass calcd. for
C.sub.26H.sub.19CIFN.sub.5O.sub.3, 503.1; m/z found, 504.0
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.72 (s, 1H),
10.30 (s, 1H), 8.42 (d, J=0.7 Hz, 1H), 8.03 (d, J=0.7 Hz, 1H), 7.85
(d, J=11.8 Hz, 1H), 7.66-7.59 (m, 2H), 7.54 (dd, J=7.8, 1.7 Hz,
1H), 7.48-7.38 (m, 2H), 7.28-7.23 (m, 2H), 7.19 (dd, J=8.3, 6.6 Hz,
1H), 2.17 (s, 6H).
Example 8
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-propylamino-quinazolin-2-yl]-1H-pyr-
azole-4-carboxylic acid.
##STR00017##
[0142] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using propylamine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.22FN.sub.5O.sub.3, 435.2; m/z found, 436.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
8.94 (d, J=0.7 Hz, 1H), 8.67 (t, J=5.6 Hz, 1H), 8.09 (d, J=0.7 Hz,
1H), 7.70 (d, J=11.9 Hz, 1H), 7.39 (d, J=8.9 Hz, 1H), 7.27-7.14 (m,
3H), 3.49 (dd, J=14.0, 6.1Hz, 2H), 2.12 (s, 6H), 1.71-1.57 (m, 2H),
0.90 (t, J=7.4 Hz, 3H).
Example 9
(rac)-1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4-(2-methoxy-1-methyl-ethylamin-
o)-quinazolin-2-yl]-1H-pyrazole-4-carboxylic acid.
##STR00018##
[0144] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using racemic 2-methoxy-1-methylethylamine in step E. MS
(ESI): mass calcd. for C.sub.24H.sub.24FN.sub.5O.sub.4, 465.2; m/z
found, 467.1 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6):
12.82 (s, 1H), 8.96 (d, J=0.7 Hz, 1H), 8.37 (d, J=7.9 Hz, 1H), 8.09
(d, J=0.7 Hz, 1H), 7.67 (d, J=11.8 Hz, 1H), 7.54 (d, J=8.9 Hz, 1H),
7.20-7.08 (m, 3H), 4.80-4.67 (m, 1H), 3.51 (dd, J=9.7, 6.5 Hz, 1H),
3.44-3.35 (m, 1H, partially obstructed by water), 3.24 (d, J=3.3
Hz, 3H), 2.11 (s, 6H), 1.21 (d, J=6.8 Hz, 3H).
Example 10
1-[4-(2-Diethylamino-ethylamino)-6-(2,6-dimethyl-phenoxy)-7-fluoro-quinazo-
lin-2-yl]-1H-pyrazole-4-carboxylic acid.
##STR00019##
[0146] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using 2-dimethylaminoethylamine in step E. MS (ESI):
mass calcd. for C.sub.26H.sub.29FN.sub.6O.sub.3, 492.2; m/z found,
493.5 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 9.00 (s,
1H), 8.83 (s, 1H), 8.15 (s, 1H), 7.76 (d, J=11.8 Hz, 1H), 7.34 (d,
J=8.8 Hz, 1H), 7.27-7.14 (m, 3H), 3.71 (d, J=5.3 Hz, 2H), 3.08-2.84
(m, 6H), 2.12 (s, 6H), 1.07 (t, J=7.0 Hz, 6H).
Example 11
1-[6-(2,6-Dimethyl-phenoxy)-4-dibutylamino-7-fluoro-quinazolin-2-yl]-1H-py-
razole-4-carboxylic acid.
##STR00020##
[0148] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using dibutylamine in step E. MS (ESI): mass calcd. for
C.sub.28H.sub.32FN.sub.5O.sub.3, 505.2; m/z found, 506.3
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
8.87 (d, J=0.7 Hz, 1H), 8.09 (d, J=0.7 Hz, 1H), 7.79 (d, J=11.8 Hz,
1H), 7.30-7.17 (m, 3H), 6.90 (d, J=9.0 Hz, 1H), 3.47-3.40 (m, 4H),
2.13 (s, 6H), 1.52-1.37 (m, 4H), 1.15-1.03 (m, 4H), 0.85 (t, J=7.3
Hz, 6H).
Example 12
1-[6-(2,6-Dimethyl-phenoxy)-4-dipropylamino-7-fluoro-quinazolin-2-yl]-1H-p-
yrazole-4-carboxylic acid.
##STR00021##
[0150] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using dipropylamine in step E. MS (ESI): mass calcd. for
C.sub.26H.sub.28FN.sub.5O.sub.3, 477.2; m/z found, 478.4
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.77 (s, 1H),
8.87 (d, J=0.6 Hz, 1H), 8.10 (d, J=0.6 Hz, 1H), 7.79 (d, J=11.8 Hz,
1H), 7.30-7.24 (m, 2H), 7.20 (dd, J=8.4, 6.6 Hz, 1H), 6.88 (d,
J=9.0 Hz, 1H), 3.43-3.37 (m, 4H), 2.13 (s, 6H), 1.55-1.41 (m, 4H),
0.70 (t, J=7.4 Hz, 6H).
Example 13
1-(4-((Cyclohexylmethyl)amino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin--
2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00022##
[0152] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using cyclohexanemethylamine in step E. MS (ESI): mass
calcd. for C.sub.27H.sub.28FN.sub.5O.sub.3, 490.1; m/z found, 489.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 8.90 (d, J=0.6
Hz, 1H), 8.65 (t, J=5.7 Hz, 1H), 8.08 (d, J=0.6 Hz, 1H), 7.68 (d,
J=11.9 Hz, 1H), 7.43 (d, J=8.9 Hz, 1H), 7.25-7.14 (m, J=8.5, 6.8
Hz, 3H), 3.39 (t, J=6.0 Hz, 2H), 2.12 (s, 6H), 1.73-1.53 (m, 6H),
1.14 (t, J=9.4 Hz, 3H), 0.97 (t, J=11.6 Hz, 2H).
Example 14
1-((4-Cyclopropylamino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin-2-yl)-1-
H-pyrazole-4-carboxylic acid.
##STR00023##
[0154] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using cycloproplyamine in step E. MS (ESI): mass calcd.
for C.sub.23H.sub.20FN.sub.5O.sub.3, 433.2; m/z found, 434.0
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.77 (s, 1H),
9.00 (d, J=0.7 Hz, 1H), 8.72 (d, J=2.7 Hz, 1H), 8.10 (d, J=0.7 Hz,
1H), 7.72 (d, J=11.8 Hz, 1H), 7.41 (d, J=8.9 Hz, 1H), 7.23-7.13 (m,
3H), 3.04-2.93 (m, 1H), 2.11 (s, 6H), 0.88-0.76 (m, 2H), 0.68-0.57
(m, 2H).
Example 15
1-((4-Cyclopropanemethylamino)-6-(2,6-dimethylphenoxy)-7-fluoroquinazolin--
2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00024##
[0156] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using cyclopropanemethylamine in step E. MS (ESI): mass
calcd. for C.sub.24H.sub.22FN.sub.5O.sub.3, 447.2; m/z found, 448.0
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.75 (s, 1H),
8.95 (d, J=0.7 Hz, 1H), 8.76 (t, J=5.7 Hz, 1H), 8.09 (d, J=0.7 Hz,
1H), 7.71 (d, J=11.8 Hz, 1H), 7.39 (d, J=8.9 Hz, 1H), 7.28-7.14 (m,
J=8.5, 6.9 Hz, 3H), 3.43-3.38 (m, 2H), 2.13 (s, 6H), 1.29-1.14 (m,
1H), 0.48-0.40 (m, 2H), 0.35-0.27 (m, 2H).
Example 16
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-((tetrahydro-2H-pyran-4-yl)amino)qui-
nazolin-2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00025##
[0158] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using 4-aminotetrahydro-2H-pyran in step E. MS (ESI):
mass calcd. for C.sub.25H.sub.24FN.sub.5O.sub.4, 477.2; m/z found,
478.0 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.77 (s,
1H), 8.95 (d, J=0.5 Hz, 1H), 8.29 (d, J=7.5 Hz, 1H), 8.10 (d, J=0.5
Hz, 1H), 7.70 (d, J=11.8 Hz, 1H), 7.49 (d, J=8.9 Hz, 1H), 7.24-7.12
(m, 3H), 4.55-4.39 (m, 1H), 3.91 (dd, J=11.0, 4.0 Hz, 2H),
3.65-3.56 (m, 2H), 3.45 (t, J=11.1Hz, 2H), 2.12 (s, 6H), 1.87 (dd,
J=12.4, 2.6 Hz, 2H), 1.78-1.73 (m, 2H), 1.72-1.59 (m, 2H).
Example 17
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-(4-methyl-1,4-diazepan-1-yl)quinazol-
in-2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00026##
[0160] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using 4-methyl-1,4-diazepane) in step E. MS (ESI): mass
calcd. for C.sub.26H.sub.27FN.sub.6O.sub.3, 490.2; m/z found, 491.3
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 8.94 (s, 1H),
8.09 (d, J=0.4 Hz, 1H), 7.81 (d, J=11.9 Hz, 1H), 7.32-7.18 (m, 3H),
6.89 (d, J=9.1Hz, 1H), 3.84-3.73 (m, 2H), 3.66 (t, J=5.9 Hz, 2H),
2.73-2.54 (m, 4H), 2.31 (s, 3H), 2.13 (s, 6H), 1.87-1.75 (m,
2H).
Example 18
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-thiomorpholinoquinazolin-2-yl)-1H-py-
razole-4-carboxylic acid.
##STR00027##
[0162] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using thiomorpholine in step E. MS (ESI): mass calcd.
for C.sub.24H.sub.22FN.sub.6O.sub.3S, 479.1; m/z found, 480.0
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.79 (s, 1H),
8.98 (d, J=0.7 Hz, 1H), 8.11 (d, J=0.7 Hz, 1H), 7.88 (d, J=11.8 Hz,
1H), 7.33-7.21 (m, 3H), 6.65 (d, J=9.1Hz, 1H), 3.86-3.75 (m, 4H),
2.56-2.51 (m, 4H), 2.14 (s, 6H).
Example 19
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-(4-hydroxypiperidin-1-yl)quinazolin--
2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00028##
[0164] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using 4-hydroxypiperidine in step E. MS (ESI): mass
calcd. for C.sub.25H.sub.24FN.sub.5O.sub.3, 477.2; m/z found, 478.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.78 (s, 1H),
8.96 (d, J=0.7 Hz, 1H), 8.10 (d, J=0.7 Hz, 1H), 7.84 (d, J=11.8 Hz,
1H), 7.32-7.19 (m, 3H), 6.71 (d, J=9.1Hz, 1H), 4.81 (d, J=4.0 Hz,
1H), 3.87-3.66 (m, 3H), 3.32-3.24 (m, 2H), 1.73-1.61 (m, 2H),
1.35-1.13 (m, 2H).
Example 20
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid.
##STR00029##
[0166] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using morpholine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.22FN.sub.5O.sub.4, 436.2; m/z found, 464.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.79 (s, 1H),
9.00 (d, J=0.7 Hz, 1H), 8.11 (d, J=0.7 Hz, 1H), 7.89 (d, J=11.8 Hz,
1H), 7.31-7.21 (m, 3H), 6.68 (d, J=9.1Hz, 1H), 3.56 (s, 8H), 2.12
(s, 6H).
Example 21
1-(4-(4-Acetamidopiperidin-1-yl)-6-(2,6-dimethylphenoxy)-7-fluoroquinazoli-
n-2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00030##
[0168] The titled compound was prepared in a manner analogous to
EXAMPLE 1, using 4-acetamidopiperidine in step E. MS (ESI): mass
calcd. for C.sub.27H.sub.27FN.sub.6O.sub.4, 518.2; m/z found, 519.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
8.97 (d, J=0.7 Hz, 1H), 8.11 (d, J=0.7 Hz, 1H), 7.91-7.80 (m, 2H),
7.32-7.19 (m, 3H), 6.70 (d, J=9.0 Hz, 1H), 3.96 (d, J=13.5 Hz, 2H),
3.88-3.76 (m, 1H), 3.20 (t, J=11.1Hz, 2H), 2.14 (s, 6H), 1.80 (s,
3H), 1.75-1.66 (m, 2H), 1.34-1.20 (m, 2H).
Example 22
1-(6-Cyclohexyl-4-methylamino-quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00031##
[0170] The titled compound was prepared in a manner analogous to
EXAMPLE 1, Steps B-F using 4-cyclohexylaniline in step B and
methylamine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.21N.sub.5O.sub.2, 351.2; m/z found, 352.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.74 (s, 1H),
9.04 (s, 1H), 8.78 (s, 1H), 8.10 (s, 2H), 7.70 (d, J=8.6 Hz, 1H),
7.66 (d, J=8.4 Hz, 1H), 3.17-3.07 (m, 3H), 2.65 (t, J=11.5 Hz, 1H),
1.95-1.80 (m, 4H), 1.75 (d, J=12.5 Hz, 1H), 1.60-1.35 (m, 4H),
1.30-1.20 (m, 1H).
Example 23
1-[6-Cyclohexyl-4-(2,6-dimethyl-benzylamino)-quinazolin-2-yl]-1H-pyrazole--
4-carboxylic acid.
##STR00032##
[0172] The titled compound was prepared in a manner analogous to
EXAMPLE 1, Steps B-F using 4-cyclohexylaniline in step B and
2,6-dimethylbenzylamine in step E. MS (ESI): mass calcd. for
C.sub.27H.sub.29N.sub.5O.sub.2, 455.2; m/z found, 456.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.72 (s, 1H),
9.09 (s, 1H), 8.56 (s, 1H), 8.26 (s, 1H), 8.11 (s, 1H), 7.75-7.63
(m, 2H), 7.20-7.13 (m, 1H), 7.13-7.06 (m, 2H), 4.87 (d, J=4.3 Hz,
2H), 2.68-2.56 (m, 1H), 2.38 (s, 6H), 1.82 (t, J=12.0 Hz, 4H), 1.71
(d, J=12.9 Hz, 1H), 1.55-1.43 (m, 2H), 1.43-1.30 (m, 2H), 1.30-1.18
(m, 1H).
Example 24
1-(4-Amino-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00033##
[0174] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
ammonia in dioxane in step E. MS (ESI): mass calcd. for
C.sub.18H.sub.19N.sub.5O.sub.2, 337.2; m/z found, 338.2 [M+H]+.
.sup.1HNMR (400 MHz, DMSO-d.sub.6) 13.57-11.64 (m, 1H), 8.93 (s,
1H), 8.59 (s, 2H), 8.17 (d, J=9.6 Hz, 2H), 7.75 (q, J=8.7 Hz, 2H),
2.66 (t, J=11.7 Hz, 1H), 1.86 (t, J=12.7 Hz, 4H), 1.75 (d, J=12.2
Hz, 1H), 1.59-1.34 (m, 4H), 1.34-1.21 (m, 1H).
Example 25
1-(6-Cyclohexyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid.
##STR00034##
[0176] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.25N.sub.5O.sub.2, 391.2; m/z found, 392.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
9.04 (s, 1H), 8.17 (s, 1H), 8.12 (s, 1H), 7.77 (s, 2H), 4.05 (s,
4H), 2.81-2.66 (m, 1H), 2.03 (s, 4H), 1.92-1.79 (m, 4H), 1.73 (d,
J=12.8 Hz, 1H), 1.58-1.35 (m, 4H), 1.31-1.16 (m, 1H).
Example 26
1-(6-Cyclohexyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00035##
[0178] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
piperidine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.27N.sub.5O.sub.2, 405.2; m/z found, 406.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) 12.78-11.82 (m,
1H), 8.99 (s, 1H), 8.10 (s, 1H), 7.75 (s, 2H), 7.73 (s, 1H), 3.85
(s, 4H), 2.69 (s, 1H), 1.94-1.89 (m, 2H), 1.83-1.75 (m, 2H), 1.75
(s, 6H), 1.55-1.39 (m, 4H), 1.34-1.28 (m, 2H).
Example 27
1-(6-Cyclohexyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00036##
[0180] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.27N.sub.5O.sub.2, 393.2; m/z found, 394.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
8.94 (s, 1H), 8.10 (s, 1H), 7.80 (s, 1H), 7.73 (s, 1H), 7.72 (s,
1H), 3.82 (q, J=6.9 Hz, 4H), 2.67 (s, 1H), 1.91 (s, 2H), 1.84 (s,
2H), 1.74 (d, J=12.1Hz, 1H), 1.51-1.35 (m, 11H).
Example 28
1-(6-Cyclohexyl-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00037##
[0182] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
aniline in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.23N.sub.5O.sub.2, 413.2; m/z found, 414.3
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.79 (s, 1H),
10.22 (s, 1H), 8.82 (s, 1H), 8.45 (s, 1H), 8.13 (s, 1H), 7.91 (d,
J=7.6 Hz, 2H), 7.81 (d, J=8.6 Hz, 1H), 7.76 (d, J=8.5 Hz, 1H),
7.52-7.45 (m, 2H), 7.23 (t, J=7.4 Hz, 1H), 3.65-3.56 (m, 1H), 2.72
(t, J=11.8 Hz, 1H), 1.96-1.83 (m, 4H), 1.82-1.72 (m, 2H), 1.66-1.52
(m, 2H), 1.44-1.32 (m, 2H), 1.30-1.23 (m, 1H).
Example 29
1-(4-((2-Chlorophenyl)amino)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00038##
[0184] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
2-chloroaniline in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.22CIN.sub.5O.sub.2, 447.2; m/z found, 448.3
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 10.35 (s, 1H),
8.50 (s, 1H), 8.42 (s, 1H), 8.04 (s, 1H), 7.83 (dd, J=8.7, 1.7 Hz,
1H), 7.76 (d, J=8.6 Hz, 1H), 7.69 (dd, J=4.0, 1.6 Hz, 1H), 7.67
(dd, J=3.9, 1.6 Hz, 1H), 7.51 (td, J=7.6, 1.5 Hz, 1H), 7.43 (td,
J=7.7, 1.7 Hz, 1H), 2.83-2.64 (m, 1H), 1.94 (d, J=11.8 Hz, 2H),
1.87 (d, J=12.7 Hz, 2H), 1.79-1.73 (m, 1H), 1.68-1.51 (m, 2H),
1.51-1.36 (m, 2H), 1.36-1.22 (m, 1H).
Example 30
1-(4-(4-Cyanopiperidin-1-yl)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00039##
[0186] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
4-cyanopiperidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.26N.sub.6O.sub.2, 430.2; m/z found, 431.1 [M+H]+.
.sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.78 (s, 1H), 9.02 (s, 1H),
8.11 (s, 1H), 7.78 (s, 2H), 7.75 (s, 1H), 4.16-4.09 (m, 2H),
3.75-3.64 (m, 2H), 3.30-3.20 (m, 1H), 2.89-2.73 (m, 1H), 2.27-2.14
(m, 2H), 2.01-1.91 (m, 2H), 1.88 (d, J=12.3 Hz, 2H), 1.84 (d,
J=12.4 Hz, 2H), 1.74 (d, J=12.6 Hz, 1H), 1.57-1.36 (m, 5H),
1.35-1.23 (m, 1H).
Example 31
1-(6-Cyclohexyl-4-(4-fluoropiperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00040##
[0188] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
4-fluoropiperidine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.26FN.sub.5O.sub.2, 423.2; m/z found, 424.1
[M+H].sup.+. .sup.1NMR (500 MHz, DMSO-d.sub.6): 12.78 (s, 1H), 9.01
(s, 1H), 8.11 (s, 1H), 7.78 (s, 3H), 5.19-4.93 (m, 1H), 3.92-3.79
(m, 4H), 2.72-2.64 (m, 1H), 2.23-2.08 (m, 2H), 2.03-1.92 (m, 2H),
1.89 (d, J=12.7 Hz, 2H), 1.83 (d, J=12.5 Hz, 2H), 1.74 (d, J=12.7
Hz, 1H), 1.52-1.39 (m, 4H), 1.33-1.22 (m, 1H).
Example 32
1-(6-Cyclohexyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid.
##STR00041##
[0190] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.23N.sub.5O.sub.2, 377.1; m/z found, 378.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.33 (s, 1H),
9.14 (s, 1H), 8.26 (s, 1H), 8.25 (s, 1H), 7.83-7.73 (m, 2H),
2.81-2.65 (m, 1H), 1.84 (d, J=8.0 Hz, 4H), 1.74-1.62 (m, 1H),
1.52-1.48 (m, 2H), 1.46-1.33 (m, 2H), 1.26-1.14 (m, 1H), 0.98-0.88
(m, 2H), 0.88-0.80 (m, 2H).
Example 33
1-(6-Cyclohexyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00042##
[0192] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
morpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.25N.sub.5O.sub.3, 407.2; m/z found, 408.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.79 (s, 1H),
9.03 (s, 1H), 8.12 (s, 1H), 7.79 (s, 1H), 7.78 (s, 2H), 4.02-3.92
(m, 4H), 3.82 (d, J=4.3 Hz, 4H), 2.73-2.64 (m, 1H), 1.92-1.85 (m,
4H), 1.73-1.68 (m, 1H), 1.53-1.38 (m, 4H), 1.34-1.21 (m, 1H).
Example 34
1-(6-Cyclohexyl-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00043##
[0194] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
thiomorpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.25N.sub.5O.sub.2S, 423.1; m/z found, 424.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
9.01 (s, 1H), 8.11 (s, 1H), 7.78 (s, 2H), 7.73 (s, 1H), 4.19-4.12
(m, 4H), 2.98-2.87 (m, 4H), 2.72-2.64 (m, 1H), 2.06-1.89 (m, 2H),
1.88-1.82 (m, 2H), 1.76-1.70 (m, 1H), 1.52-1.39 (m, 4H), 1.29-1.14
(m, 1H).
Example 35
1-(4-Cyanamido-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00044##
[0196] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
sodium cyanamide in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.18N.sub.6O.sub.2, 362.1; m/z found, 363.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 13.19 (s, 1H),
8.89 (s, 1H), 8.43 (s, 1H), 7.97 (s, 1H), 7.87 (d, J=8.6 Hz, 1H),
7.79 (d, J=8.6 Hz, 1H), 2.66 (s, 1H), 1.82 (s, 4H), 1.72-1.68 (m,
1H), 1.42-1.30 (m, 4H), 1.26-1.19 (m, 1H).
Example 36
1-(4-(tert-Butylamino)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid.
##STR00045##
[0198] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
tert-butylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.27N.sub.5O.sub.2, 393.2; m/z found, 394.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 13.27-12.44 (m,
1H), 8.89 (s, 1H), 8.29 (s, 1H), 8.18 (s, 1H), 7.94 (s, 1H),
7.76-7.71 (m, 1H), 7.69 (d, J=8.6 Hz, 1H), 2.67 (t, J=11.8 Hz, 1H),
1.85 (d, J=10.5 Hz, 4H), 1.75 (d, J=12.4 Hz, 1H), 1.63 (s, 9H),
1.59-1.50 (m, 2H), 1.48-1.38 (m, 2H), 1.35-1.24 (m, 1H).
Example 37
1-(4-(Azepan-1-yl)-6-cyclohexylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00046##
[0200] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
homopiperidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.29N.sub.5O.sub.2, 419.2; m/z found, 420.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
8.95 (s, 1H), 8.09 (s, 1H), 7.92 (s, 1H), 7.74-7.69 (m, 2H),
4.08-3.96 (m, 4H), 2.68 (s, 1H), 1.98 (s, 4H), 1.89 (d, J=10.5 Hz,
2H), 1.83 (d, J=12.0 Hz, 2H), 1.73 (d, J=11.9 Hz, 1H), 1.61 (s,
4H), 1.57-1.44 (m, 4H), 1.27 (d, J=12.2 Hz, 1H).
Example 38
1-(6-Cyclohexyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00047##
[0202] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.20H.sub.23N.sub.5O.sub.2, 365.2; m/z found, 366.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 13.57-11.86 (m,
1H), 9.11 (s, 1H), 8.24 (s, 1H), 8.05 (s, 1H), 7.82 (q, J=8.8 Hz,
2H), 3.54 (s, 6H), 2.73 (t, J=11.5 Hz, 1H), 1.85 (t, J=12.7 Hz,
4H), 1.73 (d, J=11.6 Hz, 1H), 1.57-1.44 (m, 4H), 1.34-1.20 (m,
1H).
Example 39
1-(6-Cyclohexyl-4-((cyclohexylmethyl)amino)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00048##
[0204] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
cyclohexylmethylamine in step E. MS (ESI): mass calcd. for
C.sub.25H.sub.31N.sub.5O.sub.2, 433.2; m/z found, 434.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.76 (s, 1H),
8.95 (s, 1H), 8.09 (s, 1H), 7.92 (s, 1H), 7.74-7.69 (m, 2H),
4.08-3.96 (m, 4H), 2.68 (s, 1H), 1.98 (s, 4H), 1.89 (d, J=10.5 Hz,
2H), 1.83 (d, J=12.0 Hz, 2H), 1.73 (d, J=11.9 Hz, 1H), 1.61 (s,
4H), 1.44-1.31 (m, 4H), 1.27 (d, J=12.2 Hz, 1H).
Example 40
1-(6-Cyclohexyl-4-(methylsulfonamido)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00049##
[0206] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexylaniline in step B and
methanesulfonamide in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.21N.sub.5O.sub.4S, 415.1; m/z found, 416.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.88 (s, 1H),
8.93 (s, 1H), 8.32 (s, 1H), 8.26 (s, 1H), 7.91-7.81 (m, 2H), 3.65
(s, 3H), 2.70 (t, J=11.6 Hz, 1H), 1.87 (t, J=14.8 Hz, 4H),
1.79-1.70 (m, 1H), 1.59-1.34 (m, 5H), 1.28-1.12 (m, 1H).
Example 41
1-(4-(Dimethylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00050##
[0208] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.20H.sub.17N.sub.5O.sub.2, 359.1; m/z found, 360.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.11 (s, 1H),
8.45 (s, 1H), 8.21 (s, 1H), 8.18 (d, J=8.7, 1H), 7.94 (d, J=8.7 Hz,
1H), 7.81 (d, J=7.7 Hz, 2H), 7.53 (t, J=7.7 Hz, 2H), 7.43 (t, J=7.3
Hz, 1H), 3.59 (s, 6H).
Example 42
1-(4-(Ethyl(methyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00051##
[0210] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
N-methylethylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.19N.sub.5O.sub.2, 373.1; m/z found, 374.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 13.24-12.33 (m,
1H), 9.05 (s, 1H), 8.37 (s, 1H), 8.19 (s, 1H), 8.17 (dd, J=8.8, 2.0
Hz, 1H), 7.92 (d, J=8.7 Hz, 1H), 7.83-7.78 (m, 2H), 7.53 (t, J=7.6
Hz, 2H), 7.43 (t, J=7.4 Hz, 1H), 3.96 (q, J=7.0 Hz, 2H), 3.57 (s,
3H), 1.41 (t, J=7.0 Hz, 3H).
Example 43
1-(6-Phenyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00052##
[0212] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.19N.sub.5O.sub.2, 385.1; m/z found, 386.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.09 (s, 1H),
8.51 (s, 1H), 8.24 (s, 1H), 8.20 (dd, J=8.7, 1.6 Hz, 1H), 7.96 (d,
J=8.7 Hz, 1H), 7.85-7.79 (m, 2H), 7.53 (t, J=7.6 Hz, 2H), 7.44 (t,
J=7.4 Hz, 1H), 4.16 (s, 4H), 2.05 (s, 4H).
Example 44
1-(6-Phenyl-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00053##
[0214] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
aniline in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.17N.sub.5O.sub.2, 407.1; m/z found, 408.0
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.81 (s, 1H),
10.39 (s, 1H), 8.94 (s, 1H), 8.86 (s, 1H), 8.25 (dd, J=8.7, 1.9 Hz,
1H), 8.14 (d, J=0.6 Hz, 1H), 7.93-7.81 (m, 5H), 7.58 (t, J=7.7 Hz,
2H), 7.49 (dd, J=15.4, 7.2 Hz, 3H), 7.25 (t, J=7.4 Hz, 1H).
Example 45
1-(6-Phenyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00054##
[0216] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
piperidine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.21N.sub.5O.sub.2, 399.1; m/z found, 400.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
9.03 (s, 1H), 8.19-8.12 (m, 3H), 7.92-7.87 (m, 1H), 7.83-7.77 (m,
2H), 7.54 (t, J=7.6 Hz, 2H), 7.43 (t, J=7.4 Hz, 1H), 3.94 (s, 4H),
1.77 (s, 6H).
Example 46
1-(4-(Diethylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00055##
[0218] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.2, 387.1; m/z found, 388.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 8.97 (s, 1H),
8.22 (d, J=1.8 Hz, 1H), 8.14 (dd, J=8.9, 2.1Hz, 1H), 8.13 (s, 1H),
7.87 (d, J=8.7 Hz, 1H), 7.81-7.75 (m, 2H), 7.54 (t, J=7.7 Hz, 2H),
7.43 (t, J=7.4 Hz, 1H), 3.89 (q, J=6.9 Hz, 4H), 1.45 (t, J=7.0 Hz,
6H).
Example 47
1-(4-((2-Chlorophenyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00056##
[0220] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
2-chloroaniline in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.16CIN.sub.5O.sub.2, 441.1; m/z found, 442.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 10.56 (s, 1H),
8.94 (s, 1H), 8.54 (s, 1H), 8.29 (dd, J=8.7, 1.9 Hz, 1H), 8.07 (s,
1H), 7.93 (d, J=8.7 Hz, 3H), 7.75-7.68 (m, 2H), 7.58 (t, J=7.7 Hz,
2H), 7.62-7.53 (m, 1H), 7.49-7.42 (m, 2H).
Example 48
1-(4-(Azepan-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00057##
[0222] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
homopiperidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.23N.sub.5O.sub.2, 413.1; m/z found, 414.1
[M+H].sup.+. NMR (400 MHz, DMSO-d.sub.6): 12.81 (s, 1H), 9.00 (s,
1H), 8.34 (s, 1H), 8.14 (dd, J=8.3, 1.2 Hz, 2H), 7.88 (d, J=8.7 Hz,
1H), 7.81-7.75 (m, 2H), 7.53 (t, J=7.7 Hz, 2H), 7.45-7.40 (m, 1H),
4.15-4.02 (m, 4H), 2.01 (s, 4H), 1.62 (s, 4H).
Example 49
1-(4-((Cyclohexylmethyl)amino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid.
##STR00058##
[0224] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
N-methylcyclohexylamine in step E. MS (ESI): mass calcd. for
C.sub.25H.sub.25N.sub.5O.sub.2, 427.2; m/z found, 428.1
[M+H].sup.+. NMR (400 MHz, DMSO-d.sub.6): 12.80 (s, 1H), 9.02 (s,
1H), 8.97 (s, 1H), 8.70 (s, 1H), 8.19-8.12 (m, 2H), 7.89-7.84 (m,
2H), 7.82 (d, J=8.7 Hz, 1H), 7.55 (t, J=7.7 Hz, 2H), 7.44 (t, J=7.3
Hz, 1H), 3.56 (s, 3H), 1.92-1.83 (m, 3H), 1.81-1.72 (m, 2H), 1.64
(s, 1H), 1.31-1.13 (m, 3H), 1.13-1.08 (m, 2H).
Example 50
1-(4-Cyanamido-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00059##
[0226] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
sodium cyanamide in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.12N.sub.6O.sub.2, 356.1; m/z found, 357.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 13.15 (s, 1H),
8.91 (s, 1H), 8.40 (s, 1H), 8.35 (s, 1H), 8.19 (dd, J=8.7, 2.0 Hz,
1H), 7.97 (d, J=8.6 Hz, 1H), 7.76 (d, J=7.4 Hz, 2H), 7.52 (t, J=7.6
Hz, 2H), 7.43 (t, J=7.4 Hz, 1H).
Example 51
1-(4-(Cyclopropylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00060##
[0228] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.17N.sub.5O.sub.2, 371.1; m/z found, 372.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.36 (s, 1H),
9.14 (s, 1H), 8.75 (s, 1H), 8.24-8.22 (m, 1H), 8.21 (dd, J=8.7, 1.9
Hz, 1H), 7.90 (d, J=8.7 Hz, 1H), 7.88-7.85 (m, 2H), 7.55 (dd,
J=10.5, 4.8 Hz, 2H), 7.48-7.40 (m, 1H), 3.44-3.38 (m, 1H),
1.00-0.90 (m, 2H), 0.89-0.80 (m, 2H).
Example 52
1-(4-(tert-Butylamino)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00061##
[0230] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
tert-butylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.2, 387.1; m/z found, 388.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 8.93 (s, 1H),
8.77 (s, 1H), 8.23 (s, 1H), 8.21 (s, 1H), 8.16 (dd, J=8.7, 1.9 Hz,
1H), 7.87 (dd, J=12.5, 5.0 Hz, 3H), 7.55 (t, J=7.6 Hz, 2H), 7.44
(t, J=8.4 Hz, 1H), 1.66 (s, 9H).
Example 53
1-(4-Amino-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00062##
[0232] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
ammonia in dioxane in step E. MS (ESI): mass calcd. for
C.sub.16H.sub.13N.sub.5O.sub.2, 331.1; m/z found, 332.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 13.34-12.10 (m,
1H), 8.98 (s, 1H), 8.73 (s, 1H), 8.68 (d, J=1.9 Hz, 1H), 8.55 (s,
1H), 8.21 (dd, J=8.7, 1.9 Hz, 1H), 8.15 (s, 1H), 7.89-7.83 (m, 3H),
7.55 (t, J=7.7 Hz, 2H), 7.43 (t, J=7.4 Hz, 1H).
Example 54
1-(6-Phenyl-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00063##
[0234] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
thiomorpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.19N.sub.5O.sub.2S, 417.1; m/z found, 418.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.79 (s, 1H),
9.04 (s, 1H), 8.18 (dd, J=8.7, 2.0 Hz, 1H), 8.15 (d, J=1.9 Hz, 1H),
8.14 (d, J=0.7 Hz, 1H), 7.92 (d, J=8.7 Hz, 1H), 7.85-7.80 (m, 2H),
7.57-7.52 (m, 2H), 7.46-7.41 (m, 1H), 4.26-4.16 (m, 4H), 2.94-2.79
(m, 4H).
Example 55
1-(4-(4-Acetamidopiperidin-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00064##
[0236] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
N-(piperidin-4-yl)acetamide in step E. MS (ESI): mass calcd. for
C.sub.25H.sub.24N.sub.6O.sub.3, 456.1; m/z found, 457.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.81 (s, 1H),
9.05 (s, 1H), 8.17 (d, J=8.7 Hz, 1H), 8.14 (s, 2H), 7.92 (d, J=8.7
Hz, 2H), 7.80 (dd, J=8.3, 1.1Hz, 2H), 7.54 (dd, J=10.5, 4.9 Hz,
2H), 7.44-7.38 (m, 1H), 4.48-4.36 (m, 2H), 4.05-3.91 (m, 1H), 3.52
(t, J=11.5 Hz, 2H), 2.00 (d, J=9.5 Hz, 2H), 1.84 (s, 3H), 1.62-1.51
(m, 2H).
Example 56
1-(6-Phenyl-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid.
##STR00065##
[0238] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
4-aminotetrahydropyran in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.21 N.sub.5O.sub.3, 415.1; m/z found, 416.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.12 (s, 1H),
9.05 (s, 1H), 8.79 (s, 1H), 8.22 (s, 1H), 8.20 (dd, J=8.8, 1.9 Hz,
1H), 7.89 (dd, J=8.2, 6.7 Hz, 3H), 7.56 (t, J=7.6 Hz, 2H), 7.45 (t,
J=7.4 Hz, 1H), 4.76-4.60 (m, 1H), 3.98 (dd, J=11.2, 3.2 Hz, 2H),
3.56 (dd, J=11.8, 10.1Hz, 2H), 1.99 (dd, J=12.5, 2.4 Hz, 2H),
1.80-1.72 (m, 2H).
Example 57
1-(4-(4-Methyl-1,4-diazepan-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00066##
[0240] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
N-methylhomopiperazine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.24N.sub.6O.sub.2, 428.2; m/z found, 429.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.10-11.18 (m,
1H), 9.05 (s, 1H), 8.32 (s, 1H), 8.16 (dd, J=8.7, 1.8 Hz, 1H), 8.14
(s, 1H), 7.89 (d, J=8.7 Hz, 1H), 7.83-7.79 (m, 2H), 7.53 (t, J=7.6
Hz, 2H), 7.43 (t, J=7.3 Hz, 1H), 4.28 (d, J=16.6 Hz, 2H), 4.24 (s,
2H), 3.51 (s, 2H), 3.18 (s, 2H), 2.69 (s, 3H), 2.35 (s, 2H).
Example 58
1-(4-Morpholino-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00067##
[0242] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
morpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.19N.sub.5O.sub.3, 401.1; m/z found, 402.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 13.09-12.49 (m,
1H), 9.09 (s, 1H), 8.21 (s, 1H), 8.18 (dd, J=8.7, 2.0 Hz, 1H), 8.16
(s, 1H), 7.94 (d, J=8.7 Hz, 1H), 7.82 (dd, J=8.3, 1.1Hz, 2H), 7.54
(dd, J=10.5, 4.9 Hz, 2H), 7.46-7.41 (m, 1H), 4.12-4.01 (m, 4H),
3.88-3.77 (m, 4H).
Example 59
1-(4-(4-Cyanopiperidin-1-yl)-6-phenylquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00068##
[0244] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenylaniline in step B and
4-cyanopiperidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.20N.sub.6O.sub.2, 424.1; m/z found, 425.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 13.35-12.09 (m,
1H), 9.09 (s, 1H), 8.19 (dd, J=8.7, 1.9 Hz, 1H), 8.17 (d, J=4.6 Hz,
2H), 7.94 (d, J=8.6 Hz, 1H), 7.86-7.80 (m, 2H), 7.55 (dd, J=10.5,
4.9 Hz, 2H), 7.47-7.41 (m, 1H), 4.29-4.16 (m, 2H), 3.87-3.76 (m,
2H), 3.30-3.24 (m, 1H), 2.21-2.11 (m, 2H), 2.08-1.97 (m, 2H).
Example 60
1-(6-(4-Chlorophenoxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid.
##STR00069##
[0246] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.20CIN.sub.5O.sub.3, 437.1; m/z found, 438.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H),
8.93 (s, 1H), 8.11 (s, 1H), 7.84 (d, J=9.1Hz, 1H), 7.66 (dd, J=9.1,
2.6 Hz, 1H), 7.56-7.50 (m, 2H), 7.31 (d, J=2.6 Hz, 1H), 7.27-7.17
(m, 2H), 3.68 (q, J=6.9 Hz, 4H), 1.20 (t, J=7.0 Hz, 6H).
Example 61
1-(6-(4-Chlorophenoxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00070##
[0248] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.16CIN.sub.5O.sub.3, 435.1; m/z found, 436.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.74 (s, 1H),
8.98 (s, 1H), 8.09 (s, 1H), 7.87 (d, J=2.1Hz, 1H), 7.80 (d, J=9.0
Hz, 1H), 7.57 (dd, J=9.0, 2.5 Hz, 1H), 7.49-7.44 (m, 2H), 7.15-7.08
(m, 2H), 3.89 (s, 4H), 1.97 (t, J=6.3 Hz, 4H).
Example 62
1-(6-(4-Chlorophenoxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00071##
[0250] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.16CIN.sub.5O.sub.3, 421.0; m/z found, 422.0
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.78 (s, 1H),
9.06 (s, 1H), 8.66 (d, J=3.6 Hz, 1H), 8.12 (s, 1H), 8.04 (d,
J=2.1Hz, 1H), 7.82 (d, J=9.0 Hz, 1H), 7.58 (dd, J=9.0, 2.5 Hz, 1H),
7.50-7.43 (m, 2H), 7.14-7.06 (m, 2H), 3.26-3.15 (m, 1H), 0.91-0.83
(m, 2H), 0.73-0.67 (m, 2H).
Example 63
1-(6-(4-Chlorophenoxy)-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00072##
[0252] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and piperidine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.20CIN.sub.5O.sub.3, 449.1; m/z found, 450.1
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.78 (s, 1H),
8.99 (s, 1H), 8.11 (s, 1H), 7.88 (d, J=9.1Hz, 1H), 7.64 (dd, J=9.1,
2.6 Hz, 1H), 7.54-7.48 (m, 2H), 7.34 (d, J=2.5 Hz, 1H), 7.24-7.18
(m, 2H), 3.75 (d, J=5.3 Hz, 4H), 1.68 (s, 2H), 1.63 (d, J=3.7 Hz,
4H).
Example 64
1-(6-(4-Chlorophenoxy)-4-((cyclohexylmethyl)amino)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00073##
[0254] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and cyclohexylmethanamine in step E. MS (ESI): mass calcd.
for C.sub.25H.sub.24CIN.sub.5O.sub.3, 477.2; m/z found, 478.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.78 (s, 1H),
8.98 (s, 1H), 8.67 (s, 1H), 8.12 (s, 1H), 8.10 (d, J=2.6 Hz, 1H),
7.80 (d, J=9.0 Hz, 1H), 7.57 (dd, J=9.0, 2.6 Hz, 1H), 7.49-7.44 (m,
2H), 7.14-7.09 (m, 2H), 3.48 (t, J=5.9 Hz, 2H), 1.77 (d, J=11.7 Hz,
3H), 1.67 (t, J=16.5 Hz, 3H), 1.19 (t, J=11.0 Hz, 3H), 1.03 (t,
J=11.3 Hz, 2H).
Example 65
1-(6-(4-Chlorophenoxy)-4-(4-cyanopiperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid.
##STR00074##
[0256] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and 4-cyanopiperidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.19CIN.sub.6O.sub.3, 474.1; m/z found, 475.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
9.03 (s, 1H), 8.12 (s, 1H), 7.91 (d, J=9.1 Hz, 1H), 7.65 (dd,
J=9.1, 2.6 Hz, 1H), 7.53-7.49 (m, 2H), 7.42 (d, J=2.6 Hz, 1H),
7.22-7.17 (m, 2H), 4.08-3.92 (m, 2H), 3.70-3.55 (m, 2H), 3.27-3.18
(m, 1H), 2.03 (d, J=5.9 Hz, 2H), 1.88-1.72 (m, 2H).
Example 66
1-(4-(Azepan-1-yl)-6-(4-chlorophenoxy)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00075##
[0258] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and homopiperidine in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.22CIN.sub.5O.sub.3, 474.1; m/z found, 475.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
9.03 (s, 1H), 8.12 (s, 1H), 7.91 (d, J=9.1Hz, 1H), 7.65 (dd, J=9.1,
2.6 Hz, 1H), 7.53-7.49 (m, 2H), 7.42 (s, 1H), 7.22-7.17 (m, 2H),
4.08-3.92 (m, 2H), 3.70-3.55 (m, 2H), 3.27-3.18 (m, 1H), 2.03 (d,
J=5.9 Hz, 2H), 1.88-1.72 (m, 2H).
Example 67
1-(6-(4-Chlorophenoxy)-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid.
##STR00076##
[0260] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and thiomorpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.16CIN.sub.5O.sub.3S, 467.1; m/z found, 468.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 8.81 (s, 1H),
7.94 (s, 1H), 7.89 (d, J=9.1Hz, 1H), 7.64 (dd, J=9.1, 2.7 Hz, 1H),
7.55-7.47 (m, 2H), 7.34 (d, J=2.7 Hz, 1H), 7.24-7.17 (m, 2H),
4.04-3.95 (m, 4H), 2.82-2.73 (m, 4H).
Example 68
1-(6-(4-Chlorophenoxy)-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-
-1H-pyrazole-4-carboxylic acid.
##STR00077##
[0262] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and 4-aminotetrahydropyran in step E. MS (ESI): mass calcd.
for C.sub.23H.sub.20CIN.sub.5O.sub.4, 465.1; m/z found, 466.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.81 (s, 1H),
9.02 (s, 1H), 8.41 (d, J=7.3 Hz, 1H), 8.21 (s, 1H), 8.13 (s, 1H),
7.81 (d, J=9.1Hz, 1H), 7.59 (dd, J=8.9, 2.3 Hz, 1H), 7.50-7.43 (m,
2H), 7.15-7.04 (m, 2H), 4.62-4.43 (m, 1H), 3.94 (d, J=8.6 Hz, 2H),
3.49-3.44 (m, 2H), 1.95-1.82 (m, 2H), 1.68-1.52 (m, 2H).
Example 69
1-(6-(4-Chlorophenoxy)-4-(phenylamino)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00078##
[0264] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and aniline in step E. MS (ESI): mass calcd. for
C.sub.24H.sub.16CIN.sub.5O.sub.3, 457.1; m/z found, 458.1
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.78 (s, 1H),
10.16 (s, 1H), 8.83 (s, 1H), 8.39 (d, J=2.5 Hz, 1H), 8.13 (s, 1H),
7.92-7.85 (m, 3H), 7.67 (dd, J=9.0, 2.6 Hz, 1H), 7.53-7.43 (m, 4H),
7.22 (t, J=7.4 Hz, 1H), 7.19-7.12 (m, 2H).
Example 70
1-(4-(4-Acetamidopiperidin-1-yl)-6-(4-chlorophenoxy)quinazolin-2-yl)-1H-py-
razole-4-carboxylic acid.
##STR00079##
[0266] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and N-(piperidin-4-yl)acetamide in step E. MS (ESI): mass
calcd. for C.sub.25H.sub.23CIN.sub.6O.sub.4, 506.2; m/z found,
507.2 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.83 (s,
1H), 9.01 (s, 1H), 8.13 (s, 1H), 7.89 (dd, J=8.4, 4.7 Hz, 2H), 7.65
(dd, J=9.1, 2.6 Hz, 1H), 7.55-7.45 (m, 2H), 7.38 (d, J=2.5 Hz, 1H),
7.26-7.15 (m, 2H), 4.26 (d, J=13.4 Hz, 2H), 3.99-3.78 (m, 1H), 3.36
(d, J=11.4 Hz, 2H), 1.88 (d, J=9.9 Hz, 2H), 1.80 (s, 3H), 1.48 (dd,
J=20.8, 10.3 Hz, 2H).
Example 71
1-(6-(4-Chlorophenoxy)-4-(4-methyl-1,4-diazepan-1-yl)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid.
##STR00080##
[0268] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-(4-chloro)phenoxyaniline in
step B and N-methylhomopiperazine in step E. MS (ESI): mass calcd.
for C.sub.24H.sub.23CIN.sub.6O.sub.3, 484.2; m/z found, 479.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 13.04-11.93 (m,
1H), 9.03 (s, 1H), 8.13 (s, 1H), 7.88 (d, J=9.1Hz, 1H), 7.68 (d,
J=2.4 Hz, 1H), 7.63 (dd, J=9.1, 2.6 Hz, 1H), 7.54-7.43 (m, 2H),
7.18-7.10 (m, 2H), 4.05 (s, 3H), 3.47-3.32 (m, 3H), 3.29-3.14 (m,
2H), 2.74 (s, 3H), 2.28 (s, 2H).
Example 72
1-(4-(tert-Butylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00081##
[0270] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenoxyaniline in step B and
tert-butylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.3, 403.2; m/z found, 404.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.80 (s, 1H),
8.91 (s, 1H), 8.37 (d, J=2.6 Hz, 1H), 8.13 (s, 1H), 7.77 (d,
J=9.1Hz, 2H), 7.51 (dd, J=9.0, 2.6 Hz, 1H), 7.43-7.37 (m, 2H),
7.17-7.11 (m, 1H), 7.06-6.97 (m, 2H), 1.60 (s, 9H).
Example 73
1-(6-Phenoxy-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00082##
[0272] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenoxyaniline in step B and
pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.19N.sub.5O.sub.3, 401.2; m/z found, 402.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.74 (s, 1H),
8.99 (s, 1H), 8.09 (s, 1H), 7.83 (d, J=2.6 Hz, 1H), 7.81 (d, J=9.0
Hz, 1H), 7.56 (dd, J=9.0, 2.6 Hz, 1H), 7.47-7.40 (m, 2H), 7.22-7.16
(m, 1H), 7.13-7.08 (m, 2H), 3.88 (s, 4H), 1.96 (t, J=6.4 Hz,
4H).
Example 74
1-(4-(Diethylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00083##
[0274] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenoxyaniline in step B and
diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.3, 403.2; m/z found, 404.2
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.75 (s, 1H),
8.92 (s, 1H), 8.10 (s, 1H), 7.84 (d, J=9.1Hz, 1H), 7.65 (dd, J=9.1,
2.4 Hz, 1H), 7.50 (t, J=7.9 Hz, 2H), 7.27 (dd, J=8.9, 5.0 Hz, 2H),
7.21 (d, J=7.8 Hz, 2H), 3.65 (q, J=6.9 Hz, 4H), 1.15 (t, J=6.9 Hz,
6H).
Example 75
1-(4-(Cyclopropylamino)-6-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00084##
[0276] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenoxyaniline in step B and
cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.17N.sub.5O.sub.3, 387.1; m/z found, 388.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.83 (s, 1H),
9.08 (s, 1H), 8.80 (d, J=3.4 Hz, 1H), 8.15 (s, 1H), 8.11 (d, J=2.6
Hz, 1H), 7.83 (d, J=9.0 Hz, 1H), 7.55 (dd, J=9.0, 2.6 Hz, 1H), 7.45
-7.38 (m, 2H), 7.20-7.13 (m, 1H), 7.09-7.03 (m, 2H), 3.27-3.14 (m,
1H), 0.96-0.83 (m, 2H), 0.77-0.69 (m, 2H).
Example 76
1-(6-Phenoxy-4-((tetrahydro-2H-pyran-4-yl)amino)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid.
##STR00085##
[0278] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-phenoxyaniline in step B and
4-aminotetrahydropyran in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.21N.sub.5O.sub.4, 431.2; m/z found, 432.2
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 12.78 (s, 1H),
9.01 (s, 1H), 8.41 (d, J=7.4 Hz, 1H), 8.22 (d, J=2.5 Hz, 1H), 8.12
(s, 1H), 7.80 (d, J=9.0 Hz, 1H), 7.54 (dd, J=9.0, 2.6 Hz, 1H),
7.45-7.37 (m, 2H), 7.16 (t, J=7.4 Hz, 1H), 7.05 (dd, J=8.7, 1.0 Hz,
2H), 4.53 (dd, J=11.4, 4.1Hz, 1H), 3.94 (d, J=8.8 Hz, 2H),
3.53-3.47 (m, 2H), 2.00-1.90 (m, 2H), 1.72-1.63 (m, 2H).
Example 77
1-(4-(Dimethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00086##
[0280] Step A: Preparation of Ethyl
1-(N-(ethoxycarbonyl)-N'-(3-phenoxyphenyl)carbamimidoyl)-1H-pyrazole-4-ca-
rboxylate. To a mixture of 3-phenoxyaniline (0.93 g, 5.0 mmol) and
DCM (17 mL) neat ethyl isocyanatoformate (0.65 mL, 5.5 mmol) was
added and the resulting solution was stirred for 15 min. Ethyl
pyrazole-4-carboxylate (0.77 g, 5.5 mmol), and neat
diisopropylcarbodiimide (0.78 mL, 5.0 mmol) were added sequentially
to the reaction mixture. The solution was stirred at rt for 24 h,
and then concentrated. The residue was stirred with ether (10 mL)
for 3 h in an ice bath, and then filtered. The residue was purified
by FCC (0 to 25% EtOAc/hexanes) to yield the title compound (1.6 g,
76%, ca 70% purity). MS (ESI/Cl): mass calcd. for
C.sub.22H.sub.22N.sub.4O.sub.5, 422.1; m/z found, 423.3
[M+H].sup.+.
[0281] Step B: Preparation of ethyl
1-(4-oxo-7-phenoxy-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylate.
To a solution of ethyl
1-(N-(ethoxycarbonyI)-N'-(3-phenoxyphenyl)carbamimidoyl)-1H-pyrazole-4-ca-
rboxylate (1.51g, ca 2.51 mmol) in dichloroethane (DCE) (18 mL),
neat TiCl.sub.4 (1.18 mL, 10.7 mmol) was added over 2 min. The
mixture was then heated to reflux for 2 h, and then cooled in an
ice bath. EtOH (50 mL) was added, and the mixture was stirred for 3
h. The resulting precipitate was collected by filtration, washed
with cold EtOH, and dried to provide the titled compound (0.77 g,
57%). MS (ESI/Cl): mass calcd. for C.sub.20H.sub.16N.sub.4O.sub.4,
376.1; m/z found, 377.3 [M+H].sup.+. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): 12.85 (s, 1H), 9.00 (d, J=0.5 Hz, 1H), 8.31 (s, 1H),
8.13 (d, J=8.8 Hz, 1H), 7.58-7.45 (m, 2H), 7.38-7.27 (m, 1H),
7.26-7.20 (m, 2H), 7.18 (dd, J=8.8, 2.4 Hz,1H), 6.98 (s, 1H),
4.39-4.13 (m, 2H), 1.42-1.21 (m, 3H).
[0282] Step C: Preparation of ethyl
1-(4-chloro-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylate. A
mixture of the above ethyl
1-(4-oxo-7-phenoxy-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylate
(0.31 g,0.82 mmol), and POCl.sub.3 (3.08 mL, 32.9 mmol), was heated
to reflux for 3 h. The mixture was allowed to cool to rt and then
concentrated. The residue was taken up in a minimal amount of DCM
and purified by FCC (0 to 25% EtOAc/hexanes) to yield the title
compound (250 mg, 77%). .sup.1H NMR (600 MHz, DMSO-d.sub.6): 9.06
(d, J=0.7 Hz, 1H), 8.35 (d, J=9.2 Hz, 1H), 8.23 (dd, J=10.6, 6.6
Hz, 1H), 7.63-7.59 (m, 1H), 7.60-7.54 (m, 2H), 7.41-7.36 (m, 1H),
7.31-7.29 (m, 2H), 7.18 (d, J=2.4 Hz, 1H), 4.30 (q, J=7.1Hz, 2H),
1.35-1.24 (t, J=7.2 Hz, 3H).
[0283] Step D: Preparation of ethyl
1-(4-(dimethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylate.
A THF solution of dimethylamine (2M, 0.44 mL, 0.88 mmol) was added
to a solution of the above ethyl
1-(4-chloro-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylate (70
mg, 0.18 mmol) and THF (1.4 mL). The mixture was stirred 1 h, and
then concentrated. The residue was triturated with ethanol,
providing the titled compound (45 mg, 63%). MS (ESI/CI): mass
calcd. for C.sub.22H.sub.21N.sub.5O.sub.3, 403.1; m/z found, 404.3
[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.02 (s, 1H),
8.31 (d, J=9.3 Hz, 1H), 8.12 (s, 1H), 7.53 (dd, J=11.1, 4.8 Hz,
2H), 7.32 (t, J=7.4 Hz, 1H), 7.27-7.21 (m, 2H), 7.18 (dd, J=9.3,
2.7 Hz, 1H), 6.96 (d, J=2.7 Hz, 1H), 4.27 (q, J=7.1Hz, 2H), 3.46
(s, 6H), 1.30 (t, J=7.1Hz, 3H).
[0284] Step E: Preparation of
1-(4-(dimethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid. A mixture of ethyl
1-(4-(dimethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylate
(35 mg, 0.09 mmol), 1M aqueous KOH (0.43 mL, 0.43 mmol), and THF
(1.3 mL) was heated to 40.degree. C. for 48 h with rapid stirring.
The mixture was then concentrated, cooled in an ice bath, and 1M
aqueous HCl was added until the mixture was slightly acidic (pH ca
5-6). The resulting precipitate was collected by filtration, washed
with water, and dried to furnish the titled compound (22 mg, 68%).
MS (ESI): mass calcd. for C.sub.20H.sub.17N.sub.5O.sub.3, 375.1;
m/z found, 376.3 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6):
12.73 (s, 1H), 8.98 (d, J=0.6 Hz, 1H), 8.31 (d, J=9.3 Hz, 1H), 8.07
(s, 1H), 7.52 (ddd, J=7.6, 5.9, 2.2 Hz, 2H), 7.36-7.28 (m, 1H),
7.28-7.20 (m, 2H), 7.17 (dd, J=9.3, 2.7 Hz, 1H), 6.97 (d, J=2.7 Hz,
1H), 3.46 (s, 6H).
Example 78
1-(7-Phenoxy-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00087##
[0286] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and pyrrolidine in step
D. MS (ESI): mass calcd. for C.sub.22H.sub.19N.sub.5O.sub.3, 401.1;
m/z found, 402.3 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6):
12.72 (s, 1H), 8.97 (d, J=0.6 Hz, 1H), 8.38 (d, J=9.3 Hz, 1H), 8.06
(d, J=0.6 Hz, 1H), 7.56-7.46 (m, 2H), 7.35-7.27 (m, 1H), 7.26-7.19
(m, 2H), 7.16 (dd, J=9.3, 2.7 Hz, 1H), 6.97 (d, J=2.7 Hz, 1H), 3.97
(s, 4H), 2.01 (s, 4H).
Example 79
1-(7-Phenoxy-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00088##
[0288] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and piperidine in step
D. MS (ESI): mass calcd. for C.sub.23H.sub.21N.sub.5O.sub.3, 415.1;
m/z found, 416.3 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6):
12.74 (s, 1H), 8.97 (d, J=0.7 Hz, 1H), 8.08 (d, J=0.7 Hz, 1H), 8.04
(d, J=9.2 Hz, 1H), 7.56-7.49 (m, 2H), 7.32 (t, J=7.4 Hz, 1H),
7.25-7.21 (m, 3H), 6.99 (d, J=2.6 Hz, 1H), 3.86 (s, 4H), 1.74 (s,
6H).
Example 80
1-(4-(Dimethylamino)-7-phenylquinazolin-2-yl)-1H-pyrazole-4-arboxylic
acid.
##STR00089##
[0290] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenylaniline in step A and dimethylamine in
step D. MS (ESI): mass calcd. for C.sub.20H.sub.17N.sub.5O.sub.2,
359.1; m/z found, 360.3 [M+H].sup.+. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): 9.13 (d, J=0.5 Hz, 1H), 8.40 (d, J=8.8 Hz, 1H), 8.24
(s, 1H), 8.15 (d, J=1.9 Hz, 1H), 7.89-7.81 (m, 3H), 7.59-7.48 (m,
2H), 7.53-7.44 (m, 1H), 3.59 (s, 6H).
Example 81
1-(7-Phenyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00090##
[0292] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenylaniline in step A and pyrrolidine in step
D. MS (ESI): mass calcd. for C.sub.22H.sub.19N.sub.5O.sub.2, 385.1;
m/z found, 386.3 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
9.08 (d, J=0.5 Hz, 1H), 8.45 (d, J=8.9 Hz, 1H), 8.21 (s, 1H), 8.12
(d, J=1.8 Hz, 1H), 7.90-7.78 (m, 3H), 7.62-7.53 (m, 2H), 7.53-7.45
(m, 1H), 4.07 (s, 4H), 2.05 (s, 4H).
Example 82
1-(7-Phenyl-4-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00091##
[0294] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenylaniline in step A and piperidine in step
D. MS (ESI): mass calcd. for C.sub.23H.sub.21N.sub.5O.sub.2, 399.1;
m/z found, 400.3 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
12.80 (s, 1H), 9.03 (d, J=0.5 Hz, 1H), 8.13 (d, J=0.5 Hz, 1H), 8.10
(d, J=8.7 Hz, 1H), 8.06 (d, J=1.9 Hz, 1H), 7.89-7.80 (m, 3H),
7.60-7.52 (m, 2H), 7.51-7.45 (m, 1H), 3.92 (s, 4H), 1.77 (s,
6H).
Example 83
1-(4-(Diethylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00092##
[0296] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and diethylamine in
step D. MS (ESI): mass calcd. for C.sub.22H.sub.21N.sub.5O.sub.3,
403.1; m/z found, 404.3 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 8.91 (d, J=0.7 Hz, 1H), 8.09-8.07 (m, 2H), 7.56-7.48
(m, 2H), 7.35-7.28 (m, 1H), 7.25-7.22 (m, 2H), 7.20 (dd, J=9.3, 2.7
Hz, 1H), 6.99 (d, J=2.7 Hz, 1H), 3.82 (q, J=7.0 Hz, 4H), 1.38 (t,
J=7.0 Hz, 6H).
Example 84:
1-(4-((Cyclohexylmethyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00093##
[0298] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and
cyclohexylmethanamine in step D. MS (ESI): mass calcd. for
C.sub.25H.sub.25N.sub.5O.sub.3, 443.2; m/z found, 444.4
[M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6): 12.74 (s, 1H),
8.96 (s, 1H), 8.75 (s, 1H), 8.38 (d, J=9.1Hz, 1H), 8.09 (s, 1H),
7.56-7.46 (m, 2H), 7.30 (t, J=7.4 Hz, 1H), 7.26 (dd, J=9.0, 2.5 Hz,
1H), 7.21 (dd, J=8.6, 1.0 Hz, 2H), 6.98 (d, J=2.4 Hz, 1H), 3.51 (t,
J=6.0 Hz, 2H), 1.80-1.62 (m, 7H), 1.27-1.11 (m, 2H), 1.04 (m,
2H).
Example 85
1-(4-(4-lsopropylpiperidin-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00094##
[0300] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and
4-isopropylpiperidine in step D. MS (ESI): mass calcd. for
C.sub.26H.sub.27N.sub.5O.sub.3, 457.2; m/z found, 458.4
[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6): 12.75 (s, 1H),
8.97 (d, J=0.7 Hz, 1H), 8.08 (d, J=0.7 Hz, 1H), 8.06 (d, J=9.2 Hz,
1H), 7.57-7.48 (m, 2H), 7.34-7.31 (m, 1H), 7.24-7.23 (m, 3H), 6.99
(d, J=2.6 Hz, 1H), 4.54 (d, J=13.0 Hz, 2H), 3.22 (t, J=12.0 Hz,
2H), 1.84 (d, J=9.8 Hz, 2H), 1.56-1.33 (m, 4H), 0.91 (d, J=6.6 Hz,
6H)
Example 86
1-(4-(Cyclopropylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00095##
[0302] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and cyclopropylamine in
step D. MS (ESI): mass calcd. for C.sub.21H.sub.17N.sub.5O.sub.3,
387.1; m/z found, 388.3 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 12.74 (s, 1H), 9.01 (s, 1H), 8.64 (d, J=3.9 Hz, 1H),
8.31 (d, J=9.1Hz, 1H), 8.06 (s, 1H), 7.55-7.45 (m, 2H), 7.31-7.29
(m, 1H), 7.24 (dd, J=9.0, 2.5 Hz, 1H), 7.22-7.19 (m, 2H), 6.95 (d,
J=2.5 Hz, 1H), 3.25-3.20 (m, 1H), 0.93-0.84 (m, 2H), 0.76-0.69 (m,
2H).
Example 87
1-(4-(Azepan-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00096##
[0304] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and homopiperidine in
step D. MS (ESI): mass calcd. for C.sub.24H.sub.23N.sub.5O.sub.3,
429.1; m/z found, 430.3 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 12.72 (s, 1H), 8.92 (s, 1H), 8.21 (d, J=9.3 Hz, 1H),
8.06 (s, 1H), 7.56-7.47 (m, 2H), 7.31 (t, J=7.4 Hz, 1H), 7.23 (dd,
J=8.5, 0.9 Hz, 2H), 7.16 (dd, J=9.3, 2.7 Hz, 1H), 6.97 (d, J=2.7
Hz, 1H), 4.08-3.94 (m, 4H), 1.95 (s, 4H), 1.58 (s, 4H).
Example 88
1-(4-(Diethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00097##
[0306] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 4-piperidin-1-yl-aniline in step A and
diethylamine in step D. MS (ESI): mass calcd. for
C.sub.21H.sub.26N.sub.6O.sub.2, 394.2; m/z found, 395.3
[M+H].sup.+. 1H NMR (400 MHz, DMSO-d.sub.6): 8.89 (s, 1H), 8.06 (s,
1H), 7.65 (br s, 2H), 7.18 (s, 1H), 3.78 (q, J=7.0 Hz, 4H),
3.28-3.23 (m, 4H), 1.72-1.64 (m, 4H), 1.62-1.54 (m, 2H), 1.40 (t,
J=7.0 Hz, 6H).
Example 89
1-(4-Morpholino-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00098##
[0308] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy aniline in step A and morpholine in step
D. MS (ESI): mass calcd. for C.sub.22H.sub.19N.sub.5O.sub.4, 417.1;
m/z found, 418.1 [M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6):
9.02 (s, 1H), 8.13-8.12 (m,1H), 8.11 (s, 1H), 7.59-7.45 (m, 2H),
7.33 (t, J=7.4 Hz, 1H), 7.28-7.18 (m, 3H), 7.04 (d, J=2.5 Hz, 1H),
3.94-3.92 (m, 4H), 3.88-3.76 (m, 4H).
Example 90
1-(7-Phenoxy-4-thiomorpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00099##
[0310] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy aniline in step A and thiomorpholine in
step D. MS (ESI): mass calcd. for C.sub.22H.sub.19N.sub.5O.sub.3S,
433.1; m/z found, 434.1 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 9.04-8.97 (m, 1H), 8.10 (s, 1H), 8.05 (d, J=9.2 Hz,
1H), 7.58-7.48 (m, 2H), 7.36-7.29 (m, 1H), 7.28-7.20 (m, 3H), 7.05
(d, J=2.5 Hz, 1H), 4.22-4.08 (m, 4H), 2.96-2.86 (m, 4H).
Example 91
1-(4-(4-Fluoropiperidin-1-yl)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid.
##STR00100##
[0312] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy aniline in step A and 4-fluoropiperidine
in step D. MS (ESI): mass calcd. for
C.sub.23H.sub.20FN.sub.5O.sub.3, 433.2; m/z found, 434.1
[M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6): 9.02 (s, 1H),
8.14-8.09 (m, 2H), 7.58-7.48 (m, 2H), 7.37-7.30 (m, 1H), 7.27-7.20
(m, 3H), 7.06 (d, J=2.5 Hz, 1H), 5.14-4.92 (m, 1H), 4.06-3.65 (m,
4H), 2.23-2.03 (m, 2H), 1.97-1.92 (m, 2H).
Example 92
1-(4-(Dibutylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00101##
[0314] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy aniline in step A and dibutylamine in
step D. MS (ESI): mass calcd. for C.sub.26H.sub.29N.sub.5O.sub.3,
459.2; m/z found, 460.2 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 8.91 (s, 1H), 8.10 (s, 1H), 8.04 (d, J=9.3 Hz, 1H),
7.57-7.48 (m, 2H), 7.37-7.28 (m, 1H), 7.24-7.22 (m, 3H), 7.04 (d,
J=2.3 Hz, 1H), 3.80-3.77 (m, 4H), 1.79 (dt, J=15.3, 7.7 Hz, 4H),
1.44-1.38 (m, 4H), 0.96 (t, J=7.4 Hz, 6H).
Example 93
1-(4-(Dipropylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00102##
[0316] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy aniline in step A and dipropylamine in
step D. MS (ESI): mass calcd. for C.sub.24H.sub.25N.sub.5O.sub.3,
431.2; m/z found, 432.2 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 8.91 (s, 1H), 8.10 (s, 1H), 8.03 (d, J=9.2 Hz, 1H),
7.56-7.47 (m, 2H), 7.32 (t, J=7.4 Hz, 1H), 7.23 (dd, J=8.6, 1.0 Hz,
3H), 7.04 (s, 1H), 3.77-3.74 (m, 4H), 1.93-1.70 (m, 4H), 0.98-0.96
(m, 6H).
Example 94
1-(4-(Ethyl(methyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid.
##STR00103##
[0318] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy niline in step A and N-methylethylamine
in step D. MS (ESI): mass calcd. for
C.sub.21H.sub.19N.sub.5O.sub.3, 389.2; m/z found, 390.1
[M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6): 8.97 (s, 1H),
8.26 (d, J=9.1Hz, 1H), 8.11 (s, 1H), 7.59-7.43 (m, 2H), 7.37-7.29
(m, 1H), 7.24-7.22 (m, 2H), 7.20-7.18 (m, 1H), 7.05 (s, 1H),
3.90-3.87 (m, 2H), 3.47 (s, 3H), 1.35 (t, J=7.1Hz, 3H).
Example 95
1-(4-((2-Methoxyethyl)(methyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid.
##STR00104##
[0320] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxy aniline in step A and 2-methoxy-N-methyl
ethylamine in step D. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.4, 419.2; m/z found, 420.1
[M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6): 8.98 (s, 1H),
8.36 (d, J=9.2 Hz, 1H), 8.10 (s, 1H), 7.57-7.47 (m, 2H), 7.37-7.29
(m, 1H), 7.27-7.21 (m, 2H), 7.18 (dd, J=9.3, 2.5 Hz, 1H), 7.04 (s,
1H), 4.07 (t, J=5.5 Hz, 2H), 3.77-3.74 (m, 2H), 3.53 (s, 3H), 3.31
(s, 3H).
Example 96
1-(7-Bromo-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00105##
[0322] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-bromoaniline in step A and diethylamine in step
D. MS (ESI): mass calcd. for C.sub.16H.sub.16BrN.sub.5O.sub.2,
389.1; m/z found, 390.0 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 12.75 (s, 1H), 8.94 (d, J=0.7 Hz, 1H), 8.11 (d,
J=0.7 Hz, 1H), 7.97 (s, 1H), 7.96 (d, J=2.0 Hz, 2H), 3.83 (q, J=7.0
Hz, 4H), 1.44-1.33 (m, 6H).
Example 97
1-(4-(Cyclohexylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00106##
[0324] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and cyclohexylamine in
step D. MS (ESI): mass calcd. for C.sub.24H.sub.23N.sub.5O.sub.3,
429.2; m/z found, 430.1 [M+H].sup.+. .sup.1H NMR (600 MHz,
DMSO-d.sub.6): 8.97 (s, 1H), 8.49-8.45 (m, 2H), 8.11 (s, 1H), 7.51
(t, J=7.9 Hz, 2H), 7.30 (t, J=7.4 Hz, 1H), 7.26 (d, J=9.1Hz, 1H),
7.20 (d, J=7.7 Hz, 2H), 7.01 (s, 1H), 4.30 (s, 1H), 2.05-2.00 (m,
2H), 1.82-1.80 (m, 2H), 1.70-1.68 (m, 1H), 1.52-1.36 (m, 4H),
1.29-1.13 (m, 1H).
Example 98
1-(4-((Cyclopropylmethyl)amino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00107##
[0326] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and
cyclopropylmethylamine in step D. MS (ESI): mass calcd. for
C.sub.22H.sub.19N.sub.5O.sub.3, 401.2; m/z found, 402.1
[M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6): 8.99 (s, 1H),
8.92 (s, 1H), 8.38 (d, J=8.5 Hz, 1H), 8.10 (s, 1H), 7.56-7.45 (m,
2H), 7.33-7.29 (m, 1H), 7.27 (d, J=9.0 Hz, 1H), 7.21 (dd, J=8.5,
1.0 Hz, 2H), 7.00 (s, 1H), 3.72-3.28 (m, 2H), 1.33-1.14 (m, 1H),
0.58-0.46 (m, 2H), 0.43-0.32 (m, 2H).
Example 99
1-(4-(tert-Butylamino)-7-phenoxyquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00108##
[0328] The titled compound was prepared in a manner analogous to
EXAMPLE 77 using 3-phenoxyaniline in step A and
2-methylpropan-2-amine in step D. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.3, 403.2; m/z found, 404.2
[M+H].sup.+. .sup.1H NMR (600 MHz, DMSO-d.sub.6): 8.87 (d, J=0.7
Hz, 1H), 8.51 (d, J=9.1Hz, 1H), 8.11 (d, J=0.6 Hz, 1H), 7.83 (s,
1H), 7.56-7.44 (m, 2H), 7.32-7.28 (m, 1H), 7.24 (dd, J=9.1, 2.6 Hz,
1H), 7.22-7.18 (m, 2H), 6.97 (d, J=2.5 Hz, 1H), 1.61 (s, 9H).
Example 100
1-(7-Fluoro-6-(cyclohexyloxy)-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00109##
[0330] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-fluoro-4-cyclohexyloxyaniline
in step B and morpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.24FN.sub.5O.sub.4, 441.5; m/z found, 442.3 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.68 (s, 1H), 9.00 (s, 1H), 8.10 (s,
1H), 7.68 (d, J=12.0 Hz, 1H), 7.49 (d, J=9.1Hz, 1H), 4.58 (s, 1H),
3.87 (s, 4H), 3.82 (s, 4H), 1.97 (s, 2H), 1.74 (s, 2H), 1.65-1.29
(m, 6H).
Example 101
1-(7-fluoro-6-(cyclohexyloxy)-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid.
##STR00110##
[0332] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-fluoro-4-cyclohexyloxyaniline
in step B and dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.20H.sub.22FN.sub.5O.sub.3, 399.4; m/z found, 400.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H), 8.97 (s, 1H), 8.08 (s,
1H), 7.74 (d, J=8.7 Hz, 1H), 7.59 (d, J=11.7 Hz, 1H), 4.56 (s, 1H),
3.43 (s, 6H), 1.98 (s, 2H), 1.74 (s, 2H), 1.64-1.25 (m, 6H).
Example 102
1-(7-fluoro-6-(cyclohexyloxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid.
##STR00111##
[0334] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-fluoro-4-cyclohexyloxyaniline
in step B and diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.26FN.sub.5O.sub.3, 427.5; m/z found, 428.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.78 (s, 1H), 8.92 (s, 1H), 8.10 (s,
1H), 7.62 (d, J=12.1Hz, 1H), 7.48 (d, J=8.8 Hz, 1H), 4.49 (s, 1H),
3.79 (q, J=6.4 Hz, 4H), 2.03 (s, 2H), 1.76 (s, 2H), 1.64-1.26 (m,
12H).
Example 103
1-(7-fluoro-6-(cyclohexyloxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid.
##STR00112##
[0336] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-fluoro-4-cyclohexyloxyaniline
in step B and pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.24FN.sub.5O.sub.3, 425.5; m/z found, 426.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.73 (s, 1H), 8.96 (s, 1H), 8.07 (s,
1H), 7.84 (d, J=9.1Hz, 1H), 7.56 (d, J=12.1Hz, 1H), 4.53 (s, 1H),
3.98 (s, 4H), 2.01 (s, 6H), 1.74 (s, 2H), 1.63-1.27 (m, 6H).
Example 104:
1-(7-fluoro-6-(cyclohexyloxy)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid.
##STR00113##
[0338] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-fluoro-4-cyclohexyloxyaniline
in step B and N-ethyl-N-methylamine in step E. MS (ESI): mass
calcd. for C.sub.21H.sub.24FN.sub.5O.sub.3, 413.5; m/z found, 414.1
[M+H]+. 1H NMR (400 MHz, DMSO-d.sub.6): 12.81 (s, 1H), 8.94 (s,
1H), 8.08 (s, 1H), 7.64-7.58 (m, 2H), 4.53 (s, 1H), 3.80 (q, J=6.5
Hz, 2H), 3.39 (s, 3H), 2.00 (s, 2H), 1.74 (s, 2H), 1.64-1.26 (m,
9H).
Example 105
1-(7-fluoro-6-(cyclohexyloxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00114##
[0340] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-fluoro-4-cyclohexyloxyaniline
in step B and cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.22FN.sub.5O.sub.3, 411.4; m/z found, 412.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 8.96 (s, 1H), 8.61 (s, 1H), 8.03 (s,
1H), 7.94 (d, J=8.9 Hz, 1H), 7.55 (d, J=12.1Hz, 1H), 4.55 (s, 1H),
3.19-3.07 (m, 1H), 1.95 (s, 2H), 1.74 (s, 2H), 1.64-1.26 (m, 6H),
0.97-0.85 (m, 2H), 0.77-0.67 (m, 2H).
Examples 106-135 are prophetic Examples which may be synthesized
using the general schemes provided above.
Example 106:
1-(6-Benzyl-7-fluoro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00115##
[0342] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and morpholine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20FN.sub.5O.sub.3, 433.2
Example 107:
1-(6-Benzyl-4-(dimethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid.
##STR00116##
[0344] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and dimethylamine in step E. MS (ESI): predicted
mass calcd. for C.sub.21H.sub.18FN.sub.5O.sub.2, 391.1
Example 108
1-(6-Benzyl-4-(diethylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00117##
[0346] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and diethylamine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.22FN.sub.5O.sub.2, 419.2
Example 109
1-(6-Benzyl-7-fluoro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid.
##STR00118##
[0348] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and pyrrolidine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20FN.sub.5O.sub.2, 417.2
Example 110
1-(6-Benzyl-4-(ethyl(methyl)amino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00119##
[0350] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and N-methylethanamine in step E. MS (ESI):
predicted mass calcd. for C.sub.22H.sub.20FN.sub.5O.sub.2,
405.2
Example 111
1-(6-Benzyl-4-(cyclopropylamino)-7-fluoroquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00120##
[0352] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and cyclopropyl amine in step E.MS (ESI):
predicted mass calcd. for C.sub.22H.sub.18FN.sub.5O.sub.2,
403.1
Example 112
1-(6-((2,6-Dimethylbenzyl)amino)-7-fluoro-4-morpholinoquinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid.
##STR00121##
[0354] The above compound may be made analogous to Example 1 using
ethyl
1464(2,6-dimethylbenzyl)amino)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-yl)-
-1H-pyrazole-4-carboxylate in step D and morpholine in step E. MS
(ESI): predicted mass calcd. for C.sub.25H.sub.25FN.sub.6O.sub.3,
476.2
Example 113
1-(4-(Dimethylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin-2-yl-
)-1H-pyrazole-4-carboxylic acid.
##STR00122##
[0356] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and dimethylamine in step E.
MS (ESI): predicted mass calcd. for
C.sub.23H.sub.23FN.sub.6O.sub.2, 434.2
Example 114
1-(4-(Diethylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin-2-yl)-
-1H-pyrazole-4-carboxylic acid.
##STR00123##
[0358] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and diethylamine in step E.
MS (ESI): predicted mass calcd. for
C.sub.25H.sub.27FN.sub.6O.sub.2, 462.2
Example 115
1
1-(6-((2,6-Dimethylbenzyl)amino)-7-fluoro-4-(pyrrolidin-1-yl)quinazolin--
2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00124##
[0360] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and pyrrolidine in step E.
MS (ESI): predicted mass calcd. for
C.sub.25H.sub.25FN.sub.6O.sub.2, 460.2
Example 116
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)-7-fluoroquinazolin-
-2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00125##
[0362] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and N-methylethanamine in
step E. MS (ESI): predicted mass calcd. for
C.sub.24H.sub.25FN.sub.6O.sub.2, 448.2
Example 117
1-(4-(Cyclopropylamino)-6-((2,6-dimethylbenzyl)amino)-7-fluoroquinazolin-2-
-yl)-1H-pyrazole-4-carboxylic acid.
##STR00126##
[0364] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-fluoro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and cyclopropyl amine in
step E. MS (ESI): predicted mass calcd. for
C.sub.24H.sub.23FN.sub.6O.sub.2, 446.2
Example 118
1-(7-Fluoro-4-morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid.
##STR00127##
[0366] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and morpholine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20FN.sub.5O.sub.3, 433.2
Example 119
1-(4-(Dimethylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00128##
[0368] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and dimethylamine in step E.MS (ESI):
predicted mass calcd. for C.sub.21H.sub.18FN.sub.5O.sub.2,
391.1
Example 120
1-(4-(Diethylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid.
##STR00129##
[0370] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and diethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.23H.sub.22FN.sub.5O.sub.2,
419.2
Example 121
1-(7-Fluoro-4-(pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00130##
[0372] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and pyrrolidine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20FN.sub.5O.sub.2, 417.2
Example 122
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid.
##STR00131##
[0374] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and N-methylethanamine in step E. MS (ESI):
predicted mass calcd. for C.sub.22H.sub.20FN.sub.5O.sub.2,
405.2
Example 123
1-(4-(Cyclopropylamino)-7-fluoro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid.
##STR00132##
[0376] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and cyclopropyl amine in step E. MS (ESI):
predicted mass calcd. for C.sub.22H.sub.18FN.sub.5O.sub.2,
403.1
Example 124
1-(7-Fluoro-6-isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid.
##STR00133##
[0378] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-6-isopropyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and morpholine in step E. MS (ESI): predicted
mass calcd. for C.sub.19H.sub.20FN.sub.5O.sub.3, 385.2
Example 125
1-(4-(Dimethylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00134##
[0380] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-6-isopropyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and dimethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.17H.sub.15FN.sub.5O.sub.2,
343.1
Example 126
1-(4-(Diethylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid.
##STR00135##
[0382] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-6-isopropyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and diethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.19H.sub.22FN.sub.5O.sub.2,
371.2
Example 127
1-(7-Fluoro-6-isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00136##
[0384] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-6-isopropyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and pyrrolidine in step E. MS (ESI): predicted
mass calcd. for C.sub.19H.sub.20FN.sub.5O.sub.2, 369.2
Example 128
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid.
##STR00137##
[0386] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-6-isopropyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and N-methylethanamine in step E. MS (ESI):
predicted mass calcd. for C.sub.18H.sub.20FN.sub.5O.sub.2,
357.2
Example 129
1-(4-(Cyclopropylamino)-7-fluoro-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid.
##STR00138##
[0388] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-6-isopropyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and cyclopropyl amine in step E. MS (ESI):
predicted mass calcd. for C.sub.18H.sub.18FN.sub.5O.sub.2,
355.1
Example 130
1-(7-Fluoro-4-morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00139##
[0390] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and morpholine in step E. MS (ESI):
predicted mass calcd. for 0.sub.21H.sub.23FN.sub.6O.sub.3,
426.2
Example 131
1-(4-(Dimethylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid.
##STR00140##
[0392] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and dimethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.19H.sub.21FN.sub.6O.sub.2,
384.2
Example 132
1-(4-(Diethylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid.
##STR00141##
[0394] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and diethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.21H.sub.25FN.sub.6O.sub.2,
412.2
Example 133
1-(7-Fluoro-6-(piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00142##
[0396] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and pyrrolidine in step E. MS (ESI):
predicted mass calcd. for C.sub.21H.sub.23FN.sub.6O.sub.2,
410.2
Example 134
1-(4-(Ethyl(methyl)amino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid.
##STR00143##
[0398] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and N-methylethanamine in step E. MS
(ESI): predicted mass calcd. for C.sub.20H.sub.23FN.sub.6O.sub.2,
398.2
Example 135
1-(4-(Cyclopropylamino)-7-fluoro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid.
##STR00144##
[0400] The above compound may be made analogous to Example 1 using
ethyl
1-(7-fluoro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and cyclopropylamine in step E. MS
(ESI): predicted mass calcd. for C.sub.20H.sub.21FN.sub.6O.sub.2,
396.2
Example 136
1-(7-chloro-6-(cyclohexyloxy)-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00145##
[0402] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-cyclohexyloxyaniline
in step B and morpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.24CIN.sub.5O.sub.4, 457.9; m/z found, 458.1 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 8.88 (s, 1H), 8.01 (s, 1H), 7.94
(s, 1H), 7.43 (s, 1H), 4.65 (s, 1H), 3.87 (s, 4H), 3.83 (s, 4H),
1.94 (s, 2H), 1.75 (s, 2H), 1.70-1.33 (m, 6H).
Example 137
1-(7-chloro-6-(cyclohexyloxy)-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid.
##STR00146##
[0404] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-cyclohexyloxyaniline
in step B and dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.20H.sub.22CIN.sub.5O.sub.3, 415.9; m/z found, 416.1 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H), 8.98 (s, 1H), 8.08
(s, 1H), 7.88 (s, 1H), 7.69 (s, 1H), 4.64 (s, 1H), 3.44 (s, 6H),
1.95 (s, 2H), 1.83-1.35 (m, 8H).
Example 138
1-(7-chloro-6-(cyclohexyloxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid.
##STR00147##
[0406] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-cyclohexyloxyaniline
in step B and diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.26C1N.sub.5O.sub.3, 443.9; m/z found, 444.2 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H), 8.91 (s, 1H), 8.09
(s, 1H), 7.89 (s, 1H), 7.43 (s, 1H), 4.54 (s, 1H), 3.80 (q, J=6.6
Hz, 4H), 1.99 (s, 2H), 1.77 (s, 2H), 1.68-1.50 (m, 3H), 1.48-1.33
(m, 9H).
Example 139
1-(7-chloro-6-(cyclohexyloxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid
##STR00148##
[0408] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-cyclohexyloxyaniline
in step B and pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.24C1N.sub.5O.sub.3, 441.9; m/z found, 442.2 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 8.96 (s, 1H), 8.07 (s, 1H), 7.84
(s, 1H), 7.78 (s, 1H), 4.61 (s, 1H), 3.99 (s, 4H), 2.10-1.88 (m,
6H), 1.83-1.32 (m, 8H).
Example 140
1-(7-chloro-6-(cyclohexyloxy)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-py-
razole-4-carboxylic acid.
##STR00149##
[0410] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-cyclohexyloxyaniline
in step B and N-ethyl-N-methylamine in step E. MS (ESI): mass
calcd. for 0.sub.21H.sub.24CIN.sub.5O.sub.3, 429.9; m/z found,
430.1 [M+H]+. 1H NMR (400 MHz, DMSO-d.sub.6): 8.94 (s, 1H), 8.08
(s, 1H), 7.86 (s, 1H), 7.56 (s, 1H), 4.65-4.54 (m, 1H), 3.81 (q,
J=7.5 Hz, 2H), 3.40 (s, 3H), 1.96 (s, 2H), 1.75 (s, 2H), 1.68-1.36
(m, 9H).
Example 141
1-(7-chloro-6-(cyclohexyloxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00150##
[0412] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-cyclohexyloxyaniline
in step B and cyclopropylamine in step E. MS (ESI): mass calcd. for
0.sub.21H.sub.22CIN.sub.5O.sub.3, 428.1; m/z found, 442.2 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 12.75 (s, 1H), 9.01 (s, 1H), 8.68
(s, 1H), 8.09 (s, 1H), 7.88 (s, 1H), 7.84 (s, 1H), 4.65 (s, 1H),
3.17 (s, 1H), 1.91 (s, 2H), 1.76 (s, 2H), 1.69-1.37 (m, 6H),
0.95-0.89 (m, 2H), 0.73 (s, 2H).
Examples 142-159 are prophetic Examples which may be synthesized
using the general schemes provided above.
Example 142
1-(6-Benzyl-7-chloro-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00151##
[0414] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and morpholine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20CIN.sub.5O.sub.3, 449.9
Example 143
1-(6-Benzyl-4-(dimethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00152##
[0416] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and dimethylamine in step E. MS (ESI): predicted
mass calcd. for C.sub.21H.sub.18CIN.sub.5O.sub.2, 407.9
Example 144
1-(6-Benzyl-4-(diethylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00153##
[0418] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and diethylamine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.22CIN.sub.5O.sub.2, 435.9
Example 145
1-(6-Benzyl-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid.
##STR00154##
[0420] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and pyrrolidine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20CIN.sub.5O.sub.2, 433.9
Example 146
1-(6-Benzyl-4-(ethyl(methyl)amino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00155##
[0422] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and N-methylethanamine in step E. MS (ESI):
predicted mass calcd. for C.sub.22H.sub.20CIN.sub.5O.sub.2,
421.9
Example 147
1-(6-Benzyl-4-(cyclopropylamino)-7-chloroquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00156##
[0424] The above compound may be made analogous to Example 1 using
ethyl
1-(6-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carb-
oxylate in step D and cyclopropyl amine in step E.MS (ESI):
predicted mass calcd. for C.sub.22H.sub.16CIN.sub.5O.sub.2,
419.9
Example 148
1-(6-((2,6-Dimethylbenzyl)amino)-7-chloro-4-morpholinoquinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid.
##STR00157##
[0426] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-chloro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and morpholine in step E. MS
(ESI): predicted mass calcd. for C.sub.25H.sub.25CIN.sub.6O.sub.3,
492.9
Example 149
1-(4-(Dimethylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin-2-yl-
)-1H-pyrazole-4-carboxylic acid.
##STR00158##
[0428] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-chloro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and dimethylamine in step E.
MS (ESI): predicted mass calcd. for
C.sub.23H.sub.23CIN.sub.6O.sub.2, 450.9
Example 150
1-(4-(Diethylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin-2-yl)-
-1H-pyrazole-4-carboxylic acid.
##STR00159##
[0430] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-chloro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and diethylamine in step E.
MS (ESI): predicted mass calcd. for
C.sub.25H.sub.27CIN.sub.6O.sub.2, 479.0
Example 151
1-(6-((2,6-Dimethylbenzyl)amino)-7-chloro-4-(pyrrolidin-1-yl)quinazolin-2--
yl)-1H-pyrazole-4-carboxylic acid.
##STR00160##
[0432] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-chloro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and pyrrolidine in step E.
MS (ESI): predicted mass calcd. for
C.sub.25H.sub.25CIN.sub.6O.sub.2, 479.0
Example 152
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)-7-chloroquinazolin-
-2-yl)-1H-pyrazole-4-carboxylic acid.
##STR00161##
[0434] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-chloro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and N-methylethanamine in
step E. MS (ESI): predicted mass calcd. for
C.sub.24H.sub.25CIN.sub.6O.sub.2, 464.9
Example 153
1-(4-(Cyclopropylamino)-6-((2,6-dimethylbenzyl)amino)-7-chloroquinazolin-2-
-yl)-1H-pyrazole-4-carboxylic acid.
##STR00162##
[0436] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-7-chloro-4-oxo-3,4-dihydroquinazolin-2-y-
l)-1H-pyrazole-4-carboxylate in step D and cyclopropyl amine in
step E. MS (ESI): predicted mass calcd. for
C.sub.24H.sub.23CIN.sub.6O.sub.2, 462.9
Example 154
1-(7-Chloro-4-morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid.
##STR00163##
[0438] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and morpholine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20CIN.sub.5O.sub.3, 449.9
Example 155
1-(4-(Dimethylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00164##
[0440] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and dimethylamine in step E.MS (ESI):
predicted mass calcd. for C.sub.21H.sub.18CIN.sub.5O.sub.2,
407.9
Example 156
1-(4-(Diethylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid.
##STR00165##
[0442] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and diethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.23H.sub.22CIN.sub.5O.sub.2,
435.9
Example 157
1-(7-Chloro-4-(pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00166##
[0444] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and pyrrolidine in step E. MS (ESI): predicted
mass calcd. for C.sub.23H.sub.20CIN.sub.5O.sub.2, 433.9
Example 158
1-(4-(Ethyl(methyl)amino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid.
##STR00167##
[0446] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and N-methylethanamine in step E. MS (ESI):
predicted mass calcd. for C.sub.22H.sub.20CIN.sub.5O.sub.2,
421.9
Example 159
1-(4-(Cyclopropylamino)-7-chloro-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid.
##STR00168##
[0448] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(o-tolyl)-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-c-
arboxylate in step D and cyclopropyl amine in step E. MS (ESI):
predicted mass calcd. for C.sub.22H.sub.18C1N.sub.5O.sub.2,
419.9
Example 160
1-(7-chloro-6-isopropyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxy-
lic acid.
##STR00169##
[0450] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-isopropylaniline in
step B and morpholine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.20CIN.sub.5O.sub.3, 401.9; m/z found, 402.1 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H), 9.02 (s, 1H), 8.11
(s, 1H), 7.88 (s, 2H), 3.97 (s, 4H), 3.81 (s, 4H), 3.33 (s, 1H),
1.31 (d, J=6.8 Hz, 6H).
Example 161
1-(7-chloro-4-(dimethylamino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00170##
[0452] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-isopropylaniline in
step B and dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.17H.sub.18CIN.sub.5O.sub.2, 359.8; m/z found, 360.0 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 9.01 (s, 1H), 8.12 (s, 1H), 8.11
(s, 1H), 7.82 (s, 1H), 3.49 (s, 6H), 3.39 (dt, J=14.1, 7.2 Hz, 1H),
1.32 (d, J=6.8 Hz, 6H).
Example 162
1-(7-chloro-4-diethylamino-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00171##
[0454] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-isopropylaniline in
step B and diethylamine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.22CIN.sub.5O.sub.2, 387.9; m/z found, 388.1 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 8.94 (s, 1H), 8.13 (s, 1H), 7.91
(s, 1H), 7.83 (s, 1H), 3.84 (q, J=6.7 Hz, 4H), 3.49-3.31 (m, 1H),
1.43 (t, J=6.7 Hz, 6H), 1.31 (d, J=6.7 Hz, 6H).
Example 163
1-(7-chloro-4-(pyrrolidin-1-yl)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00172##
[0456] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-isopropylaniline in
step B and pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.20CIN.sub.5O.sub.2, 385.9; m/z found, 386.1 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 8.98 (s, 1H), 8.19 (s, 1H), 8.08
(s, 1H), 7.78 (s, 1H), 4.01 (s, 4H), 3.45-3.33 (m, 1H), 2.03 (s,
4H), 1.32 (d, J=6.8 Hz, 6H).
Example 164
1-(7-chloro-4-(ethyl(methyl)amino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-
-4-carboxylic acid.
##STR00173##
[0458] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-isopropylaniline in
step B and N-ethyl-N-methylamine in step E. MS (ESI): mass calcd.
for C.sub.18H.sub.20CIN.sub.5O.sub.2, 373.9; m/z found, 374.1
[M+H]+. 1H NMR (400 MHz, DMSO-d.sub.6): 8.99 (s, 1H), 8.14 (s, 1H),
8.05 (s, 1H), 7.84 (s, 1H), 3.88 (q, J=7.1Hz, 2H), 3.48 (s, 3H),
3.40 (dt, J=13.3, 6.8 Hz, 1H), 1.41 (t, J=6.9 Hz, 3H), 1.32 (d,
J=6.8 Hz, 6H).
Example 165
1-(7-chloro-4-(cyclopropylamino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid.
##STR00174##
[0460] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 3-chloro-4-isopropylaniline in
step B and cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.18H.sub.18CIN.sub.5O.sub.2, 371.8; m/z found, 372.1 [M+H]+.
1H NMR (400 MHz, DMSO-d.sub.6): 12.75 (s, 1H), 9.04 (s, 1H), 8.87
(s, 1H), 8.27 (s, 1H), 8.11 (s, 1H), 7.78 (s, 1H), 3.42-3.33 (m,
1H), 3.21 (s, 1H), 1.32 (d, J=6.6 Hz, 6H), 0.93-0.90 (m, 2H), 0.76
(br s, 2H).
Examples 166-171 are prophetic Examples which may be synthesized
using the general schemes provided above.
Example 166
1-(7-Chloro-4-morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00175##
[0462] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and morpholine in step E. MS (ESI):
predicted mass calcd. for 0.sub.21H.sub.23CIN.sub.6O.sub.3,
442.9
Example 167
1-(4-(Dimethylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid.
##STR00176##
[0464] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and dimethylamine in step E. MS (ESI):
predicted mass calcd. for C.sub.19H.sub.21CIN.sub.6O.sub.2,
400.9
Example 168
1-(4-(Diethylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazol-
e-4-carboxylic acid.
##STR00177##
[0466] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step
[0467] D and diethylamine in step E. MS (ESI): predicted mass
calcd. for C.sub.21H.sub.25CIN.sub.6O.sub.2, 428.9
Example 169
1-(7-Chloro-6-(piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00178##
[0469] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and pyrrolidine in step E. MS (ESI):
predicted mass calcd. for C.sub.21H.sub.23CIN.sub.6O.sub.2,
410.2
Example 170
1-(4-(Ethyl(methyl)amino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid.
##STR00179##
[0471] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and N-methylethanamine in step E. MS
(ESI): predicted mass calcd. for C.sub.20H.sub.23CIN.sub.6O.sub.2,
414.9
Example 171
1-(4-(Cyclopropylamino)-7-chloro-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid.
##STR00180##
[0473] The above compound may be made analogous to Example 1 using
ethyl
1-(7-chloro-4-oxo-6-(piperidin-1-yl)-3,4-dihydroquinazolin-2-yl)-1H-pyraz-
ole-4-carboxylate in step D and cyclopropylamine in step E. MS
(ESI): predicted mass calcd. for C.sub.20H.sub.21CIN.sub.6O.sub.2,
412.9
Example 172
1-(6-(cyclohexyloxy)-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00181##
[0475] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexyloxyaniline in step B
and morpholine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.25N.sub.5O.sub.4, 423.5; m/z found, 424.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.75 (s, 1H), 9.01 (s, 1H), 8.10 (s,
1H), 7.81 (d, J=9.2 Hz, 1H), 7.56 (dd, J=9.1, 2.3 Hz, 1H), 7.30 (s,
1H), 4.52 (s, 1H), 3.84 (s, 8H), 1.97 (s, 2H), 1.75 (s, 2H),
1.62-1.22 (m, 6H).
Example 173
1-(6-(cyclohexyloxy)-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00182##
[0477] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexyloxyaniline in step B
and dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.20H.sub.23N.sub.5O.sub.3, 381.4; m/z found, 382.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.80 (s, 1H), 8.93 (s, 1H), 8.04 (s,
1H), 7.72 (d, J=9.0 Hz, 1H), 7.58-7.45 (m, 2H), 4.50 (s, 1H), 3.42
(s, 6H), 1.97 (s, 2H), 1.74 (s, 2H), 1.63-1.22 (m, 6H).
Example 174
1-(6-(cyclohexyloxy)-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00183##
[0479] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexyloxyaniline in step B
and diethylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.27N.sub.5O.sub.3, 409.5; m/z found, 410.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.69 (s, 1H), 8.89 (s, 1H), 8.07 (s,
1H), 7.72 (d, J=9.1Hz, 1H), 7.48 (d, J=9.1Hz, 1H), 7.32 (s, 1H),
4.44 (s, 1H), 3.79 (q, J=6.6 Hz, 4H), 2.01 (s, 2H), 1.76 (s, 2H),
1.64-1.22 (m, 12H).
Example 175
1-(6-(cyclohexyloxy)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-car-
boxylic acid.
##STR00184##
[0481] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexyloxyaniline in step B
and pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.25N.sub.5O.sub.3, 407.5; m/z found, 408.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.71 (s, 1H), 8.96 (s, 1H), 8.07 (s,
1H), 7.71-7.66 (m, 2H), 7.50 (dd, J=9.1, 2.4 Hz, 1H), 4.57-4.41 (m,
1H), 3.98 (s, 4H), 2.01 (s, 6H), 1.74 (s, 2H), 1.62-1.21 (m,
6H).
Example 176
1-(6-(cyclohexyloxy)-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00185##
[0483] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexyloxyaniline in step B
and cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.23N.sub.5O.sub.3, 393.5; m/z found, 394.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 9.07 (s, 1H), 8.85 (s, 1H), 8.17 (s,
1H), 7.86-7.70 (m, 2H), 7.51 (d, J=9.2 Hz, 1H), 4.54 (s, 1H), 3.29
(s, 1H), 1.95 (s, 2H), 1.76 (s, 2H), 1.63-1.20 (m, 6H), 0.95-0.89
(m, 2H), 0.78 (s, 2H).
Example 177
1-(6-(cyclohexyloxy)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4--
carboxylic acid.
##STR00186##
[0485] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-cyclohexyloxyaniline in step B
and N-ethyl-N-methylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.25N.sub.5O.sub.3, 395.5; m/z found, 396.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.75 (s, 1H), 8.91 (s, 1H), 8.04 (s,
1H), 7.72 (d, J=9.1Hz, 1H), 7.49 (d, J=9.3 Hz, 1H), 7.45 (s, 1H),
4.48 (s, 1H), 3.80 (q, J=7.3 Hz, 2H), 3.38 (s, 3H), 1.99 (s, 2H),
1.75 (s, 2H), 1.62-1.25 (m, 9H).
Example 178
1-(6-benzyl-4-morpholinoquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00187##
[0487] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-benzylaniline in step B and
morpholine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.21N.sub.5O.sub.3, 415.2; m/z found, 416.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.75 (s, 1H), 9.00 (s, 1H), 8.09 (s,
1H), 7.80-7.68 (m, 3H), 7.36-7.17 (m, 5H), 4.15 (s, 2H), 3.85-3.83
(m, 4H), 3.78-3.77 (m, 4H).
Example 179
1-(6-benzyl-4-(dimethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00188##
[0489] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-benzylaniline in step B and
dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.21H.sub.19N.sub.5O.sub.2, 373.4; m/z found, 374.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.71 (s, 1H), 8.97 (s, 1H), 8.07 (s,
1H), 8.04 (s, 1H), 7.70-7.63 (m, 2H), 7.31-7.28 (m, 4H), 7.24-7.18
(m, 1H), 4.13 (s, 2H), 3.41 (s, 6H).
Example 180
1-(6-benzyl-4-(diethylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00189##
[0491] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-benzylaniline in step B and
diethylamine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.23N.sub.5O.sub.2, 401.5; m/z found, 402.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.76 (s, 1H), 8.89 (s, 1H), 8.07 (s,
1H), 7.70 (s, 2H), 7.62 (s, 1H), 7.36-7.21 (m, 5H), 4.14 (s, 2H),
3.70 (q, J=6.8 Hz, 4H), 1.24 (t, J=6.9 Hz, 6H).
Example 181
1-(6-benzyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00190##
[0493] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-benzylaniline in step B and
pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.23H.sub.21N.sub.5O.sub.2, 399.5; m/z found, 400.3 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 8.88 (s, 1H), 8.14 (s, 1H), 7.99 (s,
1H), 7.64 (s, 2H), 7.31-2.29 (m, 4H), 7.23-7.16 (m, 1H), 4.12 (s,
2H), 3.93 (s, 4H), 2.00 (s, 4H).
Example 182
1-(6-benzyl-4-(cyclopropylamino)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00191##
[0495] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-benzylaniline in step B and
cyclopropyl amine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.19N.sub.5O.sub.2, 385.4; m/z found, 386.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 8.96 (s, 1H), 8.76 (d, J=3.6 Hz, 1H),
8.31 (s, 1H), 8.01 (s, 1H), 7.66-7.60 (m, 2H), 7.32-7.23 (m, 4H),
7.22-7.13 (m, 1H), 4.05 (s, 2H), 3.24-3.18 (m, 1H), 0.92-0.82 (m,
2H), 0.81-0.71 (m, 2H).
Example 183
1-(6-benzyl-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00192##
[0497] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-benzylaniline in step B and
N-ethyl-N-methylamine in step E. MS (ESI): mass calcd. for
C.sub.22H.sub.21N.sub.5O.sub.2, 387.4; m/z found, 388.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 8.94 (s, 1H), 8.07 (s, 1H), 7.88 (s,
1H), 7.68 (s, 2H), 7.34-7.28 (m, 4H), 7.21 (brs, 1H), 4.13 (s, 2H),
3.75 (q, J=6.8 Hz, 2H), 3.36 (s, 3H), 1.26 (t, J=6.9 Hz, 3H).
Example 184
1-(4-(morpholino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00193##
[0499] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-isopropylaniline in step B and
morpholine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.21N.sub.5O.sub.3, 367.4; m/z found, 368.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H), 9.03 (s, 1H), 8.11 (s,
1H), 7.80 (s, 3H), 3.92 (s, 4H), 3.82 (s, 4H), 3.11 (dt, J=13.5,
6.7 Hz, 1H), 1.29 (d, J=6.8 Hz, 6H).
Example 185
1-(4-(dimethylamino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00194##
[0501] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-isopropylaniline in step B and
dimethylamine in step E. MS (ESI): mass calcd. for
C.sub.17H.sub.19N.sub.5O.sub.2, 325.4; m/z found, 326.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.66 (s, 1H), 9.00 (s, 1H), 8.08 (s,
1H), 8.02 (s, 1H), 7.82-7.69 (m, 2H), 3.45 (s, 6H), 3.10 (dt,
J=13.6, 6.6 Hz, 1H), 1.29 (d, J=6.8 Hz, 6H).
Example 186
1-(4-(diethylamino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00195##
[0503] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-isopropylaniline in step B and
diethylamine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.123N.sub.5O.sub.2, 353.4; m/z found, 354.2 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 12.77 (s, 1H), 8.96 (s, 1H), 8.13 (s,
1H), 7.78 (t, J=13.6 Hz, 3H), 3.84 l (q, J=6.7 Hz, 4H), 3.09 (dt,
J=14.0, 7.0 Hz, 1H), 1.42 (t, J=6.9 Hz, 6H), 1.30 (d, J=6.9 Hz,
6H).
Example 187
1-(6-isopropyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00196##
[0505] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-isopropylaniline in step B and
pyrrolidine in step E. MS (ESI): mass calcd. for
C.sub.19H.sub.21N.sub.5O.sub.2, 351.4; m/z found, 352.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 8.96 (s, 1H), 8.08 (d, J=11.4 Hz, 2H),
7.78-7.63 (m, 2H), 3.98 (s, 4H), 3.13-3.05 (m, 1H), 2.02 (s, 4H),
1.29 (d, J=6.3 Hz, 6H).
Example 188
1-(4-(cyclopropylamino)-6-isopropylquinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid.
##STR00197##
[0507] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-isopropylaniline in step B and
cyclopropylamine in step E. MS (ESI): mass calcd. for
C.sub.18H.sub.19N.sub.5O.sub.2, 337.4; m/z found, 338.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 9.08 (s, 1H), 9.00 (s, 1H), 8.25 (s,
1H), 8.16 (s, 1H), 7.80-7.69 (m, 2H), 3.32 (s, 1H), 3.04 (dt,
J=13.4, 6.7 Hz, 1H), 1.30 (d, J=6.9 Hz, 6H), 1.02-0.76 (m, 4H).
Example 189
1-(6-isopropyl-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00198##
[0509] The titled compound was prepared in a manner analogous to
EXAMPLE 1 steps B through F using 4-isopropylaniline in step B and
N-ethyl-N-methylamine in step E. MS (ESI): mass calcd. for
C.sub.18H.sub.21N.sub.5O.sub.2, 339.4; m/z found, 340.1 [M+H]+. 1H
NMR (400 MHz, DMSO-d.sub.6): 9.10 (s, 1H), 8.26 (s, 1H), 8.02 (s,
1H), 7.93-7.83 (m, 2H), 3.97 (q, J=6.9 Hz, 2H), 3.56 (s, 3H), 3.12
(dt, J=13.7, 6.9 Hz, 1H), 1.40 (t, J=7.0 Hz, 3H), 1.29 (d, J=6.9
Hz, 6H).
Examples 190-213 are prophetic Examples which may be synthesized
using the general schemes provided above.
Example 190
1-(6-((2,6-Dimethylbenzyl)amino)-4-morpholinoquinazolin-2-yl)-1H-pyrazole--
4-carboxylic acid.
##STR00199##
[0511] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylate in step D and morpholine in step E. MS
(ESI/CI): predicted mass C.sub.25H.sub.26N.sub.6O.sub.3, 458.2.
Example 191
1-(6-((2,6-Dimethylbenzyl)amino)-4-(dimethylamino)quinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00200##
[0513] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylate in step D and dimethylamine in step E. MS
(ESI/CI): predicted mass C.sub.23H.sub.24N.sub.6O.sub.2,
416.20.
Example 192
1-(6-((2,6-Dimethylbenzyl)amino)-4-(diethylamino)quinazolin-2-yl)-1H-pyraz-
ole-4-carboxylic acid.
##STR00201##
[0515] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylate in step D and diethylamine in step E. MS
(ESI/CI): predicted mass C.sub.25H.sub.28N.sub.6O.sub.2, 444.2.
Example 193:
1-(6-((2,6-Dimethylbenzyl)amino)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid.
##STR00202##
[0517] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylate in step D and pyrrolidine in step E. MS
(ESI/CI): predicted mass C.sub.25H.sub.26N.sub.6O.sub.2, 442.2.
Example 194
1-(6-((2,6-Dimethylbenzyl)amino)-4-(cyclopropylamino)quinazolin-2-yl)-1H-p-
yrazole-4-carboxylic acid.
##STR00203##
[0519] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylate in step D and cyclopropylamine in step E. MS
(ESI/CI): predicted mass C.sub.24H.sub.24N.sub.6O.sub.2, 428.2.
Example 195
1-(6-((2,6-Dimethylbenzyl)amino)-4-(ethyl(methyl)amino)quinazolin-2-yl)-1H-
-pyrazole-4-carboxylic acid.
##STR00204##
[0521] The above compound may be made analogous to Example 1 using
ethyl
1-(6-((2,6-dimethylbenzyl)amino)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyr-
azole-4-carboxylate in step D and N-ethyl-N-methylamine in step E.
MS (ESI/CI): predicted mass C.sub.24H.sub.26N.sub.6O.sub.2,
430.2.
Example 196
1-(4-Morpholino-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00205##
[0523] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(o-tolyl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylat-
e in step D and morpholine in step E. MS (ESI/CI): predicted mass
C.sub.23H.sub.21N.sub.5O.sub.3, 415.2.
Example 197
1-(4-(Dimethylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00206##
[0525] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(o-tolyl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylat-
e in step D and dimethylamine in step E. MS (ESI/CI): predicted
mass C.sub.21H.sub.19N.sub.5O.sub.2, 373.2.
Example 198
1-(4-(Diethylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxylic
acid.
##STR00207##
[0527] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(o-tolyl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylat-
e in step D and diethylamine in step E. MS (ESI/CI): predicted mass
C.sub.23H.sub.23N.sub.5O.sub.2, 401.2.
Example 199
1-(4-(Pyrrolidin-1-yl)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00208##
[0529] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(o-tolyl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylat-
e in step D and pyrrolidine in step E. MS (ESI/CI): predicted mass
C.sub.23H.sub.21N.sub.5O.sub.2, 399.2.
Example 200
1-(4-(Cyclopropylamino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carboxyl-
ic acid.
##STR00209##
[0531] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(o-tolyl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylat-
e in step D and cyclopropylamine in step E. MS (ESI/CI): predicted
mass C.sub.22H.sub.19N.sub.5O.sub.2, 385.2.
Example 201
1-(4-(Ethyl(methyl)amino)-6-(o-tolyl)quinazolin-2-yl)-1H-pyrazole-4-carbox-
ylic acid.
##STR00210##
[0533] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(o-tolyl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-carboxylat-
e in step D and N-ethyl-N-methylamine in step E. MS (ESI/CI):
predicted mass C.sub.22H.sub.21 N.sub.5O.sub.2, 387.2.
Example 202
1-(4-Morpholino-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carboxyli-
c acid.
##STR00211##
[0535] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(piperidin-1-yl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-car-
boxylate in step D and morpholine in step E. MS (ESI/CI): predicted
mass C.sub.21H.sub.24N.sub.6O.sub.3, 408.2.
Example 203
1-(4-(Dimethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carb-
oxylic acid.
##STR00212##
[0537] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(piperidin-1-yl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-car-
boxylate in step D and dimethylamine in step E. MS (ESI/CI):
predicted mass C.sub.19H.sub.22N.sub.6O.sub.2, 366.2.
Example 204
1-(4-(Diethylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-carbo-
xylic acid.
##STR00213##
[0539] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(piperidin-1-yl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-car-
boxylate in step D and diethylamine in step E. MS (ESI/CI):
predicted mass C.sub.21H.sub.26N.sub.6O.sub.2, 394.2.
Example 205
1-(6-(Piperidin-1-yl)-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-ca-
rboxylic acid.
##STR00214##
[0541] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(piperidin-1-yl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-car-
boxylate in step D and pyrrolidine in step E. MS (ESI/CI):
predicted mass C.sub.21H.sub.24N.sub.6O.sub.2, 392.2.
Example 206
1-(4-(Cyclopropylamino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-c-
arboxylic acid.
##STR00215##
[0543] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(piperidin-1-yl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-car-
boxylate in step D and cyclopropylamine in step E. MS (ESI/CI):
predicted mass C.sub.20H.sub.22N.sub.6O.sub.2, 378.2.
Example 207
1-(4-(Ethyl(methyl)amino)-6-(piperidin-1-yl)quinazolin-2-yl)-1H-pyrazole-4-
-carboxylic acid.
##STR00216##
[0545] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(piperidin-1-yl)-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-pyrazole-4-car-
boxylate in step D and N-ethyl-N-methylamine in step E. MS
(ESI/CI): predicted mass C.sub.20H.sub.24N.sub.6O.sub.2, 380.2.
Example 208
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-morpholinoquinazolin-2-yl)-1H-pyrazo-
le-4-carboxylic acid.
##STR00217##
[0547] The above compound may be made analogous to Example 1 using
ethyl
14642,6-dimethylphenoxy)-7-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H-py-
razole-4-carboxylate in step D and morpholine in step E. MS
(ESI/CI): predicted mass C.sub.25H.sub.25N.sub.5O.sub.4, 459.2.
Example 209
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-dimethylaminoquinazolin-2-yl)-1H-pyr-
azole-4-carboxylic acid.
##STR00218##
[0549] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(2,6-dimethylphenoxy)-7-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H--
pyrazole-4-carboxylate in step D and dimethylamine in step E. MS
(ESI/CI): predicted mass C.sub.23H.sub.23N.sub.5O.sub.3, 417.2.
Example 210
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-diethylaminoquinazolin-2-yl)-1H-pyra-
zole-4-carboxylic acid.
##STR00219##
[0551] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(2,6-dimethylphenoxy)-7-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H--
pyrazole-4-carboxylate in step D and diethylamine in step E. MS
(ESI/CI): predicted mass C.sub.25H.sub.27N.sub.5O.sub.3, 445.2.
Example 211
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-(pyrrolidin-1-yl)quinazolin-2-yl)-1H-
-pyrazole-4-carboxylic acid.
##STR00220##
[0553] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(2,6-dimethylphenoxy)-7-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H--
pyrazole-4-carboxylate in step D and pyrrolidine in step E. MS
(ESI/CI): predicted mass C.sub.25H.sub.25N.sub.5O.sub.3, 443.2.
Example 212
1-(6-(2,6-Dimethylphenoxy)-7-methyl-4-cyclopropylaminoquinazolin-2-yl)-1H--
pyrazole-4-carboxylic acid.
##STR00221##
[0555] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(2,6-dimethylphenoxy)-7-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H--
pyrazole-4-carboxylate in step D and cyclopropylamine in step E. MS
(ESI/CI): predicted mass C.sub.24H.sub.23N.sub.5O.sub.3, 429.2.
Example 213
1-(6-(2,6-Dimethylphenoxy)-4-(ethyl(methyl)amino)-7-methylquinazolin-2-yl)-
-1H-pyrazole-4-carboxylic acid.
##STR00222##
[0557] The above compound may be made analogous to Example 1 using
ethyl
1-(6-(2,6-dimethylphenoxy)-7-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)-1H--
pyrazole-4-carboxylate in step D and N-ethyl-N-methylamine in step
E. MS (ESI/CI): predicted mass C.sub.25H.sub.24N.sub.5O.sub.3,
431.2.
Biological Protocols:
Expression and Purification of PHD2.sub.181-417
[0558] The human PHD2 expression construct containing amino acids
181-417 of GenBank Accession ID NM_022051 was cloned into a pBAD
vector (Invitrogen), incorporating both an N-terminal histidine tag
and a Smt3-tag, both of which are cleaved by Ulp1. Protein
production was achieved by expression in BL21 cells grown in
Terrific Broth containing 100 .mu.g/ml ampicillin. Cell cultures
were inoculated at 37.degree. C. and grown to an OD.sub.600 of 0.8.
Cultures were induced with 0.1% arabinose and grown overnight at
20.degree. C. with continuous shaking at 225 rpm. Cells were then
harvested by centrifugation and stored at -80.degree. C. Cell
pellets were suspended in Buffer A (50 mM Tris-HCl pH 7.2, 100 mM
NaCl, 100 mM L-arginine, 1 mM TCEP, 0.05% (w/v) NP-40, 50 mM
imidazole) followed by the addition of lysozyme and benzonase.
Cells were lysed by sonication and the lysate was cleared by
centrifugation (15,000 rpm, 90 min, 4.degree. C.). The protein was
purified by nickel affinity chromatography using a HisTrap Crude FF
column (GE Healthcare). Samples were eluted in Buffer A with a
50-200 mM imidazole gradient. Cleavage of the Smt tag with Ulp1
protease was achieved via overnight incubation with dialyzing
against Buffer A. The .sub.PHD2.sub.181-417 sample was then passed
over a second HisTrap Crude FF column (GE Healthcare) to remove
uncleaved protein. The flow-through was then dialyzed into 50 mM
MES pH 6.0, 1 mM TCEP, 5 mM NaCl for ion exchange chromatography on
a HiTrap SP Cation Exchange column (GE Healthcare). The
PHD2.sub.181-417protein was eluted with a 0-0.2 M NaCl gradient.
Fractions were pooled for further purification by size exclusion
chromatography over a Superdex 75 Size Exclusion Column (GE
Healthcare). Final protein was concentrated to 4 mg/ml and dialyzed
in 10 mM PIPES pH 7.0, 100 mM NaCl, 0.5 mM TCEP. The protein was
determined to have a purity of >95% by gel electrophoresis.
Enzyme Activity Assay
[0559] The PHD enzymatic assay was performed in 0.5 ml of reaction
mixture containing the following: purified
PHD2.sub.181-417polypeptide (3 .mu.g), synthetic HIF-1 .alpha.
peptide comprising residues [KNPFSTGDTDLDLEMLAPYIPMDDDFQLRSFDQLS]
(10 .mu.M, California Peptide Research Inc., Napa, Calif.), and
[5-.sup.14C]-2-oxoglutaric acid (50 mCi/mmol, Moravek Chemicals,
Brea, Calif.) in reaction buffer (40 mM Tris-HCl, pH 7.5, 0.4 mg/ml
catalase, 0.5 mM DTT, 1 mM ascorbate) for 10 minutes. Compounds
were pre-incubated for 30 min before starting the reaction (all
test compounds were dissolved at 10 mM in 100% DMSO (w/v) and were
tested with final compound concentrations at 100.mu.M in 1% DMSO
(w/v)). The reaction was stopped by addition of 50 .mu.l of 70 mM
H.sub.3PO.sub.4 and 50 .mu.l of 500 mM NaH.sub.2PO.sub.4, pH 3.2.
Detection of [.sup.14C]-succinic acid was achieved by separating
from [5-.sup.14C]-2-oxoglutaric acid by incubating the reaction
mixture with 100 .mu.l of 0.16 M DNP prepared in 30% perchloric
acid. Next, 50 .mu.l of unlabeled 20 mM 2-oxoglutaric acid/20 mM
succinic acid, serving as carrier for the radioactivity, was added
to the mixture, and was allowed to proceed for 30 minutes at room
temperature. The reaction was then incubated with 50 .mu.l of 1 M
2-oxoglutaric acid for 30 additional minutes at room temperature to
precipitate the excess DNP. The reaction was then centrifuged at
2800.times.g for 10 minutes at room temperature to separate
[.sup.14C]-succinic acid in the supernatant from the precipitated
[.sup.14C]-dinitrophenylhydrazone. Fractions of the supernatant
(400 .mu.I) were counted using a beta counter (Beckman Coulter,
Fullerton, Calif.). Inhibition of PHD2.sub.181-417 activity was
measured as a decrease in succinic acid production. The IC.sub.50
values were estimated by fitting the data to a three-parameter
logistic function using GraphPad Prism, version 4.02 (Graph Pad
Software, San Diego, Calif.).
Cellular Assay
[0560] Hep-3B cells (ATCC, Manassas, Va.) were plated in 96-well
plates at 20,000 cells per well in 100 .mu.l of DMEM containing 10%
fetal bovine serum, 1% non-essential amino acids, 50 IU/mL of
penicillin and 50 .mu.g/mL of streptomycin (all cell culture
reagents from Invitrogen, Carlsbad, Calif.). Twenty-four hours
after plating, compounds were added and incubated for an additional
24 hours. All compounds were tested with final compound
concentrations at 100 .mu.M. Fifty microliters of the supernatant
was then transferred to a human Hypoxia assay kit (Meso-Scale
Discovery, Gaithersburg, Md.). Erythropoietin in the supernatant
was detected according to the manufacturer's instructions as
follows. EPO detection plates were blocked with 3% BSA in PBS
overnight and 50 .mu.l of the supernatant was incubated at room
temperature in an orbital shaker for 2 h. Twenty-five microliters
of 0.5 .mu.g/ml anti-EPO detection antibody was added for 2 hours
at room temperature in an orbital shaker. After 3 washes in PBS,
150 .mu.l of 1.times. read buffer is added and the plate is then
read on the MSD SECTOR instrument. Data was analyzed by determining
the percent of EPO secretion in the presence of 100 .mu.M compound
relative to an assay control compound,
7-[(4-Chloro-phenyl)-(5-methyl-isoxazol-3-ylamino)-methyl]-quinolin-8-ol.
Cellular Assay for HIF1-.alpha.
[0561] Hela cells (ATCC, Manassas, Va.) were plated in 96-well
plates at 20,000 cells per well in 100 .mu.l of DMEM containing 10%
fetal bovine serum, 1% non-essential amino acids, 50 IU/mL of
penicillin and 50 .mu.g/mL of streptomycin (all cell culture
reagents from Invitrogen, Carlsbad, Calif.). 24 hours after
plating, changed media to 100 ul of DMEM without 10% fetal bovine
serum, 1.1 .mu.l of the stock solution for each compound was added
and incubated for 6 hours. All compounds were tested with a final
compound concentration of 100 .mu.M. The supernatant was removed
and the cells were lysed in 55 .mu.l of MSD lysis buffer containing
protease inhibitors. 50 .mu.l of the cell lysate was then
transferred to a blocked MSD human HIF-1.alpha. detection plate
(Meso-Scale Discovery, Gaithersburg, Md., as per manufacturers
protocol), and incubated at room temperature on an orbital shaker
for 2 hour. After 3 washes in PBS, 25 .mu.l of 20nM
anti-HIF1.alpha. a detection antibody was added and incubated for 1
hour at room temperature on an orbital shaker. After 3 washes in
PBS, 150 .mu.l of 1.times. read buffer was added and the plate was
then read on a MSD SECTOR instrument. Data was analyzed by
determining the percent of HIF stimulation in the presence of 100
.mu.M compound relative to an assay control compound,
7-[(4-Chloro-phenyl)-(5-methyl-isoxazol-3-ylamino)-methyl]-quinolin-8-ol.
[0562] Results for the compounds tested in these assays are
presented in Table 1 as an average of results obtained (NT=not
tested).
TABLE-US-00003 TABLE 1 Cellular % Enzyme EPO % HIF Ex Chemical Name
pIC.sub.50 Stimulation Stimulation 1
1-[4-Amino-6-(2,6-dimethyl-phenoxy)-7- 7.2 51 NT
fluoro-quinazolin-2-yl]-1H-pyrazole-4- carboxylic acid; 2
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4- 7.2 10 NT
methylamino-quinazolin-2-yl]-1H- pyrazole-4-carboxylic acid; 3
1-[4-Dimethylamino-6-(2,6-dimethyl- 7.2 68 NT
phenoxy)-7-fluoro-quinazolin-2-yl]-1H- pyrazole-4-carboxylic acid;
4 1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4- 6.9 17 NT
piperidin-1-yl-quinazolin-2-yl]-1H- pyrazole-4-carboxylic acid; 5
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4- 7.4 25 NT
pyrrolidin-1-yl-quinazolin-2-yl]-1H- pyrazole-4-carboxylic acid; 6
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4- 7.4 22 NT
phenylamino-quinazolin-2-yl]-1H- pyrazole-4-carboxylic acid; 7
1-[4-(2-Chloro-phenylamino)-6-(2,6- 7.2 13 NT
dimethyl-phenoxy)-7-fluoro-quinazolin-2-
yl]-1H-pyrazole-4-carboxylic acid; 8
1-[6-(2,6-Dimethyl-phenoxy)-7-fluoro-4- 7.2 59 NT
propylamino-quinazolin-2-yl]-1H-pyrazole- 4-carboxylic acid; 9
(rac)-1-[6-(2,6-Dimethyl-phenoxy)-7- 7.1 86 NT
fluoro-4-(2-methoxy-1-methyl-
ethylamino)-quinazolin-2-yl]-1H-pyrazole- 4-carboxylic acid; 10
1-[4-(2-Diethylamino-ethylamino)-6-(2,6- 5.9 13 NT
dimethyl-phenoxy)-7-fluoro-quinazolin-2-
yl]-1H-pyrazole-4-carboxylic acid; 11
1-[6-(2,6-Dimethyl-phenoxy)-4- 7.1 9 NT
dibutylamino-7-fluoro-quinazolin-2-yl]-1H- pyrazole-4-carboxylic
acid; 12 1-[6-(2,6-Dimethyl-phenoxy)-4- 7.4 9 NT
dipropylamino-7-fluoro-quinazolin-2-yl]- 1H-pyrazole-4-carboxylic
acid; 13 1-(4-((Cyclohexylmethyl)amino)-6-(2,6- 6.9 10 NT
dimethylphenoxy)-7-fluoroquinazolin-2- yl)-1H-pyrazole-4-carboxylic
acid; 14 1-((4-Cyclopropylamino)-6-(2,6- 7.1 86 NT
dimethylphenoxy)-7-fluoroquinazolin-2- yl)-1H-pyrazole-4-carboxylic
acid; 15 1-((4-Cyclopropanemethylamino)-6-(2,6- 7.2 64 NT
dimethylphenoxy)-7-fluoroquinazolin-2- yl)-1H-pyrazole-4-carboxylic
acid; 16 1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4- 7.1 71 NT
((tetrahydro-2H-pyran-4- yl)amino)quinazolin-2-yl)-1H-pyrazole-4-
carboxylic acid; 17 1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4-(4- 6.7
NT 47 methyl-1,4-diazepan-1-yl)quinazolin-2-yl)-
1H-pyrazole-4-carboxylic acid; 18
1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4- 7.0 NT 15
thiomorpholinoquinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 19
1-(6-(2,6-dimethylphenoxy)-7-fluoro-4-(4- 6.9 NT 140
hydroxypiperidin-1-yl)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid; 20 1-(6-(2,6-Dimethylphenoxy)-7-fluoro-4- 7.0 54 NT
morpholinoquinazolin-2-yl)-1H-pyrazole- 4-carboxylic acid; 21
1-(4-(4-Acetamidopiperidin-1-yl)-6-(2,6- 6.9 NT 62
dimethylphenoxy)-7-fluoroquinazolin-2- yl)-1H-pyrazole-4-carboxylic
acid; 22 1-(6-Cyclohexyl-4-methylamino- 7.1 48 NT
quinazolin-2-yl)-1H-pyrazole-4-carboxylic acid; 23
1-[6-Cyclohexyl-4-(2,6-dimethyl- 5.9 7 NT
benzylamino)-quinazolin-2-yl]-1H- pyrazole-4-carboxylic acid; 24
1-(4-Amino-6-cyclohexylquinazolin-2-yl)- 7.5 36 NT
1H-pyrazole-4-carboxylic acid; 25 1-(6-Cyclohexyl-4-(pyrrolidin-1-
6.4 39 NT yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 26
1-(6-Cyclohexyl-4-(piperidin-1- 7.1 20 NT
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 27
1-(6-Cyclohexyl-4- 7.3 45 NT (diethylamino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 28 1-(6-Cyclohexyl-4- 7.3 31 NT
(phenylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 29
1-(4-((2-Chlorophenyl)amino)-6- 7.1 NT 7.8
cyclohexylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 30
1-(4-(4-Cyanopiperidin-1-yl)-6- 6.9 NT 77
cyclohexylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 31
1-(6-Cyclohexyl-4-(4-fluoropiperidin-1- 7.1 NT 34
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 32
1-(6-Cyclohexyl-4- 6.7 49 NT (cyclopropylamino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 33
1-(6-Cyclohexyl-4-morpholinoquinazolin- 6.8 36 NT
2-yl)-1H-pyrazole-4-carboxylic acid; 34 1-(6-Cyclohexyl-4- 6.9 20
NT thiomorpholinoquinazolin-2-yl)-1H- pyrazole-4-carboxylic acid;
35 1-(4-Cyanamido-6-cyclohexylquinazolin- 7.2 67 NT
2-yl)-1H-pyrazole-4-carboxylic acid; 36 1-(4-(tert-Butylamino)-6-
6.8 NT 23 cyclohexylquinazolin-2-yl)-1H-pyrazole-4- carboxylic
acid; 37 1-(4-(Azepan-1-yl)-6- 7.1 17 NT
cyclohexylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 38
1-(6-Cyclohexyl-4- 7.2 61 NT (dimethylamino)quinazolin-2-yl)-1H-
pyrazole-4-carboxylic acid; 39 1-(6-Cyclohexyl-4- 6.9 NT 6.1
((cyclohexylmethyl)amino)quinazolin-2- yl)-1H-pyrazole-4-carboxylic
acid; 40 1-(6-Cyclohexyl-4- 6.6 NT 6.7
(methylsulfonamido)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid;
41 1-(4-(Dimethylamino)-6-phenylquinazolin- 7.2 43 NT
2-yl)-1H-pyrazole-4-carboxylic acid; 42
1-(4-(Ethyl(methyl)amino)-6- 7.3 56 NT
phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 43
1-(6-Phenyl-4-(pyrrolidin-1-yl)quinazolin- 7.3 NT 57
2-yl)-1H-pyrazole-4-carboxylic acid; 44
1-(6-Phenyl-4-(phenylamino)quinazolin-2- 7.1 NT 22
yl)-1H-pyrazole-4-carboxylic acid 45
1-(6-Phenyl-4-(piperidin-1-yl)quinazolin-2- 7.2 8 NT
yl)-1H-pyrazole-4-carboxylic acid; 46
1-(4-(Diethylamino)-6-phenylquinazolin-2- 7.4 26 NT
yl)-1H-pyrazole-4-carboxylic acid; 47
1-(4-((2-Chlorophenyl)amino)-6- 6.6 NT 10
phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 48
1-(4-(Azepan-1-yl)-6-phenylquinazolin-2- 7.2 NT 23
yl)-1H-pyrazole-4-carboxylic acid; 49
1-(4-((Cyclohexylmethyl)amino)-6- 6.9 NT 3.8
phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 50
1-(4-Cyanamido-6-phenylquinazolin-2-yl)- 7.1 NT 9.6
1H-pyrazole-4-carboxylic acid; 51 1-(4-(Cyclopropylamino)-6- 6.5 NT
40 phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 52
1-(4-(tert-Butylamino)-6-phenylquinazolin- 6.5 NT 37
2-yl)-1H-pyrazole-4-carboxylic acid; 53
1-(4-Amino-6-phenylquinazolin-2-yl)-1H- 7.0 NT 16
pyrazole-4-carboxylic acid; 54
1-(6-Phenyl-4-thiomorpholinoquinazolin- 6.8 25 NT
2-yl)-1H-pyrazole-4-carboxylic acid; 55
1-(4-(4-Acetamidopiperidin-1-yl)-6- 6.7 NT 28
phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 56
1-(6-Phenyl-4-((tetrahydro-2H-pyran-4- 6.2 NT 25
yl)amino)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 57
1-(4-(4-Methyl-1,4-diazepan-1-yl)-6- 6.4 NT 30
phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 58
1-(4-Morpholino-6-phenylquinazolin-2-yl)- 6.5 NT 49
1H-pyrazole-4-carboxylic acid; 59 1-(4-(4-Cyanopiperidin-1-yl)-6-
6.4 NT 45 phenylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 60
1-(6-(4-Chlorophenoxy)-4- 7.3 22 NT
(diethylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 61
1-(6-(4-Chlorophenoxy)-4-(pyrrolidin-1- 7.3 96 NT
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 62
1-(6-(4-Chlorophenoxy)-4- 7.0 32 NT
(cyclopropylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid;
63 1-(6-(4-Chlorophenoxy)-4-(piperidin-1- 7.6 39 NT
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 64
1-(6-(4-Chlorophenoxy)-4- 7.5 NT 1.5
((cyclohexylmethyl)amino)quinazolin-2- yl)-1H-pyrazole-4-carboxylic
acid; 65 1-(6-(4-chlorophenoxy)-4-(4- 7.4 77 NT
cyanopiperidin-1-yl)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid; 66 1-(4-(Azepan-1-yl)-6-(4- 7.5 NT 14
chlorophenoxy)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 67
1-(6-(4-Chlorophenoxy)-4- 7.3 NT 31
thiomorpholinoquinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 68
1-(6-(4-Chlorophenoxy)-4-((tetrahydro- 6.9 40 NT
2H-pyran-4-yl)amino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid; 69 1-(6-(4-Chlorophenoxy)-4- 7.7 23 NT
(phenylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 70
1-(4-(4-Acetamidopiperidin-1-yl)-6-(4- 7.1 16 NT
chlorophenoxy)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 71
1-(6-(4-Chlorophenoxy)-4-(4-methyl-1,4- 6.7 17 NT
diazepan-1-yl)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 72
1-(4-(tert-Butylamino)-6- 6.7 NT 32
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 73
1-(6-Phenoxy-4-(pyrrolidin-1- 7.2 36 NT
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 74
1-(4-(Diethylamino)-6-phenoxyquinazolin- 7.3 NT 81
2-yl)-1H-pyrazole-4-carboxylic acid; 75 1-(4-(Cyclopropylamino)-6-
6.8 20 NT phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid;
76 1-(6-Phenoxy-4-((tetrahydro-2H-pyran-4- 6.5 NT 19
yl)amino)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 77
1-(4-(Dimethylamino)-7- 7.4 75 NT
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 78
1-(7-Phenoxy-4-(pyrrolidin-1- 7.3 38 64
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 79
1-(7-Phenoxy-4-(piperidin-1-yl)quinazolin- 7.0 38 NT
2-yl)-1H-pyrazole-4-carboxylic acid; 80
1-(4-(Dimethylamino)-7-phenylquinazolin- 6.0 NT 7.8
2-yl)-1H-pyrazole-4-carboxylic acid; 81
1-(7-Phenyl-4-(pyrrolidin-1-yl)quinazolin- 5.5 NT 10
2-yl)-1H-pyrazole-4-carboxylic acid; 82
1-(7-Phenyl-4-(piperidin-1-yl)quinazolin-2- 6.1 NT 4.6
yl)-1H-pyrazole-4-carboxylic acid; 83
1-(4-(Diethylamino)-7-phenoxyquinazolin- 7.7 25 NT
2-yl)-1H-pyrazole-4-carboxylic acid; 84
1-(4-((Cyclohexylmethyl)amino)-7- 6.8 NT 4.6
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 85
1-(4-(4-Isopropylpiperidin-1-yl)-7- 6.8 NT 1.7
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 86
1-(4-(Cyclopropylamino)-7- 6.3 NT 13
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 87
1-(4-(Azepan-1-yl)-7-phenoxyquinazolin- 7.2 NT 20
2-yl)-1H-pyrazole-4-carboxylic acid; 88
1-(4-(Diethylamino)-6-(piperidin-1- 7.0 94 122
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 89
1-(4-Morpholino-7-phenoxyquinazolin-2- 6.2 NT 17
yl)-1H-pyrazole-4-carboxylic acid; 90 1-(7-Phenoxy-4- 6.3 NT 7.7
thiomorpholinoquinazolin-2-yl)-1H- pyrazole-4-carboxylic acid; 91
1-(4-(4-Fluoropiperidin-1-yl)-7- 6.3 NT 18
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 92
1-(4-(Dibutylamino)-7-phenoxyquinazolin- 7.1 NT 4.1
2-yl)-1H-pyrazole-4-carboxylic acid; 93 1-(4-(Dipropylamino)-7- 7.2
NT 43 phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 94
1-(4-(Ethyl(methyl)amino)-7- 7.2 NT 83
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 95
1-(4-((2-Methoxyethyl)(methyl)amino)-7- 6.8 NT 46
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 96
1-(7-Bromo-4-(diethylamino)quinazolin-2- 6.9 NT 72
yl)-1H-pyrazole-4-carboxylic acid; 97 1-(4-(Cyclohexylamino)-7- 7.0
NT 55 phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 98
1-(4-((Cyclopropylmethyl)amino)-7- 6.7 NT 46
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid; 99
1-(4-(tert-Butylamino)-7- 6.3 NT 31
phenoxyquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid. 100
1-(7-Fluoro-6-(cyclohexyloxy)-4- 6.6 18 NT
morpholinoquinazolin-2-yl)-1H-pyrazole- 4-carboxylic acid. 101
1-(7-fluoro-6-(cyclohexyloxy)-4- 7.1 85 NT
(dimethylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid 102
1-(7-fluoro-6-(cyclohexyloxy)-4- 7.5 37 NT
(pyrrolidin-1-yl)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid.
103 1-(7-fluoro-6-(cyclohexyloxy)-4- 7.3 31 NT
(pyrrolidin-1-yl)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid.
104 1-(7-fluoro-6-(cyclohexyloxy)-4- 7.1 49 NT
(ethyl(methyl)amino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid. 105 1-(7-fluoro-6-(cyclohexyloxy)-4- 7.2 29 NT
(cyclopropylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid.
136 1-(7-chloro-6-(cyclohexyloxy)-4- 6.7 33 NT
morpholinoquinazolin-2-yl)-1H-pyrazole- 4-carboxylic acid. 137
1-(7-chloro-6-(cyclohexyloxy)-4- 7.4 32 NT
(dimethylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid. 138
1-(7-chloro-6-(cyclohexyloxy)-4- 7.5 NT NT
(diethylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid. 139
1-(7-chloro-6-(cyclohexyloxy)-4- 7.1 NT NT
(pyrrolidin-1-yl)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid
140 1-(7-chloro-6-(cyclohexyloxy)-4- 7.2 29 NT
(ethyl(methyl)amino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid. 141 1-(7-chloro-6-(cyclohexyloxy)-4- 7.0 NT NT
(cyclopropylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid.
160 1-(7-chloro-6-isopropyl-4- 6.8 28 NT
morpholinoquinazolin-2-yl)-1H-pyrazole- 4-carboxylic acid 161
1-(7-chloro-4-(dimethylamino)-6- 7.4 32 NT
isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid. 162
1-(7-chloro-4-diethylamino-6- 7.2 40 NT
isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid. 163
1-(7-chloro-4-(pyrrolidin-1-yl)-6- 7.3 26 NT
isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid. 164
1-(7-chloro-4-(ethyl(methyl)amino)-6- 7.4 57 NT
isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid. 165
1-(7-chloro-4-(cyclopropylamino)-6- 7.0 24 NT
isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid 172
1-(6-(cyclohexyloxy)-4- 6.4 18 NT
morpholinoquinazolin-2-yl)-1H-pyrazole- 4-carboxylic acid 173
1-(6-(cyclohexyloxy)-4- 7.4 62 NT
(dimethylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid. 174
1-(6-(cyclohexyloxy)-4- 7.2 35 NT
(diethylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid. 175
1-(6-(cyclohexyloxy)-4-(pyrrolidin-1- 7.2 46 NT
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid 176
1-(6-(cyclohexyloxy)-4- 6.8 35 NT
(cyclopropylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid.
177 1-(6-(cyclohexyloxy)-4- 7.3 56 NT
(ethyl(methyl)amino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid. 178 1-(6-benzyl-4-morpholinoquinazolin-2-yl)- 6.5 NT NT
1H-pyrazole-4-carboxylic acid 179
1-(6-benzyl-4-(dimethylamino)quinazolin- 7.1 NT NT
2-yl)-1H-pyrazole-4-carboxylic acid. 180
1-(6-benzyl-4-(diethylamino)quinazolin-2- 7.1 NT NT
yl)-1H-pyrazole-4-carboxylic acid. 181
1-(6-benzyl-4-(pyrrolidin-1-yl)quinazolin- 7.1 NT NT
2-yl)-1H-pyrazole-4-carboxylic acid. 182 1-(6-benzyl-4- 7.1 NT NT
(cyclopropylamino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic acid.
183 1-(6-benzyl-4- 7.2 NT NT
(ethyl(methyl)amino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid. 184 1-(4-(morpholino)-6-isopropylquinazolin- 5.7 24 NT
2-yl)-1H-pyrazole-4-carboxylic acid. 185 1-(4-(dimethylarnino)-6-
7.0 62 NT isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid.
186 1-(4-(diethylamino)-6-isopropylquinazolin- 7.0 43 NT
2-yl)-1H-pyrazole-4-carboxylic acid 187
1-(6-isopropyl-4-(pyrrolidin-1- 6.8 28 NT
yl)quinazolin-2-yl)-1H-pyrazole-4- carboxylic acid. 188
1-(4-(cyclopropylamino)-6- 6.0 35 NT
isopropylquinazolin-2-yl)-1H-pyrazole-4- carboxylic acid 189
1-(6-isopropyl-4- 6.8 36 NT
(ethyl(methyl)amino)quinazolin-2-yl)-1H- pyrazole-4-carboxylic
acid.
* * * * *