U.S. patent application number 15/720380 was filed with the patent office on 2018-05-24 for anti-lamp1 antibodies and antibody drug conjugates, and uses thereof.
The applicant listed for this patent is SANOFI. Invention is credited to Yves BAUDAT, Francis BLANCHE, Beatrice CAMERON, Tarik DABDOUBI, Anne-Marie LEFEBVRE, Magali MATHIEU, Ana MERINO-TRIGO, Manoel NUNES.
Application Number | 20180142032 15/720380 |
Document ID | / |
Family ID | 49958431 |
Filed Date | 2018-05-24 |
United States Patent
Application |
20180142032 |
Kind Code |
A1 |
BAUDAT; Yves ; et
al. |
May 24, 2018 |
ANTI-LAMP1 ANTIBODIES AND ANTIBODY DRUG CONJUGATES, AND USES
THEREOF
Abstract
Antibodies are provided which specifically bind human and Macaca
fascicularis lysosomal-associated membrane protein 1 (LAMP1)
proteins and immunoconjugates comprising said antibodies conjugated
or linked to a growth inhibitory agent. Pharmaceutical compositions
comprising antibodies or immunoconjugates of the invention and use
of the antibodies or immunoconjugates for the treatment of cancer
are also provided, as well as LAMP1 antibodies, isolated nucleic
acids, vectors and host cells comprising a sequence encoding said
antibodies and the use of said antibody as a diagnostic tool. The
application further provides for the detection of LAMP1 gene
amplification or gain in cancer cells leading to the determination
if patients with cancer are likely to respond to anti-LAMP1
therapy. Therefore, it is proposed an in vitro method of selecting
patients with cancer which comprises determining, in a biological
sample of a patient with cancer which includes cancer cells, if
said patient harbors a LAMP1 gene copy number gain; and selecting
the patient based on the presence of LAMP1 gene copy number gain.
Anti-LAMP1 therapeutic agent for use for treating cancer in a
patient harboring LAMP1 gene copy number gain in cancer cells is
further provided.
Inventors: |
BAUDAT; Yves; (Paris,
FR) ; BLANCHE; Francis; (Paris, FR) ; CAMERON;
Beatrice; (Paris, FR) ; DABDOUBI; Tarik; (Le
Coudray Montceaux, FR) ; LEFEBVRE; Anne-Marie; (Le
Plessis Pate, FR) ; MATHIEU; Magali; (Choisy le Roi,
FR) ; MERINO-TRIGO; Ana; (Paris, FR) ; NUNES;
Manoel; (Paris, FR) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
SANOFI |
Paris |
|
FR |
|
|
Family ID: |
49958431 |
Appl. No.: |
15/720380 |
Filed: |
September 29, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14751598 |
Jun 26, 2015 |
9809653 |
|
|
15720380 |
|
|
|
|
PCT/EP2013/078017 |
Dec 26, 2013 |
|
|
|
14751598 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 16/3023 20130101;
G01N 33/574 20130101; A61K 47/6855 20170801; A61K 47/6857 20170801;
C07K 16/30 20130101; A61K 2039/505 20130101; A61K 47/6803 20170801;
C07K 2317/33 20130101; C07K 16/2896 20130101; C07K 2317/73
20130101; C07K 2317/732 20130101; C07K 16/3069 20130101; C07K
2317/34 20130101; C07K 2317/41 20130101; C07K 2317/92 20130101;
C12Q 2600/106 20130101; C07K 16/3046 20130101; C12Q 1/6886
20130101; A61K 47/6849 20170801; A61K 47/6851 20170801; C07K
2317/24 20130101; A61P 35/00 20180101; A61K 47/6863 20170801; C12Q
2600/156 20130101; C07K 2317/77 20130101; C07K 2317/565
20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 47/68 20060101 A61K047/68; C07K 16/30 20060101
C07K016/30; C12Q 1/6886 20060101 C12Q001/6886; G01N 33/574 20060101
G01N033/574 |
Foreign Application Data
Date |
Code |
Application Number |
Dec 27, 2012 |
EP |
12306691.2 |
Dec 27, 2012 |
EP |
12306694.6 |
Claims
1. An immunoconjugate comprising a) an antibody or antigen binding
fragment thereof wherein said antibody or antigen binding fragment
thereof i) binds to a first lumenal domain of human LAMP1 protein,
or ii) binds to a domain consisting of loops one to three of human
LAMP1 protein, or iii) binds to a fourth loop of human LAMP1
protein; and b) at least one growth inhibitory agent, wherein the
at least one growth inhibitory agent is linked to the antibody or
antigen binding fragment thereof.
2-5. (canceled)
6. The immunoconjugate according to claim 1, wherein the antibody
or antigen binding fragment thereof competes for binding to the
first lumenal domain of human LAMP1 protein with an antibody
selected from the group consisting of (i) an antibody comprising a
heavy chain variable domain having an amino acid sequence of SEQ ID
NO: 1 and a light chain variable domain having an amino acid
sequence SEQ ID NO: 5; or (ii) an antibody comprising a heavy chain
variable domain having an amino acid sequence of SEQ ID NO: 8 and a
light chain variable domain having an amino acid sequence SEQ ID
NO: 12; or (iii) an antibody comprising a heavy chain variable
domain having an amino acid sequence of SEQ ID NO: 15 and a light
chain variable domain having an amino acid sequence of SEQ ID NO:
16; or (i) an antibody comprising a heavy chain variable domain
having an amino acid sequence of SEQ ID NO: 42 and a light chain
variable domain having an amino acid sequence of SEQ ID NO: 46; or
(iv) an antibody comprising a heavy chain variable domain having an
amino acid sequence of SEQ ID NO: 42 and a light chain variable
domain having an amino acid sequence of SEQ ID NO: 51; or (v) an
antibody comprising a heavy chain variable domain having an amino
acid sequence of SEQ ID NO: 53 and a light chain variable domain
having an amino acid sequence of SEQ ID NO: 56; or (vi) an antibody
comprising a heavy chain variable domain having an amino acid
sequence of SEQ ID NO: 54 and a light chain variable domain having
an amino acid sequence of SEQ ID NO: 57; or (vii) an antibody
comprising a heavy chain variable domain having an amino acid
sequence of SEQ ID NO: 55 and a light chain variable domain having
an amino acid sequence of SEQ ID NO: 58.
7-8. (canceled)
9. The immunoconjugate according to claim 1, wherein the antibody
or antigen binding fragment thereof comprises: (i) a CDR1-H having
an amino acid sequence of SEQ ID NO: 2, a CDR2-H having an amino
acid sequence of SEQ ID NO: 3, a CDR3-H having an amino acid
sequence of SEQ ID NO: 4, a CDR1-L having an amino acid sequence of
SEQ ID NO: 6, a CDR2-L having an amino acid sequence of DTS, and a
CDR3-L having an amino acid sequence of SEQ ID NO: 7; or (ii) a
CDR1-H having an amino acid sequence of SEQ ID NO: 9, a CDR2-H
having an amino acid sequence of SEQ ID NO: 10, a CDR3-H having an
amino acid sequence of SEQ ID NO: 11, a CDR1-L having an amino acid
sequence of SEQ ID NO: 13, a CDR2-L having an amino acid sequence
of AAS, and a CDR3-L having an amino acid sequence of SEQ ID NO:
14; or (iii) a CDR1-H having an amino acid sequence of SEQ ID NO:
43, a CDR2-H having an amino acid sequence of SEQ ID NO: 44, a
CDR3-H having an amino acid sequence of SEQ ID NO: 45, a CDR1-L
having an amino acid sequence of SEQ ID NO: 47, a CDR2-L having an
amino acid sequence of YTS, and a CDR3-L having an amino acid
sequence of SEQ ID NO: 48 or SEQ ID NO: 52.
10-12. (canceled)
13. The immunoconjugate according to claim 1 wherein the antibody
is a chimeric or a humanised antibody.
14. The immunoconjugate according to claim 1, wherein the antibody
comprises: i) a heavy chain having an amino acid sequence of SEQ ID
NO: 17 and a light chain having an amino acid sequence of SEQ ID
NO: 18; or ii) a heavy chain having an amino acid sequence of SEQ
ID NO: 19 and a light chain having an amino acid sequence of SEQ ID
NO: 20; or iii) a heavy chain having an amino acid sequence of SEQ
ID NO: 21 and a light chain having an amino acid sequence of SEQ ID
NO: 22; or iv) a heavy chain having an amino acid sequence of SEQ
ID NO: 49 and a light chain having an amino acid sequence of SEQ ID
NO: 50, or v) a heavy chain having an amino acid sequence of SEQ ID
NO: 49 and a light chain having an amino acid sequence of SEQ ID
NO: 81, or vi) a heavy chain having an amino acid sequence of SEQ
ID NO: 60 and a light chain having an amino acid sequence of SEQ ID
NO: 59; or vii) a heavy chain having an amino acid sequence of SEQ
ID NO: 62 and a light chain having an amino acid sequence of SEQ ID
NO: 61; or Viii) a heavy chain having an amino acid sequence of SEQ
ID NO: 64 and a light chain having an amino acid sequence of SEQ ID
NO: 63.
15. (canceled)
16. The immunoconjugate according to claim 1, wherein the antibody
or antigen binding fragment thereof binds to a region of Loop 4
comprising the amino acids 360 to 375 of human LAMP1 (SEQ ID NO:
82).
17. The immunoconjugate according to claim 16, wherein the antibody
or antigen binding fragment thereof comprises a CDR1-H having an
amino acid sequence of SEQ ID NO: 83, a CDR2-H having an amino acid
sequence of SEQ ID NO: 84, a CDR3-H having an amino acid sequence
of SEQ ID NO: 85, a CDR1-L having an amino acid sequence of SEQ ID
NO: 86, a CDR2-L having an amino acid sequence of NAK, and a CDR3-L
having an amino acid sequence of SEQ ID NO: 87.
18-22. (canceled)
23. The immunoconjugate according to claim 1, wherein said at least
one growth inhibitory agent is a cytotoxic agent or a radioactive
isotope.
24-26. (canceled)
27. The immunoconjugate conjugate according to claim 23, wherein
said growth inhibitory agent is
(N.sup.2'-deacetyl-N.sup.2'-(3-mercapto-1-oxopropyl)-maytansine)
DM1 or
N.sup.2'-deacetyl-N.sup.2'(4-methyl-4-mercapto-1-oxopentyl)-maytansine
(DM4).
28. (canceled)
29. The immunoconjugate according to claim 1, wherein said growth
inhibitory agent is covalently attached to the antibody or antigen
binding fragment thereof via a linker is selected from the group
consisting of N-succinimidyl pyridyldithiobutyrate (SPDB),
4-(Pyridin-2-yldisulfanyl)-2-sulfo-butyric acid (sulfo-SPDB), and
succinimidyl (N-maleimidomethyl) cyclohexane-1-carboxylate
(SMCC).
30. The immunoconjugate according to claim 29, wherein said linker
is N-succinimidyl pyridyldithiobutyrate (SPDB) and the growth
inhibitory agent is
N.sup.2'-deacetyl-N.sup.2'-(4-methyl-4-mercapto-1-oxopentyl)-may-
tansine (DM4).
31. The immunoconjugate according to claim 29, wherein said linker
is 4-(Pyridin-2-yldisulfanyl)-2-sulfo-butyric acid (sulfo-SPDB) and
the growth inhibitory agent is
N.sup.2'-deacetyl-N.sup.2'-(4-methyl-4-mercapto-1-oxopentyl)-maytansine
(DM4).
32. The immunoconjugate according to claim 29, wherein said linker
is succinimidyl (N-maleimidomethyl) cyclohexane-1-carboxylate
(SMCC) and the growth inhibitory agent is
N.sup.2'-deacetyl-N.sup.2'-(3-mercapto-1-oxopropyl)-maytansine
(DM1).
33. The immunoconjugate according to claim 27, wherein the
immunoconjugate is characterised by a drug-to-antibody ratio (DAR)
ranging from 1 to 10, the DAR being calculated from the ratio of
the drug concentration to that of the antibody: DAR=C.sub.D/C.sub.A
wherein
C.sub.D=[(.epsilon..sub.A280.times.A.sub.252)-(.epsilon..sub.A252.times.A-
.sub.280)]/[(.epsilon..sub.D252.times..epsilon..sub.A280)-(.epsilon..sub.A-
252.times..epsilon..sub.D280)]
C.sub.A=[A.sub.280-(C.sub.D.times..epsilon..sub.D280)]/.epsilon..sub.A280
and .epsilon..sub.D252 and .epsilon..sub.D280 are respectively the
molar extinction coefficients of the drug at 252 nm and 280 nm;
.epsilon..sub.A252 and .epsilon..sub.A280 are respectively the
molar extinction coefficients of the antibody at 252 nm and 280 nm;
(A.sub.252) and A.sub.280 are respectively the absorbances for the
conjugate at 252 nm (A.sub.252) and at 280 nm (A.sub.280), measured
using a classic spectrophotometer apparatus.
34. An isolated antibody or antigen binding fragment thereof,
wherein said antibody or antigen binding fragment thereof binds to
i) a first lumenal domain of human LAMP1 protein, or ii) binds to a
domain consisting of loops one to three of human LAMP1 protein, or
iii) binds to a fourth loop of human LAMP1 protein.
35. The isolated antibody or antigen binding fragment thereof
according to claim 34, wherein the antibody or antigen binding
fragment thereof competes for binding to the first lumenal domain
of human LAMP1 protein with an antibody selected from the group
consisting of (i) an antibody comprising a heavy chain variable
domain having an amino acid sequence of SEQ ID NO: 1 and a light
chain variable domain having an amino acid sequence of SEQ ID NO:
5; or (ii) an antibody comprising a heavy chain variable domain
having an amino acid sequence of SEQ ID NO: 8 and a light chain
variable domain having an amino acid sequence of SEQ ID NO: 12; or
(iii) an antibody comprising a heavy chain variable domain having
an amino acid sequence of SEQ ID NO: 15 and a light chain variable
domain having an amino acid sequence of SEQ ID NO: 16; or (ii) an
antibody comprising a heavy chain variable domain having an amino
acid sequence of SEQ ID NO: 42 and a light chain variable domain
having an amino acid sequence of SEQ ID NO: 46; or (iv) an antibody
comprising a heavy chain variable domain having an amino acid
sequence of SEQ ID NO: 42 and a light chain variable domain having
an amino acid sequence of SEQ ID NO: 51; or (v) an antibody
comprising a heavy chain variable domain having an amino acid
sequence of SEQ ID NO: 53 and a light chain variable domain having
an amino acid sequence of SEQ ID NO: 56, or (vi) an antibody
comprising a heavy chain variable domain having an amino acid
sequence of SEQ ID NO: 54 and a light chain variable domain having
an amino acid sequence of SEQ ID NO: 57, or (vii) an antibody
comprising a heavy chain variable domain having an amino acid
sequence of SEQ ID NO: 55 and a light chain variable domain having
an amino acid sequence of SEQ ID NO: 58.
36-41. (canceled)
42. An isolated anti-LAMP-1 antibody or antigen binding fragment
thereof according to claim 34, wherein said antibody or antigen
binding fragment thereof comprises: (i) a CDR1-H having an amino
acid sequence of SEQ ID NO: 2, a CDR2-H having an amino acid
sequence of SEQ ID NO: 3, and a CDR3-H having an amino acid
sequence of SEQ ID NO: 4; and a CDR1-L having an amino acid
sequence of SEQ ID NO: 6, a CDR2-L having an amino acid sequence of
DTS, and a CDR3-L having an amino acid sequence of SEQ ID NO: 7; or
(ii) a CDR1-H having an amino acid sequence of SEQ ID NO: 9, a
CDR2-H having an amino acid sequence of SEQ ID NO: 10, a CDR3-H
having an amino acid sequence of SEQ ID NO: 11; and a CDR1-L having
an amino acid sequence of SEQ ID NO: 13, a CDR2-L having an amino
acid sequence of AAS, and a CDR3-L having an amino acid sequence of
SEQ ID NO: 14; or (iii) a CDR1-H having an amino acid sequence of
SEQ ID NO: 43, a CDR2-H having an amino acid sequence of SEQ ID NO:
44, and a CDR3-H having an amino acid sequence of SEQ ID NO: 45,
and a CDR1-L having an amino acid sequence of SEQ ID NO: 47, a
CDR2-L having an amino acid sequence of YTS, and a CDR3-L having an
amino acid sequence of SEQ ID NO: 48 or SEQ ID NO: 52; or (iv)
CDR1-H having an amino acid sequence of SEQ ID NO: 83, a CDR2-H
having an amino acid sequence of SEQ ID NO: 84, a CDR3-H having an
amino acid sequence of SEQ ID NO: 85, and a CDR1-L having an amino
acid sequence of SEQ ID NO: 86, a CDR2-L having an amino acid
sequence of NAK, and a CDR3-L having an amino acid sequence of SEQ
ID NO: 87.
43. (canceled)
44. A pharmaceutical composition comprising an immunoconjugate
according to claim 1 and a pharmaceutically acceptable carrier.
45-50. (canceled)
51. An isolated nucleic acid comprising a sequence encoding an
antibody or antigen binding fragment thereof wherein said antibody
or antigen binding fragment thereof comprises (i) a CDR1-H having
an amino acid sequence of SEQ ID NO: 2, a CDR2-H having an amino
acid sequence of SEQ ID NO: 3, and a CDR3-H having an amino acid
sequence of SEQ ID NO: 4; and a CDR1-L having an amino acid
sequence of SEQ ID NO: 6, a CDR2-L having an amino acid sequence of
DTS, and a CDR3-L having an amino acid sequence of SEQ ID NO: 7; or
(ii) a CDR1-H having an amino acid sequence of SEQ ID NO: 9, a
CDR2-H having an amino acid sequence of SEQ ID NO: 10, a CDR3-H
having an amino acid sequence of SEQ ID NO: 11; and a CDR1-L having
an amino acid sequence of SEQ ID NO: 13, a CDR2-L having an amino
acid sequence of AAS, and a CDR3-L having an amino acid sequence of
SEQ ID NO: 14; or (iii) a CDR1-H having an amino acid sequence of
SEQ ID NO: 43, a CDR2-H having an amino acid sequence of SEQ ID NO:
44, and a CDR3-H having an amino acid sequence of SEQ ID NO: 45,
and a CDR1-L having an amino acid sequence of SEQ ID NO: 47, a
CDR2-L having an amino acid sequence of YTS, and a CDR3-L having an
amino acid sequence of SEQ ID NO: 48 or SEQ ID NO: 52; or (iv)
CDR1-H having an amino acid sequence of SEQ ID NO: 83, a CDR2-H
having an amino acid sequence of SEQ ID NO: 84, a CDR3-H having an
amino acid sequence of SEQ ID NO: 85, and a CDR1-L having an amino
acid sequence of SEQ ID NO: 86, a CDR2-L having an amino acid
sequence of NAK, and a CDR3-L having an amino acid sequence of SEQ
ID NO: 87.
52. A host cell which has been transformed by a nucleic acid
according to claim 51.
53. An in vitro method of selecting patients with cancer who are
likely to respond to anti-LAMP1 therapy, wherein said method
comprises: a) determining, in a biological sample of a patient with
cancer which includes cancer cells, if said patient harbors a LAMP1
gene copy number gain; and b) selecting the patient based on the
presence of LAMP1 gene copy number gain, and wherein said patient
is selected as likely to respond to anti-LAMP1 therapy if said
patient harbors a LAMP1 gene copy number gain.
54-68. (canceled)
69. A method a patient in need thereof comprising administering to
the patient an antibody or antigen binding fragment thereof wherein
said antibody or antigen binding fragment thereof i) binds to the
first lumenal domain of human LAMP1 protein, or binds to a domain
consisting of loops one to three of human LAMP1 protein, or HD
binds to a fourth loop of human LAMP1 protein; wherein the patient
has a LAMP1 expressing cancer.
70. The method according to claim 69, wherein the antibody or
antigen binding fragment thereof is linked to at least one growth
inhibitory agent, wherein the at least one growth inhibitory.
Description
[0001] This application is a divisional of U.S. patent application
Ser. No. 14/751,598, filed Jun. 26, 2015, which is a continuation
of International Application No. PCT/EP2013/078017, filed Dec. 26,
2013, which claims priority to European Patent Application No.
12306694.6, filed Dec. 27, 2012, and to European Patent Application
No. 12306691.2, filed Dec. 27, 2012, all of which are incorporated
herein by reference in their entirety.
BACKGROUND
[0002] Antibodies are provided which specifically bind human and
Macaca fascicularis lysosomal-associated membrane protein 1 (LAMP1)
proteins and immunoconjugates comprising said antibodies conjugated
or linked to a growth inhibitory agent. Pharmaceutical compositions
comprising antibodies or immunoconjugates of the invention and use
of the antibodies or immunoconjugates for the treatment of cancer
are also provided, as well as LAMP1 antibodies, isolated nucleic
acids, vectors and host cells comprising a sequence encoding said
antibodies and the use of said antibody as a diagnostic tool. The
application further provides for the detection of LAMP1 gene
amplification or gain in cancer cells leading to the determination
if patients with cancer are likely to respond to anti-LAMP1
therapy. Therefore, it is proposed an in vitro method of selecting
patients with cancer which comprises determining, in a biological
sample of a patient with cancer which includes cancer cells, if
said patient harbors a LAMP1 gene copy number gain; and selecting
the patient based on the presence of LAMP1 gene copy number gain.
Anti-LAMP1 therapeutic agent for use for treating cancer in a
patient harboring LAMP1 gene copy number gain in cancer cells is
further provided.
[0003] Lysosome-associated membrane protein 1 (LAMP1), also known
as CD107 antigen-like family member A (CD107a), is a single-pass
type I membrane protein, which belongs to the LAMP family. LAMP2 is
the closest member of the family and both proteins are the most
abundant glycoproteins within the lysosomal membrane (Sawada, R. et
al., 1993, J Biol Chem 268: 12675-12681).
[0004] Although encoded by separate genes, with LAMP1 located on
chromosome 13q34 and LAMP2 on Xq24-25, the proteins are similar in
their primary structure, with .about.36% sequence homology (Mattei,
M. G. et al., 1990, J Biol Chem 265:7548-7551). LAMP1 and LAMP2
consist of a polypeptide core of approximately 40 kDa; they are
both anchored via their C-terminus to the lysosomal membrane and
expose the largest part, extensively glycosylated, to the lumenal
side of lysosomes. Both proteins are among the most heavily
glycosylated of cellular proteins with .about.50% of their mass as
carbohydrates and these glycosylations seem to be the key for
maintaining lysosome acidity and protecting the lysosomal membranes
from autodigestion. However, the full biological function of these
two highly glycosylated proteins in particular LAMP1 still needs to
be elucidated (Fukuda, M., 1991, J Biol Chem, 266:21327-21330;
Winchester, B., 2001, European Journal of Paediatry Neurology,
5:11-19; Gasnier, B., 2009 Biochimica et Biophysica Acta
1793:636-649).
[0005] LAMP1 is highly expressed in late endosomes and lysosomes
designating LAMP1 as marker for these two organelles (Cook, N. R.
et al., 2004, Traffic, 5 (9): 685-699). Thus, most of the
literature on LAMP1 relates to endocytosis, pinoscyosis, or
phagocytosis (Cook, N. R. et al., 2004, Traffic, 5 (9):
685-699).
[0006] Although the majority of LAMP1 and LAMP2 reside in the
lysosome, some LAMP1 and LAMP2 immunoreactivity is also observed at
low levels at the plasma membrane. The LAMP1 found in the plasma
membrane represents only 1-2% of total LAMP1. This is for example
true for peripheral blood lymphocytes (Holcombe, R. F. et al. 1993,
Clin Immunol Immunopathol. 67(1): 31-39) and platelets
(Silverstein, R. L. and Febbraio, M., 1992, Blood 80:
1470-1475).
[0007] Increased cell surface expression of LAMP1 and LAMP2 has
been observed in tumor cell lines, for example in highly metastatic
colonic carcinoma L4 cells (Saitoh, O. et al., 1992, J Biol Chem
267: 5700-5711), on human metastasizing melanoma A2058, HT1080
(human fibrosarcoma), CaCo-2 (human colon-adenocarcinoma) cells and
in colorectal neoplasms (Furuta, K. et al., 2001, J Pathol 159 (2):
449-455).
[0008] The chromosomal region 13q34 in which LAMP1 is located has
recently been linked to amplification events including a larger
amplicon that involves CUL4A, LAMP1, TFDP1, and GAS6 in human
breast cancer (Abba, Martin C. et al.; Cancer Res 2007; 4104).
TFDP1 and perhaps CUL4A were identified in the above mentioned
publication as the leading genes driving the amplification
phenomenon. In particular, analysis of publicly available breast
cancer gene expression (microarrays) data sets indicated that TFDP1
overexpression is associated with estrogen receptor (ER)-negative
and high-grade breast carcinomas, as well as shorter overall
survival, relapse-free survival, and metastasis-free interval.
Conversely, LAMP1 expression did not significantly correlate with
tumor grade. In the end, Abba et al. did not report that LAMP1
amplification translated into LAMP1 overexpression in human breast
cancer cells.
[0009] The 11 amino-acid cytoplasmic tail of LAMP1 contains a 7
amino-acid linker sequence and a 4 amino acid long tyrosine motif
(YQTI). It was shown that small changes in the spacing of this
motif relative to the membrane dramatically impair sorting in the
early/sorting endosomes. Mutations within said tyrosine motif were
shown to have an impact on the binding of LAMP1 to adaptor proteins
leading as well to impaired sorting (Obermuller, S. et al., 2002,
Journal of Cell Science 115: 185-194; Rohrer, J. et al., 1996,
Journal of Cell Biology 132(4): 565-576). Therefore, the abnormal
cell surface expression of LAMP1 in different cancer cell lines
might be related to mutations in the cytoplasmic tail even though
the mechanism is still unclear. Furthermore, it has been shown that
certain point mutations in the cytoplasmic tail lead to plasma
membrane accumulation (Gough, N. R. et al., 1999, Journal of Cell
Science 112 (23): 4257-4269).
[0010] Due to the fact that LAMP1 is a marker for endosomes and
lysosomes, numerous commercially available anti-LAMP1 antibodies
were developed for research purposes. These antibodies are either
polyclonal or monoclonal and are restricted to some biochemical
application such as immunohistochemistry (IHC), Western blots (WB),
Fluorescence activated cell sorter (FACS) analysis,
Immunoprecipitation (IP) and Enzyme-linked immunosorbent assay
(ELISA).
[0011] LAMP1 protein also has been detected at the cell membrane of
tumor cells.
[0012] E. Venetsanakos (WO 2005/012912) suggested that LAMP1 is
expressed on the surface of colon cancer cells but not on the
surface of normal colon cells and proposed that tumor growth might
be reduced by targeting a cytotoxic agent to LAMP1 via an
anti-LAMP1 antibody. Venetsanakos did not describe, however,
preparation of anti-LAMP1 antibodies or conjugates thereof with
cytotoxic or cytostatic agent or any data supporting his
hypothesis. Indeed, though a decade has passed since Venetsanakos'
initial filing and no anti-LAMP1 antibodies or their use as
immunoconjugates in an anti-LAMP1 therapy has entered clinical
development, so far. Accordingly, a great need exists for
anti-LAMP1 antibodies or immunoconjugates for the treatment of
cancer.
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] FIG. 1: sequence alignment of human and Macaca fascicularis
LAMP1 full-length proteins.
[0014] FIG. 2: Expression Profile of LAMP1 derived from FACS
analysis with the monoclonal mouse antibodies Mab1 and MAb2.
[0015] FIG. 3: Reactivity of MAb1 with human LAMP1 and cynomolgus
monkey LAMP1.
[0016] FIG. 4: Evaluation of the competition of MAb2 (murine) with
MAb1 (chimeric) for binding to LAMP1. With 2nd anti hFc being a
secondary antibody anti-human Fc and 2nd anti mFc being secondary
antibody anti-mouse Fc.
[0017] FIG. 5: Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb1 conjugate against primary human colon
adenocarcinoma CR-LRB-010P in SCID female mice.
[0018] FIG. 6: Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb1 conjugate against primary lung tumor LUN-NIC-0014
in SCID female mice.
[0019] FIG. 7: HRMS data of DM4-SPDB-chMAb1 conjugate.
[0020] FIG. 8A: Box Plot of RNA Intensity expression of LAMP1 by
Copy Number Changer category.
[0021] FIG. 8B: Plot of LAMP1 Copy Number according to LAMP1 mRNA
expression on colon tumors. Points represent individual mRNA
expression, bars corresponds to mean values.
[0022] FIG. 9: A Sperman Correlation analysis of LAMP1 mRNA and
Copy Number Change data.
[0023] FIG. 10A: Box Plot of RNA Intensity expression and LAMP1 by
Copy Number Change in Soft Tissue Sarcoma.
[0024] FIG. 10B: Box Plot of RNA Intensity expression and LAMP1 by
Copy Number Change in Corpus Endometrioid Carcinoma.
[0025] FIG. 10C: Box Plot of RNA Intensity expression and LAMP1 by
Copy Number Change in Breast Invasive Carcinoma.
[0026] FIG. 11A: Histogram of LAMP1 Copy number by LAMP1 membrane
expression (IHC category scoring) for colon tumor PDX.
[0027] FIG. 11B: Histogram of LAMP1 Copy number by LAMP1 membrane
expression (IHC category scoring) for lung and stomach tumor
PDXs.
[0028] FIG. 12: Expression profile oMAb1, 2 and 3 onto three PDXs
(CR-IGR-034P, LUN-Nlc-014 and BRE-IGR-0159).
[0029] FIG. 13: Graphical representation showing the residues of
Fab1 that are part of the paratope (ie residues with atoms within
4A of the antigen atoms).
[0030] FIG. 14: Graphical representation showing the residues of
hLAMP1 forming the epitope for Fab1 (ie residues with atoms within
4A of the antigen atoms).
[0031] FIG. 15: Graphical representation showing the overlay of the
residues of hLAMP1 and a model of G187E corresponding to cLAMP1.
Differences in orientation of Lys151 of hLAMP1 and of Tyr32 of
Fab1-LC are indicated, necessary to accommodate the mutation from
Glycine to Glutamine at position 187.
[0032] FIG. 16: Graphical representation showing an overlay of the
heavy chain residues of Fab1 and a model of Fab1 with the mutation
1280 in its heavy chain sequence of SEQ ID NO: 53 and the
interaction with LAMP1.
[0033] FIG. 17: Graphical representation showing an overlay of the
heavy chain residues of Fab1 and a model of Fab1 with the mutation
N55R in its heavy chain sequence of SEQ ID NO: 53 and the
interaction with LAMP1.
[0034] FIG. 18: HRMS data of DM4-SPDB-huMAb1_3 conjugate.
[0035] FIG. 19: HRMS data of DM4-SPDB-huMAb1_1 conjugate.
[0036] FIG. 20: HRMS data of DM4-SPDB-huMAb1_2 conjugate.
[0037] FIG. 21: HRMS data of DM4-SPDB-chMAb2 conjugate.
[0038] FIG. 22: HRMS data of DM4-SPDB-chMAb3 VLR24-R93
conjugate.
[0039] FIG. 23: Evaluation of the anti-tumor activity of
DM4-SPDB-huMAb1_1 against primary human colon adenocarcinoma
CR-LRB-010P in SCID female mice.
[0040] FIG. 24: Evaluation of the anti-tumor activity of
DM4-SPDB-huMAb1_1 against human primary invasive ductal carcinoma
BRE-IGR-0159 in SCID female mice.
[0041] FIG. 25A and FIG. 25B: Evaluation of the anti-tumor activity
of DM4-SPDB-huMAb1_1 against primary human lung tumor LUN-NIC-0070
in SCID female mice.
[0042] FIG. 26: Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb2 against primary human colon adenocarcinoma
CR-LRB-010P in SCID female mice.
[0043] FIG. 27: Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb2 against human primary invasive ductal carcinoma
BRE-IGR-0159 in SCID female mice.
[0044] FIG. 28: Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb3 against human primary invasive ductal carcinoma
BRE-IGR-0159 in SCID female mice.
[0045] FIG. 29: Graphical representation of the in vitro ADCC
mediated by chMAb1, chMAb2 and chMAb3.
[0046] FIG. 30A through FIG. 30C: Graphical representation of the
in vitro ADCC dependency on LAMP1 antigen density with HCT hu LAMP1
clone 8 LAMP1 antigen denisty: 160000 (FIG. 30A), HCT hu LAMP1
clone 4 LAMP1 antigen denisty: 2000 (FIG. 30B), and HCT hu LAMP1
clone 12 LAMP1 antigen denisty: 5000 (FIG. 30C).
[0047] FIG. 31A: Comparison of in vitro ADCC of chMAb1 and
DM4-SPDB-chMAb1.
[0048] FIG. 31B: Comparison of in vitro ADCC of chMAb2 and
DM4-SPDB-chMAb2.
[0049] FIG. 32: In vitro ADCC mediated by huMAb1_1.
[0050] FIG. 33: In vitro ADCC mediated by DM4-SPDB-huMAb1_1.
[0051] FIG. 34A and FIG. 34B: Flow cytometry analysis of ADCP with
a) Macrophages and target cells without Mab1_1 and b) Macrophages
and target cells and Mab1_1.
[0052] FIG. 35: In vitro ADCP of huMAb1_negB.
[0053] FIG. 36: Loss of in vitro ADCP for huMAb1_negA.
[0054] FIG. 37: HRMS data of huMAb1_1 conjugate modified with SNPP
with
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy)ethoxy)pyridine-2,6-diyl)
bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hbenzo[e]-
pyrrolo[1,2-a][1,4] diazepin-5(11aH)-one)DM4-SPDB-chMAb2
conjugate.
[0055] FIG. 38: Imunohistochemistry staining (IHC) on FFPE sample
of colon adenocarcinoma patient derived xenograft CR-LRB-010P and
human breast carcinoma with the polyclonal rabbit rAb4 Antibody.
The Negative controls were performed by omission of the primary
antibody. Furthermore, other irrelevant antibodies were negative or
displayed intracellular immunostaining.
[0056] FIG. 39: Immunocytochemistry (ICC) in FFPE format with the
polyclonal rabbit rAb4 Antibody at 1 .mu.g/mL.
[0057] FIG. 40: Imunohistochemistry staining (IHC) on FFPE sample
of adenocarcinoma patient derived xenograft CR-LRB-010P with MAb4
obtained from hybridoma 88LAMP1-2. The negative control was
performed by omission of the primary antibody.
[0058] FIG. 41: Binding affinity by ELISA of MAb4 towards LAMP1
(black) or LAMP2 (grey).
DETAILED DESCRIPTION
Definitions
[0059] As used herein "LAMP1" designates the "Lysosomal associated
membrane protein 1", a member of a family of glycoproteins that is
also known as LAMPA, CD107a or LGP120. LAMP1 is, according to
protein expression data for human tumoral samples in comparison to
non tumoral samples presented in the following Example 5, expressed
at the cell surface of colon adenocarcinomas, gastrointestinal
tumors (small intestine, rectum, parotid gland), vital organs
tumors (lung, liver, stomach, pancreas and kidney), reproductive
organ tumors (breast, ovary and prostate) as well as skin, larynx
and soft tissue tumors.
[0060] The human gene LAMP1 is found on chromosome 13q34
(113,951,469-113,977,441) and has a total length of 26,273 kb.
[0061] A reference sequence of the cDNA coding for full-length
human LAMP1, including the sequence encoding the signal peptide, is
available from the GenBank database under accession number
NM_005561.3 (SEQ ID NO: 23) and the representative protein
sequence, including the signal peptide (positions 1-28) is
available under NP_005552.3 (SEQ ID NO: 24). One potential isoform
of LAMP1 has been reported which would miss the amino acids at
positions 136-188 of SEQ ID NO: 24, corresponding to exon 4 of the
gene coding for human LAMP1. No synonymous SNPs have been
identified in Caucasian population of at least 60 individuals.
[0062] Concerning its orthologs, human LAMP1 shares 66% sequence
identity with respectively mouse LAMP1 (NP_034814, SEQ ID NO: 25)
and rat LAMP1 (NP_036989, SEQ ID NO: 26), and human and Macaca
mulatta LAMP1 (XP_001087801, SEQ ID NO: 27) share 96% sequence
identity.
[0063] The sequence of LAMP1 from Macaca mulatta (SEQ ID NO: 27)
and the predicted sequence of Macaca fascicularis (SEQ ID NO: 39)
are identical to 99%, said sequences differing by one additional
leucine at position 11 of Macaca mulatta LAMP1 (SEQ ID NO: 27),
i.e. in the signal peptide. Accordingly the sequences of mature
LAMP1 from Macaca mulatta and Macaca fascicularis are
identical.
[0064] The closest member of the LAMP family is LAMP 2 (P13473,
human LAMP2, soluble LAMP2 protein SEQ ID NO: 40). Human LAMP1 and
LAMP2 proteins share .about.36% sequence identity, and comprise
some conserved glycosylation sites.
[0065] A "domain" may be any region of a protein, generally defined
on the basis of sequence homologies and often related to a specific
structural or functional entity. The domain organization of LAMP1
has not been entirely published so far.
[0066] Human LAMP1 consists of 417 amino acid residues and 28
amino-terminal residues corresponding to a cleavable signal
peptide. The major portion of LAMP1 resides on the lumenal side of
the lysosome and is heavily glycosylated by N-glycans. LAMP1
contains 18 potential N-glycosylation sites of which 5 are occupied
with poly-N-acetyllactosamine glycans (Carlsson, S. R. and Fukuda,
M., 1990, J. Biol. Chem. 265(33): 20488-20495). They are clustered
into two domains separated by a hinge-like structure enriched with
prolines and serines many being linked to 0-glycans. LAMP1 has one
transmembrane domain consisting of 24 hydrophobic amino acids near
the COOH terminus, and contains a short cytoplasmic segment
composed of 11 amino acid residues at the COOH-terminal end.
[0067] The nomenclature of the two domains of LAMP1, "the first
lumenal domain" and the "second lumenal domain" are based on the
orientation of LAMP1 within its original localization, the
lysosome. Nevertheless, when LAMP1 is expressed at the cell
surface, the two lumenal domains become extracellular domains, and
therefore exposed at the cell surface. Therefore, in one embodiment
"extracellular" in context of the invention refers to LAMP1 protein
constructs comprising the first and/or second luminal domain(s) of
LAMP1 as defined below and/or variants thereof. The domain
organisation of human LAMP1 according to NP_005552.3 (SEQ ID NO:
24) has been mapped in example 6.1 and will be used in this
document as follows:
TABLE-US-00001 TABLE 1 Description of human LAMP1 domains LAMP1
Domains Positions in NP_005552 (SEQ ID NO: 24) Peptide signal
Met1-Ala28 First lumenal domain Ala29-Arg195 Loop 1, L1
Ala29-Leu100 Loop 2, L2 Thr101-Arg195 Hinge Pro196-Thr227 Second
lumenal domain Asn228-Met382 Loop 3, L3 Asn228-Ile309 Loop 4, L4
Leu310-Met382 Transmembrane domain Leu383-Gly406 Lysosome targeting
motif Arg407-Ile417
[0068] Accordingly, the domain consisting of the first to third
loops of human LAMP1 consists of amino acids at positions 29-309 of
SEQ ID NO: 24.
[0069] Domain organisation of Macaca fascicularis LAMP1 according
to the predicted sequence (SEQ ID NO: 39) is as follows:
TABLE-US-00002 TABLE 2 Description of Macaca fascicularis LAMP1
domains LAMP1 Domains Positions in SEQ ID NO: 39 Peptide signal
Met1-Ala26 First lumenal domain Ala27-Arg193 Loop 1, L1 Ala27-L98
Loop 2, L2 Thr99-Arg193 Hinge Pro194-Thr 225 Second lumenal domain
Asn226-Met380 Loop 3, L3 Asn226-Thr307 Loop 4, L4 Leu308-Met380
Transmembrane domain Leu381-Gly404 Lysosome targeting motif
Arg405-Ile415
[0070] Accordingly, the domain consisting of first to third loops
of Macaca fascicularis LAMP1 consists of amino acids at positions
27-307 of SEQ ID NO: 39.
[0071] A sequence alignment of human and Macaca fascicularis LAMP1
full-length proteins is shown on FIG. 1.
[0072] The loop region 4 of human and Macaca fascicularis LAMP1 do
not contain any glycosylation site, which distinguishes Loop 4 from
Loops 1-3 of LAMP1.
[0073] Loops 1-4 have been defined from the primary amino acid
sequence, and has been mapped in example 6.1, but not from the 3D
structure of LAMP1 since the structure was not solved prior to this
work.
[0074] A "coding sequence" or a sequence "encoding" an expression
product, such as a RNA, polypeptide, protein, or enzyme, is a
nucleotide sequence that, when expressed, results in the production
of that RNA, polypeptide, protein, or enzyme, i.e., the nucleotide
sequence encodes an amino acid sequence for that polypeptide,
protein or enzyme. A coding sequence for a protein may include a
start codon (usually ATG) and a stop codon. A region encoding an
expression product present in the DNA is called "coding DNA
sequence" or "CDS".
[0075] As used herein, references to specific proteins (e.g.,
antibodies) can include a polypeptide having a native amino acid
sequence, as well as variants and modified forms regardless of
their origin or mode of preparation. A protein which has a native
amino acid sequence is a protein having the same amino acid
sequence as obtained from nature. Such native sequence proteins can
be isolated from nature or can be prepared using standard
recombinant and/or synthetic methods. Native sequence proteins
specifically encompass naturally occurring truncated or soluble
forms, naturally occurring variant forms (e.g., alternatively
spliced forms), naturally occurring allelic variants and forms
including post-translational modifications. A native sequence
protein includes proteins following post-translational
modifications such as glycosylation, or phosphorylation, or other
modifications of some amino acid residues.
[0076] As used herein, the term "marker" refers to any biological,
chemical or physical mean allowing identifying the presence, and
possibly quantifying the expression of a target gene and/or protein
in a biological sample. Such markers are well known from one
skilled in the art. Advantageously, the markers according to the
invention are genetic markers and/or protein markers.
[0077] The term "gene" means a DNA sequence that codes for, or
corresponds to, a particular sequence of amino acids which
comprises all or part of one or more proteins or enzymes, and may
or may not include regulatory DNA sequences, such as promoter
sequences, which determine for example the conditions under which
the gene is expressed. Some genes, which are not structural genes,
may be transcribed from DNA to RNA, but are not translated into an
amino acid sequence. Other genes may function as regulators of
structural genes or as regulators of DNA transcription. In
particular, the term gene may be intended for the genomic sequence
encoding a protein, i.e. a sequence comprising regulator, promoter,
intron and exon sequences.
[0078] As used herein, the terms "copy number variation", "copy
number variant" and "CNV" are used indifferently and refer to a DNA
segment of 1 kb or larger and present at variable copy number in
comparison with a reference genome. The terms "structural variant",
"duplicon", "indel", "intermediate-sized structural variant (ISV)",
"low copy repeat (LCR)", "multisite variant (MSV)", "paralogous
sequence variant (PSV)", "segmental duplication", "interchromosomal
duplication", and "intrachromosomal duplication", found in the
literature, are included herein in the term "CNV".
[0079] Furthermore, copy number variation can refer to a single
gene, or include a contiguous set of genes.
[0080] As used herein "gene number" describes the numbers of genes
present in the cell. In diploid organisms, in a normal state, two
copies of each nucleic sequence are naturally present in the
genome, therefore, the copy number (CN) is =2. In particular, the
genome displays two alleles for each gene, one on each chromosome
of a pair of homologous chromosomes (except for the genes localized
on sexual chromosomes).
[0081] Herein the word "gene number" and "gene copy number" can be
used interchangeably.
[0082] In the context of the invention, a "copy" of a sequence
encompasses a sequence identical to said sequence but also allelic
variations of said sequence.
[0083] One example to measure DNA copy number and therefore DNA
copy number change is array-based CGH which is a high-throughput
technique to measure DNA copy number change across the genome. The
DNA fragments or "clones" of test and reference samples are
hybridized to mapped array fragments. Log 2 intensity ratios of
test to reference provide useful information about genome-wide
profiles in copy number.
[0084] The "Log 2" or "Log 2ratio" value is used to describe the
copy number of a gene or a DNA fragment in a cell genome. In an
ideal situation, the log 2 ratio of normal (copy-variation neutral)
clones is log 2(2/2)=0, single copy losses is log 2(1/2)=-1, and
single copy gains is log 2(3/2)=0.58. Multiple copy gains or
amplifications would have values of log 2(4/2), log 2(5/2), . . .
.
[0085] As used herein, the term "gain" of a sequence refers in
general to the presence of a copy number .gtoreq.2.5 (alternatively
a Log 2ratio .gtoreq.0.32) of said sequence in the diploid genome
of a subject. These .gtoreq.2.5 copies may be adjacent or not on
the genome; in particular they may be present in different regions
of a pair of chromosomes or on chromosomes belonging to distinct
pairs of chromosomes of the genome.
[0086] Accordingly, the term "gene copy number gain" refers to the
presence of .gtoreq.2.5 copy numbers (alternatively a Log 2ratio
.gtoreq.0.32) of a specific gene in the diploid genome of a
subject. When the copy number=2.5, 50% of the cells used for
defining the copy number contain the usual 2 copies of the gene in
a diploid organism and 50% of the cells used for defining the copy
number contain the usual 2 copies and 1 additional copy more of
said gene (in total 3 copies of said gene).
[0087] The term "low gain" of a sequence refers in general to the
presence of a copy number .gtoreq.2.5 but <5 (alternatively
0.32.ltoreq. log 2 ratio <1.32) of said sequence in the diploid
genome of a subject. The terms "amplification", "Amp", or "high
gain" refer herein to the presence of a copy number .gtoreq.5, or
alternatively a Log 2.gtoreq.1.32, of a specific sequence in the
diploid genome of a subject. Accordingly, the term "gene number
amplification" refers to the presence of .gtoreq.5 copy numbers of
a specific gene in the diploid genome of a subject
[0088] As used herein, a "fragment of a sequence" corresponds to a
portion of said sequence, for instance of a nucleotide sequence.
Said fragment is preferably at least 10 bp long. More preferably
said fragment is at least 15 bp long, in particular at least 20 bp
long. Most preferably, said fragment is at least 25 bp long, at
least 30 bp long, in particular at least 33 bp long. A fragment of
the above sequence may be in particular a primer or probe.
[0089] In the context of the invention, a "mutated sequence" of a
reference sequence refers to a sequence including insertion(s),
deletion(s) or substitution(s) of one or more nucleotide(s),
wherein said mutated sequence is at least 75% identical to the
reference sequence. The percentage of sequence identity is
calculated by comparing the mutated sequence optimally aligned with
the reference sequence, determining the number of positions at
which the identical nucleic acid base (e.g., A, T, C, G, U, or I)
occurs in both sequences to yield the number of matched positions,
dividing the number of matched positions by the total number of
positions of the reference sequence, and multiplying the result by
100 to yield the percentage of sequence identity. Preferably, the
mutated sequence is at least 80%, 85%, 90%, 95% identical to the
reference sequence.
[0090] Preferably said mutated sequence of a reference sequence is
an allelic variant of said reference sequence. As used herein, an
"allelic variant" denotes any of two or more alternative forms of a
gene occupying the same chromosome locus.
[0091] A sequence "at least 85% identical to a reference sequence"
is a sequence having, on its entire length, 85%, or more, in
particular 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
sequence identity with the entire length of the reference
sequence.
[0092] A percentage of "sequence identity" may be determined by
comparing the two sequences, optimally aligned over a comparison
window, wherein the portion of the polynucleotide or polypeptide
sequence in the comparison window may comprise additions or
deletions (i.e. gaps) as compared to the reference sequence (which
does not comprise additions or deletions) for optimal alignment of
the two sequences. The percentage is calculated by determining the
number of positions at which the identical nucleic acid base or
amino acid residue occurs in both sequences to yield the number of
matched positions, dividing the number of matched positions by the
total number of positions in the window of comparison and
multiplying the result by 100 to yield the percentage of sequence
identity. Optimal alignment of sequences for comparison is
conducted by global pairwise alignment, e.g. using the algorithm of
Needleman and Wunsch J. Mol. Biol. 48: 443 (1970). The percentage
of sequence identity can be readily determined for instance using
the program Needle, with the BLOSUM62 matrix, and the following
parameters gap-open=10, gap-extend=0.5.
[0093] A "conservative amino acid substitution" is one in which an
amino acid residue is substituted by another amino acid residue
having a side chain R group with similar chemical properties (e.g.,
charge or hydrophobicity). In general, a conservative amino acid
substitution will not substantially change the functional
properties of a protein. Examples of groups of amino acids that
have side chains with similar chemical properties include 1)
aliphatic side chains: glycine, alanine, valine, leucine, and
isoleucine; 2) aliphatic-hydroxyl side chains: serine and
threonine; 3) amide-containing side chains: asparagine and
glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and
tryptophan; 5) basic side chains: lysine, arginine, and histidine;
6) acidic side chains: aspartic acid and glutamic acid; and 7)
sulfur-containing side chains: cysteine and methionine.
Conservative amino acids substitution groups are:
valine-leucine-isoleucine, phenylalanine-tyrosine-tryptophane,
lysine-arginine, alanine-valine, glutamate-aspartate, and
asparagine-glutamine.
[0094] An "antibody" may be a natural or conventional antibody in
which two heavy chains are linked to each other by disulfide bonds
and each heavy chain is linked to a light chain by a disulfide
bond. There are two types of light chain, lambda (I) and kappa
(.kappa.). There are five main heavy chain classes (or isotypes)
which determine the functional activity of an antibody molecule:
IgM, IgD, IgG, IgA and IgE. Each chain contains distinct sequence
domains. The light chain includes two domains or regions, a
variable domain (VL) and a constant domain (CL). The heavy chain
includes four domains, a variable domain (VH) and three constant
domains (CH1, CH2 and CH3, collectively referred to as CH). The
variable regions of both light (VL) and heavy (VH) chains determine
binding recognition and specificity to the antigen. The constant
region domains of the light (CL) and heavy (CH) chains confer
important biological properties such as antibody chain association,
secretion, trans-placental mobility, complement binding, and
binding to Fc receptors (FcR). The Fv fragment is the N-terminal
part of the Fab fragment of an immunoglobulin and consists of the
variable portions of one light chain and one heavy chain. The
specificity of the antibody resides in the structural
complementarity between the antibody combining site and the
antigenic determinant. Antibody combining sites are made up of
residues that are primarily from the hypervariable or
complementarity determining regions (CDRs). Occasionally, residues
from nonhypervariable or framework regions (FR) influence the
overall domain structure and hence the combining site.
Complementarity Determining Regions or CDRs refer to amino acid
sequences which together define the binding affinity and
specificity of the natural Fv region of a native immunoglobulin
binding site. The light and heavy chains of an immunoglobulin each
have three CDRs, designated CDR1-L, CDR2-L, CDR3-L and CDR1-H,
CDR2-H, CDR3-H, respectively. A conventional antibody
antigen-binding site, therefore, includes six CDRs, comprising the
CDR set from each of a heavy and a light chain V region.
[0095] "Framework Regions" (FRs) refer to amino acid sequences
interposed between CDRs, i.e. to those portions of immunoglobulin
light and heavy chain variable regions that are relatively
conserved among different immunoglobulins in a single species. The
light and heavy chains of an immunoglobulin each have four FRs,
designated FR1-L, FR2-L, FR3-L, FR4-L, and FR1-H, FR2-H, FR3-H,
FR4-H, respectively.
[0096] As used herein, a "human framework region" is a framework
region that is substantially identical (about 85%, or more, in
particular 90%, 95%, 97%, 99% or 100%) to the framework region of a
naturally occurring human antibody. [0097] In the context of the
invention, CDR/FR definition in an immunoglobulin light or heavy
chain is to be determined based on IMGT definition (Lefranc, M. P.
et al., 2003, Dev Comp Immunol. 27(1): 55-77; www.imgt.org).
[0098] As used herein, the term "antibody" denotes conventional
antibodies and fragments thereof, as well as single domain
antibodies and fragments thereof, in particular variable heavy
chain of single domain antibodies, and chimeric, humanised,
bispecific or multispecific antibodies.
[0099] As used herein, antibody or immunoglobulin also includes
"single domain antibodies" which have been more recently described
and which are antibodies whose complementary determining regions
are part of a single domain polypeptide. Examples of single domain
antibodies include heavy chain antibodies, antibodies naturally
devoid of light chains, single domain antibodies derived from
conventional four-chain antibodies, engineered single domain
antibodies. Single domain antibodies may be derived from any
species including, but not limited to mouse, human, camel, llama,
goat, rabbit and bovine. Single domain antibodies may be naturally
occurring single domain antibodies known as heavy chain antibody
devoid of light chains. In particular, Camelidae species, for
example camel, dromedary, llama, alpaca and guanaco, produce heavy
chain antibodies naturally devoid of light chain. Camelid heavy
chain antibodies also lack the CH1 domain.
[0100] The variable heavy chain of these single domain antibodies
devoid of light chains are known in the art as "VHH" or "nanobody".
Similar to conventional VH domains, VHHs contain four FRs and three
CDRs. Nanobodies have advantages over conventional antibodies: they
are about ten times smaller than IgG molecules, and as a
consequence properly folded functional nanobodies can be produced
by in vitro expression while achieving high yield. Furthermore,
nanobodies are very stable, and resistant to the action of
proteases. The properties and production of nanobodies have been
reviewed by Harmsen and De Haard H J (Appl. Microbiol. Biotechnol.
2007 November; 77(1): 13-22).
[0101] The term "monoclonal antibody" or "mAb" as used herein
refers to an antibody molecule of a single amino acid composition
that is directed against a specific antigen, and is not to be
construed as requiring production of the antibody by any particular
method. A monoclonal antibody may be produced by a single clone of
B cells or hybridoma, but may also be recombinant, i.e. produced by
protein engineering.
[0102] The term "chimeric antibody" refers to an engineered
antibody which in its broadest sense contains one or more regions
from one antibody and one or more regions from on or more other
antibody(ies). In particular a chimeric antibody comprises a VH
domain and a VL domain of an antibody derived from a non-human
animal, in association with a CH domain and a CL domain of another
antibody, in particular a human antibody. As the non-human animal,
any animal such as mouse, rat, hamster, rabbit or the like can be
used. A chimeric antibody may also denote a multispecific antibody
having specificity for at least two different antigens. In an
embodiment, a chimeric antibody has variable domains of mouse
origin and constant domains of human origin
[0103] The term "humanised antibody" refers to an antibody which is
initially wholly or partially of non-human origin and which has
been modified to replace certain amino acids, in particular in the
framework regions of the heavy and light chains, in order to avoid
or minimize an immune response in humans. The constant domains of a
humanized antibody are most of the time human CH and CL domains. In
an embodiment, a humanized antibody has constant domains of human
origin.
[0104] "Fragments" of (conventional) antibodies comprise a portion
of an intact antibody, in particular the antigen binding region or
variable region of the intact antibody. Examples of antibody
fragments include Fv, Fab, F(ab')2, Fab', dsFv, (dsFv)2, scFv,
sc(Fv)2, diabodies, bispecific and multispecific antibodies formed
from antibody fragments. A fragment of a conventional antibody may
also be a single domain antibody, such as a heavy chain antibody or
VHH.
[0105] The term "Fab" denotes an antibody fragment having a
molecular weight of about 50,000 and antigen binding activity, in
which about a half of the N-terminal side of H chain and the entire
L chain, among fragments obtained by treating IgG with a protease,
papaine, are bound together through a disulfide bond.
[0106] The term "F(ab')2" refers to an antibody fragment having a
molecular weight of about 100,000 and antigen binding activity,
which is slightly larger than the Fab bound via a disulfide bond of
the hinge region, among fragments obtained by treating IgG with a
protease, pepsin.
[0107] A single chain Fv ("scFv") polypeptide is a covalently
linked VH::VL heterodimer which is usually expressed from a gene
fusion including VH and VL encoding genes linked by a
peptide-encoding linker. The human scFv fragment of the invention
includes CDRs that are held in appropriate conformation, in
particular by using gene recombination techniques. Divalent and
multivalent antibody fragments can form either spontaneously by
association of monovalent scFvs, or can be generated by coupling
monovalent scFvs by a peptide linker, such as divalent
sc(Fv).sub.2. "dsFv" is a VH::VL heterodimer stabilised by a
disulphide bond. "(dsFv)2" denotes two dsFv coupled by a peptide
linker.
[0108] The term "bispecific antibody" or "BsAb" denotes an antibody
which combines the antigen-binding sites of two antibodies within a
single molecule. Thus, BsAbs are able to bind two different
antigens simultaneously. Genetic engineering has been used with
increasing frequency to design, modify, and produce antibodies or
antibody derivatives with a desired set of binding properties and
effector functions as described for instance in EP 2 050 764
A1.
[0109] The term "multispecific antibody" denotes an antibody which
combines the antigen-binding sites of two or more antibodies within
a single molecule.
[0110] The term "diabodies" refers to small antibody fragments with
two antigen-binding sites, which fragments comprise a heavy-chain
variable domain (VH) connected to a light-chain variable domain
(VL) in the same polypeptide chain (VH-VL). By using a linker that
is too short to allow pairing between the two domains on the same
chain, the domains are forced to pair with the complementary
domains of another chain and create two antigen-binding sites.
[0111] The term "hybridoma" denotes a cell, which is obtained by
subjecting a B cell prepared by immunizing a non-human mammal with
an antigen to cell fusion with a myeloma cell derived from a mouse
or the like which produces a desired monoclonal antibody having an
antigen specificity.
[0112] By "purified" and "isolated" it is meant, when referring to
a polypeptide (i.e. the antibody of the invention) or a nucleotide
sequence, that the indicated molecule is present in the substantial
absence of other biological macromolecules of the same type. The
term "purified" as used herein in particular means at least 75%,
85%, 95%, or 98% by weight, of biological macromolecules of the
same type are present. An "isolated" nucleic acid molecule which
encodes a particular polypeptide refers to a nucleic acid molecule
which is substantially free of other nucleic acid molecules that do
not encode the subject polypeptide; however, the molecule may
include some additional bases or moieties which do not
deleteriously affect the basic characteristics of the
composition.
[0113] As used herein, the term "subject" denotes a mammal, such as
a rodent, a feline, a canine, and a primate. In particular a
subject according to the invention is a human.
[0114] Throughout the instant application, the term "comprising" is
to be interpreted as encompassing all specifically mentioned
features as well optional, additional, unspecified ones. As used
herein, the use of the term "comprising" also discloses the
embodiment wherein no features other than the specifically
mentioned features are present (i.e. "consisting of").
[0115] Throughout the instant application, the term "and/or" is a
grammatical conjunction that is to be interpreted as encompassing
that one or more of the cases it connects may occur. For example,
the sentence "quantifying the expression of a target gene and/or
protein in a biological sample" indicates the expression of a
target gene may be quantified (mRNA), or the expression of a
protein or the expression of a target gene (mRNA) and the protein
together may be quantified.
[0116] Accordingly, the wording "a variable domain of heavy chain
of sequence SEQ ID NO: 1 or a sequence at least 85% identical
thereto and/or a variable domain of light chain of sequence of
sequence SEQ ID NO: 5, or a sequence at least 85% identical
thereto" is to b interpreted as "a variable domain of heavy chain
of sequence SEQ ID NO: 1 or a sequence at least 85% identical
thereto" or "a variable domain of light chain of sequence of
sequence SEQ ID NO: 5, or a sequence at least 85% identical
thereto" or "a variable domain of heavy chain of sequence SEQ ID
NO: 1 or a sequence at least 85% identical thereto and a variable
domain of light chain of sequence of sequence SEQ ID NO: 5, or a
sequence at least 85% identical thereto".
[0117] The term "cancer", "neoplasm", "tumor", and "carcinoma" are
used interchangeably herein to refer to cells that exhibit
relatively autonomous growth, so that they can exhibit an aberrant
growth phenotype characterized by significant loss of control of
cell proliferation. In general, cells of interest for detection or
treatment in the present application include precancerous (e.g.
benign), malignant, metastatic, and non-metastatic cells.
Immunoconjugates
[0118] For therapeutic purposes, it is advantageous to create an
antibody with optimal characteristics for use as an antibody drug
conjugate, i.e. an antibody which specifically recognizes a target
present on the surface of cancer cells and which is capable of
efficiently triggering internalization once bound to said
target.
[0119] The inventors raised antibodies against colon tumor cells or
lung tumor cells and screened resulting clones for the differential
binding to tumor cells and non-tumor tissue.
[0120] The inventors identified in this way antibodies
distinguishing tumoral from non-tumoral tissues. Three of those
antibodies were selected (the so-called antibodies "MAb1", "MAb2"
and "MAb3"), fulfilling the expected features necessary for
therapeutical application, in particular in the form of ADC. Those
three antibodies showed high binding affinity (within the nanomolar
range) to cell surface expressed LAMP1 in cancer cells.
Furthermore, those three anti-LAMP1 antibodies showed high capacity
to trigger internalization of the LAMP1/anti-LAMP1 antibody
complex, as shown in example 4.4 and 4.3.
[0121] The inventors demonstrated that the chimeric antibodies
derived from MAb1, MAb2, MAb3 (chMAb1, chMAb2, chMAb3), combined
with a cytotoxic maytansinoid (DM4) showed as well a high but
slightly different binding affinity to human LAMP1 or cynomologus
monkey LAMP1 then the naked antibody as shown in example 8.1.7 and
8.1.8.
[0122] Accordingly in one embodiment the immunoconjugate in context
of the invention has an affinity (EC.sub.50) for full length human
LAMP1 and cynomologues monkey LAMP1 expressed at the cell surface
of a recombinant cell line, wherein the cell line may be HCT116 and
the apparent affinity measured via Flow Cytometry is .ltoreq.30 nM,
for example .ltoreq.20 nM or .ltoreq.15 nM.
[0123] The Methods to measure the affinity (EC.sub.50) for full
length human LAMP1 and cynomologues monkey LAMP1 are further
explained in the chapter "antibodies".
[0124] The inventors additionally demonstrated that a chimeric
antibody derived from MAb1 (chMAb1), combined with a cytotoxic
maytansinoid (DM4), induces cytotoxic activity in vitro on human
HCT116 tumor cells containing a stable integration of the LAMP1
coding DNA sequence in the genomic DNA and expressing LAMP1 on
their surface.
[0125] Furthermore, the inventors demonstrated that humanized
antibodies derived from MAb1 (huMAb1_1, huMAb1_2, huMAb1_3),
combined with a cytotoxic maytansinoid (DM4) induce cytotoxic
activity in vitro on human HCT116 tumor cells containing a stable
integration of the LAMP1 coding DNA sequence in the genomic
DNA.
[0126] They have also shown that the immunoconjugate
DM4-SPDB-chMAb1 induces a marked anti-tumor activity in vivo in
mice bearing the primary human colon adenocarcinoma xenograft
derived from patient CR-LRB-010P, when used at a dose of 10 mg/kg,
5 mg/kg and 2.5 mg/kg, with a single injection, as described in
example 10.1.1.
[0127] Furthermore, the inventors showed that this immunoconjugate
induces a marked anti-tumor activity in vivo in mice bearing the
primary human lung tumor xenograft derived from patient
LUN-NIC-0014, when used at a dose of 10 mg/kg, 5 mg/kg and 2.5
mg/kg, with a single injection, as described in example 10.1.2.
[0128] They have also shown that the immunoconjugates
DM4-SPDB-huMAb1_1, DM4-SPDB-chMAb2, and DM4-SPDB-chMAb3 induce a
marked anti-tumor activity in vivo in different patient-derived
xenograft as shown in example 10.2-10.4.
[0129] For example, it was shown the immunoconjugate
DM4-SPDB-huMAb1_1 induces a marked anti-tumor activity in vivo in a
primary human invasive ductal carcinoma xenograft and primary human
lung tumor xenograft derived from patient, when used at a dose of
10 mg/kg, 5 mg/kg, 2.5 mg/kg, or 1.25 mg/kg with a single
injection, as described in example 10.2.2 and 10.2.3.
[0130] Also the immunoconjugates DM4-SPDB-chMAb2 and
DM4-SPDB-chMAb3 induced a marked anti-tumor activity in vivo in a
murine model of primary human invasive ductal carcinoma xenograft
derived from patient, when used at a dose of 10 mg/kg, 5 mg/kg and
2.5 mg/kg or 5 mg/kg, 2.5 mg/kg and 1.25 mg/kg, respectively, with
a single injection, as described in example 10.3.2 and 10.4.
[0131] Altogether, for the first time, these results validly
identify LAMP1 as a therapeutic target for the treatment of
cancer.
[0132] Accordingly, the invention relates to an immunoconjugate
comprising an antibody which: [0133] a) binds to human and Macaca
fascicularis LAMP1 proteins; and [0134] b) is linked or conjugated
to at least one growth inhibitory agent.
[0135] Any antibody which binds to human and Macaca fascicularis
LAMP1 proteins, as described throughout the instant application
(e.g. MAb4, fragments thereof, or chimeric or humanised version
thereof), can be incorporated in the immunoconjugate according to
the invention.
[0136] As used herein, "conjugate", "immunoconjugate",
"antibody-drug conjugate" or "ADC" have the same meaning and are
interchangeable.
[0137] A "growth inhibitory agent", or "anti-proliferative agent",
which can be used indifferently, refers to a compound or
composition which inhibits growth of a cell, especially tumour
cell, either in vitro or in vivo. A growth inhibitory agent denotes
in particular a cytotoxic agent or a radioactive isotope.
[0138] The term "radioactive isotope" is intended to include
radioactive isotopes suitable for treating cancer, such as
At.sup.211, Ac.sup.225, Bi.sup.212, Bi.sup.213, Pb.sup.212,
Er.sup.169, I.sup.131, I.sup.124, I.sup.125, Y.sup.90, In.sup.111,
P.sup.32, Re.sup.186, Re.sup.188, Sm.sup.153, Sr.sup.89, Zr.sup.89,
Tc.sup.99m, Ga.sup.68, Cu.sup.84 and radioactive isotopes of Lu
such as Lu.sup.177. Such radioisotopes generally emit mainly
beta-radiation. In an embodiment the radioactive isotope is
alpha-emitter isotope, more precisely Thorium 227 (Th.sup.227)
which emits alpha-radiation. The immunoconjugates according to the
present invention can be prepared as described in the application
WO2004/091668.
[0139] In one embodiment, a radioactive isotope is selected from
the group consisting of At.sup.211, Ac.sup.25, Bi.sup.213,
Pb.sup.212, Er.sup.169, I.sup.124, I.sup.125, In.sup.111, P.sup.32,
Re.sup.186, Sm.sup.153, Sr.sup.89, Zr.sup.89, Tc.sup.99m,
Ga.sup.68, Cu.sup.64 and radioactive isotopes of Lu, for instance
from At.sup.211, Er.sup.169, I.sup.125, In.sup.111, P.sup.32,
Re.sup.186, Sm.sup.153, Sr.sup.89, radioactive isotopes of Lu, and
Th.sup.227.
[0140] The term "cytotoxic agent" as used herein refers to a
substance that inhibits or prevents the function of cells and/or
causes destruction of cells. The term "cytotoxic agent" is intended
to include chemotherapeutic agents, enzymes, antibiotics, and
toxins such as small molecule toxins or enzymatically active toxins
of bacterial, fungal, plant or animal origin, including fragments
and/or variants thereof, and the various antitumor or anticancer
agents disclosed below. In some embodiments, the cytotoxic agent is
a drug or a pro-drug of a compound consisting in an anti-tubulin
agent such as taxoids or taxanes, a vinca-alkaloid, a maytansinoid
or maytansinoid analog such as DM1 or DM4, a cryptophycin
derivative, an auristatin or dolastatin analog; a DNA alkylating
agent, such as a tomaymycin or pyrrolobenzodiazepine derivative, a
CC-1065 or CC-1065 analog; a leptomycin derivative; a topoisomerase
II inhibitor, an RNA polymerase II inhibitor such as
alpha-amanitin.
[0141] According to a first embodiment, said at least one growth
inhibitory agent is neither an undefined radioactive isotope, a
chemotherapeutic drug, a protein or lectin, nor pokeweed antiviral
protein, abrin, ricin and each of their A chains, doxorubicin,
cisplastin, Iodine-131, Yttrium-90, Rhenium-188, Bismuth-212,
Taxol, 5-Fluorouracil, VP-16 (etoposide), bleomycin, methotrexate,
vindesine, adriamycin, vincristine, vinblastine,
bis-chloroethylnitrosourea (BCNU), mitomycin, cyclophosphamide and
a cytokine such as TNF and TNF-.beta..
[0142] According to this first embodiment, the invention relates in
particular to an immunoconjugate comprising an antibody which:
[0143] a) binds to human and Macaca fascicularis LAMP1 proteins;
and [0144] b) is linked or conjugated to at least one growth
inhibitory agents [0145] (i) a cytotoxic agent selected from the
group consisting of enzymes other than from pokeweed antiviral
protein; antibiotics other than from bleomycin and mitomycin;
toxins of bacterial, fungal, or animal origin or of plant origin
other than from abrin and ricin, including fragments and/or
variants thereof; a drug or a pro-drug of a compound consisting in
an anti-tubulin agent such as a maytansinoid or maytansinoid analog
such as DM1 or DM4, a taxoid or taxane other than from paclitaxel
(Taxol), a vinca-alkaloid other than from vindesine, vincristine
and vinblastine, a cryptophycin derivative, an auristatin or
dolastatin analog; a DNA alkylating agent other than from BCNU and
cyclophosphamide, such as a tomaymycin or pyrrolobenzodiazepine
derivative, a CC-1065 or CC-1065 analog; a leptomycin derivative; a
topoisomerase II inhibitors other than doxorubicin (adriamycin) and
etoposide, a RNA polymerase II inhibitor such as alpha-amanitin, or
[0146] (ii) a radioactive isotope selected from the group
consisting of At.sup.211, Ac.sup.225, Bi.sup.213, Pb.sup.212,
Er.sup.169, I.sup.124, I.sup.125, In.sup.111, P.sup.32, Re.sup.186,
Sm.sup.153, Sr.sup.89, Zr.sup.89, Tc.sup.99m, Ga.sup.68, Cu.sup.64
and radioactive isotopes of Lu such as Lu.sup.177, and
Th.sup.227.
[0147] In one embodiment a radioactive isotope is selected from the
group consisting of At.sup.211, Er.sup.169, I.sup.125, In.sup.111,
P.sup.32, Re.sup.186, Sm.sup.153, Sr.sup.89, radioactive isotopes
of Lu, and Th.sup.227.
[0148] In said first embodiment, the antibody may bind in
particular to a domain consisting of the first to third loops of
human and Macaca fascicularis LAMP1 proteins; wherein the domain
consisting of the first to third loops of human LAMP1 protein
consists of amino acids Ala29 to Ile309 of SEQ ID NO: 24 and the
domain consisting of the first to third loops of Macaca
fascicularis LAMP1 protein consists of amino acids Ala27 to Thr307
of SEQ ID NO: 39
[0149] According to a second embodiment, the invention relates to
an immunoconjugate wherein the antibody binds to a domain
consisting of the first to third loops of human and Macaca
fascicularis LAMP1 proteins; wherein the domain consisting of the
first to third loops of human LAMP1 protein consists of amino acids
Ala29 to Ile309 of SEQ ID NO: 24 and the domain consisting of the
first to third loops of Macaca fascicularis LAMP1 protein consists
of amino acids Ala27 to Thr307 of SEQ ID NO: 39.
[0150] Therefore, according to this second embodiment, the
immunoconjugate comprises an antibody which [0151] a) binds to a
domain consisting of the first to third loops of human and Macaca
fascicularis LAMP1 proteins; wherein the domain consisting of the
first to third loops of human LAMP1 protein consists of amino acids
Ala29 to Ile309 of SEQ ID NO: 24 and the domain consisting of the
first to third loops of Macaca fascicularis LAMP1 protein consists
of amino acids Ala27 to Thr307 of SEQ ID NO: 39; and [0152] b) is
linked or conjugated to said at least one growth inhibitory
agent.
[0153] Although not compulsory, in said second embodiment, the at
least one growth inhibitory agent may be different from an
undefined radioactive isotope, a chemotherapeutic drug, a protein
or lectin, in particular from pokeweed antiviral protein, abrin,
ricin and each of their A chains, doxorubicin, cisplastin,
Iodine-131, Yttrium-90, Rhenium-188, Bismuth-212, Taxol,
5-Fluorouracil, VP-16 (etoiposide), bleomycin, methotrexate,
vindesine, adriamycin, vincristine, vinblastine, BCNU, mitomycin,
cyclophosphamide and a cytokine such as TNF and TNF-.beta..
[0154] Accordingly, said at least one growth inhibitory agent may
be a radioactive isotopes selected from the group consisting of
At.sup.211, Ac.sup.225, Bi.sup.213, Pb.sup.212, Er.sup.169,
I.sup.124, I.sup.125, In.sup.111, P.sup.32, Re.sup.186, Sm.sup.153,
Sr.sup.89, Zr.sup.89, Tc.sup.99m, Ga.sup.68, Cu.sup.64 and
radioactive isotopes of Lu such as Lu.sup.177, and Th.sup.227, for
instance At.sup.211, Er.sup.169, I.sup.125, In.sup.111, P.sup.32,
Re.sup.186, Sm.sup.153, Sr.sup.89, radioactive isotopes of Lu such
as Lu.sup.177, and Th.sup.227, or a cytotoxic agent as defined in
said first embodiment.
[0155] In said first and second embodiments, said at least one
growth inhibitory agent may be in particular drug or a pro-drug of
a compound consisting in a maytansinoid or maytansinoid analog such
as DM1 or DM4, a tomaymycin or pyrrolobenzodiazepine derivative, a
cryptophycin derivative, a leptomycin derivative, an auristatin or
dolastatin analog, or a CC-1065 or CC-1065 analog, a RNA polymerase
II inhibitor such as alpha-amanitin.
[0156] In one embodiment, a suitable tomamycin is a tomamycine
dimer. Said tomamycin dimer is for instance
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy)ethoxy)pyridine-2,6-diyl)
bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hbenzo[e]-
pyrrolo[1,2-a][1,4] diazepin-5(11aH)-one).
[0157] The structural formula of
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy)ethoxy)pyridine-2,6-diyl)
bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hbenzo[e]-
pyrrolo[1,2-a][1,4] diazepin-5(11aH)-one) is
##STR00001##
[0158] A "maytansinoid" as used herein denotes maytansinoids and
maytansinoid analogs. Maytansinoids are drugs that inhibit
microtubule formation and that are highly toxic to mammalian
cells.
[0159] Examples of suitable maytansinoids include maytansinol and
maytansinol analogs.
[0160] Examples of suitable maytansinol analogues include those
having a modified aromatic ring and those having modifications at
other positions. Such suitable maytansinoids are disclosed in U.S.
Pat. Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946;
4,315,929; 4,331,598; 4,361,650; 4,362,663; 4,364,866; 4,450,254;
4,322,348; 4,371,533; 6,333,410; 5,475,092; 5,585,499; and
5,846,545.
[0161] Specific examples of suitable analogues of maytansinol
having a modified aromatic ring include: [0162] (1) C-19-dechloro
(U.S. Pat. No. 4,256,746) (prepared by LAH reduction of ansamytocin
P2); [0163] (2) C-20-hydroxy (or C-20-demethyl) +/-C-19-dechloro
(U.S. Pat. Nos. 4,361,650 and 4,307,016) (prepared by demethylation
using Streptomyces or Actinomyces or dechlorination using LAH); and
[0164] (3) C-20-demethoxy, C-20-acyloxy (-OCOR), +/-dechloro (U.S.
Pat. No. 4,294,757) (prepared by acylation using acyl
chlorides).
[0165] Specific examples of suitable analogues of maytansinol
having modifications of other positions include: [0166] (1) C-9-SH
(U.S. Pat. No. 4,424,219) (prepared by the reaction of maytansinol
with H.sub.2S or P.sub.2S.sub.5); [0167] (2) C-14-alkoxymethyl
(demethoxy/CH.sub.2OR) (U.S. Pat. No. 4,331,598); [0168] (3)
C-14-hydroxymethyl or acyloxymethyl (CH.sub.2OH or CH.sub.2OAc)
(U.S. Pat. No. 4,450,254) (prepared from Nocardia); [0169] (4)
C-15-hydroxy/acyloxy (U.S. Pat. No. 4,364,866) (prepared by the
conversion of maytansinol by Streptomyces); [0170] (5) C-15-methoxy
(U.S. Pat. Nos. 4,313,946 and 4,315,929) (isolated from Trewia
nudiflora); [0171] (6) C-18-N-demethyl (U.S. Pat. Nos. 4,362,663
and 4,322,348) (prepared by the demethylation of maytansinol by
Streptomyces); and [0172] (7) 4,5-deoxy (U.S. Pat. No. 4,371,533)
(prepared by the titanium trichloride/LAH reduction of
maytansinol).
[0173] In a specific embodiment, the cytotoxic conjugates of the
present invention utilize the thiol-containing maytansinoid (DM1),
formally termed
N.sup.2'-deacetyl-N.sup.2'-(3-mercapto-1-oxopropyl)-maytansine, as
the cytotoxic agent. DM1 is represented by the following structural
formula (I):
##STR00002##
[0174] In another embodiment, the cytotoxic conjugates of the
present invention utilize the thiol-containing maytansinoid DM4,
formally termed
N.sup.2'-deacetyl-N.sup.2'-(4-methyl-4-mercapto-1-oxopentyl)-maytansine,
as the cytotoxic agent. DM4 is represented by the following
structural formula (II):
##STR00003##
[0175] In further embodiments of the invention, other maytansines,
including thiol and disulfide-containing maytansinoids bearing a
mono or di-alkyl substitution on the carbon atom bearing the sulfur
atom, may be used. These include a maytansinoid having, at C-3,
C-14 hydroxymethyl, C-15 hydroxy, or C-20 desmethyl, an acylated
amino acid side chain with an acyl group bearing a hindered
sulfhydryl group, wherein the carbon atom of the acyl group bearing
the thiol functionality has one or two substituents, said
substituents being CH.sub.3, C.sub.2H.sub.5, linear or branched
alkyl or alkenyl having from 1 to 10 reagents and any aggregate
which may be present in the solution.
[0176] Examples of these cytotoxic agents and of methods of
conjugation are further given in the application WO2008/010101
which is incorporated by reference.
[0177] In some embodiments of the present invention, the antibody
is covalently attached, directly or via a cleavable or
non-cleavable linker, to the at least one growth inhibitory
agent.
[0178] "Linker", as used herein, means a chemical moiety comprising
a covalent bond or a chain of atoms that covalently attaches a
polypeptide to a drug moiety.
[0179] The conjugates may be prepared by in vitro methods. In order
to link a drug or prodrug to the antibody, a linking group is used.
Suitable linking groups are well known in the art and include
disulfide groups, thioether groups, acid labile groups, photolabile
groups, peptidase labile groups and esterase labile groups.
Conjugation of an antibody of the invention with cytotoxic agents
or growth inhibitory agents may be made using a variety of
bifunctional protein coupling agents including but not limited to
N-succinimidyl pyridyldithiobutyrate (SPDB), butanoic acid
4-[(5-nitro-2-pyridinyl)dithio]-2,5-dioxo-1-pyrrolidinyl ester
(nitro-SPDB), 4-(Pyridin-2-yldisulfanyl)-2-sulfo-butyric acid
(sulfo-SPDB), N-succinimidyl (2-pyridyldithio) propionate (SPDP),
SNPP (N-succinimidyl 4-(5-nitro-2-pyridyldithio)pentanoate),
succinimidyl (N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC),
iminothiolane (IT), bifunctional derivatives of imidoesters (such
as dimethyl adipimidate HCL), active esters (such as disuccinimidyl
suberate), aldehydes (such as glutaraldehyde), bis-azido compounds
(such as bis (p-azidobenzoyl)-hexanediamine), bis-diazonium
derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine),
diisocyanates (such as toluene 2,6-diisocyanate), and bis-active
fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For
example, a ricin immunotoxin can be prepared as described in
Vitetta et al (1987). Carbon labeled 1-isothiocyanatobenzyl
methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary
chelating agent for conjugation of radionucleotide to the antibody
(WO 94/11026).
[0180] The linker may be a "cleavable linker" facilitating release
of the cytotoxic agent or growth inhibitory agent in the cell. For
example, an acid-labile linker, a peptidase-sensitive linker, an
esterase labile linker, a photolabile linker or a
disulfide-containing linker (See e.g. U.S. Pat. No. 5,208,020) may
be used. The linker may be also a "non-cleavable linker" (for
example SMCC linker) that might lead to better tolerance in some
cases.
[0181] Alternatively, a fusion protein comprising the antibody of
the invention and a cytotoxic or growth inhibitory polypeptide may
be made, by recombinant techniques or peptide synthesis. The length
of DNA may comprise respective regions encoding the two portions of
the conjugate either adjacent one another or separated by a region
encoding a linker peptide which does not destroy the desired
properties of the conjugate.
[0182] The antibodies of the present invention may also be used in
Dependent Enzyme Mediated Prodrug Therapy by conjugating the
polypeptide to a prodrug-activating enzyme which converts a prodrug
(e.g. a peptidyl chemotherapeutic agent, see WO81/01145) to an
active anti-cancer drug (See, for example, WO 88/07378 and U.S.
Pat. No. 4,975,278). The enzyme component of the immunoconjugate
useful for ADEPT includes any enzyme capable of acting on a prodrug
in such a way so as to convert it into its more active, cytotoxic
form. Enzymes that are useful in the method of this invention
include, but are not limited to, alkaline phosphatase useful for
converting phosphate-containing prodrugs into free drugs;
arylsulfatase useful for converting sulfate-containing prodrugs
into free drugs; cytosine deaminase useful for converting non-toxic
fluorocytosine into the anticancer drug, 5-fluorouracil; proteases,
such as serratia protease, thermolysin, subtilisin,
carboxypeptidases and cathepsins (such as cathepsins B and L), that
are useful for converting peptide-containing prodrugs into free
drugs; D-alanylcarboxypeptidases, useful for converting prodrugs
that contain D-amino acid substituents; carbohydrate-cleaving
enzymes such as O-galactosidase and neuraminidase useful for
converting glycosylated prodrugs into free drugs; P-lactamase
useful for converting drugs derivatized with P-lactams into free
drugs; and penicillin amidases, such as penicillin V amidase or
penicillin G amidase, useful for converting drugs derivatized at
their amine nitrogens with phenoxyacetyl or phenylacetyl groups,
respectively, into free drugs. The enzymes can be covalently bound
to the polypeptides of the invention by techniques well known in
the art such as the use of the heterobifunctional crosslinking
reagents discussed above.
[0183] According to said first and second embodiments, in the
conjugate of the invention, the growth inhibitory agent may be a
maytansinoid, in particular DM1 or DM4.
[0184] In such a conjugate, the antibody is conjugated to said at
least one growth inhibitory agent by a linking group. In particular
said linking group is a non-cleavable linker, such as SPDB,
sulfo-SPDB, or SMCC.
[0185] In particular, the conjugate may be selected from the group
consisting of: [0186] i) an antibody-SPDB-DM4 conjugate of formula
(III)
[0186] ##STR00004## [0187] ii) an antibody-sulfo-SPDB-DM4 conjugate
of formula (IV)
[0187] ##STR00005## [0188] iii) an antibody-SMCC-DM1 conjugate of
formula (V)
##STR00006##
[0189] In a further embodiment, in the conjugate of the invention,
the growth inhibitory agent may be tomamycin, for instance a
tomamycin dimer, for example
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy)ethoxy)pyridine-2,6-diyl)
bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hbenzo[e]-
pyrrolo[1,2-a][1, 4] diazepin-5(11aH)-one).
[0190] In such a conjugate, the antibody is conjugated to said at
least one growth inhibitory agent by a linking group, for instance
by SNPP.
[0191] Accordingly, in one embodiment the conjugate may an
antibody-SNPP-(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methy-
lpropyl)(methyl)amino)ethoxy)ethoxy)ethoxy)pyridine-2,6-diyl).
[0192] In general, the conjugate can be obtained by a process
comprising the steps of: [0193] (i) bringing into contact an
optionally-buffered aqueous solution of a cell-binding agent (e.g.
an antibody according to the invention) with solutions of a linker
and a cytotoxic compound; [0194] (ii) then optionally separating
the conjugate which was formed in (i) from the unreacted
cell-binding agent.
[0195] The aqueous solution of cell-binding agent can be buffered
with buffers such as, e.g. potassium phosphate, acetate, citrate or
N-2-Hydroxyethylpiperazine-N'-2-ethanesulfonic acid (Hepes buffer).
The buffer depends upon the nature of the cell-binding agent. The
cytotoxic compound is in solution in an organic polar solvent, e.g.
dimethyl sulfoxide (DMSO) or dimethylacetamide (DMA).
[0196] The reaction temperature is usually comprised between
20.degree. C. and 40.degree. C. The reaction time can vary from 1
to 24 hours. The reaction between the cell-binding agent and the
cytotoxic agent can be monitored by size exclusion chromatography
(SEC) with a refractometric and/or UV detector. If the conjugate
yield is too low, the reaction time can be extended.
[0197] A number of different chromatography methods can be used by
the person skilled in the art in order to perform the separation of
step (ii): the conjugate can be purified e.g. by SEC, adsorption
chromatography (such as ion exchange chromatography, IEC),
hydrophobic interaction chromatograhy (HIC), affinity
chromatography, mixed-support chromatography such as hydroxyapatite
chromatography, or high performance liquid chromatography (HPLC).
Purification by dialysis or diafiltration can also be used.
[0198] As used herein, the term "aggregates" means the associations
which can be formed between two or more cell-binding agents, said
agents being modified or not by conjugation. The aggregates can be
formed under the influence of a great number of parameters, such as
a high concentration of cell-binding agent in the solution, the pH
of the solution, high shearing forces, the number of bonded dimers
and their hydrophobic character, the temperature (see Wang, L. and
Gosh, R., 2008, J. Membr Sci. 318: 311-316, and references cited
therein); note that the relative influence of some of these
parameters is not clearly established. In the case of proteins and
antibodies, the person skilled in the art will refer to Cromwell,
M. E. et al. (2006, AAPS Jounal 8(3): E572-E579). The content in
aggregates can be determined with techniques well known to the
skilled person, such as SEC (see Walter et al., 1993, Anal.
Biochem., 212(2): 469-480).
[0199] After step (i) or (ii), the conjugate-containing solution
can be submitted to an additional step (iii) of chromatography,
ultrafiltration and/or diafiltration.
[0200] The conjugate is recovered at the end of these steps in an
aqueous solution.
[0201] According to an embodiment, the conjugate according to the
invention is characterised by a "drug-to-antibody ratio" (or "DAR")
as measured by DAR UV ranging from 1 to 10, for instance from 2 to
5, in particular from 3 to 4. This is generally the case of
conjugates including maytansinoid molecules.
[0202] This DAR number can vary with the nature of the antibody and
of the drug (i.e. the growth-inhibitory agent) used along with the
experimental conditions used for the conjugation (like the ratio
growth-inhibitory agent/antibody, the reaction time, the nature of
the solvent and of the cosolvent if any). Thus the contact between
the antibody and the growth-inhibitory agent leads to a mixture
comprising several conjugates differing from one another by
different drug-to-antibody ratios; optionally the naked antibody;
optionally aggregates. The DAR that is determined is thus a mean
value.
[0203] A method which can be used to determine the DAR, herein
called DAR UV, consists in measuring spectrophotometrically the
ratio of the absorbance at of a solution of substantially purified
conjugate at .lamda..sub.D and 280 nm. 280 nm is a wavelength
generally used for measuring protein concentration, such as
antibody concentration. The wavelength .lamda..sub.D is selected so
as to allow discriminating the drug from the antibody, i.e. as
readily known to the skilled person, .lamda..sub.D is a wavelength
at which the drug has a high absorbance and .lamda..sub.D is
sufficiently remote from 280 nm to avoid substantial overlap in the
absorbance peaks of the drug and antibody. .lamda..sub.D may be
selected as being 252 nm in the case of maytansinoid molecules. A
method of DAR calculation may be derived from Antony S. Dimitrov
(ed), LLC, 2009, Therapeutic Antibodies and Protocols, vol 525,
445, Springer Science:
[0204] The absorbances for the conjugate at .lamda..sub.D
(A.sub..lamda.D) and at 280 nm (A.sub.280) are measured using a
classic spectrophotometer apparatus (allowing to calculate the "DAR
parameter"). The absorbances can be expressed as follows:
A.sub..lamda.D=(C.sub.D.times..epsilon..sub.DAD)+(C.sub.A.times..epsilon-
..sub.A.lamda.D)
A.sub.280=(C.sub.D.times..epsilon..sub.D280)+(C.sub.A.times..epsilon..su-
b.A280)
[0205] wherein: [0206] C.sub.D and C.sub.A are respectively the
concentrations in the solution of the drug and of the antibody
[0207] .epsilon..sub.D.lamda.D and .epsilon..sub.D280 are
respectively the molar extinction coefficients of the drug at
.lamda..sub.D and 280 nm [0208] .epsilon..sub.A.lamda.D and
.epsilon..sub.A280 are respectively the molar extinction
coefficients of the antibody at .lamda..sub.D and 280 nm.
[0209] Resolution of these two equations with two unknowns leads to
the following equations:
C.sub.D=[(.epsilon..sub.A280.times..sub.A.lamda.D)-(.epsilon..sub.A.lamd-
a.D.times.A.sub.280)]/[(.epsilon..sub.A.lamda.D.times..epsilon..sub.A280)--
(.epsilon..sub.A.lamda.D.times..epsilon..sub.D280)]
C.sub.A=[A.sub.280-(C.sub.D.times..epsilon..sub.D280)]/.epsilon..sub.A28-
0
[0210] The average DAR is then calculated from the ratio of the
drug concentration to that of the antibody:
DAR=C.sub.D/C.sub.A.
[0211] In the immunoconjugate according to the invention, the
antibody is in particular specific for human and Macaca
fascicularis LAMP1 proteins.
[0212] The antibody is in particular a chimeric or humanised
antibody. The antibody may also be an antibody fragment, or a
bispecific or multispecific antibody.
[0213] Antibodies binding specifically to human and Macaca
fascicularis LAMP1 proteins which are particularly contemplated to
be included in the immunoconjugates of the invention are described
in further details in the following "Antibodies" section.
Antibodies
[0214] The inventors identified four antibodies (the so-called
antibodies "MAb1", "MAb2", "MAb3" and "MAb4") that bind
specifically to human LAMP1 and distinguish tumoral from
non-tumoral tissues. The antibodies MAb1, MAb2, MAb3 allowed for
the first time to detect extracellularly expressed LAMP1 and thus
to perform IHC analysis on Frozen-OCT (from Optimal Cutting
Temperature) specimens and AFA (Alcohol Formalin Acetic acid
Fixative) to distinguish cancerous from non-cancerous tissue.
[0215] However, IHC analysis of tumor tissues from biobanks or from
hospitals before or during patient treatment is routinely done with
formalin-fixed paraffin-embedded (FFPE) samples. Although MAb1,
MAb2 and MAb3 allow LAMP1 membrane reinforcement in frozen-OCT and
AFA (Alcohol Formalin Acetic acid Fixative) sample format, they can
not lead to the detection of LAMP1 reinforcement in FFPE format.
One of the reasons is probably the effect of the formalin fixative
combined to the complexity of the protein. The inventors discovered
peptides that allowed the production of a monoclonal antibody MAb4
that can be furthermore used for IHC experiments on the FFPE the
format and thus allows the application of the herein presented
methods on FFPE tumor biobanks and FFPE hospital samples.
[0216] Those four antibodies showed a high binding affinity (within
the nanomolar range) to cell surface expressed LAMP1 in cancer
cells. Furthermore, at least the anti-LAMP1 MAb1, MAb2 and MAb3
antibodies showed a high capacity to trigger internalization of the
LAMP1/anti-LAMP1 antibody complex, as shown in example 4.4.
[0217] Additionally, the four antibodies are cross-reactive with
Macaca fascicularis LAMP1 but do not display any cross-reactivity
with human LAMP2 protein.
[0218] The binding sites of antibodies MAb1, MAb2 and MAb3 have
been mapped to a domain consisting of the first to third loops of
human and Macaca fascicularis LAMP1 proteins, in particular to the
first lumenal domain of human LAMP1. More specifically the binding
site of MAb1 was mapped in loops 1-2 and the binding site of MAb2
and MAb3 was mapped in loop1. The antibodies MAb1 and MAb2 do not
compete with each other for binding to human LAMP1. Therefore at
least two epitopes on LAMP1 have been found to interact with the
antibodies of the invention.
[0219] The binding site of Antibody MAb4 has been mapped to a
domain consisting of the third to fourth loop of human and Macaca
fascicularis LAMP1 proteins, in particular to the fourth loop of
human LAMP1. More specifically the antibody MAb4 binds to a region
of Loop 4 comprising the amino acids 360 to 375 of human LAMP1 that
consists of sequences SEQ ID NO: 82.
[0220] The inventors have determined the sequence of variable heavy
and light chains of these monoclonal antibodies which are directed
against the human and Macaca fascicularis LAMP1 proteins.
[0221] The so-called antibody "MAb1" comprises: [0222] a variable
domain of heavy chain consisting of sequence
QVQLQQSGAELVKPGASVKMSCKASGYIFTNYNIHWVKKSPGQGLEWIGAIYPGNGDAPY
SQKFKDKATLTADKSSSTTYMQLSRLTSEDSAVYYCVRANWDVAFAYWGQGTLVSVSA (SEQ ID
NO: 1, with CDRs shown in bold characters) in which FR1-H spans
amino acid positions 1 to, 25, CDR1-H spans amino acid positions 26
to 33 (SEQ ID NO: 2), FR2-H spans amino acid positions 34 to 50,
CDR2-H spans amino acid positions 51 to 58 (SEQ ID NO: 3), FR3-H
spans amino acid positions 59 to 96, CDR3-H spans amino acid
positions 97 to 107 (SEQ ID NO: 4), and FR4-H spans amino acid
positions 108 to 118, and [0223] a variable domain of light chain
consisting of sequence
DIQMTQSPPSLSASLGGKVTITCKASQDIDRYMAWYQDKPGKGPRLLIHDTSTLQPGIPSRF
SGSGSGRDYSFSISNLEPEDIATYYCLQYDNLWTFGGGTKLEIK [0224] (SEQ ID NO: 5,
with CDRs shown in bold characters) in which FR1-L spans amino acid
positions 1 to 26, CDR1-L spans amino acid positions 27 to 32 (SEQ
ID NO: 6), FR2-L spans amino acid positions 33 to 49, CDR2-L spans
amino acid positions 50 to 52, FR3-L spans amino acid positions 53
to 88, CDR3-L spans amino acid positions 89 to 96 (SEQ ID NO: 7),
and FR4-H spans amino acid positions 97 to 106.
[0225] The so-called antibody "MAb2" comprises: [0226] a variable
domain of heavy chain consisting of sequence
QVQLQQSAAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYFNPSSGYPE
YNQKFKDKTTLTADKSSNTAFIQLNSLTSEDSAVYYCSRGYYYGSRGYALDFWGQGASVT VSS
[0227] (SEQ ID NO: 8, with CDRs shown in bold characters) in which
FR1-H spans amino acid positions 1 to 25, CDR1-H spans amino acid
positions 26 to 33 (SEQ ID NO: 9), FR2-H spans amino acid positions
34 to 50, CDR2-H spans amino acid positions 51 to 58 (SEQ ID NO:
10), FR3-H spans amino acid positions 59 to 96, CDR3-H spans amino
acid positions 97 to 111 (SEQ ID NO: 11), and FR4-H spans amino
acid positions 112 to 122, and [0228] a variable domain of light
chain consisting of sequence
NIVLTQSPVSLAVSLGQRATISCRASESVDINGNTFMHWYQQKPGQSPKLVIYAASNIESGV
PARFSGSGSSTDFTFTIDPVEADDVATYYCQQFNIEDPWTFGGGTKVEIK [0229] (SEQ ID
NO: 12, with CDRs shown in bold characters) in which FR1-L spans
amino acid positions 1 to 26, CDR1-L spans amino acid positions 27
to 36 (SEQ ID NO: 13), FR2-L spans amino acid positions 37 to 53,
CDR2-L spans amino acid positions 54 to 56, FR3-L spans amino acid
positions 57 to 92, CDR3-L spans amino acid positions 93 to 101
(SEQ ID NO: 14), and FR4-H spans amino acid positions 102 to
111.
[0230] A variant of antibody MAb2, called herein "MAb2.sub.Can" was
also generated by introducing canonical residues by substitution of
A116T in the variable domain of the heavy chain and by substitution
of V9A, V51L, 158L, S72G and A108T in the variable domain of the
light chain.
[0231] The so-called "antibody MAb2.sub.Can" comprises: [0232] a
variable domain of heavy chain consisting of sequence [0233]
QVQLQQSAAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYFNPS
SGYPEYNQKFKDKTTLTADKSSNTAFIQLNSLTSEDSAVYYCSRGYYYGSRGYALDFWGQ
GTSVTVSS (SEQ ID NO: 15). [0234] a variable domain of light chain
consisting of sequence [0235]
NIVLTQSPASLAVSLGQRATISCRASESVDINGNTFMHWYQQKPGQSPKLLIYAASN
LESGVPARFSGSGSGTDFTFTIDPVEADDVATYYCQQNIEDPWTFGGGTKLEIK (SEQ ID NO:
16).
[0236] Both "MAb2.sub.Can" and "MAb2", under chimeric form, have
the same affinity for human LAMP1 (see Table 13).
[0237] The so-called antibody "MAb3" comprises: [0238] a variable
domain of heavy chain consisting of sequence
QIQLVQSGPELKKPGETVKISCKASGYIFTNYGMNWVKQAPGKGLKWMGWINTYTGESRY
ADDFKGRFALSLETSASTAYLQINNLENEDMATYFCAREDYYGNSPWFFDVWGAGTTVTV SS
[0239] (SEQ ID NO: 42, with CDRs shown in bold characters) in which
FR1-H spans amino acid positions 1 to 25, CDR1-H spans amino acid
positions 26 to 33 (SEQ ID NO: 43), FR2-H spans amino acid
positions 34 to 50, CDR2-H spans amino acid positions 51 to 58 (SEQ
ID NO: 44), FR3-H spans amino acid positions 59 to 96, CDR3-H spans
amino acid positions 97 to 111 (SEQ ID NO: 45), and FR4-H spans
amino acid positions 112 to 122, and [0240] a variable domain of
light chain consisting of sequence
DIQMTQTTSSLSASLGDRVTISCNASQGINKYLNWYQQKPDGTVKLLIYYTSTLHSGVPSRF
SGSGSGTDYSLTINNLEPEDIATYYCQQYTKLPFTFGSGTKLEIK [0241] (SEQ ID NO:
46, with CDRs shown in bold characters) in which FR1-L spans amino
acid positions 1 to 26, CDR1-L spans amino acid positions 27 to 32
(SEQ ID NO: 47), FR2-L spans amino acid positions 33 to 49, CDR2-L
spans amino acid positions 50 to 52, FR3-L spans amino acid
positions 53 to 88, CDR3-L spans amino acid positions 89 to 97 (SEQ
ID NO: 48), and FR4-H spans amino acid positions 98 to 107.
[0242] A variant of MAb3 ("MAb3 VL_R24_R93") was generated by
introducing into VL sequence of MAb3 the following amino acid
substitutions: N24R and K93R. Accordingly, the variable domain of
light chain of MAb3 VL_R24_R93 consist of [0243]
DIQMTQTTSSLSASLGDRVTISCRASQGINKYLNWYQQKPDGTVKLLIYYTSTLHSG
VPSRFSGSGSGTDYSLTINNLEPEDIATYYCQQYTRLPFTFGSGTKLEIK (SEQ ID NO: 51)
(the mutated residues as compared with VL of MAb3 being shown in
enlarged characters).
[0244] CDR3-L of MAb3 VL_R24_R93 thus consists of QQYTRLPFT (SEQ ID
NO: 52).
[0245] The so called "MAb4" comprises: [0246] a variable domain of
heavy chain consisting of sequence [0247]
QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGS
GGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCARYRSYDWYFDVWGAGTT VTVSS
(SEQ ID NO: 88, with CDRs shown in bold characters) in which FR1-H
spans amino acid positions 1 to 25, CDR1-H spans amino acid
positions 26 to 33 (SEQ ID NO: 83), FR2-H spans amino acid
positions 34 to 50, CDR2-H spans amino acid positions 51 to 58 (SEQ
ID NO: 84), FR3-H spans amino acid positions 59 to 96, CDR3-H spans
amino acid positions 97 to 108 (SEQ ID NO: 85), and FR4-H spans
amino acid positions 109 to 119, and [0248] a variable domain of
light chain consisting of sequence [0249]
DIQMTQSPASLSASVGETVTITCRVSGNIHNYLAWYQQKQGKSPQLLVYNAKTLAD
GVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSNPYTFGGGTKLEIK (SEQ ID NO: 89,
with CDRs shown in bold characters) in which FR1-L spans amino acid
positions 1 to 26, CDR1-L spans amino acid positions 27 to 32 (SEQ
ID NO: 86), FR2-L spans amino acid positions 33 to 49, CDR2-L spans
amino acid positions 50 to 52, FR3-L spans amino acid positions 53
to 88, CDR3-L spans amino acid positions 89 to 97 (SEQ ID NO: 87),
and FR4-H spans amino acid positions 98 to 107.
[0250] The antibody may also be a humanised antibody or a fragment
of a humanised antibody. For example, the antibody of the invention
may result from humanisation of any of the antibodies defined
above.
[0251] Numerous methods for humanisation of an antibody sequence
are known in the art; see e.g. the review by Almagro & Fransson
(2008) Front Biosci. 13: 1619-1633. One commonly used method is CDR
grafting, or antibody reshaping, which involves grafting of the CDR
sequences of a donor antibody, generally a mouse antibody, into the
framework scaffold of a human antibody of different specificity.
Since CDR grafting may reduce the binding specificity and affinity,
and thus the biological activity of the parent antibody, back
mutations may be introduced at selected positions of the CDR
grafted antibody in order to retain the binding specificity and
affinity of the parent antibody. Identification of positions for
possible back mutations can be performed using information
available in the literature and in antibody databases. An
alternative humanization technique to CDR grafting and back
mutation is resurfacing, in which non-surface exposed residues of
non-human origin are retained, while surface residues are altered
to human residues. Another alternative technique is known as
"guided selection" (Jespers, L. S. et al., 1994, Biotechnology
12(9): 899-993) and can be used to derive from a murine antibody a
fully human antibody conserving the epitope and binding
characteristics of the parental antibody. The technique of
humanization based on molecular dynamic calculations as disclosed
in the application WO2009/032661 may be used. Thus in one
embodiment humanized antibodies may also be called "resurfaced"
antibodies.
[0252] For chimeric antibodies, humanisation typically involves
modification of the framework regions of the variable region
sequences.
[0253] Amino acid residues that are part of a CDR will typically
not be altered in connection with humanisation, although in certain
cases it may be desirable to alter individual CDR amino acid
residues, for example to remove a glycosylation site, a deamidation
site, an undesired cysteine residue, a lysine residue in the case
of ADC, N-linked glycosylation occurs by attachment of an
oligosaccharide chain to an asparagine residue in the tripeptide
sequence Asn-X-Ser or Asn-X-Thr, where X may be any amino acid
except Pro. Removal of an N-glycosylation site may be achieved by
mutating either the Asn or the Ser/Thr residue to a different
residue, in particular by way of conservative substitution.
Deamidation of asparagine and glutamine residues can occur
depending on factors such as pH and surface exposure. Asparagine
residues are particularly susceptible to deamidation, primarily
when present in the sequence Asn-Gly, and to a lesser extent in
other dipeptide sequences such as Asn-Ala. When such a deamidation
site, in particular Asn-Gly, is present in a CDR sequence, it may
therefore be desirable to remove the site, typically by
conservative substitution to remove one of the implicated residues.
In the case of ADC, attachment of a cytotoxic to mAb could be
prepared via covalent linkage to lysine side chain residue. This
steric hindrance may interfere with mAb binding to antigen. It may
therefore be desirable to remove the lysine residue, typically by
an arginine conservative substitution. Substitution in a CDR
sequence to remove one of the implicated residues is also intended
to be encompassed by the present invention. The inventors further
generated humanized antibodies "huMAb1_1", "huMAb1_2", "huMAb1_3"
based on CDR grafting and/or on Molecular Dynamic Trajectories (4D
humanization protocol) as described in example 7.2.1 and herein
below.
[0254] Accordingly, in one embodiment, the anti-LAMP1 antibodies in
context of the invention are humanized anti-LAMP1 antibodies
obtained through CDR grafting and/or based on Molecular Dynamic
Trajectories (4D humanization protocol).
[0255] Accordingly, in an embodiment, the humanized anti-LAMP1
antibody "huMAb1_1" comprises: [0256] the variable domain (VH1) of
heavy chain consisting of sequence [0257]
QVQLVQSGAEVKKPGSSVKVSCKASGYIFTNYNIHWVKKSPGQGLEWIGAIYPGNG
DAPYSQKFQGKATLTADTSTSTTYMELSSLRSEDTAVYYCVRANWDVAFAYWGQGTLVTV SS
(SEQ ID NO: 53) and [0258] the variable domain (VL1) of light chain
of huMAb1_1 consisting of sequence
DIQMTQSPSSLSASVGDRVTITCKASQDIDRYMAWYQDKPGKAPRLLIHDTSTLQS
GVPSRFSGSGSGRDYTLTISNLEPEDFATYYCLQYDNLWTFGGGTKVEIK (SEQ ID NO:
56).
[0259] The humanized antibody "huMAb1_2" comprises: [0260] a
variable domain (VH2) of heavy chain consisting of sequence [0261]
QVQLVQSGAELVKPGASVKMSCKASGYIFTNYNIHWVKKSPGQGLEWIGAIYPGNG
DAPYSQKFQDRATLTADTSSSTTYMELSSLTSEDSAVYYCVRANWDVAFAYWGQGTLVS VSS
(SEQ ID NO: 54), and [0262] a variable domain of light chain (VL2)
consisting of sequence [0263]
DIQMTQSPPSLSASVGGKVTITCKASQDIDRYMAWYQDKPGKGPKLLIHDTSTLQP
GIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLWTFGGGTKLEIK (SEQ ID NO:
57)
[0264] The humanized antibody "huMAb1_3" comprises: [0265] a
variable domain (VH3) of heavy chain consisting of sequence [0266]
QVQLVQSGAELVKPGASVKMSCKASGYIFTNYNIHWVRQAPGQGLEWIGAIYPGN
GDAPYAQKFQGRATLTADTSSSTTYMELSSLTSEDTAVYYCVRANWDVAFAYWGQGTLV TVSS
(SEQ ID NO: 55), and [0267] a variable domain of light chain (VL3)
consisting of sequence [0268]
DIQMTQSPSSLSASVGGKVTITCKASQDIDRYMAWYQQKPGKGPKLLIHDTSTLQP
GVPSRFSGSGSGRDYSLTISSLEPEDIATYYCLQYDNLWTFGGGTKLEIK (SEQ ID
NO:58)
[0269] The invention relates to an antibody which binds
specifically to human and Macaca fascicularis LAMP1 proteins.
[0270] "Affinity" is defined, in theory, by the equilibrium
association between the whole antibody and the antigen. It can be
experimentally assessed by a variety of known methods, such as
measuring association and dissociation rates with surface plasmon
resonance or measuring the EC.sub.50 in an immunochemical assay
(ELISA, FACS). Enzyme-linked immunosorbent assay (ELISA) is a
biochemistry assay that uses a solid-phase enzyme immunoassay to
detect the presence of a substance, usually an antigen, in a liquid
sample or wet sample. Antigens from the sample are attached to a
surface. Then, a further specific antibody is applied over the
surface so it can bind to the antigen. This antibody is linked to
an enzyme, and, in the final step, a substance containing the
enzyme's substrate is added. The subsequent reaction produces a
detectable signal, most commonly a color change in the substrate.
Fluorescence-activated cell sorting (FACS) provides a method for
sorting a heterogeneous mixture of biological cells into two or
more containers, one cell at a time, based upon the specific light
scattering and fluorescent characteristics of each cell. In these
assays, the EC.sub.50 is the concentration of the antibody which
induces a response halfway between the baseline and maximum after
some specified exposure time on a defined concentration of antigen
by ELISA (enzyme-linked immuno-sorbent assay) or cell expressing
the antigen by FACS (Fluorescence Activated Cell Sorting).
[0271] A monoclonal antibody binding to antigen 1(Ag1) is
"cross-reactive" to antigen 2 (Ag2) when the EC.sub.50s are in a
similar range for both antigens. In the present application, a
monoclonal antibody binding to Ag1 is cross-reactive to Ag2 when
the ratio of affinity of Ag2 to affinity of Ag1 is equal or less
than 10 (in particular 5, 2, 1 or 0.5), affinities being measured
with the same method for both antigens.
[0272] A monoclonal antibody binding to Ag1 is "not significantly
cross-reactive" to Ag2 when the affinities are very different for
the two antigens. Affinity for Ag2 may not be measurable if the
binding response is too low. In the present application, a
monoclonal antibody binding to Ag1 is not significantly
cross-reactive to Ag2, when the binding response of the monoclonal
antibody to Ag2 is less than 5% of the binding response of the same
monoclonal antibody to Ag1 in the same experimental setting and at
the same antibody concentration. In practice, the antibody
concentration used can be the EC.sub.50 or the concentration
required to reach the saturation plateau obtained with Ag1.
[0273] A monoclonal antibody "binds specifically" to Ag1 when it is
not significantly cross-reactive to Ag2.
[0274] The antibody according to the invention binds specifically
to human and Macaca fascicularis LAMP1 proteins. It does not
significantly cross-react with human LAMP2 (SEQ ID NO: 40).
[0275] In one embodiment, the antibody according to the invention
has an affinity (EC.sub.50) for human and/or cynomolgus monkey
LAMP1 expressed at the cell surface of a recombinant cell line,
wherein the cell line may be HEK293 and/or HCT116 and the apparent
affinity measured via Flow Cytometry is .ltoreq.70 nM, for example
.ltoreq.60 nM, .ltoreq.50 nM, .ltoreq.45 nM, .ltoreq.40 nM,
.ltoreq.35 nM, .ltoreq.30 nM, .ltoreq.25 nM, .ltoreq.20 nM,
.ltoreq.15 nM or .ltoreq.10 nM.
[0276] In one embodiment, the antibody according to the invention
has an affinity (EC.sub.50) for full length human and cynomolgus
monkey LAMP1 expressed at the cell surface of a recombinant cell
line, wherein the cell line may be HCT116 and the apparent affinity
measured via Flow Cytometry is .ltoreq.20 nM, in particular
.ltoreq.10 nM, .ltoreq.8 nM or .ltoreq.7 nM.
[0277] In one example, the antibody according to the invention has
an affinity (EC.sub.50) for cynomolgus monkey LAMP1 expressed at
the cell surface of a recombinant cell line, wherein the cell line
may be HEK293 and the apparent affinity measured via Flow Cytometry
is .ltoreq.50 nM, for example .ltoreq.40 nM or .ltoreq.35 nM.
[0278] In another example, the antibody according to the invention
has a KD for full purified human LAMP1 (SEQ ID NO 28) expressed in
HEK293 cells measured via surface plasmon resonance (SPR) is 70 nM,
for example 60 nM, 50 nM, 40 nM, 30 nM, 20 nM or 10 nM.
[0279] The use of surface plasmon resonance to determine is known
to the skilled in the art. In one example the binding kinetics of
for example the murine, chimer or humanized anti-LAMP1 mAbs were
determined by surface plasmon resonance assay using typically a
BIAcore 2000 (BIAcore Inc., Uppsala, N.J.). Therefore, for example
a CM5 BIAcore biosensor chip was docked into the instrument and
activated with for example 70 .mu.L of 1:1 NHS/EDC at room
temperature. Typically, a mouse anti-.alpha.human Fc IgG1 (BIAcore
#BR-1008-39) and rabbit anti-.alpha.murine Fc IgG1 (BIAcore
#BR-1008-38) (50 .mu.g/mL in 1 M acetate buffer, pH5) were
immobilized on the activated chips in all flow cells. The
immobilization was carried out at a flow rate of for example 10
.mu.L/min up to saturation. The chip was then blocked by for
example injection of 70 .mu.L of ethanolamine-HCl, pH 8.5, followed
by one wash with 3 M MgCl.sub.2 for anti-.alpha.human Fc IgG1 and
one wash with 10 mM Glycine-HCl pH 1.7 for anti-.alpha.murine Fc
IgG1. To measure the binding of for example anti-LAMP1 mAbs to
LAMP1, antibodies were used at 1-5 .mu.g/mL in BIAcore running
buffer (HBS-EP). The antigen for example (Sequence ID No 28 protein
produced as described in example 6.2) was injected from for example
1 to 256 nM. Following completion of the injection phase,
dissociation was monitored in a BIAcore running buffer at the same
flow rate for typically 600 sec. The surface was typically
regenerated between injections using for example 2.times.5 .mu.L 3
M MgCl.sub.2 (2.times.30 s) or anti-.alpha.human Fc IgG1 and
1.times.30 .mu.L 10 mM Glycine-HCl pH 1.7 for anti-.alpha.murine Fc
IgG1 (180 s). Individual sensorgrams were typically analyzed using
BIAevaluation software.
[0280] Thus, the polypeptide according to the invention may be used
in toxicological studies performed in monkeys, wherein the toxicity
profile obtained from those studies is relevant to anticipate
potential adverse effects in humans.
[0281] Alternatively, or furthermore, the antibody according to the
invention has an affinity (EC.sub.50) for LAMP1 expressed on the
surface of advanced human primary colon tumor CR-IGR-034P and
measured via Flow Cytometry is .ltoreq.50 nM, .ltoreq.40 nM, in
particular .ltoreq.30 nM, .ltoreq.20 nM or 5 nM.
[0282] Antibody binding capacity or ABC is the quantification of
cell surface antigen. ABC can be measured using QIFIKIT.RTM.
(Registered trademark of BIOCYTEX). The antibodies according to the
invention have a high ABC on many Patient derived Xenografts of
different origin (.gtoreq.20.000, in particular .gtoreq.50.000,
.gtoreq.100.000, .gtoreq.150.000 ABC) and tumor cell lines, in
particular colon tumor cells such as Colo205, SW480 or LS174T
(.gtoreq.1.500, .gtoreq.2.500, .gtoreq.4.000 ABC).
[0283] Alternatively, or furthermore, the antibody according to the
invention has the ability to internalize and recycle LAMP1 to the
cell membrane. In particular, when bound by an antibody according
to the invention, a molecule of LAMP1 at the membrane of cancer
cell has the capacity undergo at least 1, 4, 7 or 9 recyclings at
the cell membrane. In other words, one molecule of LAMP1 expressed
at the surface of a cancer cell can be bound by, and therefore
internalize, at least 2, 5, 8 or 10 molecules of antibody according
to the invention. Still in other words, according to an embodiment,
at least 2, 5, 8 or 10 molecules of antibody according to the
invention are internalized by one molecule of LAMP1 expressed at
the surface of a cancer cell.
[0284] Internalization may be assayed for instance by determining
an internalization score or by a fluorescence-based quenching
method.
[0285] The internalization score (IS) is defined as a ratio of the
fluorescence intensity inside the cell to the intensity of the
entire cell. It may be measured as described by using the imaging
flow cytemeter ImageStream.sup.x (from the supplier Amnis.RTM.
Corporation, 2505 Third Avenue, Suite 210, Seattle, Wash.
98121-1480, www.amnis.com). The higher the score, the greater the
fluorescence intensity is inside the cell. As described by Amnis
(see www.amnis.com), the inside of the cell is defined by an
erosion of a mask that fits the membrane of the cell. The score is
invariant to cell size and can accommodate concentrated bright
regions and small dim spots. The ratio is mapped to a logarithmic
scale to increase the dynamic range to values between {-inf, inf}.
The thickness of the membrane (in pixels) determines which pixels
are used to define the boundary and the membrane portions of the
cell. The user supplies an `internal` mask based on the brightfield
image that covers the inside of the cell, the thickness of the
membrane in pixels and the fluorescent channel of interest. The
cell is divided into 2 regions: External (B) and internal (I). The
user supplies the internal region as the mask. The external region
is determined by: 1. Dilating the internal mask by the membrane
thickness. 2. Combining 1 with the object mask of the channel of
interest. 3. External region equals mask 2 and not the internal
mask. Next, the mean intensity of the upper quartile of the pixels
in each region is determined. The Internalization Score (IS) is
then computed as follows:
I S = log ( a 1 - a ) , where a = m I m I + m B p I P B
##EQU00001## [0286] mI=Mean intensity of upper quartile pixels in
I, mB=Mean intensity of upper quartile pixels in B, [0287] pI=Peak
intensity of upper quartile pixels in I, pB=Peak intensity of upper
quartile pixels in B.
[0288] In the case of transferrin, (Williams A. et al., 1996,
Biomembranes, 4:255-287) the authors have obtained an IS of 0 when
the cells were left on ice and an IS of 0.9 when the cells were
incubated at 37.degree. C. for one hour.
[0289] For the antibodies of the invention, the inventors have
shown that the internalization scores (IS) at 37.degree. C. were
10-fold higher than at 4.degree. C. Since internalization of
antibodies does not take place at 4.degree. C., the internalization
scores obtained at 4.degree. C. reflect the density of LAMP1
molecules at the cell surface. A 10-fold higher value of the IS
parameter at 37.degree. C. than at 4.degree. C. therefore means
that the LAMP1 protein is quickly and repeatedly recycling at the
cell membrane. In other words the antibodies according to the
invention have a very high internalization capacity, much higher
than the capacity calculated from the density of the LAMP1 protein
at the cell surface.
[0290] Quantification of internalization can also be performed by
fluorescence-based quenching methods. In particular, a
fluorescence-based Alexa488-quenching method has been described to
analyze internalisation of targeting agents (Frejd et al. 2010,
International Journal of Oncology, 36: 757-763). According to said
description, internalization is calculated as the Mean fluorescence
intensity (MFI) value of quenched cells (intracellular compartments
only) divided by the MFI value of unquenched cells (both cell
surface and intracellular compartments) at 37.degree. C., according
to the following formula:
Percentage of internalized fraction : FL of quenched cells at 37
.degree. C . FL of unquenched cells at 37 .degree. C . .times. 100
##EQU00002##
[0291] Cells incubated with Alexa488-labelled compounds at
4.degree. C. are used as a control since internalization of
antibodies does not take place at 4.degree. C.
[0292] The inventors showed that after quenching, the total
fluorescence of Alexa488-MAb1 measured from cells labelled at
37.degree. C. (both cell surface and intracellular compartments)
was 10-fold higher than the fluorescence of cells labelled at
4.degree. C. (cell surface) after 4 h (example 4.4). Accordingly,
these results also indicate that the LAMP1 protein is quickly and
repeatedly recycling at cell membrane.
[0293] Thus, the inventors showed for the first time that LAMP1 can
function as a receptor mediating the internalization of antibodies
and suggest that availability of specific internalizing antibodies
should aid in developing novel therapeutic methods to target
toxins, drugs or short-range isotopes to be delivered specifically
to the interior of the cancer cells.
[0294] Furthermore the inventors could show that the results from
example 4.4 taken together indicate that each LAMP1 molecule is
involved in several (at least up to 10 on average) internalization
cycles via recycling at cell membrane during the course of the
experiment.
[0295] The antibody of the invention binds specifically to a domain
consisting in particular of the first to third loops of human and
Macaca fascicularis LAMP1 proteins. The domain consisting of the
first to third loops of human LAMP1 protein is defined by the amino
acids Ala29 to Ile309 of SEQ ID NO: 24, and the domain consisting
of the first to third loops of Macaca fascicularis LAMP1 protein is
defined by the amino acids Ala27 to Thr307 of SEQ ID NO: 39.
According to an embodiment, the antibody of the invention binds
specifically to the first lumenal domain of human and Macaca
fascicularis LAMP1 proteins.
[0296] The first lumenal domain of human LAMP1 is defined by the
amino acids at positions Ala29 to Arg195 of SEQ ID NO: 24, and the
first lumenal domain of Macaca fascicularis LAMP1 protein is
defined by the amino acids at positions Ala27 to Arg193 of SEQ ID
NO: 39. More specifically, the antibody can bind to the human and
Macaca fascicularis first lumenal domain indifferently whether
expressed as a soluble extracellular domain (e.g. amino acids
Ala29-Met382 for human LAMP1 (SEQ ID NO: 24) or Ala27-Met380 for
Macaca fascicularis LAMP1 (SEQ ID NO: 39)), or as a
membrane-anchored full-length LAMP1 protein recombinantly expressed
at the surface of a cell line, for instance HT29, Colo205 and
HCT116, HEK293 cell line. The inventors demonstrated that MAb1
binds to the amino acids 101 to 195 of SEQ ID NO: 24 corresponding
to Loop 2 of human LAMP1, for example to the amino acids 101 to 110
(SEQ ID NO: 72), 144 to 157 (SEQ ID NO:73) and 174 to 188 (SEQ ID
NO: 74) of SEQ ID NO: 24 as herein described in example 4.8. It has
been further identified by crystallography, that the binding site
of MAb1 further encompasses the amino acids Asn35, Cys80, Gly 81,
Glu83, Asn84 located in loop 1 of SEQ ID NO: 24.
[0297] Accordingly, MAb1 also binds to the amino acids at positions
29 to 100 of SEQ ID NO: 24 corresponding to Loop 1 of human LAMP1,
for example to a region that consists of the amino acids at
positions 35 to 84 of SEQ ID NO: 24 (SEQ ID NO:97), or to two
regions that consists of Asn35 of SEQ ID NO: 24 and amino acids at
positions 80-84 of SEQ ID NO: 24.
[0298] Furthermore both MAb2 and MAb3 bind to the amino acids 29 to
100 (SEQ ID NO: 77) of SEQ ID NO: 24 corresponding to Loop 1 of
human LAMP1, for instance MAb2 and MAb3 both bind to the amino
acids 29 to 41 (SEQ ID NO: 75) and 68 to 80 (SEQ ID NO: 76) of SEQ
ID NO: 24.
[0299] In a further antibody, the antibody of the invention binds
specifically to the second luminal domain of human and Macaca
fascicularis LAMP1 proteins, for instance to the fourth loop.
[0300] The fourth loop of human LAMP1 protein consists of amino
acids at positions Leu310 to Met382 of SEQ ID NO: 24 and the fourth
loop of Macaca fascicularis LAMP1 protein consists of amino acids
at positions Leu 308 to Met380 of SEQ ID NO: 39.
[0301] More specifically, the antibody binds to a region of Loop 4
comprising the amino acids 360 to 375 of human LAMP1 that consists
of sequences SEQ ID NO: 82.
[0302] In another embodiment, the antibody of the invention binds
specifically to human and Macaca fascicularis LAMP1 proteins
indifferently whether in non-glycosylated or glycosylated form.
[0303] Accordingly, in an embodiment, the invention relates to an
antibody which binds to: [0304] three regions of Loop 2 of human
LAMP1 that consist of sequences SEQ ID NO: 72, SEQ ID NO: 73 and
SEQ ID NO: 74, respectively, and optionally further to a region of
Loop1 of human LAMP1 that consists of sequence (SEQ ID NO:97); or
[0305] two regions of Loop 1 of human LAMP1 that consist of
sequences SEQ ID NO: 75 and SEQ ID NO: 76, respectively; or [0306]
a region of Loop4 of human LAMP1 that consist of sequence SEQ ID
NO: 82.
[0307] Furthermore, the inventors identified the residues R146,
D150, K152, R106, A108, N181, S182, S183, R186 and G187 of SEQ ID
NO: 24 as likely to interact with MAb1 as described in example 6.5.
They further identified the residues A29, M30, M32, G36, A40, S69,
D70, T72, V74, L75, and R77 of SEQ ID NO: 24 as likely to interact
with MAb2 and/or MAb3. Those residues have been individually
replaced by an alanine residue in the LAMP1 sequence derived from
hLAMP1_.DELTA.GYQTI and encoded in plasmid pXL5626 as described in
example 6.6. The inventors observed loss of binding to MAb1 for
alanine mutations at positions I149, D150 and R186 of SEQ ID NO: 24
in the LAMP1 protein, indicating that these positions are important
for MAb1 binding to LAMP1. Furthermore, loss of binding was
demonstrated for LAMP1 to MAb3 for alanine mutations at positions
G38 and D70 of SEQ ID NO: 24 due to Ala substitution in LAMP1
protein indicating that these positions are important for MAb3
binding to LAMP1.
[0308] Accordingly, in an embodiment, the invention relates to an
antibody which binds to: [0309] the amino acids 1149, D150 and R186
of SEQ ID NO: 24, or [0310] the amino acids G38 and D70 of SEQ ID
NO: 24, or
[0311] The invention also provides for an antibody which competes
for binding to a domain consisting of the first to third loops of
human and Macaca fascicularis LAMP1 proteins with an antibody
selected from the group consisting of the so-called antibodies
Mab1, Mab2, MAb2.sub.Can, MAb3, MAb3 VL_R24_R93, huMAb1_1 and
huMAb1_2, huMAb1_3 i.e.: [0312] (i) an antibody comprising a
variable domain of heavy chain of sequence SEQ ID NO: 1 and/or a
variable domain of light chain of sequence of sequence SEQ ID NO:
5; or [0313] (ii) an antibody comprising a variable domain of heavy
chain of sequence SEQ ID NO: 8 and/or a variable domain of light
chain of sequence of sequence SEQ ID NO: 12; or [0314] (iii) an
antibody comprising a variable domain of heavy chain of sequence
SEQ ID NO: 15 and/or a variable domain of light chain of sequence
of sequence SEQ ID NO: 16; or [0315] (iv) an antibody comprising a
variable domain of heavy chain of sequence SEQ ID NO: 42 and/or a
variable domain of light chain of sequence of sequence SEQ ID NO:
46; or [0316] (v) an antibody comprising a variable domain of heavy
chain of sequence SEQ ID NO: 42 and/or a variable domain of light
chain of sequence of sequence SEQ ID NO: 51; or [0317] (vi) an
antibody comprising a variable domain of heavy chain of sequence
SEQ ID NO: 53 and/or a variable domain of light chain of sequence
of sequence SEQ ID NO: 56; or [0318] (vii) an antibody comprising a
variable domain of heavy chain of sequence SEQ ID NO: 54 and/or a
variable domain of light chain of sequence of sequence SEQ ID NO:
57; or [0319] (viii) an antibody comprising a variable domain of
heavy chain of sequence SEQ ID NO: 55 and/or a variable domain of
light chain of sequence of sequence SEQ ID NO: 58.
[0320] In an embodiment, said antibody competes for binding to the
first lumenal domain of human and Macaca fascicularis LAMP1
proteins. For instance the invention provides for an antibody which
competes for binding to: [0321] three regions of Loop 2 of human
LAMP1 that consist of sequences SEQ ID NO: 72, SEQ ID NO: 73 and
SEQ ID NO: 74, respectively; or [0322] two regions of Loop 1 of
human LAMP1 that consist of sequences SEQ ID NO:75 and SEQ ID NO:
76, respectively, [0323] with an antibody comprising a variable
domain of heavy chain and a variable domain of light chain as
defined according to i-viii) above, as appropriate (i.e. with said
three regions of Loop 2 for an antibody as defined according to i
and vi-viii) above, or with said two regions of Loop 1 for an
antibody as defined according to ii-v)).
[0324] In one embodiment the competition is determined by use of an
ELISA as described in Example 4.8 of the specification, wherein
competition is defined by a signal of less than 80% of signal
compared to mAb control alone as assessed by absorption, when the
two competing antibodies are in solution at similar molarity, and
wherein competition is defined by a signal of less than 80%, for
instance less than_70%, 60%, 50%, 40%, 30%, 20%, 10%.
[0325] The ability of an antibody to compete for binding to a
domain consisting of the first to third loops, in particular to the
first lumenal domain, of human and Macaca fascicularis LAMP1
proteins with an antibody comprising the variable heavy and light
chains of an antibody selected from the group consisting of the
so-called antibodies MAb1, MAb2, MAb2.sub.Can, MAb3,
MAb3_VLR24-R93, huMAb1_1, huMAb1_2 and huMAb1_3 (hereafter a
"reference" antibody) may be readily assayed, for instance, by
competitive ELISA wherein the antigen (i.e. a polypeptide
comprising or consisting of a fragment of human or Macaca
fascicularis LAMP1 including the first to third loops of LAMP1, or
the first lumenal domain, in particular a protein containing the
first lumenal domain of LAMP1 from human and cynomolgus origin such
as presented in example 6.3) is bound to a solid support and two
solutions containing the candidate antibody and the reference
antibody, respectively, are added and the antibodies are allowed to
compete for binding to the antigen. The amount of reference
antibody bound to the antigen may then be measured, and compared to
the amount of reference antibody bound to the antigen when measured
against a negative control. An amount of bound reference antibody
in presence of the candidate antibody decreased as compared to the
amount of bound reference antibody in presence of the negative
control indicates that the candidate antibody has competed with the
reference antibody. Conveniently, the reference antibody may be
labeled (e.g. fluorescently) to facilitate detection of bound
reference antibody. Repeated measurements may be performed with
serial dilutions of the candidate and/or reference antibody.
[0326] In another example binding competition between MAb1 and MAb2
or MAb3 can be typically measured between two anti-LAMP1 mAbs by
ELISA with recombinant human LAMP1 coated on plate (as described in
example 6.2). Briefly, typically two mAbs were added simultaneously
at concentrations of for example 0.06 and 15 mg/L, the
concentration of typically 0.06 mg/L being close to the EC.sub.50.
MAb format was chosen so that the two mAbs had different Fc domains
(either human or murine). Individual measurements of mAb binding
could be performed typically by their unique specific binding to Fc
(for example with Peroxidase-AffiniPure Goat Anti-Human IgG Ab,
Fc.gamma. Fragment Specific (Jackson 109-035-098) or with
Peroxidase-AffiniPure Goat Anti-Mouse IgG Ab, Fc.gamma. Fragment
Specific (Jackson 115-035-164)). The results were reported as a
percentage of the value obtained from the mAb alone at the same
concentration.
[0327] In particular, the antibody according to the invention
comprises the CDR sequences of the heavy and/or light chains of one
of so-called anti-LAMP1 antibodies MAb1, MAb2 and MAb3. More
specifically, the antibody can comprise the CDR sequences of the
heavy light chain, or the CDR sequences of the heavy and light
chains, of one of so-called anti-LAMP1 antibodies MAb1, MAb2, MAb3
and MAb3 VL_R24_R93.
[0328] Accordingly, the antibody of the invention may comprise:
[0329] (i) a CDR1-H of sequence SEQ ID NO: 2 or a sequence
differing from SEQ ID NO: 2 by one amino acid substitution, a
CDR2-H of sequence SEQ ID NO: 3 or a sequence differing from SEQ ID
NO: 3 by one amino acid substitution, and a CDR3-H of sequence SEQ
ID NO: 4 or a sequence differing from SEQ ID NO: 4 by one amino
acid substitution; and/or a CDR1-L of sequence SEQ ID NO: 6 or a
sequence differing from SEQ ID NO: 6 by one amino acid
substitution, a CDR2-L of sequence DTS or a sequence differing from
DTS by one amino acid substitution and a CDR3-L of sequence SEQ ID
NO: 7 or a sequence differing from SEQ ID NO: 7 by one amino acid
substitution; or [0330] (ii) a CDR1-H of sequence SEQ ID NO: 9 or a
sequence differing from SEQ ID NO: 9 by one amino acid
substitution, a CDR2-H of sequence SEQ ID NO: 10 or a sequence
differing from SEQ ID NO: 10 by one amino acid substitution, a
CDR3-H of sequence SEQ ID NO: 11 or a sequence differing from SEQ
ID NO: 11 by one amino acid substitution; and/or a CDR1-L of
sequence SEQ ID NO: 13 or a sequence differing from SEQ ID NO: 13
by one amino acid substitution, a CDR2-L of sequence AAS or a
sequence differing from AAS by one amino acid substitution, and a
CDR3-L of sequence SEQ ID NO: 14 or a sequence differing from SEQ
ID NO: 14 by one amino acid substitution; or [0331] (iii) a CDR1-H
of sequence SEQ ID NO: 43 or a sequence differing from SEQ ID NO:
43 by one amino acid substitution, a CDR2-H of sequence SEQ ID NO:
44 or a sequence differing from SEQ ID NO: 44 by one amino acid
substitution, and a CDR3-H of sequence SEQ ID NO: 45 or a sequence
differing from SEQ ID NO: 45 by one amino acid substitution; and/or
a CDR1-L of sequence SEQ ID NO: 49 or a sequence differing from SEQ
ID NO: 47 by one amino acid substitution, a CDR2-L of sequence YTS
or a sequence differing from YTS by one amino acid substitution,
and a CDR3-L of sequence SEQ ID NO: 48 or SEQ ID NO: 52 or a
sequence differing from SEQ ID NO: 48 or SEQ ID NO: 52 by one amino
acid substitution.
[0332] In a further embodiment, the antibody according to the
invention comprises the CDR sequences of the heavy and/or light
chains of so-called anti-LAMP1 antibody MAb4. More specifically,
the antibody can comprise the CDR sequences of the heavy light
chain, or the CDR sequences of the heavy and light chains, of the
so-called anti-LAMP1 antibody MAb4.
[0333] Accordingly, the antibody of the invention may comprise a
CDR1-H of sequence SEQ ID NO: 83, a CDR2-H of sequence SEQ ID NO:
84, a CDR3-H of sequence SEQ ID NO: 85, a CDR1-L of sequence SEQ ID
NO: 86, a CDR2-L of sequence NAK, and a CDR3-L of sequence SEQ ID
NO: 87.
[0334] Furthermore, the antibody of the invention may comprise, or
consist of, a heavy chain of sequence SEQ ID NO: 98 and/or a light
chain of sequence of sequence SEQ ID NO: 99 (i.e heavy and/or light
chain of MAb4 as described in example 17.2.3).
[0335] In one embodiment this antibody may be chimeric, humanized,
or an antibody fragment.
[0336] In the antibody of the invention, one individual amino acid
may be altered by substitution, in particular by conservative
substitution, in one or more (in particular in only one) of the
above CDR sequences. Such an alteration may be intended for example
to remove a glycosylation site or a deamidation site, in connection
with humanisation of the antibody. Another alteration could also be
intended to remove a lysine in a CDR, since covalent attachment to
cytotoxic via lysine side chain residue may interfere with binding
to antigen in the case of ADC. For instance, SEQ ID NO: 48 and SEQ
ID NO: 52 are CDR3-L sequences that differ by one amino acid
substitution at their position 5.
[0337] According to an embodiment, the antibody comprises [0338]
(i) a CDR1-H of sequence SEQ ID NO: 2, a CDR2-H of sequence SEQ ID
NO: 3, and a CDR3-H of sequence SEQ ID NO: 4; and/or a CDR1-L of
sequence SEQ ID NO: 6, a CDR2-L of sequence DTS, and a CDR3-L of
sequence SEQ ID NO: 7; or [0339] (ii) a CDR1-H of sequence SEQ ID
NO: 9, a CDR2-H of sequence SEQ ID NO: 10, a CDR3-H of sequence SEQ
ID NO: 11; and/or a CDR1-L of sequence SEQ ID NO: 13, a CDR2-L of
sequence AAS, and a CDR3-L of sequence SEQ ID NO: 14; or [0340]
(iii) a CDR1-H of sequence SEQ ID NO: 43, a CDR2-H of sequence SEQ
ID NO: 44, and a CDR3-H of sequence SEQ ID NO: 45, and/or a CDR1-L
of sequence SEQ ID NO: 47, a CDR2-L of sequence YTS, and a CDR3-L
of sequence SEQ ID NO: 48 or SEQ ID NO: 52.
[0341] In particular, the antibody can comprise: [0342] (i) a
CDR1-H of sequence SEQ ID NO: 2, a CDR2-H of sequence SEQ ID NO: 3,
a CDR3-H of sequence SEQ ID NO: 4, and/or a CDR1-L of sequence SEQ
ID NO: 6, a CDR2-L of sequence DTS, and a CDR3-L of sequence SEQ ID
NO: 7; or [0343] (ii) a CDR1-H of sequence SEQ ID NO: 9, a CDR2-H
of sequence SEQ ID NO: 10, a CDR3-H of sequence SEQ ID NO: 11,
and/or [0344] a CDR1-L of sequence SEQ ID NO: 13, a CDR2-L of
sequence AAS, and a CDR3-L of sequence SEQ ID NO: 14; or [0345]
(iii) a CDR1-H of sequence SEQ ID NO: 43, a CDR2-H of sequence SEQ
ID NO: 44, a CDR3-H of sequence SEQ ID NO: 45, and/or [0346] CDR1-L
of sequence SEQ ID NO: 47, a CDR2-L of sequence YTS, and a CDR3-L
of sequence SEQ ID NO: 48 or SEQ ID NO: 52, or [0347] (iv) a
fragment of an antibody as defined in (i), (ii), or (iii).
[0348] The inventors cristallized recombinant Fab from huMAb1_1
that was identified to bind to loop 1 and loop 2 in a complex with
non-glycosylated LAMP1 protein according to the protocol described
in example 7.3.1. Based on the determination of the tridimensional
structure of huMab1_1 in complex with LAMP1, most of its CDRs can
be associated to specific canonical structure as referenced in
Al-Lazikini, Lesk and Chothia (1997) J. Mol. Biol. 273:927-948
mentioned above. The cristall structure allowed determining
mutations that can be introduced into the CDRS without disturbing
said canonical structure. It is known to the skilled in the art
that disturbation of said canonical structure would result in a
modified binding behavior. They thus identified by analyzing the
crystallographic structure, that Q27 and D28 of SEQ ID NO: 68
located in CDR1-L can be replaced by any amino acid as long as the
loop retains the canonical structure .kappa.2B and I129 of SEQ ID
NO: 68 can be replaced by an equivalent hydrophobic residues, for
instance Leu or Val. T51 of SEQ ID NO: 68 and S52 of SEQ ID NO: 68,
both located in CDR2-L can be replaced by a Ser, in case of T51 and
by any amino acid, in the case of S52, as long as this loop retains
the classic .gamma.-turn conformation. Residues D92, N93, L94 of
SEQ ID NO: 68, located in CDR3-L can be replaced by any amino acids
as long as the loop retains canonical structure .lamda.1B.
Furthermore, G26 of SEQ ID NO: 69, located in CDR-1H can be
replaced by any amino acid, Y27 of SEQ ID NO: 69, located in CDR-1H
by a phenylalanine, T30 of SEQ ID NO: 69, located in CDR-1H by any
amino acid, as long as the loop retains the canonical structure 1.
Residues D102, V103 and A104 of SEQ ID NO: 69, located in CDR-3H
can be replaced by any amino acid of similar sizes and
properties.
[0349] Accordingly, the invention provides for an antibody which
binds to three regions of Loop 2 of human LAMP1 that consist of
sequences SEQ ID NO: 72, SEQ ID NO: 73 and SEQ ID NO: 74,
respectively; and comprises [0350] a) a CDR1-L consisting of
sequence X.sub.1X.sub.2X.sub.3DRY (SEQ ID NO:93) wherein each of
X.sub.1 and X.sub.2 is any amino acid and X.sub.3 is selected from
Ile, Leu and Val; and [0351] a CDR2-L consisting of sequence
DX.sub.1X.sub.2 wherein X.sub.1a is selected from T or S and
X.sub.2 is any amino acid; and [0352] a CDR3-L consisting of the
sequence LQYX.sub.1X.sub.2X.sub.3WT, in which X.sub.1, X.sub.2 and
X.sub.3 is any amino acid; and/or [0353] b) a CDR1-H consisting of
sequence X.sub.1X.sub.2IFX.sub.3NYN (SEQ ID NO: 82) wherein each of
X.sub.1 and X.sub.3 are any amino acid and X.sub.2 is selected from
Tyr or Phe; and a CDR2-H consisting of SEQ ID NO: 3; and [0354]
CDR3-H consisting of sequence VRANWX.sub.1X.sub.2X.sub.3FAY (SEQ ID
NO: 84) wherein each of X.sub.1, X.sub.2, X.sub.3, is any amino
acid.
[0355] In one embodiment said antibody retains the ability to bind
to loop 2.
[0356] The skilled in the art knows methods to verify if the
antibody according to the definition retains its ability to bind to
three regions of loop 2 of human LAMP1 that consist of sequences
SEQ ID NO: 72, SEQ ID NO: 73 and SEQ ID NO: 74, respectively, and
thus does not suffer from a disturbed canonical structure.
[0357] The invention also provides antibodies as defined above
further comprising at least the variable domain of heavy chain
and/or the variable domain of light chain of one of the so-called
anti-LAMP1 antibodies MAb1, MAb2, MAb2.sub.Can, MAb3, MAb3
VL_R24_R93, huMAb1_1 and huMAb1_2, huMAb1_3, for instance MAb1,
MAb2, MAb2.sub.Can, MAb3, MAb3 VL_R24_R93.
[0358] Thus the invention relates in particular to an antibody
which comprises: [0359] (i) a variable domain of heavy chain of
sequence SEQ ID NO: 1 or a sequence at least 85% identical thereto
and/or a variable domain of light chain of sequence of sequence SEQ
ID NO: 5, or a sequence at least 85% identical thereto; or [0360]
(ii) a variable domain of heavy chain of sequence SEQ ID NO: 8, or
a sequence at least 85% identical thereto, and/or a variable domain
of light chain of sequence of sequence SEQ ID NO: 12, or a sequence
at least 85% identical thereto; or [0361] (iii) a variable domain
of heavy chain of sequence SEQ ID NO: 15, or a sequence at least
85% identical thereto, and/or a variable domain of light chain of
sequence of sequence SEQ ID NO: 16, or a sequence at least 85%
identical thereto; or [0362] (iv) a variable domain of heavy chain
of sequence SEQ ID NO: 42, or a sequence at least 85% identical
thereto, and/or a variable domain of light chain of sequence of
sequence SEQ ID NO: 46 or SEQ ID NO: 51, or a sequence at least 85%
identical thereto; or [0363] (v) a variable domain of heavy chain
of sequence SEQ ID NO: 53 or a sequence at least 85% identical
thereto and/or a variable domain of light chain of sequence of
sequence SEQ ID NO: 56, or a sequence at least 85% identical
thereto; or [0364] (vi) a variable domain of heavy chain of
sequence SEQ ID NO: 54 or a sequence at least 85% identical thereto
and/or a variable domain of light chain of sequence of sequence SEQ
ID NO: 57, or a sequence at least 85% identical thereto; or [0365]
(vii) a variable domain of heavy chain of sequence SEQ ID NO: 55 or
a sequence at least 85% identical thereto and/or a variable domain
of light chain of sequence of sequence SEQ ID NO: 58, or a sequence
at least 85% identical thereto.
[0366] In one embodiment, the invention relates to an isolated
anti-LAMP-1 antibody which comprises: [0367] (i) a CDR1-H of
sequence SEQ ID NO: 2, a CDR2-H of sequence SEQ ID NO: 3, and a
CDR3-H of sequence SEQ ID NO: 4; and/or a CDR1-L of sequence SEQ ID
NO: 6, a CDR2-L of sequence DTS, and a CDR3-L of sequence SEQ ID
NO: 7; or [0368] (ii) a CDR1-H of sequence SEQ ID NO: 9, a CDR2-H
of sequence SEQ ID NO: 10, a CDR3-H of sequence SEQ ID NO: 11;
and/or a CDR1-L of sequence SEQ ID NO: 13, a CDR2-L of sequence
AAS, and a CDR3-L of sequence SEQ ID NO: 14; or [0369] (iii) a
CDR1-H of sequence SEQ ID NO: 43, a CDR2-H of sequence SEQ ID NO:
44, and a CDR3-H of sequence SEQ ID NO: 45, and/or a CDR1-L of
sequence SEQ ID NO: 47, a CDR2-L of sequence YTS, and a CDR3-L of
sequence SEQ ID NO: 48 or SEQ ID NO: 52; or [0370] (iv) CDR1-H of
sequence SEQ ID NO: 83, a CDR2-H of sequence SEQ ID NO: 84, a
CDR3-H of sequence SEQ ID NO: 85, and/or a CDR1-L of sequence SEQ
ID NO: 86, a CDR2-L of sequence NAK, and a CDR3-L of sequence SEQ
ID NO: 87; or a heavy chain of sequence SEQ ID NO: 60 or a light
chain of sequence SEQ ID NO: 59; or [0371] (v) a heavy chain of
sequence SEQ ID NO: 62 or a light chain of sequence SEQ ID NO: 61;
or [0372] (vi) a heavy chain of sequence SEQ ID NO: 64 or a light
chain of sequence SEQ ID NO: 63.
[0373] For instance, the sequence of the variable domain of heavy
or light chain may differ from the reference sequence SEQ ID NO: 1,
5, 8, 12, 15, 16, 42, 46 or 51, 53, 56, 54, 57, 55, 58, for
instance from SEQ ID NO: 1, 5, 8, 12, 15, 16, 42, 46 or 51 as
appropriate, by one or more amino acid substitution(s), in
particular by one or more conservative amino acid substitution(s)
and/or substitution(s) with canonical residues.
[0374] In particular, the sequence of the variable domain of heavy
or light chain may differ from the reference sequence SEQ ID NO: 1,
5, 8, 12, 15, 16, 42, 46 or 51, 53, 56, 54, 57, 55, 58, for example
from SEQ ID NO: 1, 5, 8, 12, 15, 16, 42, 46 or 51 by conservative
amino acid substitution(s), only.
[0375] The sequence alterations as compared with sequence SEQ ID
NO: 1, 5, 8, 12, 15, 16, 42, 46 or 51, 53, 56, 54, 57, 55, 58, for
example from SEQ ID NO: 1, 5, 8, 12, 15, 16, 42, 46 or 51 will in
particular be present essentially in one or more of the framework
regions, FR1-L, FR2-L, FR3-L, FR4-L and/or FR1-H, FR2-H, FR3-H,
FR4-H.
[0376] However, amino acid substitutions in one or more CDRs are
also possible.
[0377] The invention also provides antibodies as defined above
further comprising at least the variable domain of heavy chain
and/or the variable domain of light chain of one of the so-called
anti-LAMP1 antibodies MAb4.
[0378] Thus the invention relates in particular to an antibody
which comprises a variable domain of heavy chain of sequence SEQ ID
NO: 88 or a sequence at least 85% identical thereto and/or a
variable domain of light chain of sequence of sequence SEQ ID NO:
89, or a sequence at least 85% identical thereto.
[0379] The antibody according to the invention is in particular a
conventional antibody, in particular a conventional monoclonal
antibody, or an antibody fragment, a bispecific or multispecific
antibody.
[0380] According to an embodiment, the antibody according to the
invention comprises or consists of an IgG, or a fragment
thereof.
[0381] The antibody of the invention and a fragment thereof may be,
respectively, a murine antibody and a fragment of a murine
antibody.
[0382] The antibody may also be a chimeric antibody, and in
particular a murine/human antibody, e.g. an antibody comprising
murine variable domains of heavy and light chains and a CH domain
and a CL domain from a human antibody. The antibody may be a
fragment of such an antibody.
[0383] According to an embodiment, the antibody of the invention
is: [0384] a) a chimeric antibody comprising, or consisting of, a
heavy chain of sequence SEQ ID NO: 17 and/or a light chain of
sequence of sequence SEQ ID NO: 18 (i.e heavy and/or light chain of
chMAb1 as described in example 7); or [0385] b) a chimeric antibody
comprising, or consisting of, a heavy chain of sequence SEQ ID NO:
19 and/or a light chain of sequence of sequence SEQ ID NO: 20; (i.e
heavy and/or light chain of chMAb2 as described in example 7); or
[0386] c) a chimeric antibody comprising, or consisting of, a heavy
chain of sequence SEQ ID NO: 21 and/or a light chain of sequence of
sequence SEQ ID NO: 22; (i.e heavy and/or light chain of
chMAb2.sub.Can as described in example 7); or [0387] d) a chimeric
antibody comprising, or consisting of, a heavy chain of sequence
SEQ ID NO: 49 and/or a light chain of sequence of sequence SEQ ID
NO: 50; (i.e heavy and/or light chain of chMAb3); or [0388] e) a
chimeric antibody comprising, or consisting of, a heavy chain of
sequence SEQ ID NO: 49 and/or a light chain of sequence of sequence
SEQ ID NO:81; (i.e heavy and/or light chain of chMAb3_VLR24-R93; or
[0389] f) a fragment of the chimeric antibody defined in a), b),
c), d) and e).
[0390] The antibody of the invention may also be a humanized
antibody. Thus, according to an embodiment, the antibody of the
invention comprises, or consists of: [0391] i) a heavy chain of
sequence SEQ ID NO: 60 or a sequence at least 85% identical thereto
and/or a light chain of sequence of sequence SEQ ID NO: 59 or a
sequence at least 85% identical thereto (i.e heavy and/or light
chain of huMAb1_1 as described in example 7.2); or [0392] ii) a
heavy chain of sequence SEQ ID NO: 62 or a sequence at least 85%
identical thereto and/or a light chain of sequence of sequence SEQ
ID NO: 61 or a sequence at least 85% identical thereto (i.e heavy
and/or light chain of huMAb1_2 as described in example 7.2); or
[0393] iii) a heavy chain of sequence SEQ ID NO: 64 a or a sequence
at least 85% identical thereto nd/or a light chain of sequence of
sequence SEQ ID NO: 63 or a sequence at least 85% identical thereto
(i.e heavy and/or light chain of huMAb1_3 as described in example
7.2).
[0394] In one embodiment the antibody of the invention is a
humanized antibody. In a further embodiment said humanized antibody
is obtained through the resurfacing technology. Such antibodies may
also be called "resurfaced" antibodies.
[0395] The antibody according to the invention may also be a single
domain antibody or a fragment thereof. In particular, a single
domain antibody fragment may consist of a variable heavy chain
(VHH) which comprises the CDR1-H, CDR2-H and CDR3-H of the
antibodies as described above. The antibody may also be a heavy
chain antibody, i.e. an antibody devoid of light chain, which may
or may not contain a CH1 domain.
[0396] The single domain antibody or a fragment thereof may also
comprise the framework regions of a camelid single domain antibody,
and optionally the constant domain of a camelid single domain
antibody.
[0397] The antibody according to the invention may also be an
antibody fragment, in particular a humanised antibody fragment,
selected from the group consisting of Fv, Fab, F(ab')2, Fab', dsFv,
(dsFv)2, scFv, sc(Fv)2, and diabodies.
[0398] The antibody may also be a bispecific or multispecific
antibody formed from antibody fragments, at least one antibody
fragment being an antibody fragment according to the invention.
Multispecific antibodies are polyvalent protein complexes as
described for instance in EP 2 050 764 A1 or US 2005/0003403
A1.
[0399] The bispecific or multispecific antibodies according to the
invention can have specificity for (a) the first to third loops, in
particular to the first lumenal domain on human/Macaca fascicularis
LAMP1 targeted by one of the so-called MAb1, MAb2, MAb2.sub.Can,
MAb3, MAb3_VLR24-R93 antibodies and (b) at least one other antigen.
According to an embodiment the at least one other antigen is not a
human or Macaca fascicularis LAMP1 family member, and in particular
not at least one or all of human and Macaca fascicularis LAMP2.
According to another embodiment, the at least one other antigen may
be an epitope on human Macaca fascicularis LAMP1 other than said
first to third loops, in particular first lumenal domain targeted
by one of the so-called MAb1, MAb2, MAb2.sub.Can and MAb3
antibodies.
[0400] Said antibodies can be produced by any technique well known
in the art. In particular said antibodies are produced by
techniques as hereinafter described.
[0401] Antibodies and fragments thereof according to the invention
can be used in an isolated (e.g., purified) from or contained in a
vector, such as a membrane or lipid vesicle (e.g. a liposome).
[0402] The antibodies of the invention may represent any
combination of the above mentioned features.
[0403] Nucleic Acids, Vectors and Recombinant Host Cells
[0404] A further object of the invention relates to a nucleic acid
sequence comprising or consisting of a sequence encoding an
antibody of the invention as defined above.
[0405] Typically, said nucleic acid is a DNA or RNA molecule, which
may be included in any suitable vector, such as a plasmid, cosmid,
episome, artificial chromosome, phage or a viral vector.
[0406] The terms "vector", "cloning vector" and "expression vector"
mean the vehicle by which a DNA or RNA sequence (e.g. a foreign
gene) can be introduced into a host cell, so as to transform the
host and promote expression (e.g. transcription and translation) of
the introduced sequence.
[0407] So, a further object of the invention relates to a vector
comprising a nucleic acid of the invention.
[0408] Such vectors may comprise regulatory elements, such as a
promoter, enhancer, terminator and the like, to cause or direct
expression of said polypeptide upon administration to a subject.
Examples of promoters and enhancers used in the expression vector
for animal cell include enhancer and promoter of human
cytomegalovirus (Nelson, J., 1996 J. Virology 70: 3207-3986), early
promoter and enhancer of SV40 (Mizukami, T. and Itoh, S. et al.,
1987, J Biochem. 101(5): 1307-1310), LTR promoter and enhancer of
Moloney mouse leukemia virus (Kuwana Y. et al., 1987, Biochem
Biophys Res Commun. 149: 960-968), promoter (Mason, J. O. et al.,
1985, Cell 41: 479-487) and enhancer (Gillies, S. D. et al., 1983,
Cell 33: 717-728) of immunoglobulin H chain and the like.
[0409] Any expression vector for animal cell can be used, so long
as a gene encoding the human antibody C region can be inserted and
expressed. Examples of suitable vectors include pAGE107 (Miyaji, H.
et al., 1990, Cytotechnology 3(2): 133-140), pAGE103 (Mizukami, T.
and Itoh, S. et al., 1987, J Biochem. 101(5): 1307-1310), pHSG274
(Brady, G. et al., 1984, Gene 27(2): 223-232), pKCR (O'Hare, K. et
al., 1981, Proc Natl Acad Sci USA. 78(3): 1527-1531), pSG1 beta
d2-4-(Miyaji, H. et al., 1990, Cytotechnology 4: 173-180) and the
like.
[0410] Other examples of plasmids include replicating plasmids
comprising an origin of replication pCEP5, or integrative plasmids,
such as for instance pUC, pcDNA, pBR, and the like.
[0411] Other examples of viral vector include adenoviral,
retroviral, herpes virus and AAV vectors. Such recombinant viruses
may be produced by techniques known in the art, such as by
transfecting packaging cells or by transient transfection with
helper plasmids or viruses. Typical examples of virus packaging
cells include PA317 cells, PsiCRIP cells, GPenv+cells, 293 cells,
etc. Detailed protocols for producing such replication-defective
recombinant viruses may be found for instance in WO 95/14785, WO
96/22378, U.S. Pat. No. 5,882,877, U.S. Pat. No. 6,013,516, U.S.
Pat. No. 4,861,719, U.S. Pat. No. 5,278,056 and WO 94/19478.
[0412] A further object of the present invention relates to a cell
which has been transfected, infected or transformed by a nucleic
acid and/or a vector according to the invention.
[0413] The term "transformation" means the introduction of a
"foreign" (i.e. extrinsic) gene, DNA or RNA sequence to a host
cell, so that the host cell will express the introduced gene or
sequence to produce a desired substance, typically a protein or
enzyme coded by the introduced gene or sequence. A host cell that
receives and expresses introduced DNA or RNA has been
"transformed".
[0414] The nucleic acids of the invention may be used to produce a
recombinant antibody of the invention in a suitable expression
system. The term "expression system" means a host cell and
compatible vector under suitable conditions, e.g. for the
expression of a protein coded for by foreign DNA carried by the
vector and introduced to the host cell.
[0415] Common expression systems include E. coli host cells and
plasmid vectors, insect host cells and Baculovirus vectors, and
mammalian host cells and vectors. Other examples of host cells
include, without limitation, prokaryotic cells (such as bacteria)
and eukaryotic cells (such as yeast cells, mammalian cells, insect
cells, plant cells, etc.). Specific examples include E. coli,
Kluyveromyces or Saccharomyces yeasts, mammalian cell lines (e.g.,
Vero cells, CHO cells, 313 cells, COS cells, HEK293 cells etc.) as
well as primary or established mammalian cell cultures (e.g.,
produced from lymphoblasts, fibroblasts, embryonic cells,
epithelial cells, nervous cells, adipocytes, etc.). Examples also
include mouse SP2/0-Ag14 cell (ATCC CRL1581), mouse P3X63-Ag8.653
cell (ATCC CRL1580), CHO cell in which a dihydrofolate reductase
gene (hereinafter referred to as "DHFR gene") is defective (Urlaub,
G. et al.; 1980, Proc Natl Acad Sci USA. 77(7): 4216-4220), rat
YB2/3HL.P2.G11.16Ag.20 cell (ATCC CRL1662, hereinafter referred to
as "YB2/0 cell"), and the like. The YB2/0 cell is of interest,
since ADCC activity of chimeric or humanised antibodies is enhanced
when expressed in this cell.
[0416] In particular, for expression of humanised antibody, the
expression vector may be either of a type in which a gene encoding
an antibody heavy chain and a gene encoding an antibody light chain
exists on separate vectors or of a type in which both genes exist
on the same vector (tandem type). In respect of easiness of
construction of a humanised antibody expression vector, easiness of
introduction into animal cells, and balance between the expression
levels of antibody H and L chains in animal cells, humanised
antibody expression vector of the tandem type is preferred
(Shitara, K. et al., 1994, J Immunol Methods. January 3: 167(1-2):
271-8). Examples of tandem type humanised antibody expression
vector include pKANTEX93 (WO 97/10354), pEE18 and the like.
[0417] The present invention also relates to a method of producing
a recombinant host cell expressing an antibody according to the
invention, said method comprising the steps consisting of: (i)
introducing in vitro or ex vivo a recombinant nucleic acid or a
vector as described above into a competent host cell, (ii)
culturing in vitro or ex vivo the recombinant host cell obtained
and (iii), optionally, selecting the cells which express and/or
secrete said antibody.
[0418] Such recombinant host cells can be used for the production
of antibodies of the invention.
Methods of Producing Antibodies of the Invention
[0419] Antibodies of the invention may be produced by any technique
known in the art, such as, without limitation, any chemical,
biological, genetic or enzymatic technique, either alone or in
combination.
[0420] Knowing the amino acid sequence of the desired sequence, one
skilled in the art can readily produce said antibodies or
immunoglobulin chains, by standard techniques for production of
polypeptides. For instance, they can be synthesized using
well-known solid phase method, in particular using a commercially
available peptide synthesis apparatus (such as that made by Applied
Biosystems, Foster City, Calif.) and following the manufacturer's
instructions. Alternatively, antibodies and immunoglobulin chains
of the invention can be synthesized by recombinant DNA techniques
as is well-known in the art. For example, these fragments can be
obtained as DNA expression products after incorporation of DNA
sequences encoding the desired (poly)peptide into expression
vectors and introduction of such vectors into suitable eukaryotic
or prokaryotic hosts that will express the desired polypeptide,
from which they can be later isolated using well-known
techniques.
[0421] In particular, the invention further relates to a method of
producing an antibody of the invention, which method comprises the
steps consisting of: (i) culturing a transformed host cell
according to the invention; (ii) expressing said antibody or
polypeptide; and (iii) recovering the expressed antibody or
polypeptide.
[0422] Methods for producing humanised or chimeric antibodies
involve conventional recombinant DNA and gene transfection
techniques are well known in the art (See Morrison, S. L. and Oi,
V. T., 1984, Annu Rev Immunol 2: 239-256 and patent documents U.S.
Pat. No. 5,202,238; and U.S. Pat. No. 5,204,244).
[0423] In a particular embodiment, a chimeric antibody of the
present invention can be produced by obtaining nucleic sequences
encoding the murine VL and VH domains as previously described,
constructing a chimeric antibody expression vector by inserting
them into an expression vector for animal cell having genes
encoding human antibody CH and human antibody CL, and expressing
the coding sequence by introducing the expression vector into an
animal cell.
[0424] In another particular embodiment, a humanised antibody of
the present invention can be produced by obtaining nucleic
sequences encoding humanised VL and VH domains as previously
described, constructing a humanised antibody expression vector by
inserting them into an expression vector for animal cell having
genes encoding human antibody CH and human antibody CL, and
expressing the coding sequence by introducing the expression vector
into an animal cell.
[0425] As the CH domain of a humanized or chimeric antibody, it may
be any region which belongs to human immunoglobulin heavy chains,
but those of IgG class are suitable and any one of subclasses
belonging to IgG class, such as IgG1, IgG2, IgG3 and IgG4, can also
be used. Also, as the CL of a human chimeric antibody, it may be
any region which belongs to human immunoglobulin light chains, and
those of kappa class or lambda class can be used.
[0426] Antibodies can be humanised using a variety of techniques
known in the art including, for example, the technique disclosed in
the application WO2009/032661, CDR-grafting (EP 239,400; PCT
publication WO91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and
5,585,089), veneering or resurfacing (EP 592,106; EP 519,596;
Padlan EA (1991); Studnicka, G. M. et al., 1994, Protein Eng. 7(6):
805-814; Roguska, M. A. et al., 1994, Proc Natl Acad Sci USA 91(3):
969-973), and chain shuffling (U.S. Pat. No. 5,565,332) The general
recombinant DNA technology for preparation of such antibodies is
also known (see European Patent Application EP 125023 and
International Patent Application WO 96/02576).
[0427] Antibodies of the invention are suitably separated from the
culture medium by conventional immunoglobulin purification
procedures such as, for example protein A affinity chromatography,
ceramic hydroxyapatite chromatography, mixed-mode chromatography,
size-exclusion chromatography etc.
[0428] The Fab of the present invention can be obtained by treating
an antibody which specifically reacts with LAMP1 with a protease,
such as papaine. Also, the Fab can be produced by inserting DNA
sequences encoding both chains of the Fab of the antibody into a
vector for prokaryotic expression, or for eukaryotic expression,
and introducing the vector into procaryotic or eukaryotic cells (as
appropriate) to express the Fab.
[0429] The F(ab')2 of the present invention can be obtained
treating an antibody which specifically reacts with LAMP1 with a
protease, pepsin. Also, the F(ab')2 can be produced by binding Fab'
described below via a thioether bond or a disulfide bond.
[0430] The Fab' of the present invention can be obtained treating
F(ab')2 which specifically reacts with LAMP1 with a reducing agent,
such as dithiothreitol. Also, the Fab' can be produced by inserting
DNA sequences encoding Fab' chains of the antibody into a vector
for prokaryotic expression, or a vector for eukaryotic expression,
and introducing the vector into prokaryotic or eukaryotic cells (as
appropriate) to perform its expression.
[0431] The scFv of the present invention can be produced by taking
sequences of the CDRs or VH and VL domains as previously described,
constructing a DNA encoding an scFv fragment, inserting the DNA
into a prokaryotic or eukaryotic expression vector, and then
introducing the expression vector into prokaryotic or eukaryotic
cells (as appropriate) to express the scFv. To generate a humanised
scFv fragment, a well known technology called CDR grafting may be
used, which involves selecting the complementary determining
regions (CDRs) according to the invention, and grafting them onto a
human scFv fragment framework of known three dimensional structure
(see, e. g., WO98/45322; WO 87/02671; U.S. Pat. No. 5,859,205; U.S.
Pat. No. 5,585,089; U.S. Pat. No. 4,816,567; EP0173494).
[0432] The single chain antibody or VHH directed against LAMP1 may
be obtained for instance by a method comprising the steps of (a)
immunizing a mammal belonging to the Camelidae with LAMP1 or a
fragment thereof, so as to elicit antibodies (and in particular
heavy chain antibodies) against LAMP1; (b) obtaining a biological
sample from the Camelidae thus immunized, said sample comprising
heavy chain antibody sequences and/or V.sub.HH sequences that are
directed against LAMP1; and (c) recovering (e.g isolating) heavy
chain antibody sequences and/or VH.sub.H sequences that are
directed against LAMP1 from said biological sample. Suitable single
chain antibody or VHH may also be obtained by screening a library
comprising heavy chain antibody sequences and/or VHH sequences for
heavy chain antibody sequences and/or VHH sequences that compete
for binding to the first to third loops, in particular to the first
lumenal domain of human and Macaca fascicularis LAMP1 proteins with
an antibody comprising the variable heavy and light chains of an
antibody selected from the group consisting of the so-called
antibodies MAb1, MAb2, MAb2.sub.Can, MAb3, huMAb1_1 and huMAb1_2,
huMAb1_3, for instance MAb1, MAb2, MAb2.sub.Can, MAb3.
Modification of the Antibodies of the Invention
[0433] Amino acid sequence modification(s) of the antibodies
described herein are contemplated. For example, it may be desirable
to improve the binding affinity and/or other biological properties
of the antibody.
[0434] Modifications and changes may be made in the structure of
the antibodies of the present invention, and in the DNA sequences
encoding them, and still result in a functional antibody or
polypeptide with desirable characteristics.
[0435] In making the changes in the amino sequences of polypeptide,
the hydropathic index of amino acids may be considered. The
importance of the hydropathic amino acid index in conferring
interactive biologic function on a protein is generally understood
in the art. It is accepted that the relative hydropathic character
of the amino acid contributes to the secondary structure of the
resultant protein, which in turn defines the interaction of the
protein with other molecules, for example, enzymes, substrates,
receptors, DNA, antibodies, antigens, and the like. Each amino acid
has been assigned a hydropathic index on the basis of their
hydrophobicity and charge characteristics these are: isoleucine
(+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8);
cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine
(-0.4); threonine (-0.7); serine (-0.8); tryptophane (-0.9);
tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate
(-3.5); glutamine (-3.5); aspartate -3.5); asparagine (-3.5);
lysine (-3.9); and arginine (-4.5).
[0436] A further object of the present invention also encompasses
function-conservative variants of the polypeptides of the present
invention.
[0437] For example, certain amino acids may be substituted by other
amino acids in a protein structure without appreciable loss of
activity. Since the interactive capacity and nature of a protein
define its biological functional activity, certain amino acid
substitutions can be made in a protein sequence, and of course in
its DNA encoding sequence, while nevertheless obtaining a protein
with like properties. It is thus contemplated that various changes
may be made in the antibodies sequences of the invention, or
corresponding DNA sequences which encode said polypeptides, without
appreciable loss of their biological activity.
[0438] It is known in the art that certain amino acids may be
substituted by other amino acids having a similar hydropathic index
or score and still result in a protein with similar biological
activity, i.e. still obtain a biological functionally equivalent
protein. It is also possible to use well-established technologies,
such as alanine-scanning approaches, to identify, in an antibody or
polypeptide of the invention, all the amino acids that can be
substituted without significant loss of binding to the antigen.
Such residues can be qualified as neutral, since they are not
involved in antigen binding or in maintaining the structure of the
antibody. One or more of these neutral positions can be substituted
by alanine or by another amino acid can without changing the main
characteristics of the antibody or polypeptide of the
invention.
[0439] As outlined above, amino acid substitutions are generally
therefore based on the relative similarity of the amino acid
side-chain substituents, for example, their hydrophobicity,
hydrophilicity, charge, size, and the like. Exemplary substitutions
which take several of the foregoing characteristics into
consideration are well known to those of skill in the art and
include: arginine and lysine; glutamate and aspartate; serine and
threonine; glutamine and asparagine; and valine, leucine and
isoleucine.
[0440] It may be also desirable to modify the antibody of the
invention with respect to effector function, e.g. so as to enhance
antigen-dependent cell-mediated cytotoxicity (ADCC) and/or
complement dependent cytotoxicity (CDC) of the antibody. This may
be achieved by introducing one or more amino acid substitutions in
an Fc region of the antibody. Alternatively or additionally,
cysteine residue(s) may be introduced in the Fc region, thereby
allowing inter-chain disulfide bond formation in this region. The
homodimeric antibody thus generated may have improved
internalization capability and/or increased complement-mediated
cell killing and/or antibody-dependent cellular cytotoxicity (ADCC)
(Caron, P. C. et al., 1992, J Exp Med. 176(4): 1191-1195 and Shopes
B., 1992, J Immunol. 148(9): 2918-2922).
[0441] Another type of amino acid modification of the antibody of
the invention may be useful for altering the original glycosylation
pattern of the antibody, i.e. by deleting one or more carbohydrate
moieties found in the antibody, and/or adding one or more
glycosylation sites that are not present in the antibody. The
presence of either of the tripeptide sequences asparagine-X-serine,
and asparagine-X-threonine, where X is any amino acid except
proline, creates a potential glycosylation site. Addition or
deletion of glycosylation sites to the antibody is conveniently
accomplished by altering the amino acid sequence such that it
contains one or more of the above-described tripeptide sequences
(for N-linked glycosylation sites).
[0442] Another type of modification of the antibody of the
invention may be to remove a lysine in a CDR or specially close to
a CDR since covalent attachment to cytotoxic via lysine side chain
residue may interfere with binding to antigen in the case of
ADC.
[0443] Another type of modification involves the removal of
sequences identified, either in silico or experimentally, as
potentially resulting in degradation products or heterogeneity of
antibody preparations. As examples, deamidation of asparagine and
glutamine residues can occur depending on factors such as pH and
surface exposure. Asparagine residues are particularly susceptible
to deamidation, primarily when present in the sequence Asn-Gly, and
to a lesser extent in other dipeptide sequences such as Asn-Ala.
When such a deamidation site, in particular Asn-Gly, is present in
an antibody or polypeptide of the invention, it may therefore be
desirable to remove the site, typically by conservative
substitution to remove one of the implicated residues. Such
substitutions in a sequence to remove one or more of the implicated
residues are also intended to be encompassed by the present
invention.
[0444] Another type of covalent modification involves chemically or
enzymatically coupling glycosides to the antibody. These procedures
are advantageous in that they do not require production of the
antibody in a host cell that has glycosylation capabilities for N-
or O-linked glycosylation. Depending on the coupling mode used, the
sugar(s) may be attached to (a) arginine and histidine, (b) free
carboxyl groups, (c) free sulfhydryl groups such as those of
cysteine, (d) free hydroxyl groups such as those of serine,
threonine, or hydroxyproline, (e) aromatic residues such as those
of phenylalanine, or tyrosine, (f) the amide group of glutamine.
For example, such methods are described in WO87/05330.
[0445] Removal of any carbohydrate moieties present on the antibody
may be accomplished chemically or enzymatically. Chemical
deglycosylation requires exposure of the antibody to the compound
trifluoromethanesulfonic acid, or an equivalent compound. This
treatment results in the cleavage of most or all sugars except the
linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while
leaving the antibody intact. Chemical deglycosylation is described
by Sojahr, H. et al. (1987, Arch Biochem Biophys. 259(1): 52-57)
and by Edge, A. S. et al. (1981, Anal Biochem. 118(1): 131-137).
Enzymatic cleavage of carbohydrate moieties on antibodies can be
achieved by the use of a variety of endo- and exo-glycosidases as
described by Thotakura, N R. et al. (1987, Methods Enzymol 138:
350-359).
[0446] Another type of covalent modification of the antibody
comprises linking the antibody to one of a variety of non
proteinaceous polymers, eg., polyethylene glycol, polypropylene
glycol, or polyoxyalkylenes, in the manner set forth in U.S. Pat.
Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or
4,179,337.
Pharmaceutical Compositions
[0447] The antibodies or immunoconjugates of the invention may be
combined with pharmaceutically acceptable excipients, and
optionally sustained-release matrices, such as biodegradable
polymers, to form therapeutic compositions.
[0448] Thus, another object of the invention relates to a
pharmaceutical composition comprising an antibody or an
immunoconjugate of the invention and a pharmaceutically acceptable
carrier.
[0449] The invention also relates to a polypeptide or an
immunoconjugate according to the invention, for use as a
medicament.
[0450] "Pharmaceutically" or "pharmaceutically acceptable" refers
to molecular entities and compositions that do not produce an
adverse, allergic or other untoward reaction when administered to a
mammal, especially a human, as appropriate. A pharmaceutically
acceptable carrier or excipient refers to a non-toxic solid,
semi-solid or liquid filler, diluent, encapsulating material or
formulation auxiliary of any type.
[0451] The form of the pharmaceutical compositions, the route of
administration, the dosage and the regimen naturally depend upon
the condition to be treated, the severity of the illness, the age,
weight, and gender of the patient, etc.
[0452] The pharmaceutical compositions of the invention can be
formulated for a topical, oral, parenteral, intranasal,
intravenous, intramuscular, subcutaneous or intraocular
administration and the like.
[0453] In particular, the pharmaceutical compositions contain
vehicles which are pharmaceutically acceptable for a formulation
capable of being injected. These may be in particular isotonic,
sterile, saline solutions (monosodium or disodium phosphate,
sodium, potassium, calcium or magnesium chloride and the like or
mixtures of such salts), or dry, especially freeze-dried
compositions which upon addition, depending on the case, of
sterilized water or physiological saline, permit the constitution
of injectable solutions.
[0454] The doses used for the administration can be adapted as a
function of various parameters, and in particular as a function of
the mode of administration used, of the relevant pathology, or
alternatively of the desired duration of treatment.
[0455] To prepare pharmaceutical compositions, an effective amount
of the antibody or immunoconjugate of the invention may be
dissolved or dispersed in a pharmaceutically acceptable carrier or
aqueous medium.
[0456] The pharmaceutical forms suitable for injectable use include
sterile aqueous solutions or dispersions; and sterile powders for
the extemporaneous preparation of sterile injectable solutions or
dispersions. In all cases, the form must be sterile and must be
fluid to the extent that easy syringability exists. It must be
stable under the conditions of manufacture and storage and must be
preserved against the contaminating action of microorganisms, such
as bacteria and fungi.
[0457] The carrier can be a solvent or dispersion medium
containing, for example, water, ethanol, polyol (for example,
glycerol, propylene glycol, and liquid polyethylene glycol, and the
like), suitable mixtures thereof. The proper fluidity can be
maintained, for example, by the use of a coating, such as lecithin,
by the maintenance of the required particle size in the case of
dispersion and by the use of surfactants, stabilizing agents,
cryoprotectants or antioxidants. The prevention of the action of
microorganisms can be brought about by antibacterial and antifungal
agents. In many cases, it will be preferable to include isotonic
agents, for example, sugars or sodium chloride.
[0458] Sterile injectable solutions are prepared by incorporating
the active compounds in the required amount in the appropriate
solvent with several of the other ingredients enumerated above, as
required, followed by filtered sterilization. Generally,
dispersions are prepared by incorporating the various sterilized
active ingredients into a sterile vehicle which contains the basic
dispersion medium and the required other ingredients from those
enumerated above. In the case of sterile powders for the
preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum-drying and freeze-drying techniques which
yield a powder of the active ingredient plus any additional desired
ingredient from a previously sterile-filtered solution thereof.
[0459] Upon formulation, solutions will be administered in a manner
compatible with the dosage formulation and in such amount as is
therapeutically effective. The formulations are easily administered
in a variety of dosage forms, such as the type of injectable
solutions described above, but drug release capsules and the like
can also be employed.
[0460] For parenteral administration in an aqueous solution, for
example, the solution should be suitably buffered if necessary and
the liquid diluent first rendered isotonic with sufficient saline
or glucose. These particular aqueous solutions are especially
suitable for intravenous, intramuscular, subcutaneous and
intraperitoneal administration. In this connection, sterile aqueous
media which can be employed will be known to those of skill in the
art in light of the present disclosure. For example, one dosage
could be dissolved in 1 mL of isotonic NaCl solution and either
added to 1000 mL of hypodermoclysis fluid or injected at the
proposed site of infusion, (see for example, "Remington's
Pharmaceutical Sciences" 15th Edition, pages 1035-1038 and
1570-1580). Some variation in dosage will necessarily occur
depending on the condition of the subject being treated. The person
responsible for administration will, in any event, determine the
appropriate dose for the individual subject.
[0461] The antibody or immunoconjugate of the invention of the
invention may be formulated within a therapeutic mixture to
comprise about 0.01 to 100 milligrams, per dose or so.
Therapeutic Methods and Uses
[0462] The inventors have shown that an antibody directed against
the first to third loops of LAMP1, in particular against the first
lumenal domain of LAMP1, in particular MAb1 and MAb2 and Mab3, is
able to actively internalize the LAMP1 receptor-antibody complex
after binding and accumulate probably via coated pits. Internalized
antibodies MAb1, MAb2 and Mab3 localized to early endosomes and
subsequently trafficked to and accumulation in lysosomal
compartments.
[0463] ImageStream multispectral imaging flow cytometer (Amnis
corp.) reveals that the internalized antibodies accumulate in
lysosomal compartments. Immunofluorescence analysis of viable
Colo205 cells incubated with MAb1, MAb2 and MAb3 at 4.degree. C.
showed distinct plasma membrane staining. Incubation of cells at
37.degree. C. with MAb1, MAb2 and MAb3 revealed labeling of both
plasma membrane and intracellular vesicles after 4 hours
incubation. Since the internalization score (IS) revealing the
fluorescence inside cells (as measured at 37.degree. C.) is 10-fold
higher than the fluorescence at the cell surface (as measured at
4.degree. C.), this means that the LAMP1 protein is quickly
recycling at cell membrane. All together, our results show for the
first time that LAMP1 might function as a receptor mediating the
internalization of antibodies and suggest that availability of
specific internalizing antibodies should aid in developing novel
therapeutic methods to target toxins, drugs or short-range isotopes
to be delivered specifically to the interior of the cancer
cells.
[0464] Furthermore, they have shown that an antibody according to
the invention, combined with a cytotoxic maytansinoid (DM4),
induces cytotoxic activity in vitro on human HCT116 tumor or HEK293
cells containing a stable integration of the LAMP1 coding DNA
sequence in the genomic DNA wherein individual clones present
different intensities of LAMP1 on the cell surface.
[0465] In another example 9.4, the inventors showed that an
antibody according to the invention, combined with a cytotoxic
tomamycin dimer, induces cytotoxic activity in vitro.
[0466] They have also shown that an antibody combined with a
cytotoxic maytansinoid (DM4) induces a marked anti-tumor activity
in vivo in a murine model of primary human colon adenocarcinoma
xenografts derived from patient, when used at a dose of 10 mg/kg, 5
mg/kg and 2.5 mg/kg, with a single injection at day 17 post tumor
implantation as described in example 10.1.1.
[0467] Furthermore, they have also shown that this immunoconjugate
induces a marked anti-tumor activity in vivo in a murine model of
primary human lung tumor xenografts derived from patient, when used
at a dose of 10 mg/kg, 5 mg/kg and 2.5 mg/kg, with a single
injection at day 26 post tumor implantation as described in example
10.1.2.
[0468] The inventors have also shown that the immunoconjugates of
DM4-SPDB-huMAb1_1, DM4-SPDB-chMAb2, DM4-SPDB-chMAb3 induce a marked
anti-tumor activity in vivo in different murine model of different
cancer xenograft models as shown in example 10.2-10.4.
[0469] For example, it was shown the immunoconjugate
DM4-SPDB-huMAb1_1 induces a marked anti-tumor activity in vivo
primary human invasive ductal carcinoma xenograft and primary human
lung tumor xenograft derived from patient, when used at a dose of
10 mg/kg, 5 mg/kg and 2.5 mg/kg, with a single injection, as
described in example 10.2.2 and 10.2.3.
[0470] Also the immunoconjugates DM4-SPDB-chMAb2 and
DM4-SPDB-chMAb3 induce a marked anti-tumor activity in primary
human invasive ductal carcinoma xenograft derived from patient,
when used at a dose of 10 mg/kg, 5 mg/kg and 2.5 mg/kg or 5 mg/kg,
2.5 mg/kg and 1.25 mg/kg, respectively, with a single injection, as
described in example 10.3.2 and 10.4.
[0471] Thus, polypeptides, antibodies, immunoconjugates, or
pharmaceutical compositions of the invention may be useful for
treating cancer.
[0472] The invention further relates to an anti-LAMP1 therapeutic
agent for use for treating cancer in a patient harboring LAMP1 gene
copy number gain in cancer cells.
[0473] In an embodiment, said patient harboring LAMP1 gene copy
number gain in cancer cells has been selected by the in vitro
method of selecting patients with cancer according to the
invention. In particular, the use comprises selecting said patient
harboring LAMP1 gene copy number gain in cancer cells by a method
of selecting patients with cancer according to the invention.
[0474] The invention also relates to a method of treating a patient
with cancer which comprises [0475] a) selecting a patient with
cancer who is likely to respond to anti-LAMP1 therapy by a in vitro
method of selecting patients with cancer according to the
invention; and [0476] b) administering anti-LAMP1 therapy to said
selected patient.
[0477] The invention further relates to a method of selecting a
patient with cancer for anti-LAMP1 therapy, comprising: [0478] (a)
determining, in a biological sample of a patient with cancer which
includes cancer cells, if said patient harbors a LAMP1 gene copy
number gain; and [0479] (b) administering to said patient
anti-LAMP1 therapy, if said patient harbors a LAMP1 gene copy
number gain.
[0480] The invention also relates to a method of treating cancer in
a patient, comprising: [0481] (a) determining, in a biological
sample of a patient with cancer which includes cancer cells, if
said patient harbors a LAMP1 gene copy number gain; and [0482] (b)
administering to said patient anti-LAMP1 therapy, if said patient
harbors a LAMP1 gene copy number gain.
[0483] The cancer to be treated with antibodies, immunoconjugates,
or pharmaceutical compositions of the invention is a cancer
expressing LAMP1 on the cell surface, in particular overexpressing
LAMP1 on the cell surface as compared to normal (i.e. non tumoral)
cells of the same tissular origin.
[0484] Expression of LAMP1 by cancer cells may be readily assayed
for instance by using an antibody according to the invention, as
described in the following section "Diagnostic uses", and in
particular by an immunohistochemical method for instance as
described in Example 5.
[0485] In particular the cancer may be colon adenocarcinomas but
also gastrointestinal tumors (small intestine, rectum, parotid
gland), vital organs tumors (lung, liver, pancreas, stomach and
kidney), reproductive organ tumors (breast, ovary and prostate) as
well as skin, larynx and soft tissue tumors, for instance the
cancer is selected from the group consisting of colon
adenocarcinoma, gastrointestinal tumors (small intestine, rectum,
parotid gland), vital organs tumors (lung, liver, pancreas and
kidney), reproductive organ tumors (breast, ovary and prostate) as
well as skin, larynx or soft tissue tumors.
[0486] In one embodiment gastrointestinal tumors are small
intestine tumor, rectum tumor and/or parotid gland tumor.
[0487] In one embodiment reproductive organ tumors gastrointestinal
tumors are lung tumor, liver tumor, pancreas tumor, stomach tumor
and kidney tumor.
[0488] In one embodiment reproductive organ tumors are breast
tumor, ovary tumor or prostate tumor.
[0489] Screening of a panel of human tumors by immunohistochemistry
using a mouse anti-human LAMP1 antibody according to the invention
indeed showed antibody staining in these types of cancers, as
described in further details in Example 5.
[0490] In particular, LAMP1 expressing human tumoral cells may be
selected from the group consisting of colon, stomach, rectum, lung
squamous cell carcinoma, breast invasive ductal and lobular
carcinoma and prostate adenocarcinoma cells. These tumors were
indeed found to display more than 50% of cells positive for LAMP1
expression at the cell membrane (see example 5).
[0491] The antibodies or immunoconjugates of the invention may be
used alone or in combination with any suitable growth-inhibitory
agent.
[0492] The antibodies of the invention may be conjugated or linked
to a growth inhibitory agent, cytotoxic agent, or a
prodrug-activating enzyme as previously described. Antibodies of
the invention may be indeed useful for targeting said growth
inhibitory agent, cytotoxic agent, or a prodrug to the cancerous
cells expressing or over-expressing LAMP1 on their surface.
[0493] It is also well known that therapeutic monoclonal antibodies
can lead to the depletion of cells bearing the antigen specifically
recognized by the antibody. This depletion can be mediated through
at least three mechanisms: antibody mediated cellular cytotoxicity,
complement dependent lysis, and direct anti-tumour inhibition of
tumour growth through signals given via the antigen targeted by the
antibody.
[0494] "Complement dependent cytotoxicity" or "CDC" refers to the
lysis of a target cell in the presence of complement. Activation of
the classical complement pathway is initiated by the binding of the
first component of the complement system to antibodies which are
bound to their cognate antigen. To assess complement activation, a
CDC assay, e.g. as described in Gazzano-Santoro et al. (1997) may
be performed.
[0495] "Antibody-dependent cell-mediated cytotoxicity" or "ADCC"
refers to a form of cytotoxicity in which secreted antibodies bound
onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g.
Natural Killer (NK) cells, neutrophils, and macrophages) enable
these cytotoxic effector cells to bind specifically to an
antigen-bearing target cell and subsequently kill the target cell.
To assess ADCC activity of a molecule of interest, an in vitro ADCC
assay, such as that described in U.S. Pat. No. 5,500,362 or
5,821,337 was also contemplated. It is known to the skilled in the
art that specific mutations such as the D265A mutation according to
the nomenclature described by Kabat et al. (Sequences of Proteins
of Immunological Interest, 5th edition, National Institute of
Health, Bethesda, Md., 1991) significantly decrease binding to
Fc.quadrature.Rs and ADCC (Lund et al., J. Immunol., 157:4963-4969,
1996; Shields et al., J. Biol. Chem., 276(1): 6591-6604, 2001).
[0496] In one example the mutation of 266A of for example SEQ ID
NO: 56 in the hulgG1 corresponds to the D265A mutation mentioned
above and thus significantly decrease binding to Fc.quadrature.Rs
and ADCC.
[0497] Thus, an object of the invention relates to a method for
treating a cancer comprising administering a subject in need
thereof with a therapeutically effective amount of a polypeptide,
an antibody, an immunoconjugate or a pharmaceutical composition of
the invention.
[0498] "Antibody-dependent cellular phagocytosis" or "ADCP" refers
to a form of cytotoxicity in which antibodies bound onto Fc
receptors (FcRs) present on certain cytotoxic cells (e.g.
macrophages) enable these cytotoxic effector cells to bind
specifically to an antigen-bearing target cell and subsequently
kill the target cell by phagocytosis. To assess ADCP activity of a
molecule of interest, an in vitro ADCP assay, such as that
described in McEarchem et al., 2007, Blood 109:1185.
[0499] In the context of the invention, the term "treating" or
"treatment", as used herein, means reversing, alleviating,
inhibiting the progress of, or preventing the disorder or condition
to which such term applies, or one or more symptoms of such
disorder or condition. By the term "treating cancer" as used herein
is meant the inhibition of the growth of malignant cells of a
tumour and/or the progression of metastases from said tumor. Such
treatment can also lead to the regression of tumor growth, i.e.,
the decrease in size of a measurable tumor. In particular, such
treatment leads to the complete regression of the tumor or
metastase.
[0500] According to the invention, the term "patient" or "patient
in need thereof" is intended for a human or non-human mammal
affected or likely to be affected with a malignant tumor. In
particular, said patient may be a patient who has been determined
to be susceptible to a therapeutic agent targeting LAMP1, in
particular to an antibody or immunoconjugate according to the
invention, for instance according to a method as described
herebelow.
[0501] As disclosed above, "anti-LAMP1 therapy" is a therapy which
involves a therapeutic agent targeting LAMP1. According to the
invention, the term "therapeutic agent targeting LAMP1" or
"anti-LAMP1 therapeutic agent" describe an agent binding to LAMP1
and having cytotoxic and/or cytostatic activity.
[0502] As used herein, the term "binding agent" refers to a
molecule that exhibits specific binding activity towards LAMP1.
Such a binding molecule can include a variety of different types of
molecules including, for example, macromolecules and small organic
molecules. Small molecule binding agents can include, for example,
receptor ligands, antagonists and agonists. Macromolecules can
include, for example, peptide, polypeptide and protein, nucleic
acids encoding polypeptide binding agents, lectins, carbohydrate
and lipids. It is understood that the term includes fragments and
domains of the agent so long as binding function is retained.
Similarly, the boundaries of the domains are not critical so long
as binding activity is maintained. In the specific example where
the binding agent is a peptide, polypeptide or protein, such
binding proteins can include monomeric or multimeric species.
Heteromeric binding proteins are a specific example of multimeric
binding proteins. It is understood that when referring to
multimeric binding proteins that the term includes fragments of the
subunits so long as assembly of the polypeptides and binding
function of the assembled complex is retained. Heteromeric binding
proteins include, for example, antibodies and fragments thereof
such as Fab and F(ab')2 portions.
[0503] According to an embodiment, the anti-LAMP1 therapeutic agent
is an anti-LAMP1 antibody or an immunoconjugate comprising an
anti-LAMP1 antibody and at least one growth inhibitory agent.
[0504] By a "therapeutically effective amount" of the polypeptide
of the invention is meant a sufficient amount of the polypeptide to
treat said cancer disease, at a reasonable benefit/risk ratio
applicable to any medical treatment. It will be understood,
however, that the total daily usage of the polypeptides and
compositions of the present invention will be decided by the
attending physician within the scope of sound medical judgment. The
specific therapeutically effective dose level for any particular
patient will depend upon a variety of factors including the
disorder being treated and the severity of the disorder; activity
of the specific polypeptide employed; the specific composition
employed, the age, body weight, general health, sex and diet of the
patient; the time of administration, route of administration, and
rate of excretion of the specific polypeptide employed; the
duration of the treatment; drugs used in combination or
coincidental with the specific polypeptide employed; and like
factors well known in the medical arts. For example, it is well
known within the skill of the art to start doses of the compound at
levels lower than those required to achieve the desired therapeutic
effect and to gradually increase the dosage until the desired
effect is achieved. Another object of the invention relates to a
polypeptide, an antibody, an immunoconjugate or a pharmaceutical
composition of the invention for use in the treatment of a
malignant tumour.
[0505] In particular, the polypeptide, antibody, immunoconjugate or
pharmaceutical composition may be used for inhibiting the
progression of metastases of a malignant tumour.
[0506] Polypeptides of the invention may be used in combination
with any other therapeutical strategy for treating malignant tumour
(e.g. adjuvant therapy), and/or for reducing the growth of the
metastatic tumour.
[0507] Efficacy of the treatment with an antibody or
immunoconjugate according to the invention may be readily assayed
in vivo, for instance on a mouse model of cancer and by measuring
e.g. changes in tumor volume between treated and control groups, %
tumor regression, partial regression and/or complete regression as
defined in Example 10.
[0508] In one embodiment, the antibody is one of the anti-LAMP1
antibodies developed by the applicant (the so-called antibodies
"MAb1", "MAb2", "MAb3", huMAb1_1 and huMAb1_2, huMAb1_3) that bind
specifically to human LAMP1 and distinguish tumoral from
non-tumoral tissues as further described in the section
"Antibodies" above.
Diagnostic Uses
[0509] The antibody according to the invention revealed that some
LAMP1 expression occurred at the membrane of non-tumoral cells but
was restricted to stomach epithelial cells, oesophageal epithelial
cells, breast epithelial cells, prostate epithelial cells,
testicular epithelial cells and limited to a few cells.
Nevertheless, prevalence and mean intensities for LAMP1 expression
at the membrane of non-tumoral samples were lower than those found
in tumours.
[0510] Instead, LAMP1 is highly expressed at the surface of a
variety other carcinomas than colon adenocarcinomas, including
gastrointestinal tumors (small intestine, rectum, parotid gland),
vital organs tumors (lung, liver, stomach, pancreas and kidney),
reproductive organ tumors (breast, ovary and prostate) as well as
skin, larynx and soft tissue tumors, for example gastrointestinal
tumors (small intestine, rectum, parotid gland), vital organs
tumors (lung, liver, pancreas and kidney), reproductive organ
tumors (breast, ovary and prostate) as well as skin, larynx and
soft tissue tumors. Therefore, LAMP1 constitutes a marker of
certain cancers and, therefore, has the potential to be used to
indicate the effectiveness of an anti-cancer therapy or detecting
recurrence of the disease.
[0511] In particular, LAMP1 is highly expressed at the surface of
carcinomas selected from the group consisting of colon, rectum,
lung squamous cell carcinoma, stomach, breast invasive ductal and
lobular carcinoma and prostate adenocarcinoma cells, more
particularly colon, rectum, lung squamous cell carcinoma, breast
invasive ductal and lobular carcinoma and prostate adenocarcinoma
cells.
[0512] As described above in the chapter `antibodies`, the
inventors developed antibodies MAb1, MAb2, MAb3 allowing for the
first time to detect extracellularly expressed LAMP1 and thus to
perform IHC analysis on Frozen-OCT (from Optimal Cutting
Temperature) specimens and AFA (Alcohol Formalin Acetic acid
Fixative) and MAb4 allowing LAMP1 reinforcement in FFPE format and
thus allows to distinguish cancerous from non-cancerous tissue.
[0513] In a preferred embodiment, the antibody of the invention is
used as component of an assay in the context of a therapy targeting
LAMP1 expressing tumours, in order to determine susceptibility of
the patient to the therapeutic agent, monitor the effectiveness of
the anti-cancer therapy or detect recurrence of the disease after
treatment. In particular, the same antibody of the invention is
used both as component of the therapeutic agent and as component of
the diagnostic assay.
[0514] Thus, a further object of the invention relates to an
antibody according to the invention for use for in vivo detecting
LAMP1 expression in a subject, or for use for ex vivo detecting
LAMP1 expression in biological sample of a subject. Said detection
may be intended in particular for [0515] a) diagnosing the presence
of a cancer in a subject, or [0516] b) determining susceptibility
of a patient having cancer to a therapeutic agent targeting LAMP1,
in particular an immunoconjugate according to the invention, or
[0517] c) monitoring effectiveness of anti-LAMP1 cancer therapy or
detecting cancer relapse after anti-LAMP1 cancer therapy, in
particular for therapy with an immunoconjugate according to the
invention by detecting expression of the surface protein LAMP1 on
tumor cells.
[0518] In an embodiment, the antibody is intended for an in vitro
or ex vivo use. For example, LAMP1 may be detected in vitro or ex
vivo in a biological sample obtained from a subject, using an
antibody of the invention. The use according to the invention may
also be an in vivo use. For example, an antibody according to the
invention is administered to the subject and antibody-cell
complexes are detected and/or quantified, whereby the detection of
said complexes is indicative of a cancer.
[0519] The invention further relates to an in vitro or ex vivo
method of detecting the presence of a cancer in a subject,
comprising the steps consisting of: [0520] a) contacting a
biological sample of a subject with an antibody according to the
invention, in particular in conditions sufficient for the antibody
to form complexes with said biological sample, [0521] b) measuring
the level of antibody bound to said biological sample, [0522] c)
detecting the presence of a cancer by comparing the measured level
of bound antibody with a control, an increased level of bound
antibody compared to control being indicative of a cancer.
[0523] The invention also relates to an in vitro or ex vivo method
of determining susceptibility of a patient having cancer to a
therapeutic agent targeting LAMP1, in particular to an
immunoconjugate according to the invention, which method comprises
the steps consisting of: [0524] a) contacting a biological sample
of a patient having cancer with an antibody according to the
invention, in particular in conditions sufficient for the antibody
to form complexes with said biological sample, [0525] b) measuring
the level of antibody bound to said biological sample, [0526] c)
comparing the measured level of bound antibody to said biological
sample sample with the level of antibody bound to a control, [0527]
wherein an increased level of bound antibody to said biological
sample compared to control is indicative of a patient susceptible
to a therapeutic agent targeting LAMP1.
[0528] In the above methods, said control can be a normal, non
cancerous, biological sample of the same type, or a reference value
determined a representative of the antibody binding level in normal
biological sample of the same type. In an embodiment, the
antibodies of the invention are useful for diagnosing a LAMP1
expressing cancer, such as a colon adenocarcinoma, gastrointestinal
tumors (small intestine, rectum, parotid gland), vital organs
tumors (lung, liver, pancreas and kidney), reproductive organ
tumors (breast, ovary and prostate) as well as skin, larynx and
soft tissue tumors.
[0529] The invention further relates to an in vitro or ex vivo
method of monitoring effectiveness of anti-LAMP1 cancer therapy,
comprising the steps consisting of: [0530] a) contacting a
biological sample of a subject undergoing anti-LAMP1 cancer
therapy, with an antibody according to the invention, in particular
in conditions sufficient for the antibody to form complexes with
said biological sample, [0531] b) measuring the level of antibody
bound to said biological sample, [0532] c) comparing the measured
level of bound antibody with the level of antibody bound to a
control; [0533] wherein a decreased level of bound antibody to said
biological sample compared to control is indicative of
effectiveness of said anti-LAMP1 cancer therapy.
[0534] In said method, an increased level of bound antibody to said
biological sample compared to control is indicative of
ineffectiveness of said anti-LAMP1 cancer therapy.
[0535] Said control is in particular a biological sample of the
same type as the biological sample submitted to analysis, but which
was obtained from the subject previously in time, during the course
of the anti-LAMP1 cancer therapy.
[0536] The invention further relates to an in vitro or ex vivo
method of detecting cancer relapse after anti-LAMP1 cancer therapy,
comprising the steps consisting of: [0537] (a) contacting a
biological sample of a subject having completed anti-LAMP1 cancer
therapy, with an antibody according to the invention, in particular
in conditions sufficient for the antibody to form complexes with
said biological sample, [0538] (b) measuring the level of antibody
bound to said biological sample, [0539] (c) comparing the measured
level of bound antibody with the level of antibody bound to a
control, [0540] wherein a increased level of bound antibody to said
biological sample compared to control is indicative of cancer
relapse after anti-LAMP1 cancer therapy.
[0541] Said control is in particular a biological sample of the
same type as the biological sample submitted to analysis, but which
was obtained from the subject previously in time, upon or after
completion of the anti-LAMP1 cancer therapy.
[0542] Said anti-LAMP1 cancer therapy is in particular a therapy
using an antibody or immunoconjugate according to the invention.
Said anti-LAMP1 cancer therapy targets a LAMP1 expressing cancer,
in particular a colon adenocarcinoma, gastrointestinal tumors
(small intestine, rectum, parotid gland), vital organs tumors
(lung, liver, pancreas, stomach and kidney), reproductive organ
tumors (breast, ovary and prostate) as well as skin, larynx and
soft tissue tumors.
[0543] In an embodiment, antibodies of the invention may be
labelled with a detectable molecule or substance, such as a
fluorescent molecule, a radioactive molecule or any other labels
known in the art that provide (either directly or indirectly) a
signal.
[0544] As used herein, the term "labeled", with regard to the
antibody according to the invention, is intended to encompass
direct labeling of the antibody by coupling (i.e., physically
linking) a detectable substance, such as a radioactive agent or a
fluorophore (e.g. fluorescein isothiocyanate (FITC) or
phycoerythrin (PE) or Indocyanine (Cy5)) to the polypeptide, as
well as indirect labeling of the polypeptide by reactivity with a
detectable substance.
[0545] An antibody of the invention may be labelled with a
radioactive molecule by any method known to the art. For example
radioactive molecules include but are not limited radioactive atom
for scintigraphic studies such as I.sup.123, I.sup.124, I.sup.125,
In.sup.111, Re.sup.186, Re.sup.188, Tc.sup.99, and isotopes for
Positron Emission Tomography such as Zr.sup.89, I.sup.124,
Ga.sup.68 or Cu.sup.64.
[0546] A "biological sample" encompasses a variety of sample types
obtained from a subject and can be used in a diagnostic or
monitoring assay. Biological samples include but are not limited to
blood and other liquid samples of biological origin, solid tissue
samples such as a biopsy specimen or tissue cultures or cells
derived therefrom, and the progeny thereof. Therefore, biological
samples encompass clinical samples, cells in culture, cell
supernatants, cell lysates, serum, plasma, biological fluid, and
tissue samples, in particular tumor sample.
[0547] In particular, the biological tissues may be prepared as
frozen-OCT (Optimal Cutting Temperature) or AFA (acetic formalin
alcohol) samples. Indeed, antibodies according to the invention can
advantageously be used on AFA sample which is a format used by
hospitals to collect and archive tissue samples.
[0548] Measuring or determining the level of antibody bound the
said biological sample may be performed by any suitable method
known in the art such as FACS or IHC, for instance.
[0549] The invention also relates to an in vivo method of detecting
the presence of a cancer in a subject, comprising the steps
consisting of: [0550] a) administering an antibody according to the
invention detectably labelled to a patient, [0551] b) detecting
localisation of said detectably labelled antibody in the patient by
imaging.
[0552] Antibodies of the invention may be useful for staging of
cancer (e.g., in radioimaging). They may be used alone or in
combination with other cancer markers.
[0553] The terms "detection" or "detected" as used herein includes
qualitative and/or quantitative detection (measuring levels) with
or without reference to a control.
[0554] In the content of the invention, the term "diagnosing", as
used herein, means the determination of the nature of a medical
condition intended to identify a pathology which affects the
subject from a number of collected data.
[0555] In said method, the cancer is a LAMP1 expressing cancer, in
particular a colon adenocarcinoma, gastrointestinal tumors (small
intestine, rectum, parotid gland), vital organs tumors (lung,
liver, pancreas and kidney), reproductive organ tumors (breast,
ovary and prostate) as well as skin, larynx and soft tissue
tumors.
Method of Selecting Patients with Cancer
[0556] The invention relates to an in vitro method of selecting
patients with cancer which comprises: [0557] a) determining, in a
biological sample of a patient with cancer which includes cancer
cells, if said patient harbors a LAMP1 gene copy number gain; and
[0558] b) selecting the patient based on the presence of LAMP1 gene
copy number gain.
[0559] In an embodiment, said method is for selecting a patient
with cancer who is likely to respond to anti-LAMP1 therapy, and
said patient is selected as likely to respond to anti-LAMP1 therapy
if said patient harbors a LAMP1 gene copy number gain. If said
patient does not harbor a LAMP1 gene copy number gain, the patients
may nevertheless be selected as likely to respond to anti-LAMP1
therapy based, for instance, on the detection of cell surface
expression of LAMP1 as expression or overexpression of LAMP1 at the
surface of tumor cells may have other causes than LAMP1 gene copy
number gain.
[0560] The LAMP1 gene gain can be related to a focal somatic gain
or amplification, a somatic large region gain or amplification on
13 q, a somatic chromosome duplication, a somatic chromosome
triplication or polyploidy. LAMP1 gene copy number gain or
amplification is included in a larger amplicon. The term "amplicon"
as used herein refers to a segment of the genome that forms
multiple linear copies. According to the invention, the amplicon
which might undergo copy number variation leading to a LAMP1 gene
copy number gain will be called herein LAMP1 amplicon.
[0561] Said "LAMP1 amplification" comprises a DNA region which can
measure between 378 kb and 34.2 MB. Said "LAMP1 gain" comprises a
DNA region which can measure between 523 kb and 95.8 MB
[0562] In one embodiment, the LAMP1 gene copy number gain can be
signified by the CNV of a LAMP1 amplicon in colon PDX which
comprises at least 454 kb from base 113785387 to base 114240314 on
human chromosome 13 (NC_000013). Said minimal LAMP1 amplicon
contains others genes than LAMP1, for example the genes ADPRHL1,
CUL4A, DCUNID2, GRTP1, LAMP1, LOC100130463, PCID2, PRO7, TFDP1,
TMCO3 and F10.
[0563] In another embodiment said LAMP1 amplicon comprises at least
the genes ADPRHL1, ATP11A, ATP4B, CUL4A, DCUN1D2, F10, F7, FAM70B,
FLJ41484, FLJ44054, GAS6, GRK1, GRTP1, LAMP1, LINC00552,
LOC100128430, LOC100130463, LOC100506063, LOC100506394, MCF2L,
MCF2L-AS1, PCID2, PROZ, RASA3, TFDP1 and TMCO3C13orf35.
[0564] In a further embodiment the LAMP1 amplicon comprises 95.8 Mb
from base 19,296,544 to base 115,107,245 on human chromosome 13
(NC_000013).
[0565] In the context of the present invention, the positions of
the nucleotides are indicated accordingly to the NCBI human genome
sequence (Build 37, February 2009). It is known to the one skilled
in the art, that a genome sequence is variable from an individual
to another. Therefore, the positions defined herein for the LAMP1
amplicon may slightly change according to the human genome sequence
used. However, methods to compare genomic sequences and nucleotide
positions are well known to the one skilled in the art.
[0566] There are numerous methods allowing determining the presence
of a LAMP1 gene copy number change in biological samples which are
well known from the one skilled in the art. These methods include,
without being limited, hybridization methods with DNA probes
specific of marker sequences, such as comparative genomic
hybridization (CGH), matrix-CGH, array-CGH, oligonucleotide arrays,
representational oligonucleotide microarray (ROMA), high-throughput
technologies for SNP genotyping, for example Affymetrix SNP chips,
and amplification methods such as quantitative PCR.
[0567] In particular, the presence of said marker LAMP1 gene copy
number change is determined by amplification, or by hybridization
with DNA probes specific for LAMP1 gene or genes included in the
LAMP1 amplicon. In an embodiment, the method of the invention is
implemented by Fluorescence In Situ Hybridization (FISH),
Comparative Genomic Hybridization (CGH), New Generation Sequencing
(NGS) and/or Polymerase Chain Reaction (PCR).
[0568] Accordingly, the invention relates to a method, wherein
LAMP1 gene copy number gain is determined with a method selected
from the group consisting of FISH, CGH, NGS and/or PCR.
[0569] Methods of quantitative PCR are well-known in the art and
include real-time PCR, competitive PCR and radioactive PCR. For
instance, a quantitative PCT method to enumerate DNA copy number
has been described in the U.S. Pat. No. 6,180,349.
[0570] As used herein, the term "primer" refers to an
oligonucleotide which is capable of annealing to a target sequence
and serving as a point of initiation of DNA synthesis under
conditions suitable for amplification of the primer extension
product which is complementary to said target sequence. The primer
is typically single stranded for maximum efficiency in
amplification. In particular, the primer is an
oligodeoxyribonucleotide. The length of the primer depends on
several factors, including temperature and sequence of the primer,
but must be long enough to initiate the synthesis of amplification
products. In an embodiment the primer is from 15 to 35 nucleotides
in length. A primer can further contain additional features which
allow for detection, immobilization, or manipulation of the
amplified product. The primer may furthermore comprise
covalently-bound fluorescent dyes, which confer specific
fluorescence properties to the hybrid consisting of the primer and
the target-sequence or non covalently-bound fluorescent dyes which
can interact with the double-stranded DNA/RNA to change the
fluorescence properties. Fluorescent dyes which can be used are for
example SYBR-green or ethidium bromide.
[0571] A "pair of primers" or "primer pair" as used herein refers
to one forward and one reverse primer as commonly used in the art
of DNA amplification such as in PCR amplification.
[0572] As used herein, a "probe" refers to an oligonucleotide
capable of binding in a base-specific manner to a complementary
strand of nucleic acid. A probe may be labeled with a detectable
moiety. Various labeling moieties are known in the art. Said moiety
may, for example, either be a radioactive compound, a detectable
enzyme (e.g., horse radish peroxidase (HRP)) or any other moiety
capable of generating a detectable signal such as calorimetric,
fluorescent, chemiluminescent or electrochemiluminescent signal.
The detectable moiety may be detected using known methods. A probe
may vary in length from about 5 to 100 nucleotides, for instance
from about 10 to 50 nucleotides, or from about 20 to 40
nucleotides. In an embodiment, a probe comprises 33
nucleotides.
[0573] The terms "hybridize" or "hybridization," as is known to
those skilled in the art, refer to the binding of a nucleic acid
molecule to a particular nucleotide sequence under suitable
conditions, namely under stringent conditions.
[0574] The term "stringent condition" or "high stringency
condition" as used herein corresponds to conditions that are
suitable to produce binding pairs between nucleic acids having a
determined level of complementarity, while being unsuitable to the
formation of binding pairs between nucleic acids displaying a
complementarity inferior to said determined level. Stringent
conditions are the combination of both hybridization and wash
conditions and are sequence dependent. These conditions may be
modified according to methods known from those skilled in the art
(Tijssen, 1993, Laboratory Techniques in Biochemistry and Molecular
Biology--Hybridization with Nucleic Acid Probes, Part I, Chapter 2
"Overview of principles of hybridization and the strategy of
nucleic acid probe assays", Elsevier, New York). Generally, high
stringency conditions are selected to be about 5.degree. C. lower
than the thermal melting point (Tm), for instance at a temperature
close to the Tm of perfectly base-paired duplexes (Andersen,
Nucleic acid Hybridization, Springer, 1999, p. 54). Hybridization
procedures are well known in the art and are described for example
in Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D. D.,
Seidman, J. G., Smith, J. A., Struhl, K. eds. (1998) Current
protocols in molecular biology. V. B. Chanda, series ed. New York:
John Wiley & Sons.
[0575] High stringency conditions typically involve hybridizing at
about 50.degree. C. to about 68.degree. C. in
5.times.SSC/5.times.Denhardt's solution/1.0% SDS, and washing in
0.2.times.SSC/0.1% SDS at about 60.degree. C. to about 68.degree.
C.
[0576] In one embodiment, the invention relates to a method wherein
the mean LAMP1 gene copy number in cancer cells is .gtoreq.2.5. In
particular the mean LAMP1 gene copy number in cancer cells may be
2.5 and <5.
[0577] In one embodiment, the invention relates to a method wherein
the mean LAMP1 gene copy number in cancer cells is .gtoreq.5.
[0578] The method of the invention can further comprise determining
if LAMP1 is expressed at the surface of cancer cells of the
patient, and i) said patient is selected as likely to respond to
anti-LAMP1 therapy if said patient harbors a LAMP1 gene copy number
gain and if said cancer cells of the patient express LAMP1 at their
surface or ii) said patient is selected as unlikely to respond to
anti-LAMP1 therapy if said cancer cells of the patient do not
express LAMP1 at their surface.
[0579] There are numerous methods allowing determining if LAMP1 is
expressed at the surface of cancer cells, or overexpressed as
compared with normal cells (i.e. non tumoral) of the same tissular
origin, as which are well known from the one skilled in the art.
These methods include for example, without being limited, IHC,
Western Blot (WB), Fluorescence activated cell sorting (FACS)
analysis, immunofluorescence (IF), immunoprecipitation (IP) and
Enzyme-linked immunosorbent assay (ELISA).
[0580] In an embodiment, immunohistochemistry (IHC) is used for
determining if LAMP1 is expressed or over-expressed at the surface
of cancer cells.
[0581] Expression of LAMP1 by cancer cells may be readily assayed
for instance by using an anti-LAMP1 antibody as described in
example 3.
[0582] The inventors showed that, LAMP1 gain is detected in 28
tumor types, including Colorectal adenocarcionoma, Stomach, Liver,
Lung (Adenocarcinoma and Squamous), Breast (Basal, BRCA, LUMA, LUMB
and HER2), Ovary, Head & neck, Kidney (Kidney Chromophobe,
Kidney Renal Clear Cell Carcinoma, Kidney Renal Papilliary), Cell
Carcinoma, Cervical squamous Cell, Pancreatic, Prostate, Bladder
urothelial, Glioma (Low grade glyoma and Glioblastoma multiform),
Uterus, Thyroid, Leukemia, Lymphoma, Esophageal, Melanoma and Soft
tissue sarcoma. High gain or amplification is detected in, breast,
cervical, colorectal, glioblastoma, head and neck, liver, lung,
glioma, ovarian, stomach and uterine cancer.
[0583] Accordingly, in an embodiment of the method of the
invention, the patient is having a cancer selected from the group
consisting of colorectal, stomach, liver, lung, breast, ovarian,
head and neck, kidney, pancreatic, prostate, uterine, glioma,
bladder, thyroid cancer and leukemia, lymphoma, esophageal,
melanoma and soft tissue sarcoma, for instance colorectal, stomach,
liver, lung, ovarian, head and neck, kidney, pancreatic, prostate,
uterine, glioma, bladder, thyroid cancer and leukemia, lymphoma,
esophageal, melanoma and soft tissue sarcoma.
[0584] In a further embodiment the patient is having a cancer
selected from the group consisting of, breast, cervical,
colorectal, glioblastoma, head and neck, liver, lung, glioma,
ovarian, stomach, and uterine cancer; or in particular from the
group consisting of cervical, colorectal, glioblastoma, head and
neck, liver, lung, glioma, ovarian, stomach, thyroid, and uterine
cancer; or still more particularly from the group consisting of
colon and lung cancer.
[0585] LAMP1 gene copy number gain and high expression of LAMP1
could be detected at the surface of cancers selected from the group
consisting of colon, lung, liver, pancreatic, kidney breast,
ovarian, prostate, stomach cancer.
[0586] Thus in one embodiment the cancer may be selected from
colon, lung, liver, pancreatic, kidney, ovarian, prostate, stomach
cancer, for example from colon, lung, liver, pancreatic, kidney,
ovarian, prostate, stomach cancer.
[0587] Furthermore, LAMP1 gene copy gain is correlated with the
LAMP1 mRNA expression in bladder, breast, colon, lung, stomach and
ovarian cancer. A significant association is shown between LAMP1
gene copy number gain/amplification and the expression of LAMP1 at
the plasma membrane of tumor cells for colon, stomach and lung
tumor PDX.
[0588] Accordingly, in a further embodiment of the method of the
invention, the patient is having a cancer selected from the group
consisting of breast, colon, lung, stomach, and ovarian. In another
embodiment, the patient is having a cancer selected from the group
consisting of colon, lung, stomach and ovarian.
[0589] An "anti-LAMP1 therapy" is a therapy which involves a
therapeutic agent targeting LAMP1. In one embodiment, such an
anti-LAMP1 therapy is an anti-LAMP1 antibody or immunoconjugate.
Anti-LAMP1 therapy is described in further details hereafter.
[0590] The cancer may be in particular bladder, cervical,
colorectal, glioblastoma, head and neck, kidney, liver, lung,
glioma, ovarian, pancreatic, prostate, stomach, thyroid, and
uterine cancer. In another example the cancer is particularly
colorectal or lung cancer.
Kits
[0591] Finally, the invention also provides kits comprising at
least one antibody or immunoconjugate of the invention. Kits
containing antibodies of the invention find use in detecting the
surface protein LAMP1, or in therapeutic or diagnostic assays. Kits
of the invention can contain a polypeptide or antibody coupled to a
solid support, e.g. a tissue culture plate or beads (e.g. sepharose
beads). Kits can be provided which contain antibodies for detection
and quantification of the surface protein LAMP1 in vitro, e.g. in
an ELISA or a Western blot. Such an antibody useful for detection
may be provided with a label such as a fluorescent or
radiolabel.
[0592] The invention will be further illustrated in light of the
following Figures and Examples.
BRIEF DESCRIPTION OF THE SEQUENCES
[0593] SEQ ID NO: 1 shows the VH sequence of the "MAb1"
antibody.
[0594] SEQ ID NO: 2-4 show the sequences of the CDR1-H, CDR2-H,
CDR3-H of the "MAb1" antibody.
[0595] SEQ ID NO: 5 shows the VL sequence of the "MAb1"
antibody.
[0596] SEQ ID NO: 6-7 show the sequences of the CDR1-L, CDR3-L of
the "MAb1" antibody.
[0597] SEQ ID NO: 8 shows the VH sequence of the "MAb2"
antibody.
[0598] SEQ ID NO: 9-11 show the sequences of the CDR1-H, CDR2-H,
CDR3-H of the "MAb2" antibody.
[0599] SEQ ID NO: 12 shows the VL sequence of the "MAb2"
antibody.
[0600] SEQ ID NO: 13-14 show the sequences of the CDR1-L, CDR3-L of
the "MAb2" antibody.
[0601] SEQ ID NO: 15 shows the VH sequence of the so-called
"Mab2.sub.Can" antibody.
[0602] SEQ ID NO: 16 shows the VL sequence of the so-called
"Mab2.sub.Can" antibody.
[0603] SEQ ID NO: 17 shows the sequence of the heavy chain of the
chimeric antibody "chMAb1" antibody.
[0604] SEQ ID NO: 18 shows the sequence of the light chain of the
chimeric antibody "chMAb1" antibody.
[0605] SEQ ID NO: 19 shows the sequence of the heavy chain of the
chimeric antibody "chMAb2" antibody.
[0606] SEQ ID NO: 20 shows the sequence of the light chain of the
chimeric antibody "chMAb2" antibody.
[0607] SEQ ID NO: 21 shows the sequence of the heavy chain of the
chimeric antibody "chMab2.sub.Can" antibody.
[0608] SEQ ID NO: 22 shows the sequence of the light chain of the
chimeric antibody "chMab2.sub.Can" antibody.
[0609] SEQ ID NO: 23 shows the DNA sequence of full-length human
LAMP1 as available from GenBank database under accession number NM
005561.3.
[0610] SEQ ID NO: 24 shows the Protein sequence of full-length
human LAMP1 as available from GenBank database under
NP_005552.3.
[0611] SEQ ID NO: 25 shows the Protein sequence of full-length
mouse LAMP1 as available from GenBank database under NP_034814
[0612] SEQ ID NO: 26 shows the Protein sequence of full-length rat
LAMP1 as available from GenBank database under NP_036989.
[0613] SEQ ID NO: 27 shows the Protein sequence of full-length
Macaca mulatta LAMP1 as available from GenBank database under
XP_002723509.
[0614] SEQ ID NO: 28 shows the sequence of human LAMP1
extracellular domain without Peptide Signal, followed by C-terminal
6 amino acid His-Tag.
[0615] SEQ ID NO: 29 shows the sequence of cynomologous monkey
LAMP1 extracellular domain without Peptide Signal, followed by
C-terminal tag including 6 amino acid His-sequence.
[0616] SEQ ID NO: 30 shows the sequence of a human and mouse LAMP1
chimer containing mouse Loop1 region of LAMP1 and human Loop2-4 of
LAMP1 without Peptide Signal, followed by C-terminal 6 amino acid
His-Tag.
[0617] SEQ ID NO: 31 shows the sequence of a human and mouse LAMP1
chimer containing mouse Loop1-2 region of LAMP1 and human Loop3-4
of LAMP1 without Peptide Signal, followed by C-terminal 6 amino
acid His-Tag.
[0618] SEQ ID NO: 32 shows the sequence of a human and mouse LAMP1
chimer containing human Loop1-2 region of LAMP1 and mouse Loop3-4
of LAMP1 without Peptide Signal, followed by C-terminal tag
including 6 amino acid His sequence.
[0619] SEQ ID NO: 33 shows the sequence of a human and mouse LAMP1
chimer containing human Loop1-3 region of LAMP1 and mouse Loop4 of
LAMP1 without Peptide Signal, followed by C-terminal tag including
6 amino acid His sequence.
[0620] SEQ ID NO: 34 shows the sequence of mouse LAMP1
extracellular domain without Peptide Signal, followed by C-terminal
tag including 6 amino acid His sequence.
[0621] SEQ ID NO: 35 shows the light chain sequence of the "MAb1"
antibody.
[0622] SEQ ID NO: 36 shows the heavy chain sequence of the "MAb1"
antibody.
[0623] SEQ ID NO: 37 shows the light chain sequence of the "MAb2"
antibody.
[0624] SEQ ID NO: 38 shows the heavy chain sequence of the "MAb2"
antibody.
[0625] SEQ ID NO: 39 shows the predicted full-length LAMP1 protein
sequence of Macaca fascicularis.
[0626] SEQ ID NO: 40 shows the sequence of human LAMP2
extracellular domain without Peptide Signal, followed by C-terminal
10 amino acid His-Tag.
[0627] SEQ ID NO: 41 shows the full-length protein sequence of
human LAMP2.
[0628] SEQ ID NO: 42 shows the VH sequence of the "MAb3"
antibody.
[0629] SEQ ID NO: 43-45 show the sequences of the CDR1-H, CDR2-H,
CDR3-H of the "MAb3" antibody.
[0630] SEQ ID NO: 46 shows the VL sequence of the "MAb3"
antibody.
[0631] SEQ ID NO: 47 and 48 show the sequences of the CDR1-L and
CDR3-L of the "MAb3" antibody.
[0632] SEQ ID NO: 49 shows the sequence of the heavy chain of the
chimeric antibody "chMAb3" antibody.
[0633] SEQ ID NO: 50 shows the sequence of the light chain of the
chimeric antibody "chMAb3" antibody.
[0634] SEQ ID NO: 51 shows the sequence of the variable domain of
light chain of antibody "MAb3 VL_R24_R93".
[0635] SEQ ID NO: 52 shows the sequence of CDR3-L of antibody "MAb3
VL_R24_R93".
[0636] SEQ ID NO: 53 shows the VH1 sequence of the humanized
antibody "huMAb1_1" antibody.
[0637] SEQ ID NO: 54 shows the VH2 sequence of the humanized
antibody "huMAb1_2" antibody.
[0638] SEQ ID NO: 55 shows the VH3 sequence of the humanized
antibody "huMAb1_3" antibody.
[0639] SEQ ID NO: 56 shows the VL1 sequence of the humanized
antibody "huMAb1_1" antibody.
[0640] SEQ ID NO: 57 shows the VL2 sequence of the humanized
antibody "huMAb1_2" antibody.
[0641] SEQ ID NO: 58 shows the VL3 sequence of the humanized
antibody "huMAb1_3" antibody.
[0642] SEQ ID NO: 59 shows the light chain variant 1 sequence of
the "huMAb1_1" antibody.
[0643] SEQ ID NO: 60 shows the heavy chain variant 1 sequence of
the "huMAb1_1" antibody.
[0644] SEQ ID NO: 61 shows the light chain variant 2 sequence of
the "huMAb1_2" antibody.
[0645] SEQ ID NO: 62 shows the heavy chain variant 2 sequence of
the "huMAb1_2" antibody.
[0646] SEQ ID NO: 63 shows the light chain variant 3 sequence of
the "huMAb1_3" antibody.
[0647] SEQ ID NO: 64 shows the heavy chain variant 3 sequence of
the "huMAb1_3" antibody.
[0648] SEQ ID NO: 65 shows the light chain sequence of the negative
control "huMAb1_negA" antibody with the mutations 36A and 95A.
[0649] SEQ ID NO: 66 shows the heavy chain sequence of the negative
control "huMAb1_negA" antibody with the mutation 101A.
[0650] SEQ ID NO: 67 shows the heavy chain sequence of the negative
control "huMAb1_negB" antibody with the mutation 266A.
[0651] SEQ ID NO: 68 shows the light chain sequence of the
recombinant huMAb1_1 for cristalization.
[0652] SEQ ID NO: 69 shows the heavy chain sequence of the
recombinant huMAb1_1 for cristalization comprising a C-terminal
His-tag.
[0653] SEQ ID NO: 70 shows the sequence of a human Loop1-2 region
of LAMP1 with a cleavable thioredoxin (trx A) tag, a His-Tag and a
thrombin cleavage site.
[0654] SEQ ID NO: 71 shows the sequence of the untagged
hLAMP1-29-195.
[0655] SEQ ID NO: 72 shows the amino acid sequence corresponding to
the amino acids 101 to 110 of SEQ ID NO: 24.
[0656] SEQ ID NO: 73 shows the amino acid sequence corresponding to
the amino acids 144 to 157 of SEQ ID NO: 24.
[0657] SEQ ID NO: 74 shows the amino acid sequence corresponding to
the amino acids 174 to 188 of SEQ ID NO: 24.
[0658] SEQ ID NO: 75 shows the amino acid sequence corresponding to
the amino acids 29 to 41 of SEQ ID NO: 24.
[0659] SEQ ID NO: 76 shows the amino acid sequence corresponding to
the amino acids 68 to 80 of SEQ ID NO: 24.
[0660] SEQ ID NO: 77 shows the amino acid sequence corresponding to
the amino acids 29 to 100 of SEQ ID NO: 24.
[0661] SEQ ID NO: 78 shows the amino acid sequence corresponding to
the amino acids 97 to 110 of SEQ ID NO: 24.
[0662] SEQ ID NO: 79 shows the amino acid sequence corresponding to
the amino acids 173 to 189 of SEQ ID NO: 24.
[0663] SEQ ID NO: 80 shows the amino acid sequence corresponding to
the amino acids 132 to 302 of SEQ ID NO: 70.
[0664] SEQ ID NO: 81 shows the sequence of the light chain of the
chimeric antibody "chMAb3 VL_R24_R93". SEQ ID NO: 82 shows the
amino acid sequence corresponding to the amino acids 360 to 375 of
SEQ ID NO: 24.
[0665] SEQ ID NO: 83-85 show the sequences of the CDR1-H, CDR2-H,
CDR3-H of the "MAb4" antibody.
[0666] SEQ ID NO: 86 and 87 show the sequences of the CDR1-L and
CDR3-L of the "MAb4" antibody.
[0667] SEQ ID NO: 88 shows the VH1 sequence of the antibody
"MAb4".
[0668] SEQ ID NO: 89 shows the VL1 sequence of the antibody
"MAb4".
[0669] SEQ ID NO: 90 shows the amino acid sequence corresponding to
the amino acids 47 to 61 of SEQ ID NO: 24.
[0670] SEQ ID NO: 91 shows the amino acid sequence corresponding to
the amino acids 140 to 155 of SEQ ID NO: 24.
[0671] SEQ ID NO: 92 shows the amino acid sequence corresponding to
the amino acids 307 to 321 of SEQ ID NO: 24.
[0672] SEQ ID NO: 93 shows a consensus sequence for CDR1-L of
MAb1/huMAb1_1/huMAb1_2/huMAb1_3 antibody family based on residues
identified as important for the canonical structure and thus the
binding of human LAMP1 using cristallography.
[0673] SEQ ID NO: 94 shows a consensus sequence for CDR3-L of
MAb1/huMAb1_1/huMAb1_2/huMAb1_3 antibody family based on residues
identified as important for the canonical structure and thus the
binding of human LAMP1 using cristallography.
[0674] SEQ ID NO: 95 shows a consensus sequence for CDR1-H of
MAb1/huMAb1_1/huMAb1_2/huMAb1_3 antibody family based on residues
identified as important for the canonical structure and thus the
binding of human LAMP1 using cristallography.
[0675] SEQ ID NO: 96 shows a consensus sequence for CDR3-H of
MAb1/huMAb1_1/huMAb1_2/huMAb1_3 antibody family based on residues
identified as important for the canonical structure and thus the
binding of human LAMP1 using crystallography.
[0676] SEQ ID NO: 97 shows the amino acid sequence corresponding to
the amino acids 35 to 84 of SEQ ID NO: 24.
[0677] SEQ ID NO: 98 shows the light chain sequence of the "MAb4"
antibody.
[0678] SEQ ID NO: 99 shows the heavy chain sequence of the "MAb4"
antibody.
Examples
Example 1: Preparation of Patient-Derived Tumor Xenografts
(PDX)
Example 1.1: Preparation of CR-LRB-010P, CR-LRB-003P, and
CR-IGR-034P PDXs
[0679] A large collection of colorectal cancer models directly
derived from tumor samples collected during patient surgery was
develop. Patient-derived colorectal cancer tumor were collected,
after patient's informed consent, in 3 medical centers: Curie
Institute (Paris, France), Gustave Roussy Institute (Villejuif,
France), and Lariboisiere Hospital (Paris, France). Immediately
after surgery (1 hour after resection in average), 2 fragments were
transferred in culture medium including DMEM with 10 mmol/L HEPES,
4.5 g/L glucose, 1 mmol/L pyruvate sodium, 200 U/mL penicillin, 200
mg/mL streptomycin, 200 mg/mL gentamicin, 5 mg/mL ciprofloxacin, 20
mg/mL metronidazole, 25 mg/mL vancomycin, and 2.5 mg/mL fungizone
or DMEM with Nanomycopulitine (Abcys) for engraftment. After 2 to
24 hours following the patient surgery, the tumor samples were
engrafted on 2 Swiss nude mice. Small fragments (50 mm.sup.3) were
subcutaneously engrafted into the scapular area or on the flank of
anesthetized mice. (xylazine/ketamine or isoflurane protocol).
Tumor growth was measured at least once a week and serial fragment
grafts of each given tumor were conducted on 3 to 5 Swiss nude or
CB17-SCID (after 3 passages) mice when the tumors reached a volume
of 800 to 1500 mm.sup.3. (Julien, S. 2012, Clin. Cancer Res.
18(19):5314-5328.
Example 1.2: Preparation of LUN-NIC-0014 PDX and LUN-NIC-0070
PDXs
[0680] Non-small-cell lung carcinoma samples were collected, after
patient's informed consent, in CHU Pasteur (Nice, France).
Immediately after surgery, a piece of the patient tumor was
transferred in AQIX medium and sent to Sanofi (Vitry sur Seine,
France). After 24 to 48 hours following the patient surgery, the
tumors samples were engrafted on 2-5 CB17-SCID mice. Small
fragments (50 mm.sup.3) were subcutaneously engrafted on the mice
flank. Tumor growth was followed at least once a week and serial
fragment grafts of each given tumor were conducted on 5 to 10
CB17-SCID (after 3 passages) mice when the tumor reached a volume
of 800 to 1500 mm.sup.3.
Example 1.3: Preparation of BRE-IGR-0159 PDX
[0681] Breast carcinoma samples were collected, after patient's
informed consent, in Gustave Roussy Institute (Villejuif, France).
Immediately after surgery (1 hour after resection in average), 4
fragments were transferred in culture medium including DMEM,
penicillin, streptomycin and fungizone for engraftment. After a
maximum of 12 hours following the patient surgery, the tumor
samples (fragments about 50 mm.sup.3) were engrafted on fat pad on
4 BALB nude mice. Tumor growth was followed at least once a week
and sent to Sanofi (Vitry sur Seine). Serial fragment grafts of
each given tumor were conducted on 3 to 5 BALB nude or CB17-SCID
mice (after 3 passages) when the tumors reach a volume of 800 to
1500 mm.sup.3.
Example 2: Generation of Monoclonal Mouse Anti LAMP1 Antibodies and
First Screening
[0682] Immunizations, fusion and screening were performed
essentially as described previously using primary disaggregated
tumor CR-LRB-010P or CR-LRB-003P or LUN-NIC-0014 mentioned in
example 1 for immunization and P3X63-Ag8.653 myeloma cells for
fusion. Using the classical method described by Wennerberg A. E et
al. (1993, Am. J. Pathol. 143(4): 1050-1054), 6-8 weeks old female
BALB/c mice (S082342; Charles River Labs, Bar Harbor, Me.) each
received three rounds of immunization over a course of 41 days.
Antigens were administered intraperitonealy to ventral site of
mice. Three days after the last injection, mice were sacrificed and
spleens were isolated aseptically and washed with fresh RPMI
medium. Lymphocytes were released from the spleens and single-cell
suspension was washed twice with RPMI medium before being fused
with P3X63-AG8.653 myeloma cells using polyethylene glycol. After
fusion, the cell mixture was incubated in an incubator at
37.degree. C. for 16-24 hours. The resulting cells preparation was
transferred into selective semi-solid medium and aseptically plated
out into 100 mm Petri plates and incubated at 37.degree. C. Ten
days after initiation of selection, the plates were examined for
hybridoma growth, and visible colonies were picked-up and placed
into 96-well plates containing 200 .mu.L of growth medium. The
96-well plates were kept in an incubator at 37.degree. C. for 2 to
4 days.
[0683] Primary screening for IgG production was performed by
Enzyme-linked immunosorbent assay (ELISA) using a anti-mouse kappa
light chain antibody (Bethyl #A90-119A) as capturing antigen.
Plates were coated with mouse kappa light chain antibody at 0.5
.mu.g/well in PBS and 100 .mu.L/well of primary antibody was added
to the plate. The plate was incubated at 37.degree. C. for 1 h and
washed five times with PBS containing 0.05% Tween-20 (PBS-T). Then,
100 .mu.L of a 1:50 000 dilution of goat anti-mouse IgG (Fc)
conjugated with horseradish peroxidase (Pierce #31349) was added to
each well. Following incubation at 37.degree. C. for 1 h in
darkness, plates were washed with PBS-T five times. Antibody
binding was visualized by adding TMB-H.sub.2O.sub.2 buffer and read
at a wavelength of 450. Antibodies with the murine IgG, C kappa
isotype were selected for further screening.
Example 3: Hybridoma Screening by Immunohistochemistry (IHC)
[0684] Individual hybridoma supernatants raised against tumor
tissue CR-LRB-010P were screened by IHC on a macroarray slide
containing frozen sections of immunizing tumor (CR-LRB-010P), human
non-tumoral colon and human non-tumoral skin. Frozen-OCT (from
Optimal Cutting Temperature) specimens of non-tumoral colon and
skin were obtained from surgical cases (commercial sources such as
Asterand, US Biomax, Strasbourg Hospital). The automated
immunostaining was performed unsing Ventana Discovery and Discovery
XT automated systems (Ventana Medical Systems, Inc, USA).
[0685] Frozen 10 .mu.m cryostat sections were incubated with IgG
culture supernatants as primary antibody (unknown concentration,
dilution 1/3 in Phosphate Buffer Saline, PBS) for 40 min at
37.degree. C. Culture medium was used as negative control. A
postfixation step with glutaraldehyde (0.05% in NaCl 0.9% w/v) for
4 min was done. The secondary antibody Affinipure rabbit anti-mouse
IgG (315-005_008, Jackson Immunosearch Laboratories, Inc. USA) was
used at 4.8 .mu.g/mL and incubated for 12 min at 37.degree. C.
Immunostaining was done with UltraMap Red chromogenic detection kit
according to manufacturer's recommendations for 8 min. Cryostat
sections were subsequently counterstaining with hematoxylin II
(790-2208, Ventana Medical Systems, Inc USA) and bluing for 4 min
(760-2037). Stained slides were dehydrated and coverslipped with
Coverquick 2000 mounting medium (Labonord, Ref 05547530).
[0686] Sections immunostained with mAbs were analyzed by microscope
(Nikon Eclipse E400). After the immunohistochemical screening
clones of interest were identified as those with reactivity with
areas of tumoral colon cells but not normal epithelial cells of
colon mucosa. MAb1 antibody showed evidence of tumor-associated
reactivity and were negative on epidermal human non-tumoral
cells.
[0687] Similar results were obtained with MAb2 and MAb3. Based on
these IHC results, MAb1 MAb2 and MAb3 were purified for further
evaluation, including extensive IHC characterization on non-tumoral
and tumoral tissues for MAb1.
Example 4: mAb Characterization
[0688] Antibodies MAb1 MAb2 and MAb3 were analysed for cell surface
binding on human primary disaggregated colon tumor by FACS using
Guava.RTM.easyCyte.TM.8HT Flow Cytometry System.
[0689] The apparent affinity expressed as EC50 values was estimated
using BIOST@T-SPEED software.
[0690] Mouse hybridomas expressing antibody were produced into T500
flask and conditioned media collected after 7 days of growth.
Antibody was purified by passing the conditioned media through a
Protein-G column, washed and eluted with Glycine/HCl 100 mM pH 2.7
buffer. The eluate was dialyzed against PBS before sterile
filtration and stored at 4.degree. C.
Example 4.1: Apparent Affinity of Antibodies MAb 1 and MAb2 to
Human Primary Colon Tumor PDX by Row Cytometry
[0691] Advanced human primary colon tumor CR-IGR-034P was obtained
from Patient-derived xenograft in mice. Tumor CR-IGR-034P was
enzymatically dissociated using collagenase Type IV (Invitrogen;
#17104-019) and deoxyribonuclease I (Invitrogen; #18047-019) for 1
h at 4.degree. C. Cell viability was estimated by Viacount
application using Guava.RTM. easyCyte.TM. 8HT Flow Cytometry
System. For apparent affinity estimation, CR-IGR-034P tumoral cells
were coated at 40,000 cells/well on 96-well High Bind plate (MSD
L15X13-3) and 100 .mu.L/well of antibody was added in 2-fold serial
dilutions starting at 20 .mu.g/ml up to 12 dilutions in assay
diluant for 45 min at 4.degree. C. and washed three times with PBS
1% BSA. 100 .mu.L/well of goat anti-mouse IgG conjugated with
Alexa647 (Invitrogen; # A2135) or goat anti-human IgG conjugated
with Alexa488 (Invitrogen; # A11013) was added for 45 min at
4.degree. C. and washed three times with PBS 1% BSA. The antibody
binding was evaluated after centrifugation and resuspension of
cells by adding 200 .mu.l/well PBS 1% BSA and read using Guava.RTM.
easyCyte.TM. 8HT Flow Cytometry System. EC50 values were estimated
using BIOST@T-SPEED software. EC50 values obtained with the
advanced human primary colon tumor CR-IGR-034P are listed in Table
3.
TABLE-US-00003 TABLE 3 EC.sub.50 obtained with CR-IGR-034P MAb1
MAb2 MAb3 CR-IGR-034P 5 nM 14 nM 6 nM
[0692] Antibody binding capacity of antibody was determined using
Mouse IgG Calibrator kit (Biocytex #7208) or Human IgG Calibrator
Kit (Biocytex #CP010) according to the manufacturer's instructions.
Antibody binding capacity of 230 000 and 180 000 were measured for
antibody MAb1 and MAb2 respectively on CR-IGR-034P.
Example 4.2: The Antibodies Bind to Multiple Cancer Cells
[0693] MAb1 and MAb2 antibodies bind to multiple cancer cells and
determination of antibody binding capacity
[0694] Antibodies were found to be able of binding to multiple
tumor cells by Flow Cytometry using the conditions described in
example 4.1. The panel of tumor cells comprises Patient-derived
tumor xenografts from different origins and tumor cell lines. FIG.
2 illustrates the expression profile and Table 4 summarizes the
antibody binding capacity results.
TABLE-US-00004 TABLE 4 Antibody Binding Capacity by FACS on
Patient-derived xenografts Antibody Binding Capacity (ABC) MAb2
MAb1 PDX/origin CR-LRB-003P/colorectal 22 000 25 000
CR-LRB-010P/colorectal 95,000 140,000 CR-IGR-034P/colorectal
180,000 230,000 OVA-IGR-0022/ovary 60,000 67,000
STO-IND-006/stomach 64,000 90,000 LUN-NIC-025/lung 27,000 33,000
LUN-NIC-014/lung 102,000 104,000 Cell lines/origin Colo205/colon
4,000 6,000 SW480/colon 1,700 2,500 LS174T/colon 3,600 6,000
[0695] The monoclonal antibodies MAb1 and MAb2 led to high ABC in
several PDXs of colorectal, ovary, stomach and lung origin and
lower ABC in cell lines than in PDXs of colon origin.
MAb3 Antibodies Bind to Multiple Cancer Cells
[0696] Advanced human primary tumors from colon (CR-IGR-034P), lung
(LUN-NIC-014P and breast (BRE-IGR-0159) indications were obtained
from patient-derived xenograft (PDX) in mice as described in
example 1. PDXs were enzymatically dissociated using collagenase
Type IV (Invitrogen; #17104-019) and deoxyribonuclease I
(Invitrogen, #18047-019) for 1 h at 4.degree. C. Cell viability was
estimated by Viacount application using Guava.RTM. easyCyte.TM. 8
HT Flow Cytometry System. Tumoral cells were coated at 40,000
cells/well on 96-well High Bind plate (MSD L15XB-3) and 100 .mu.L
of antibody was added at 20 .mu.g/mL for 45 min at 4.degree. C. and
washed three times with PBS 1% BSA. 100 .mu.L of goat anti-human
IgG conjugated with Alexa488 (Invitrogen; #A11013) was added for 45
min at 4.degree. C. and washed three times with PBS 1% BSA. The
antibody binding was evaluated after centrifugation and
resuspension of cells by adding 200 .mu.L/well PBS 1% BSA and read
using Guava.RTM. easyCyte.TM. 8 HT Flow Cytometry System. The mean
fluorescence was recorded and plotted in the graph shown in FIG. 12
to illustrate the expression profile of the three mAbs onto the
three PDXs. Results presented in FIG. 12 show that MAb3 binds to
the different patient-derived xenografts from colon, lung and
breast origin as Mab1 and Mab2 do.
Example 4.3: Internalization Score of MAb1, MAb2 and MAb3 Following
Binding to Colon Colo205 Tumoral Cells Expressing LAMP1 by
ImageStream Multispectral Imaging Flow Cytometer (Amnis Corp.)
[0697] Viable Colo205 cells (5.times.10.sup.5 cells) were seeded
into wells of 6-well plates and incubated for 4 hours at 37.degree.
C./5% CO.sub.2 (or 4.degree. C. on ice for negative control) with
10 .mu.g/ml of AlexaFluor488-labeled antibody MAb1 or
AlexaFluor488-labeled antibody MAb2 or AlexaFluor488-labeled
antibody MAb3. Cells were washed by centrifugation with PBS 1% BSA
at 400 g for 5 minutes. Cells were fixed and permeabilized using
100 .mu.L of Perm/Fix buffer on ice for 20 minutes. Cells were
washed by centrifugation with 1 mL of Perm/Wash Cell buffer at 400
g for 5 minutes.
[0698] To test whether internalized antibodies accumulate in
lysosomes, simultaneous uptake of mAbs and AlexaFluor647-labeled
CD107a (a lysosomal marker) were carried out. Labelled
AlexaFluor647 anti-CD107a antibody at 10 .mu.g/mL was incubated on
ice for 20 minutes. After incubation, 1 mL Perm/Wash Cell buffer
was added to wash, before centrifuging (400 g, 5 min). The
supernatant was flicked from the plate before the cells were fixed
with 200 .mu.L 1% formaldehyde on ice for 20 minutes. The
fluorescence of cells was analyzed with the ImageStream
multispectral imaging flow cytometer (Amnis corp.) using the
Internalization feature. Five thousand events were acquired for
each experimental condition and the corresponding images were
analyzed using the IDEAS image-analysis software.
TABLE-US-00005 TABLE 5 Internalization score by Fluorescence-Based
ImageStream Imaging Flow Cytometer Internalization score (IS)
Internalization score (IS) mAb 4.degree. C., 4 hr 37.degree. C., 4
hr MAb1 0.22 2.22 MAb2 0.19 2.24 MAb3 0.11 1.56
[0699] The monoclonal antibodies MAb1 MAb2 and MAb3 led to high
internalization scores in Colo205 cell line as shown in Table
5.
Example 4.4: Quenching of Alexa488 by Use of the Anti-Alexa488
Antibody, Flow Cytometry and Calculation of Internalized Fraction
of MAb1
[0700] Alexa488-labelled MAb1 (66 nM) was incubated with
6.times.10.sup.5 Colo205 cells in complete medium for 4 h at
37.degree. C. or 4.degree. C. The cells were washed twice in ice
cold PBS in a cold centrifuge, and resuspended in 500 nM quenching
anti-Alexa488 antibody diluted in ice cold PBS. All tubes were
incubated for 1 h on ice. Without washing, all cells were fixed in
two volumes of 2% paraformaldehyde for 10 min at room temperature.
The paraformaldehyde was removed by one wash in PBS, and the cells
were resuspended in PBS and analyzed in a flow cytometer
(Guava.RTM. easyCyte 8HT Flow Cytometry System).
[0701] An internalization positive control experiment was done in
parallel with Alexa488-labelled Transferrin (600 nM).
[0702] Mean fluorescence intensity (MFI) values obtained from the
flow cytometry reading of 5.times.10.sup.4 cells per tube were used
for all calculations. Internalization was calculated as the MFI
value of quenched cells (intracellular compartments only) divided
by the MFI value of unquenched cells (both cell surface and
intracellular compartments) at 37.degree. C. as described in the
formula:
Percentage of internalized fraction : FL of quenched cells at 37
.degree. C . FL of unquenched cells at 37 .degree. C . .times. 100
##EQU00003##
[0703] The cells incubated with Alexa488-labelled compounds at
4.degree. C. were used as a control since internalization of
antibodies does not take place significantly at 4'C.
[0704] After 4 h at 37.degree. C., about 97.0% of the total cell
fluorescence from Alexa488-MAb1 was intracellular. By comparison,
about 98.5% of the total cell fluorescence from
Alexa488-Transferrin was intracellular. Transferrin is known to be
internalized very efficiently by Colo205 cells.
[0705] After quenching, the fluorescence of Alexa488-MAb1 measured
from cells labelled at 37.degree. C. (both cell surface and
intracellular compartments) was 10-fold higher than that of cells
labelled at 4.degree. C. (cell surface). Because the fluorescence
of Alexa488-MAb1 measured at cell surface at 4.degree. C. is
proportional to the antigen density, all the above results taken
together indicate that each LAMP1 molecule is involved in several
(10 on average) internalization cycles via recycling at cell
membrane during the course of the experiment.
[0706] Our results show for the first time that LAMP1 can function
as a receptor mediating the internalization of antibodies very
efficiently via receptor recycling to the cell surface and suggest
that the availability of specific internalizing antibodies should
aid in developing novel therapeutic methods to target toxins, drugs
or short-range isotopes to be delivered specifically to the
interior of the cancer cells, as shown in Table 6.
TABLE-US-00006 TABLE 6 Internalization measurements by Flow
Cytometry 4.degree. C. 37.degree. C. mAb Quencher 37.degree. C.
Quencher MFI, Alexa488-MAb1 4.46 172.14 167.08 MFI,
Alexa488-Transferrin 8.98 1210
Example 4.5: Purification and Identification of the MAb1, MAb2 and
MAb3 Antibody Antigen Target
[0707] The antigen target of MAb1, MAb2 and MAb3 are purified from
a membrane fraction enriched by human primary colon tumor
CR-LRB-010P or CR-IGR-034P using Pierce Classic IP Kit (#26146)
according to the manufacturer's instructions.
[0708] Pulled-down proteins were separated by SDS-PAGE and proteins
stained with silver nitrate. Stained bands were submitted to an
in-gel tryptic digestion, and eluted peptides were analyzed by
tandem MS (LC-MS/MS) on an Orbitrap bentchtop mass spectrometer
(Thermo). Raw MS/MS data analysis with Mascot (Matrix Science)
database search engine, revealed LAMP1.
[0709] This target was confirmed by ELISA with the recombinant
human LAMP1 as described in example 6.2 (SEQ ID NO: 28). The
obtained EC.sub.50 are listed in Table 7 and Table 11.
TABLE-US-00007 TABLE 7 EC.sub.50 determined by ELISA values on
recombinant human LAMP1 (29-382 of SEQ ID NO: 28) Antibody
EC.sub.50 MAb1 0.18 nM MAb2 0.25 nM
Example 4.6: Specificity to LAMP1
[0710] LAMP2 is the closest member of the LAMP family with 35%
sequence identity to LAMP1. For evaluating specificity to LAMP1 of
MAb1, MAb2 and MAb3 antibodies, 96-well plates were coated with
recombinant human LAMP2 with a C-terminal 10 His-tag (SEQ ID NO:
40) (R&D Systems 6228-LM) using the same coating conditions
described previously. Anti-LAMP1 antibodies were added to the
plates and detected by using rabbit anti-mouse IgG conjugated with
horseradish peroxidase (Sigma; #A9044). Antibody binding was
visualized by adding TMB-H.sub.2O.sub.2 buffer and read at a
wavelength of 450 nm. No binding to LAMP2 was detected with MAb1,
MAb2 and MAb3 antibodies.
Example 4.7: Cross-Reactivity with Cynomolgus Monkey LAMP1
[0711] Antibody MAb1 was assessed for its ability to bind primate
LAMP1 protein by ELISA. Extracellular domain of LAMP1 of human
(Ala29-Met382 of SEQ ID NO: 24) and cynomolgus monkey LAMP1
(Ala27-Met380 of SEQ ID NO: 39) were prepared as described in
example 6.2. Plate was coated with cynomolgus monkey LAMP1 protein
(SEQ ID NO: 29), antibody MAb1 was added to the plate and detected
with rabbit anti-mouse IgG conjugated with horseradish peroxidase
(Sigma; #A9044). The antibody binding was visualized by adding
TMB-H.sub.2O.sub.2 buffer and read at a wavelength of 450 nm.
Binding affinity was in the same range with both proteins as shown
on FIG. 3 for MAb1.
[0712] Antibody MAb1 was also assessed for its ability to bind
human LAMP1 and primate LAMP1 proteins expressed at the surface of
recombinant HEK293 cells by FACS. LAMP1 Coding DNA Sequence, RefSeq
NM_005561.3 (SEQ ID NO: 23) was cloned internally. The CDS of
Macaca mulatta LAMP1, RefSeq XP_001087801 (SEQ ID NO: 27) was also
cloned internally. The predicted sequences of mature LAMP1 from
Macaca mulatta and Macaca fascicularis are identical to 99%, said
sequence differing by one additional Leucin at position 11 of
Macaca mulatta (SEQ ID NO: 27), i.e. in the signal peptide. The
mature LAMP1 proteins of Macaca mulatta and Macaca fascicularis are
identical. Therefore the secreted LAMP1 used in the following
example is referred to cynomolgus monkey. Both CDS were cloned into
mammalian expression plasmids under CMV enhancer/promoter and SV40
polyA signals. HEK293 cells (Invitrogen; #K9000-10.) were
transiently transfected with human LAMP1 or cynomolgus LAMP1
plasmids using FreeStyle.TM. MAX 293 Expression System according to
the manufacturer's instructions. Human LAMP1 transfected HEK293
cells and cynomolgus LAMP1 transfected HEK293 cells were coated at
40,000 cells/well on 96-well High Bind plate (MSD L15XB-3) and 100
.mu.L/well of antibody MAb1 was added in 2-fold serial dilutions
starting at 20 .mu.g/ml up to 12 dilutions in assay diluant for 45
min at 4.degree. C. and washed three times with PBS 1% BSA. 100
.mu.L/well of goat anti-mouse IgG conjugated with Alexa647
(Invitrogen; # A2135) was added for 45 min at 4.degree. C. and
washed three times with PBS 1% BSA. The antibody binding was
evaluated after centrifugation and resuspension of cells by adding
200 .mu.l/well PBS 1% BSA and read using Guava.RTM. easyCyte.TM.
8HT Flow Cytometry System. EC50 values were estimated using
BIOST@T-SPEED software. Binding affinity was in the same range with
EC.sub.50 of 14 and 44 nM to respectively human and cynomlogus
monkey LAMP1 expressed transiently at the cell surface of HEK293
for MAb1.
[0713] Antibody MAb1 was assessed for its ability to bind human
LAMP1 and primate LAMP1 proteins expressed at the surface of
recombinant HCT116 stable clones by FACS. HCT116 cells were
infected by a lentiviral vector allowing stable integration of the
human or the cynomolgus LAMP1 CDS in genomic DNA of cells.
Individual clones with different densities of human or cynomolgus
LAMP1 cell surface localization were derived from a pool of HCT116
infected cells. HCT116 cells expressing human or cynomolgus LAMP1
were plated in 96-well plates at 200 000 per well and MAb1 was
added in 2-fold serial dilutions starting at 40 .mu.g/ml up to 12
dilutions in assay diluant for 1 h at 4.degree. C. and washed two
times with PBS 1% BSA. 100 .mu.L/well of goat anti-human IgG
conjugated with Alexa488 (Invitrogen; # A11013) was added for 1 h
at 4.degree. C. and washed two times with PBS 1% BSA. The antibody
binding was evaluated after centrifugation and resuspension of
cells in 100 .mu.l fixing solution (paraformaldehyde at 4% in PBS).
Samples were read using Galaxy.RTM. Flow Cytometry System (Partec).
EC50 values were estimated using BIOST@T-SPEED software. Antibody
MAb1 binds to human and cynomolgus LAMP1 expressed at the cell
surface of recombinant HCT116 with similar affinity and EC.sub.50
of 4.9 and 5.5 nM respectively.
[0714] Antibody MAb2 was assessed for its ability to bind human
LAMP1 and primate LAMP1 proteins expressed at the surface of
recombinant HCT116 stable clones by FACS. Recombinant HCT116 cells
were coated at 40,000 cells/well on 96-well High Bind plate (MSD
L15XB-3) and 100 .mu.L/well of antibody MAb2 was added in 2-fold
serial dilutions starting at 20 .mu.g/ml up to 12 dilutions in
assay diluant for 45 min at 4.degree. C. and washed three times
with PBS 1% BSA. 100 .mu.L/well of goat anti-mouse IgG conjugated
with Alexa647 (Invitrogen; # A2135) was added for 45 min at
4.degree. C. and washed three times with PBS 1% BSA. The antibody
binding was evaluated after centrifugation and re-suspension of
cells by adding 200 .mu.l/well PBS 1% BSA and read using Guava.RTM.
easyCyte.TM. 8HT Flow Cytometry System. EC50 values were estimated
using BIOST@T-SPEED software. Antibody MAb2 binds to human and
cynomolgus LAMP1 expressed at the cell surface of recombinant
HCT116 with similar affinity and EC.sub.50 of 6.3 and 6.6 nM
respectively for MAb2.
[0715] Therefore MAb1 and MAb2 bind to LAMP1 of human and
cynomolgus origin with similar affinity.
[0716] Antibody MAb3 was assessed by flow cytometry for its ability
to bind to human LAMP1 and primate LAMP1 proteins expressed
respectively at the surface of HCT116 or HEK293 stable clones.
HCT116 stable clone was obtained as described above. HEK293 cells
were infected by a lentiviral vector allowing stable integration of
the human or the cynomolgus LAMP1 CDS in genomic DNA of cells.
Individual clones with different densities of cynomolgus LAMP1 cell
surface localization were derived from a pool of HEK293 infected
cells. Protocol as described in example above. EC.sub.50 values
were estimated using BIOST@T-SPEED software. Antibody MAb3 binds to
human and cynomolgus LAMP1 expressed at the surface of HCT116 or
HEK293 with similar affinity and EC.sub.50 of 7.6 and 4.0 nM
respectively.
[0717] Therefore MAb1, MAb2 and MAb3 bind to LAMP1 of human and
cynomolgus origin with similar affinity.
Example 4.8: Binding Competition Between MAb According to the
Invention and/or Commercially Available Anti-LAMP1 H4A3
[0718] The following examples present information on the
competition of the mAbs towards the epitope onto LAMP1 by ELISA. It
confirmed data obtained on the epitope binding site as described in
example 6 and allowed the comparison with a commercially available
anti-LAMP1 mAb.
Binding Competition Between MAb1 and MAb2
[0719] Competition between MAb2 (murine) and MAb1 (chimeric) for
binding to LAMP1 was assayed by ELISA and is illustrated on FIG. 4.
No competition was observed.
Binding Competition Between MAb1 and MAb2 or MAb3
[0720] Competition experiments between two anti-LAMP1 mAbs were
performed by ELISA with recombinant human LAMP1 coated on plate (as
described in example 6.2). Briefly, two mAbs were added
simultaneously at concentrations of 0.06 and 15 mg/L, the
concentration of 0.06 mg/L being close to the EC.sub.50. MAb format
was chosen so that the two mAbs had different Fc domains (either
human or murine). Individual measurements of mAb binding could be
performed specifically by their unique specific binding to Fc (with
Peroxidase-AffiniPure Goat Anti-Human IgG Ab, Fc.gamma. Fragment
Specific (Jackson 109-035-098) or with Peroxidase-AffiniPure Goat
Anti-Mouse IgG Ab, Fc.gamma. Fragment Specific (Jackson
115-035-164)). Results were reported as a percentage of the value
obtained from the mAb alone at the same concentration, see Table
8.
TABLE-US-00008 TABLE 8 Competition between chMAb1 and MAb2 or MAb3
Percentage of signal compared mAb to mAb Sample Added concen-
control ID mAbs tration Secondary Ab alone 1 chMAb1 + 0.06 mg/L
Anti-Human IgG_HRP 80% MAb2 15 mg/L 2 chMAb1 + 0.06 mg/L Anti-Mouse
IgG_HRP 100% MAb2 15 mg/L chMAb1 0.06 mg/L Anti-Human IgG_HRP 100%
chMAb1 0.06 mg/L Anti-Mouse IgG_HRP 0% MAb2 15 mg/L Anti-Human
IgG_HRP 0% MAb2 15 mg/L Anti-Mouse IgG_HRP 100% 3 chMAb1 + 0.06
mg/L Anti-Human IgG_HRP 80% MAb3 15 mg/L 4 chMAb1 + 0.06 mg/L
Anti-Mouse IgG_HRP 90% MAb3 15 mg/L MAb3 15 gm/L Anti-Human IgG_HRP
0% MAb3 15 mg/L Anti-Mouse IgG_HRP 100% 5 chMAb1 + 0.06 mg/L
Anti-Human IgG_HRP 10% MAb1 15 mg/L 6 chMAb1 + 0.06 mg/L Anti-Mouse
IgG_HRP 90% MAb1 15 mg/L MAb1 15 mg/L Anti-Human IgG_HRP 0% MAb1 15
mg/L Anti-Mouse IgG_HRP 100%
[0721] It was found that MAb1 does not compete with MAb2 or MAb3.
Therefore the LAMP1 epitope binding site for MAb1 does not overlap
with the epitope binding sites for MAb2 or MAb3.
Binding Competition Between H4A3 and MAb1 or MAb2 or MAb3 and
Between MAb2 and MAb3
[0722] Competition experiments between anti-LAMP1 H4A3 (BioLegend
328602) and MAb1, Mab2, or MAb3 and between MAb2 and MAb3 were
performed as described in above Example B4.81 Results were reported
as a percentage of the value obtained from the mAb alone at the
same concentration, see Table 9.
TABLE-US-00009 TABLE 9 Competition between H4A3 and chMAb1 or
chMAb2 or chMAb3 Percentage of signal compared mAb to mAb Sample
Added concen- control ID mAbs tration Secondary Ab alone 1 H4A3 +
0.06 mg/L Anti-Human IgG_HRP 96% chMAb1 15 mg/L H4A3 + 0.06 mg/L
Anti-Mouse IgG_HRP 98% chMAb1 15 mg/L chMAb1 15 mg/L Anti-Human
IgG_HRP 100% chMAb1 15 mg/L Anti-Mouse IgG_HRP 0% H4A3 0.06 mg/L
Anti-Human IgG_HRP 0% H4A3 0.06 mg/L Anti-Mouse IgG_HRP 100% MAb1 +
0.06 mg/L Anti-Human IgG_HRP 96% chMAb1 15 mg/L MAb1 + 0.06 mg/L
Anti-Mouse IgG_HRP 28% chMAb1 15 mg/L MAb1 0.06 mg/L Anti-Human
IgG_HRP 0% MAb1 0.06 mg/L Anti-Mouse IgG_HRP 100% 2 H4A3 + 0.06
mg/L Anti-Human IgG_HRP 100% chMAb2 15 mg/L H4A3 + 0.06 mg/L
Anti-Mouse IgG_HRP 57% chMAb2 15 mg/L chMAb2 15 mg/L Anti-Human
IgG_HRP 100% chMAb2 15 mg/L Anti-Mouse IgG_HRP 0% MAb2 + 0.06 mg/L
Anti-Human IgG_HRP 100% chMAb2 15 mg/L MAb2 + 0.06 mg/L Anti-Mouse
IgG_HRP 9% chMAb2 15 mg/L MAb2 0.06 mg/L Anti-Human IgG_HRP 0% MAb2
0.06 mg/L Anti-Mouse IgG_HRP 100% 3 H4A3 + 0.06 mg/L Anti-Human
IgG_HRP 100% chMAb3 15 mg/L H4A3 + 0.06 mg/L Anti-Mouse IgG_HRP 11%
chMAb3 15 mg/L chMAb3 15 mg/L Anti-Human IgG_HRP 100% chMAb3 15
mg/L Anti-Mouse IgG_HRP 0% MAb3 + 0.06 mg/L Anti-Human IgG_HRP 100%
chMAb3 15 mg/L MAb3 + 0.06 mg/L Anti-Mouse IgG_HRP 15% chMAb3 15
mg/L MAb3 0.06 mg/L Anti-Human IgG_HRP 0% MAb3 0.06 mg/L Anti-Mouse
IgG_HRP 100% 4 MAb3 + 0.06 mg/L Anti-Human IgG_HRP 99% chMAb2 15
mg/L MAb3 + 0.06 mg/L Anti-Mouse IgG_HRP 58% chMAb2 15 mg/L MAb3
0.06 mg/L Anti-Human IgG_HRP 0% MAb3 0.06 mg/L Anti-Mouse IgG_HRP
100%
[0723] It was found that H4A3 competes with MAb3, partially
competes with Mab2 and does not compete with MAb1 for binding to
LAMP1.
[0724] It was found that MAb2 and MAb3 partially compete for
binding to LAMP1.
Example 5: Immunohistochemistry (IHC) Characterization of Purified
MAb1 on Human Non-Tumoral and Tumoral Tissues
[0725] The monoclonal antibody MAb1 was purified for further
evaluation and antibody validation by extensive IHC
characterization on non-tumoral and tumoral tissues. Therefore a
large panel of human non-tumoral and tumoral tissues from
commercial Tissue-Micro-Arrays or whole cryostat sections was
tested for LAMP1 immunoreactivity either as Frozen-OCTs (Optimal
Cutting Temperature) or Acetic Formalin Alcohol (AFA) or formalin
patient-derived human xenografts. The PDXs samples used were
described in example 1.
Immunostaining on AFA Format
[0726] Classical IHC was performed using Ventana automatic
instrument (Discovery XT, Ventana Medical Systems, Inc, USA).
Sections were dewaxed and incubated with avidin and biotin blocking
reagent (Endogenous Block, Ventana, 760-050) followed by Serum
Block incubation (Ventana 760-4212). The murine monoclonal antibody
MAb1 was then incubated at final concentration of 4 .mu.g/mL during
1 hour at 37.degree. C. A post-fixation step with glutaraldehyde
(0.05% in NaCl 0.9% w/v) during 4 min was done. The secondary goat
anti-mouse IgG2a-biotinilated was incubated for 12 min at
37.degree. C. (Southern Biotech, Ref 1080-08, and dilution 1/200 in
Ventana's diluent). Immunostaining was done with DAB Map
chromogenic detection kit according to manufacturer's
recommendations. A counterstaining step was applied to the cryostat
sections with hematoxylin II (790-2208, Ventana Medical Systems,
Inc USA) and bluing reagent was applied for 4 min (760-2037).
Stained slides were dehydrated and coverslipped with Coverquick
2000 mounting medium (Labonord, ref 05547530). The negative
controls used in this study consisted in omission of primary
antibody and the use of IgG2a isotype (final concentration 1
.mu.g/mL in PBS).
Immunostaining on PFA Format
[0727] Classical IHC was performed using Ventana automatic
instrument (Discovery XT, Ventana Medical Systems, Inc, USA).
Sections were dewaxed and antigen retrieval Cell Conditioning 1
(CC1) buffer (ref 950-123 Ventana) was applied during 52 min. The
sections were incubated with avidin and biotin blocking reagent
(Endogenous Block, Ventana, 760-050) and Serum Block reagent
(Ventana, 760-4212). The murine monoclonal antibody MAb1 was then
incubated at final concentration of 4 .mu.g/mL during 1 hour at
37.degree. C. A post-fixation step with glutaraldehyde (0.05% in
NaCl 0.9% w/v) during 4 min was done. The secondary goat anti-mouse
IgG2a-biotinilated was incubated for 12 min at 37.degree. C.
(Southern Biotech, Ref 1080-08, and dilution 1/200 in Ventana's
diluent). Immunostaining was done with DAB Map chromogenic
detection kit according to manufacturer's recommendations. A
counterstaining step was applied to the cryostat sections with
hematoxylin II (790-2208, Ventana Medical Systems, Inc USA) and
bluing reagent was applied for 4 min (760-2037). Stained slides
were dehydrated and coverslipped with Coverquick 2000 mounting
medium (Labonord, ref 05547530). The negative controls used in this
study consisted in omission of primary antibody and the use of
IgG2a isotype (final concentration 1 .mu.g/mL in PBS).
Immunostaining on Frozen-OCT Format
[0728] After avidin and biotin blocking (Endogenous Block, Ventana,
760-050), frozen sections were incubated with murine monoclonal
antibody MAb1 (final concentration 1 .mu.g/mL (for human samples)
and 1 and 5 .mu.g/mL (for monkey samples) in Phosphate Buffer
Saline, PBS) for 32 min at 37.degree. C. A postfixation step with
glutaraldehyde (0.05% in NaCl 0.9% w/v) for 4 min was done. The
secondary goat anti-mouse IgG2a-biotinylated was incubated for 12
min at 37.degree. C. (Southern Biotech, Ref 1080-08, dilution 1/200
in Ventana's diluent). Immunostaining was done with DAB Map
chromogenic detection kit according to manufacturer's
recommendations. A counterstaining step was applied to the cryostat
sections with hematoxylin II (790-2208, Ventana Medical Systems,
Inc USA) and bluing reagent was applied for 4 min (760-2037).
Stained slides were dehydrated and coverslipped with Coverquick
2000 mounting medium (Labonord, Ref 05547530).
[0729] The negative controls used in this study consisted in
omission of primary antibody and the use of IgG2a isotype (final
concentration 1 .mu.g/mL in PBS).
Data Analysis
[0730] Sections immunostained with purified murine antibody MAb1
were scanned and digitized at a magnification of .times.20 using
Scan Scope XT system (Aperio Technologies, Vista Calif.). Digitized
images were then captured using Image Scope software (v10.2.2.2319
Aperio, Technologies).
[0731] Staining evaluation included several parameters: histologic
site of reactivity (cytoplasm, nuclei or membrane), main type of
reactive cell, staining intensity and cell staining frequency. The
positive samples were scored with a scale of intensity from 1 to 3.
Ranges of intensities were described as negative (0), weak (1),
moderate (2) and strong (3). Cell frequency was the percentage of
immunostained cells and was estimated by the histologist
observation as a median by sample. The cell frequency was ordered
in 5 categories: 1 (0-5%), 2 (6-25%), 3 (26-50%), 4 (51-75%) and 5
(76-100%).
[0732] A global expression was calculated according the Allred
Score (AS) description. AS was obtained by adding the intensity and
the proportion scores to obtain a total score that ranged from 0-8.
The AS was reported as a percent of the maximum global score and
ranged in 5 categories: very low (0-25%), weak (26-50%), moderate
(51-75%) and high (75-100%). The prevalence was defined as the
percent of positive cases for the indication.
[0733] Basic descriptive statistics were calculated with Microsoft
Excel 2003. For each indication, number of cases, positive cases
number, prevalence, intensity score mean, frequency mean and Allred
score were described.
Non-Tumoral Tissue Distribution
[0734] Globally, the experimental data show that the IHC pattern of
LAMP1 on cells of non-tumoral adult tissues is predominantly
cytoplasmic.
[0735] LAMP1 was expressed in the cytoplasm of a large panel of
tissues, including vital organs, gastrointestinal, reproductive,
urinary, endocrine, lymphoid and others as skin, muscle, eye,
spinal cord) and no membrane staining was observed in main organs
as heart, liver, pancreas, lung and kidney.
[0736] However, some LAMP1 expression at the membrane occurred but
was restricted to stomach epithelial cells, oesophageal epithelial
cells, breast epithelial cells, prostate epithelial cells,
testicular epithelial cells (Table 10).
[0737] Nevertheless, prevalence and mean intensities for LAMP1
expression at the membrane of non-tumoral samples were lower than
those found in tumours.
TABLE-US-00010 TABLE 10 LAMP1 immunostaining in human non-tumoral
samples- Membrane pattern Non tumoral tissues % Prev Intensity %
+cells Prev % Prv Prev Memb Memb Memb Tissue Type N Cyto Cyto Memb
(Mean) (Mean) (Mean) Cell type Stomach 28 28/28 100% 3/28 11% 2 16
Epithelial C. Esophagus 17 16/17 94% 2/17 12% 2.5 5 Epithelial
Basal C. Breast 17 17/17 100% 6/17 35% 1.5 15 Epithelial C.
Prostate 26 26/26 100% 1/26 4% 2 5 Epithelial C. Testis 14 14/14
100% 5/14 36% 2.2 12 Germinal + Leyding
Tumoral Tissue Distribution
[0738] The immunohistochemical pattern using MAb1 or MAb2 in human
tumoral tissues demonstrates that the antigen is located in the
cytoplasm and/or membrane of tumoral tissues. Protein expression
data for human tumoral samples displaying the membrane pattern show
that LAMP1 antigen is not restricted to colon adenocarcinomas. A
variety of other carcinomas, including gastrointestinal tumors
(small intestine, rectum, parotid gland), vital organs tumors
(lung, liver, stomach, pancreas and kidney), reproductive organ
tumors (breast, ovary and prostate) as well as skin, larynx and
soft tissue tumors (Table 11).
TABLE-US-00011 TABLE 11 LAMP1 immunostaining in human tumoral
samples: Membrane pattern TUMORAL TISSUES Intensity % +Cells Prev %
Prev Memb Memb Alred 1- 6- 26- 51- 76- Organ Tumor Type N Memb Memb
(Mean) (Mean) Score Neg 5% 25% 50% 75% 100% >50% Colon
Adenocarcinoma 86 38/86 44 2.5 30 69 56% 17% 16% 2% 7% 9% Small
Adenocarcinoma 1 1/1 100 3.0 30 75 100% Intestine Rectum
Adenocarcinoma 14 9/14 64 3.0 21 63 36% 21% 14% 21% 7% Parotid
Adenocarcinoma 3 2/3 67 2.0 18 50 33% 33% 33% Gland Lung Squamous
Cell 29 6/29 21 2.5 31 69 79% 3% 10% 3% 3% 6% Carc Adenocarcinoma
12 4/12 33 2.5 26 69 67% 8% 8% 17% Liver Hepatocellular 2 1/2 50 2
5 38 50% 50% Carc Pancreas Adenocarcinoma 18 1/18 6 2 10 50 94% 6%
Kidney Clear Cell Carc 9 1/9 11 3 5 50 89% 11% Breast InvDucCar 70
27/70 39 2.4 41 68 61% 3% 13% 9% 7% 7% 14% InvLobCar 3 2/3 67 2.5
60 81 33% 33% 33% 33% Ovary Adenocarcinoma 21 5/21 24 3.0 15 63 76%
5% 5% 14% Serous Carcinoma 6 1/6 17 2 10 50 83% 17% Prostate
Adenocarcinoma 16 4/16 25 3.0 43 75 75% 19% 6% 6% Stomach
Adenocarcinoma 32 8/32 25 2.3 45 NA 75% 3% 9% 9% 3% 13% Skin
Squamous Cell 6 1/6 17 3.0 10 63 83% 17% Carc Malignant 4 1/4 25
2.0 40 63 75% 25% Melanoma Larynx Squamous Cell 5 1/5 20 2.0 5 38
80% 20% Carc Soft Giant cell tumor of 2 1/2 50 3.0 5 50 50% 50%
Tissue thigh
[0739] Tumor indications were ranked in terms of LAMP1 expression
level based on the percentage of samples displaying more than 50%
of membrane frequency (positive cells).
[0740] Based on this parameter the first tumor indications were
colon, rectum, lung squamous cell carcinoma, breast invasive ductal
and lobular carcinoma, stomach adenocarcinoma and prostate
adenocarcinoma.
[0741] Additionally, indications displaying 25-50% of positive
cells at the membrane, could be also considered as relevant
indications, including small intestine adenocarcinoma, parotid
gland adenocarcinoma, lung adenocarcinoma, ovary adenocarcinoma,
skin malignant melanoma and larynx squamous cell carcinoma (Table
11).
[0742] Moreover, LAMP1 immunostaining was not detected at the
membrane in the following tumor indications: Lung small cell
carcinoma (0/3), esophagus squamous cell carcinoma (0/11), cervix
squamous cell carcinoma 0/3), endometrium adenocarcinoma (0/3),
vulva squamous cell carcinoma (0/6), testis seminoma (0/4), testis
embryonal carcinoma (0/1), bladder transitional cell carcinoma
(0/1), thyroid papillary adenocarcinoma (0/3) and mullerian mixed
tumor of the oral cavity (0/5).
Example 6--Binding Site Identification
[0743] In this example LAMP1 domains were defined and human-murine
hybrid LAMP1 proteins were designed to generate secreted as well as
membrane-anchored LAMP1 proteins allowing the characterization of
the binding site of the anti-LAMP1 mAbs towards LAMP1.
Example 6.1: Definition of LAMP1 Domains
[0744] LAMP1 also named CD107a is the Lysosomal Associated Membrane
Protein 1. It is a transmembrane type I protein of around 120 kDa.
The protein is a highly glycosylated monomer with eighteen
N-glycosylation and six O-glycosylation sites. It is composed of
two lumenal domains separated by a hinge. Each lumenal domain has
two disulphide bridges that define two loops. According to RefSeq
NP_005552.3 (SEQ ID NO: 24) the different domains of LAMP1 have
been mapped as shown in Table 1. Based on structural information
and in particular beta-strands and amino acids differences between
human and mouse LAMP1 several hybrid LAMP1 molecules were
designed.
Example 6.2: Preparation of Recombinant Extracellular Domains of
LAMP1 Proteins
[0745] The high level of glycosylation of the antigen required a
specific approach to determine the binding site of the anti-LAMP1
mAbs on LAMP1. The LAMP1 monoclonal antibodies MAb1 and MAb2 do not
show any binding to the mouse LAMP1 protein. This absence of
binding was used to design several chimeric LAMP1 proteins in which
one or several of the LAMP1 domains (Loop1-Loop4) in the human
construct were replaced by the murine counterpart. The absence of
binding once the binding site of the antibody was replaced by the
murine counterpart allowed for identification of the antibody
binding side.
[0746] Hence, the extracellular protein domains of LAMP1 from
human, cynomolgus monkey (c) and murine (m) origin or hybrid
between murine and human LAMP1 domains have been prepared by
transient expression in human embryonic kidney HEK293 cells with
plasmids allowing expression of the respective cDNA as outlined on
Table 12.
[0747] Each expression plasmid was complexed with 293Fectin.TM.
(Life Technologies) and eight days post-transfection in
suspension-cultivated 293-F cells (derived from HEK293 cells), the
corresponding soluble protein was purified by IMAC (GE Healthcare)
to generate a protein batch.
TABLE-US-00012 TABLE 12 Description of the recombinant
extracellular domains of LAMP1 proteins Protein name Description of
protein domains Sequence ID. LAMP1::histag human LAMP1 (29-382) SEQ
ID NO: 28 cLAMP1::histag cynomolgus LAMP1 (27-380) SEQ ID NO: 29
mLAMP1_L1_LAMP1_L234::histag Loop1: mouse LAMP1 (25-94) SEQ ID NO:
30 Loop2-4: human LAMP1 (101-382) mLAMP1_L12_LAMP1_L34::histag
Loop1-2: mouse LAMP1 (25-189) SEQ ID NO: 31 Loop3-4: human LAMP1
(196-382) LAMP1_L12_mLAMP1_L34::histag Loop1-2: human LAMP1
(29-195) SEQ ID NO: 32 Loop3-4: mouse LAMP1 (190-369)
LAMP1_L123_mLAMP1_L4::histag Loop1-3: human LAMP1 (29-309) SEQ ID
NO: 33 Loop4: mouseLAMP1 (299-369) mLAMP1::histag mouse LAMP1
(25-369) SEQ ID NO: 34
Example 6.3: Determination of Binding Affinity and Epitope by
ELISA
[0748] Secreted LAMP1 proteins described in example 6.2 were used
to identify the binding domain to anti-LAMP1 mAbs by ELISA. MAb1
recognizes loop 2 of LAMP1 and MAb2 recognizes loop 1 of LAMP1 with
EC.sub.50 to LAMP1 of around 0.2 and 0.3 nM respectively.
TABLE-US-00013 TABLE 13 EC.sub.50 (nM) obtained for murine or
chimeric hybridoma mAbs Protein Loop1: Loop1-2: Loop1-2: Loop1-3:
mLAMP1 mLAMP1 hLAMP1 hLAMP1 Anti- human/ Mouse Loop2-4: Loop3-4:
Loop3-4: Loop4: body LAMP1 LAMP1 hLAMP1 hLAMP1 mLAMP1 mLAMP1 MAb1
0.18 No 0.15 No binding 0.18 0.16 binding MAb2 0.25 No No No
binding 0.25 0.25 binding binding chMAb1 0.12 No 0.11 No binding
0.11 0.11 binding chMAb3 0.11 No No No binding 0.12 0.11 binding
binding
Example 6.4: Expression of LAMP1 Transmembrane Proteins
[0749] Different LAMP1 proteins were expressed at the cell membrane
of HEK293 cells after transient expression from mammalian plasmids
encoding the entire coding sequence of LAMP1 deleted of the
intracellular lysosome-targeting motif GYQTI and substituted by a
5-Ala repeat sequence. Mammalian plasmids had similar expression
signals as plasmids used to produce recombinant LAMP1 described in
example 6.2. Table 14 below lists all the plasmids that were
designed in order to confirm the results obtained with soluble
LAMP1 protein by ELISA in example 6.3 and further characterize the
binding domains of the anti-LAMP1 mAbs.
TABLE-US-00014 TABLE 14 Description of LAMP1 transmembrane proteins
Short description of LAMP1 transmembrane protein/ Plasmid Encoded
Protein with amino acid positions according to SEQ ID NO: 24
pXL5626 hLAMP1_.DELTA.GYQTI human LAMP1 pXL5668
LAMP1_mL1_hL234_.DELTA.GYQTI Hybrid LAMP1 murine in L1 and human in
L2 to L4 pXL5669 LAMP1_hL12_mL34_.DELTA.GYQTI Hybrid LAMP1 human in
L1 and L2 murine in L3 and L4 pXL5719
hLAMP1_.DELTA.glycaninL1_.DELTA.GYQTI human LAMP1 with substitution
of N > Q at positions 37, 45, 62, 76 and 84 in L1 pXL5720
hLAMP1_.DELTA.glycaninL2_.DELTA.GYQTI human LAMP1 with substitution
of N > Q at positions 103, 107, 121, 130, 165 and 181 in L2
pXL5988 LAMP1_mL1_hL2_mL34_.DELTA.GYQTI Hybrid LAMP1 murine in L1,
L3 and L4 human in L2 pXL5997 LAMP1_hL1_mL2_hL34_.DELTA.GYQTI
Hybrid LAMP1 human in L1, L3 and L4 murine in L2 pXL5990
LAMP1_mseq6_.DELTA.GYQTI Hybrid LAMP1; human sequence except murine
sequence at position 97 to 110 in L2 pXL5991
LAMP1_mseq7_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 110 to 128 in L2 pXL5992
LAMP1_mseq8_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 128 to 144 in L2 pXL5993
LAMP1_mseq9_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 144 to 157 in L2 pXL5994
LAMP1_mseq10_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 157 to 173 in L2 pXL5995
LAMP1_mseq11_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 173 to 189 in L2 pXL5996
LAMP1_mseq12_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 189 to 196 in L2 pXL6009 mLAMP1_.DELTA.GYQTI
murine LAMP1 pXL6012 LAMP1_mseq1_.DELTA.GYQTI Hybrid LAMP1 human
sequence except murine sequence at position 29 to 41 in L1 pXL6013
LAMP1_mseq2_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 41 to 56 in L1 pXL6014
LAMP1_mseq3_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 56 to 68 in L1 pXL6015
LAMP1_mseq4_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 68 to 80 in L1 pXL6017
LAMP1_mseq5_.DELTA.GYQTI Hybrid LAMP1 human sequence except murine
sequence at position 80 to 97 in L1/L2 pXL6041
mLAMP1_hseq6-11_.DELTA.GYQTI Hybrid LAMP1 murine sequence except
human sequence at position 91 to 104 and 167 to 183 in L2 pXL6047 m
LAMP1_hseq6_.DELTA.GYQTI Hybrid LAMP1 murine sequence except human
sequence at position 91 to 104 in L2 pXL6048
mLAMP1_hseq11_.DELTA.GYQTI Hybrid LAMP1 murine sequence except
human sequence at position 167 to 183 in L2 pXL6092
mLAMP1_hseq6-9-11_.DELTA.GYQTI hybrid LAMP1 murine sequence except
human sequence at position 91 to 104 and 138 to 151 and 167 to 183
in L2
Example 6.5: Determination of Binding Affinity and Epitope by Flow
Cytometry
[0750] Each expression plasmid described in example 6.4 was
complexed with 293Fectin.TM. in suspension-cultivated 293-F cells
as using the protocol outlined in example 6.2. Two days post
transfection cells were processed, analyzed by flow cytometry
(Guava.RTM. easyCyte.TM. 8 HT) as mentioned in example 4.7, and the
mean fluorescence was recorded. This fluorescence represents a
semi-quantitative assessment of binding.
[0751] The results obtained with plasmids pXL5626, pXL5668,
pXL5669, pXL5719 and pXL5720 are summarized in Table 15.
TABLE-US-00015 TABLE 15 Binding of huMAb1_1, chMAb1, chMAb2 and
chMAb3 onto LAMP1 proteins by flow cytometry (Mean fluorescence)
Plasmid pXL5626 pXL5668 pXL5669 pXL5719 pXL5720 Protein
hLAMP1_.DELTA.GYQTI LAMP1_mL1_hL234_ LAMP1_hL12_mL34_
hLAMP1_.DELTA.glycaninL1_ hLAMP1_.DELTA.glycaninL2_ .DELTA.GYQTI
.DELTA.GYQTI .DELTA.GYQTI .DELTA.GYQTI huMAb1_1 864 1112 934 1103
528 Binding Binding Binding Binding Binding chMAb1 1047 1059 1484
1113 1006 Binding Binding Binding Binding Binding chMAb2 1025 6 814
458 958 Binding No binding Binding Binding Binding chMAb3 640 21
764 706 765 Binding No binding Binding Binding Binding
[0752] This first set of affinity data (Table 15) with
membrane-anchored LAMP1 proteins are in agreement with the ELISA
data reported on Example 6.3 with the secreted LAMP1 proteins. MAb1
binds to hLAMP1 in L2 positions 101 to 195 of hLAMP1 (SEQ ID No:
24), MAb2 and MAb3 bind to hLAMP1 in L1 positions 29 to 100 of
hLAMP1. These data also showed that none of the three anti-LAMP1
bind to a glycotope since MAb1 binds to LAMP1 for which L2 was
engineered to have no N-glycosylation site and MAb2 and MAb3 bind
to LAMP1 for which L1 was engineered to have no N-glycosylation
site. The results obtained with plasmids pXL5626, pXL5988, pXL5669,
pXL5990 to pXL5997 are summarized in Table 16.
TABLE-US-00016 TABLE 16 Binding of huMAb1_1 and chMAb2 onto LAMP1
proteins by flow cytometry (mean fluorescence) Plasmid Protein
huMAb1_1 chMAb2 pXL5626 hLAMP1_.DELTA.GYQTI 1412 1498 Binding
Binding pXL5988 LAMP1_mL1_hL2_mL34_.DELTA.GYQTI 1180 10 Binding No
binding pXL5997 LAMP1 _hL1 _mL2_hL34_.DELTA.GYQTI 25 1167 No
Binding Binding pXL5990 LAMP1_mseq6_.DELTA.GYQTI 11 1721 No Binding
Binding pXL5991 LAMP1_mseq7_.DELTA.GYQTI 1400 1412 Binding Binding
pXL5992 LAMP1_mseq8_.DELTA.GYQTI 1440 1688 Binding Binding pXL5993
LAMP1_mseq9_.DELTA.GYQTI 545 1461 Binding Binding pXL5994
LAMP1_mseq10_.DELTA.GYQTI 1414 1555 Binding Binding pXL5995
LAMP1_mseq11_.DELTA.GYQTI 16 1378 No Binding Binding pXL5996 LAMP1
mseq12_.DELTA.GYQTI 1303 1365 Binding Binding ballast no LAMP1 1 1
No binding No binding
[0753] The results obtained with plasmids pXL5626, pXL6041,
pXL6047, pXL6048, and pXL6009 are summarized in Table 17.
TABLE-US-00017 TABLE 17 Binding of MAb1 and MAb2 onto LAMP1
proteins by flow cytometry (mean fluorescence Experiment n.degree.
1 Experiment n.degree. 2 Plasmid Protein MAb1 MAb2 MAb1 pXL5626
hLAMP1_.DELTA.GYQTI 1748 1183 551 Binding binding Full binding
pXL6041 mLAMP1_hseq6-11_.DELTA.GYQTI 680 28 211 Binding No binding
binding pXL6047 mLAMP1_hseq6_.DELTA.GYQTI 7 25 3 No binding No
binding No binding pXL6048 mLAMP1_hseq11_.DELTA.GYQTI 6 28 2 No
binding No binding No binding pXL6092
mLAMP1_hseq6-9-11_.DELTA.GYQTI Not done Not done 499 Full binding
pXL6009 mLAMP1_.DELTA.GYQTI 4 21 2 No binding No binding No
binding
[0754] The results obtained with plasmids pXL5626, pXL6012 to
pXL6015, pXL6017 and pXL6009 are summarized in Table 18.
TABLE-US-00018 TABLE 18 Binding of MAb1, MAb2 and MAb3 onto LAMP1
proteins by flow cytometry (mean fluorescence Plasmid Protein MAb1
MAb2 MAb3 pXL5626 hLAMP1_.DELTA.GYQTI 914 757 749 Binding Binding
Binding pXL6012 LAMP1_mseq1_.DELTA.GYQTI 1027 105 Low 2.8 No
binding binding pXL6013 LAMP1_mseq2_.DELTA.GYQTI 990 694 803
Binding Binding Binding pXL6014 LAMP1_mseq3_.DELTA.GYQTI 888 694
674 Binding Binding Binding pXL6015 LAMP1_mseq4_.DELTA.GYQTI 891 27
No 3 No Binding binding binding pXL6017 LAMP1_mseq5_.DELTA.GYQTI
846 629 721 Binding Binding Binding pXL6009 mLAMP1_.DELTA.GYQTI 13
No 27 No 3 No binding binding binding
[0755] The affinity data described in Table 16 with
membrane-anchored LAMP1 proteins demonstrated that MAb1 binds to
LAMP1 in L2 positions 101 to 195 of hLAMP1 (SEQ ID NO: 24)
(pXL5626, pXL5988 and pXL5997). More specifically MAb1 does not
bind to hybrid LAMP1 protein where human LAMP1 residues from
positions 97 to 110 or from positions 173 to 189 have been
substituted by murine LAMP1 residues, but it binds to hybrid LAMP1
protein where human LAMP1 residues from positions 110 to 173 or
from positions 189 to 196 in L2 have been substituted by murine
LAMP1 residues. Of note some binding is also lost when human LAMP1
residues from position 144 to 157 are replaced by the murine LAMP1
residues. In addition data reported in Table 17 Experiment No 1
showed that residues from positions 97 to 110 and from positions
173 to 189 are simultaneously needed to restore some of the
binding. Data reported in Table 17 experiment No 2 showed that
residues from positions 91 to 104 and 138 to 151 and 167 to 183 in
Loop2 are simultaneously needed to restore full binding of
MAb1.
[0756] From these sets of affinity data (Tables 15, 16, 17 and 18)
obtained by flow cytometry with membrane-anchored LAMP1 proteins
and the ELISA results with the secreted LAMP1 proteins described in
Example 6.3, the following conclusions could be derived:
[0757] MAb1 binds to L2 positions 101 to 195 of LAMP1, MAb2 and
MAb3 bind to L1 positions 29 to 100 of LAMP1.
[0758] None of the three anti-LAMP1 bind to a glycotope since MAb1
binds to LAMP1 for which L2 was engineered to have no
N-glycosylation site and MAb2 and MAb3 bind to LAMP1 for which L1
was engineered to have no N-glycosylation site.
[0759] MAb1 does not bind to hybrid LAMP1 protein where human LAMP1
residues from positions 97 to 110 (SEQ ID NO: 78) or from positions
173 to 189 (SEQ ID NO: 79) have been substituted by murine LAMP1
residues. But it binds to hybrid LAMP1 protein where human LAMP1
residues from positions 110 to 173 or from positions 189 to 196 in
L2 have been substituted by murine LAMP1 residues.
[0760] MAb1 interacts with amino acids located within L2 and more
specifically MAb1 interacts with amino acids located within
sequences from positions 101 to 110 (SEQ ID NO: 72) and/or from
positions 174 to 188 (SEQ ID NO: 74) and to some extent to sequence
from positions 144 to 157 (SEQ ID NO: 73). Therefore, we can infer
from these results and from amino acid differences between murine
and human sequences that human LAMP1 residues among R146, D150,
K152, R106, A108, N181, S182, S183, R186 and G187 are likely to
interact with MAb1.
[0761] MAb2 interacts with amino acids located within L1 and more
specifically MAb2 interacts with amino acids located within
sequences from positions 68 to 80 (SEQ ID NO: 76) and to some
extent within sequences from positions 29 to 41 (SEQ ID NO: 75).
Therefore, we can infer from these results and from amino acid
differences between murine and human sequences that human LAMP1
residues among A29, M30, M32, G36, A40, S69, D70, T72, V74, L75,
and R77 are likely to interact with MAb2.
[0762] MAb3 interacts with amino acids located within L1 and more
specifically MAb3 interacts with amino acids located within
sequences from positions 29 to 41 (SEQ ID NO: 75) and/or from
positions 68 to 80 (SEQ ID NO: 76). Therefore, we can infer from
these results and from amino acid differences between murine and
human sequences that human LAMP1 residues among A29, M30, M32, G36,
A40, S69, D70, T72, V74, L75, and R77 are likely to interact with
MAb3.
Example 6.6: Determination of Individual Amino Acid Involved in
Epitope Binding by Ala Scan
[0763] Individual residues identified in example 6.5 and not
involved in .beta.-strand structure have been individually replaced
by an alanine residue in the LAMP1 sequence derived from
hLAMP1_.DELTA.GYQTI and encoded in plasmid pXL5626 (example 6.4). A
total of 21 plasmids were engineered from pXL5626 (see Table 19)
and used to assay LAMP1 expression at the cell membrane of HEK293
cells after transient transfection. Two days post transfection
cells were processed, analyzed by flow cytometry (Guava.RTM.
easyCyte.TM. 8 HT) as mentioned in example 4.7, and the mean
fluorescence was recorded. This fluorescence represents a
semi-quantitative assessment of binding. Loss of binding is
reported on Table 19 when there is a decrease of more than 50% of
the mean fluorescence compared to the control protein encoded from
pXL5626.
TABLE-US-00019 TABLE 19 Loss of binding to anti-LAMP1 mAb with
Alascan LAMP1 transmembrane proteins Position of mutation Binding
Binding Plasmid in hLAMP1_.DELTA.GYQTI to MAb1 to MAb3 pXL5626 none
pXL6058 G36A pXL6065 N37A pXL6059 G38A Binding loss pXL6060 L67A
pXL6066 P68A pXL6067 S69A pXL6069 D70A Binding loss pXL6072 N107A
pXL6073 A108T pXL6080 T109A pXL6070 I149A Binding loss pXL6085
D150A Binding loss pXL6071 K151A pXL6079 Y178A pXL6074 L179A
pXL6075 S180A pXL6076 N181A pXL6077 F184A pXL6081 R186A Binding
loss pXL6082 G187A
[0764] Loss of binding to MAb1 at positions 1149, D150 and R186 due
to Ala substitution in LAMP1 protein indicates that these positions
are important for MAb1 binding to LAMP1.
[0765] Loss of binding to MAb3 at positions G38 and D70 due to Ala
substitution in LAMP1 protein indicate that these positions are
important for MAb2 binding to LAMP1.
Example 7: Determination of mAb Sequences
Example 7.1: Determination of mAb Sequences and Generation of
Chimeric mAbs
[0766] The sequences of the variable domains of the mAb were
retrieved from the hybridoma and cloned into an expression vector
to ensure that the cloned mAbs had the same characteristics as the
initial murine mAbs.
[0767] The cDNA encoding the variable domains of the monoclonal
antibodies were obtained as follows. cDNA has been retrieved and
sequenced by RT-PCR (transcriptase SuperScript III from Invitrogen
and polymerase Phusion from Finnzymes) from 100 hybridoma cells and
oligonucleotides located at the 5'-end of the cDNA encoding the
variable regions and the constant domains.
High Resolution Mass Spectrometry of Hybridoma (HRMS):
[0768] Mass spectra were obtained on a Waters Synapt G2 TOF system
in electrospray positive mode (ES+). Chromatographic conditions are
the following: column: UPLC MassPrep 20 .mu.m 2.1.times.5 mm;
solvents: A: H.sub.2O+0.1% formic acid: B; CH.sub.3CN+0.1% formic
acid; column temperature: 80.degree. C.; flow rate 0.2 mL/min;
gradient elution (10 min): 10% B for 30 sec; from 10 to 50% of B in
7 min 10 sec; 8 min: 90% B; 8 min 30 sec: 10% B; 10 min: 10% B.
Samples were reduced 30 min at 37.degree. C. in Gdn.HCL 6M/DTT 1M
before LC/MS analysis.
[0769] The derived amino acid sequences provided information in
agreement with the data obtained on purified mAbs derived from the
hybridoma by N-terminal sequencing and mass spectrometry (LC/MS) of
the heavy and light chains (LC, HC) Table 20. No identical
sequences were found in the patented sequences from
GenomeQuest.
TABLE-US-00020 TABLE 20 Mass spectrometry analysis of anti-LAMP1
mAbs from hybridoma Mass (Da) by LC/MS in silico value Clone ID
Chain from batch retrieved from sequence MAb1 LC 23587 23587 HC
(G0F) 50700 50700 MAb2 LC 23911 23911 HC (G0F) 50702 50704 MAb3 LC
23725 + higher 23723 masses due to N-glycans HC (G0F) 50852
50848
[0770] The nucleic acid sequences of the variable domains VH and VL
were cloned into expression vectors in fusion with the human IgG1
or the human Ckappa constant domain coding sequences, respectively,
to then generate batches of chimeric mAbs by transient expression
in 293-F cells as described in Example 6.2. Batches were purified
by protein A affinity chromatography (MabSelect, GE Heathcare). The
eluate was dialyzed against PBS before sterile filtration and
storage at 4.degree. C.
[0771] Affinity to LAMP1 remained similar for murine and chimeric
mAbs illustrated by the EC.sub.50 obtained by ELISA with LAMP1 in
Table 21.
TABLE-US-00021 TABLE 21 EC.sub.50 (nM) obtained with LAMP1 for
murine hybridoma and corresponding chimeric mAbs obtained for
murine hybridoma mAbs clone EC.sub.50 obtained for chimeric mAbs ID
hLAMP1 clone ID hLAMP1 MAb1 0.18 nM chMAb1 0.12 nM (assay A) 0.12
nM (assay B) MAb2 0.25 nM chMAb2 0.12 nM (assay A) chMAb2.sub.can
0.12 nM (assay A) chMAb3 0.12 nM (assay B) chMAb3VL_R24_R93 0.11 nM
(assay B)
[0772] Based on the data described above, the amino acid sequences
of the HC and the LC were validated.
[0773] The LC and HC sequences of MAb1 are shown in SEQ ID NO: 35
and SEQ ID NO: 36, respectively.
[0774] The LC and HC sequences of MAb2 are shown in SEQ ID NO: 37
and SEQ ID NO: 38, respectively.
[0775] The sequences for the CDR regions were deduced from the
protein sequence using the IMGT nomenclature.
[0776] The LC and HC sequences of chMAb1 are shown in SEQ ID NO: 18
and SEQ ID NO: 17, respectively, and the LC and HC sequences of
chMAb2 are shown in SEQ ID NO: 20 and SEQ ID NO: 19, respectively.
The LC and HC sequences of chMAb3 are shown in SEQ ID NO: 49 and
SEQ ID NO: 50, respectively.
[0777] Of note, canonical residues have been introduced into clone
MAb2 at positions A9, L51, L58, G72 and L108 on VL and at position
T116 on VH sequence, to generate MAb2.sub.can. The corresponding
amino acid sequences of the VH and the VL of MAb2.sub.can are SEQ
ID NO: 15 and SEQ ID NO: 16, respectively. The HC and LC sequences
of chMAb2.sub.can are shown in SEQ ID NO: 21 and 22,
respectively.
[0778] A batch of clone chMAb2.sub.can was generated in the same
conditions as the batch corresponding to clone chMAb2. This
highlights that point mutations in the FR can be made without any
impact on binding but more importantly provide an alternative to
the production process.
[0779] A batch of clone chMAb3_VLR24-R93 was generated in the same
conditions as the batch corresponding to clone chMAb3. This
highlights that point mutations in the CDR can be made without any
impact on binding.
Affinity to LAMP1 by SPR:
[0780] The binding kinetics of the murine, chimer or humanized
anti-LAMP1 mAbs were determined by surface plasmon resonance assay
using a BIAcore 2000 (BIAcore Inc., Uppsala, N.J.). Briefly, a CM5
BIAcore biosensor chip was docked into the instrument and activated
with 70 .mu.L of 1:1 NHS/EDC at room temperature. A mouse
anti-.alpha.human Fc IgG1 (BIAcore #BR-1008-39) and rabbit
anti-.alpha.murine Fc IgG1 (BIAcore #BR-1008-38) (50 .mu.g/mL in 1
M acetate buffer, pH5) were immobilized on the activated chips in
all flow cells. The immobilization was carried out at a flow rate
of 10 .mu.L/min up to saturation. The chip was then blocked by
injection of 70 .mu.L of ethanolamine-HCl, pH 8.5, followed by one
wash with 3 M MgCl.sub.2 for anti-.alpha.human Fc IgG1 and one wash
with 10 mM Glycine-HCl pH 1.7 for anti-.alpha.murine Fc IgG1. To
measure the binding of anti-LAMP1 mAbs to LAMP1, antibodies were
used at 1-5 .mu.g/mL in BIAcore running buffer (HBS-EP). The
antigen (SEQ ID NO: 28 protein produced as described in example
6.2) was injected from 1 to 256 nM. Following completion of the
injection phase, dissociation was monitored in a BIAcore running
buffer at the same flow rate for 600 sec. The surface was
regenerated between injections using 2.times.5 .mu.L 3 M MgCl.sub.2
(2.times.30 s) or anti-.alpha.human Fc IgG1 and 1.times.30 .mu.L 10
mM Glycine-HCl pH 1.7 for anti-.alpha.murine Fc IgG1 (180 s).
Individual sensorgrams were analyzed using BIAevaluation
software.
[0781] Affinity to LAMP1 for the murine, chimer or humanized mAbs
is reported on Table 22. It was found to be independent of the MAb
format.
[0782] MAb1 binds to LAMP1 with K.sub.D ranging from 4.8 to 8.2
nM
[0783] MAb2 binds to LAMP1 with K.sub.D ranging from 63.5 to 68.8
nM
[0784] MAb3 binds to LAMP1 with K.sub.D ranging from 4.7 to 7.2
nM
[0785] The commercially available anti-LAMP1 mAb (H4A3 (BioLegend
328602) has a significantly higher K.sub.D and thus a lower binding
efficiency than Mab1, Mab 2 and MAb 3 with a Kd of around 100
nM.
TABLE-US-00022 TABLE 22 Binding kinetics to LAMP1 for the murine,
chimer or humanized mAbs Mab k.sub.a (M.sup.-1 s.sup.-1) k.sub.d
(s.sup.-1) K.sub.D (nM) Mab1 14.8E+04 0.71E-03 4.8 huMAb1_1
19.1E+04 1.57E-03 8.2 chMAb2can 7.21E+04 4.96E-03 68.8 Mab2
6.33E+04 4.02E-03 63.5 chMAb3VL_R24_R93 17.3E+04 1.25E-03 7.2 MAb3
24.2E+04 1.13E-03 4.7 Murine H4A3 5.80E+04 6.09E-03 105 (BioLegend
328602)
Example 7.2: Obtention and Characterisation of Humanized Variants
Derived from MAb1
[0786] In this example, humanized variants of parental murine IgG
MAb1 have been designed in silico. The resulting huMAb1 variants
were produced and provided similar characteristics as the chimer
chMAb1.
Example 7.2.1 Design of the Humanized Anti-LAMP1 huMAb1
Humanization Based on CDR Grafting
[0787] This approach consists in the transplantation of CDRs of the
parental murine MAb1 into relevant human FRs. The variable light
and heavy regions of murine MAb1 were compared to human germline
sequences from IMGT Information system (Lefranc et al. Nucl. Acids.
Res. 2009, 37:D1006-D1012) to select the human light and heavy
variable sequences that would serve as the basis of the humanized
MAb1 regions (huMAb1).
[0788] The mouse light chain variable region displayed 68.8%
identity over the V region and 74.7% identity within the FRs alone
to the human germline kappa light chain IGKV1-27. For the joining
region, mouse J region displayed 90% identity to human germline
IGKJ4. Consequently human V region IGKV1-27 combined to human J
region IGKJ4 given a global germinality index (identity calculated
on FRs only) of 76.4% have been selected as human acceptor
sequences for humanization of the mouse MAb1 light chain. This then
became the basis of the humanized variant of the anti-LAMP1 MAb1
light chain, which comprised the CDRs of the murine MAb1 Vk region
and the FRs of the human IGKV1-27.sub.-- IGKJ4 regions.
[0789] The mouse heavy chain variable region displayed 65.3%
identity over the V region and 70.0% identity within the FRs alone
to the human heavy variable germline IGHV1-69. For the joining
region, mouse J region displayed 78% identity to human heavy
joining germline IGHJ4. Consequently human germline V region
IGHV1-69 combined to human germline J region IGHJ4 given a global
germinality index (identity calculated on FRs only) of 71.4% have
been selected as human acceptor sequences for humanization of the
murine MAb1 heavy region. This then became the basis of the
humanized variant of the anti-LAMP1 MAb1 heavy chain, which
comprised the CDRs of the murine MAb1 Vh region and the FRs of the
human IGHV1-69_IGHJ4 regions.
[0790] However, some FRs residues are also important for the
biological activity of the antibody since they can impact CDRs
conformation and thus antigen binding. Back mutations to murine
amino acid may be introduced at selected positions of FRs grafted
antibody in order to retain the binding specificity and affinity of
the parent antibody. Thus, the next step in the design process was
to study the protein sequences of the humanized variant to
determine if any of these amino acid residues were likely to alter
the conformation or orientation of the CDRs loops. A 3D homology
model of the variable regions of both the murine and the humanized
antibodies were built using model antibody framework protocol of
Discovery studio 3.1 from Accelrys Software Inc.
[0791] The VL and VH sequences of the murine MAb1 were compared to
the protein database (PDB) (Berman et al. Nucleic Acids Research,
2000, 28:235-242).
[0792] The structure model of the antithrombotic monoclonal
antibody 82D6A3 with the PDB identity number 2ADF was used as
template for the light chain (96.6% identity on light chain
framework) and the structure model of IL-23 in complex with
neutralizing FAB with the PDB identity number 3D85 was used as
template for the heavy chain (83.5% identity on heavy chain
framework).
[0793] In the same way, the VL and VH sequences of the humanized
variant (human FRs and murine CDR) were compared to the protein
database (PDB) (Berman et al. Nucleic Acids Research, 2000,
28:235-242). The model with the PDB identity number 3AAZ was used
as template for the light chain (86.6% identity on light chain
framework) and the model with the PDB identity number 3KDM was used
as template for the heavy chain (84.3% identity on heavy chain
framework) (All PDB references refer to the PDB identity number as
available on Nov. 26, 2013).
[0794] Both 3D homology models, the murine MAb1 and the humanized
version were compared and each amino acid substitution from mouse
to human version were carefully looked. When the substitution of a
mouse to a human residue was done at a position that could
influence the conformation of the CDRs, a back mutation to the
murine residue was done.
Humanization Based on Molecular Dynamic Trajectories (4D
Humanization Protocol)
[0795] A molecular dynamics (MD) simulation of the 3D homology
model of the murine MAb1 (as described in section above on grafting
protocol) was subsequently performed, with constraints on the
protein backbone at 500 K temperature for 1.1 nanoseconds (ns) in
Generalized Born implicit solvent. 10 diverse conformations were
extracted from this first MD run every 100 picoseconds (ps) for the
last 1 ns. These diverse conformations were then each submitted to
a MD simulation, with no constraints on the protein backbone and at
300 K temperature, for 2.3 ns. For each of the 10 MD runs, the last
2,000 snapshots, one every ps, from the MD trajectory were then
used to calculate, for each murine MAb1 amino acid, its root mean
square deviations (rmsd) compared to a reference medoid position.
By comparing the average rmsd on the 10 separate MD runs of a given
amino acid to the overall average rmsd of all MAb1 murine amino
acids, one decides if the amino acid is flexible enough, as seen
during the MD to be considered as likely to interact with B-cell
receptors and responsible for activation of the immune response. 28
amino acids were identified as flexible in the murine MAb1
antibody, excluding the CDRs and its immediate 5 .ANG.
vicinity.
[0796] The motion of the 60 most flexible murine MAb1 amino acids,
during the 20 ns (10.times.2 ns) of molecular dynamic simulation,
were then compared to the motion of the corresponding flexible
amino acids of 49 human 3D homology models, for each of which were
run the same simulations. These 49 human models have been built by
systematically combining a representative panel of 7 human light
chains (namely vk1, vk2, vk3, vk4, vlambda1, vlambda2, vlambda3)
with a representative panel of 7 human heavy chains (namely vh1a,
vh1b, vh2, vh3, vh4, vh5, vh6).
[0797] The vk1-vh1b combination showed the highest 4D similarity of
its flexible amino acids compared to the flexible amino acids of
the murine MAb1 antibody; this model was therefore used to humanize
the MAb1 antibody, focusing on the flexible amino acids. For the
pairwise amino acid association between the murine MAb1 and
vk1-vh1b amino acids, the 2 sequences were aligned based on the
optimal 3D superposition of the alpha carbons of the 2
corresponding homology models.
[0798] In addition, to improve the stability of the resulting
humanized MAb1 antibody, the amino acids of the light and heavy
chains with low frequency of occurrence vs their respective
canonical sequences, excluding the CDRs, are originally proposed to
be mutated into the most frequently found amino acids
(.DELTA..DELTA.Gth>0.5 kcal/mol; (Monsellier et al. J. Mol.
Biol. 2006, 362, 580-593). A first list of consensus mutations for
the LC and for the HC has been restricted to the amino acids found
in the closest human model (i.e vk1-vh1b). None of these mutations
are located in the "Vernier" zone (Foote et al., J. Mol. Biol.
1992, 224, 487-499). Other criteria are taken into account to
consider these consensus mutations for potentially stabilizing the
anti-LAMP1 MAb1 antibody. These criteria are a favourable change of
hydropathy at the surface or a molecular mechanics based predicted
stabilization of the mutant. Stabilizing mutations reported to be
successful in the literature (Bedouelle, H. J. Mol. Biol. 2006,
362, 580-593; Steipe B. J. Mol. Biol. 1994, 240, 188-192) were
considered.
Resulting Humanized VL and VH Regions
[0799] Based on both approached, the CDRs grafting and the 4D
protocols, three versions for the variable light chain (VL1, VL2
and VL3) and three versions for the variable heavy chain (VH1, VH2
and VH3) are proposed. The particular combination of amino acid
residues mutated in each humanized MAb1 VL and VH variants are set
forth in Table 23 and Table 24 respectively. The complete amino
acid sequences of the humanized VH and VL domains are set forth in
Table 25.
For the Variable Light Region:
[0800] The humanized VL1 variant with SEQ ID NO: 56 displays a
total of 12 mutations compared to mouse sequence with SEQ ID NO: 5.
This variant derives from frameworks of human germline
IGKV1-27_IGKJ4 sequences with 6 back mutations done because they
were suspected to have negative impact on mAb structure, CDRs
conformation and therefore, on binding to its target. In addition,
for amino acids at position 43 and 83, mutation in a more frequent
amino acid present in IGKV1 germlines (A43 and F83) was
preferred.
[0801] The humanized VL2 variant with SEQ ID NO: 57 displays 2
mutations which derive from the direct comparison between the
non-CDR most flexible amino acids of the murine MAb1 light chain
and the vk1 human light chain sequence.
[0802] The humanized VL3 variant with SEQ ID NO: 58 derives from
VL2 and includes 6 new mutations that are consensus (vk1 sequence)
and potentially stabilizing.
[0803] The particular combination of amino acid residues mutated in
the individual humanized light chains of huMAb1 thus VL of
huMab1_1, huMab1_2 and huMab1_3 are set forth in Table 23.
TABLE-US-00023 TABLE 23 Mutations of the VL variants of the
anti-LAMP1 MAb1 antibody HuMab1_1 HuMAb1_2 HuMAb1_3 Mouse MAb1 VL
(VL1) (VL2) (VL3) P9 S9 S9 L15 V15 V15 V15 G17 D17 K18 R18 D38 Q38
G43 A43 R45 K45 K45 P56 S56 I58 V58 V58 S72 T72 F73 L73 L73 S74 T74
T74 N77 S77 I83 F83 L103 V103
For the Variable Heavy Region:
[0804] The VH1 variant (SEQ ID NO: 53) displays a total of a total
of 15 residues substitution compared to the mouse sequence (SEQ ID
NO: 1). This variant derives from frameworks of human germline
IGHV1-69_IGHJ4 sequences with 9 back mutations done because they
were expected to have negative impact on mAb structure, CDRs
conformation and therefore, on binding to its target. In addition,
K74 of SEQ ID NO: 1 in vicinity of CDRs was mutated into T to
anticipate a potential problem if targeted by the conjugation
process.
[0805] The VH2 variant displays 7 mutations: 6 mutations deriving
from the direct comparison between the non-CDR most flexible amino
acids of the murine MAb1 heavy chain and the vh1b human heavy chain
sequence, plus mutation of K74 of SEQ ID NO: 1 into T to anticipate
a potential problem if targeted by the conjugation process.
[0806] The VH3 variant derives from VH2 and includes 7 new
mutations that are consensus (vh1b sequence) and potentially
stabilizing.
[0807] The particular combination of amino acid residues mutated in
the individual humanized light chains of huMAb1 thus VH of
huMab1_1, huMab1_2 and huMab1_3 are set forth in Table 24.
TABLE-US-00024 TABLE 24 Mutations of the VH variants of the
anti-LAMP1 MAb1 antibody Mouse MAb1 HuMab1_1 HuMab1_2 HuMab1_3 VH
(VH1) (VH2) (VH3) Q5 V5 V5 V5 L11 V11 V12 K12 A16 S16 M20 V20 K38
R38 K39 Q39 S40 A40 S61 A61 K65 Q65 Q65 Q65 D66 G66 G66 K67 R67 R67
K74 T74 T74 T74 S76 T76 Q82 E82 E82 E82 R85 S85 S85 S85 T87 R87 S91
T91 T91 S115 T115 T115 A118 S118 S118 S118
[0808] The resulting humanized sequences were blasted for sequence
similarity against the Immune Epitope Data Base (IEDB) database
((PLos Biol (2005) 3(3)e91) http://www.immuneepitope.org;) to
ensure that none of the sequences contain any known B- or T-cell
epitope listed in.
[0809] The complete amino acid sequences of the humanized VH and VL
domains are set forth in Table 25.
TABLE-US-00025 TABLE 25 VH and VL amino acid sequences of humanized
anti-LAMP1 antibodies. VH or VL SEQ ID variant Sequence NO.
huMAb1_1 QVQLVQSGAEVKKPGSSVKVSCKASGYIFTN SEQ ID VH1
YNIHWVKKSPGQGLEWIGAIYPGNGDAPYSQ NO: 53
KFQGKATLTADTSTSTTYMELSSLRSEDTAV YYCVRANWDVAFAYWGQGTLVTVSS huMAb1_2
QVQLVQSGAELVKPGASVKMSCKASGYIFTN SEQ ID VH2
YNIHWVKKSPGQGLEWIGAIYPGNGDAPYSQ NO: 54
KFQDRATLTADTSSSTTYMELSSLTSEDSAV YYCVRANWDVAFAYWGQGTLVSVSS huMAb1_3
QVQLVQSGAELVKPGASVKMSCKASGYIFTN SEQ ID VH3
YNIHWVRQAPGQGLEWIGAIYPGNGDAPYAQ NO: 55
KFQGRATLTADTSSSTTYMELSSLTSEDTAV YYCVRANWDVAFAYWGQGTLVTVSS huMAb1_1
DIQMTQSPSSLSASVGDRVTITCKASQDIDR SEQ ID VL1
YMAWYQDKPGKAPRLLIHDTSTLQSGVPSRF NO: 56
SGSGSGRDYTLTISNLEPEDFATYYCLQYDN LWTFGGGTKVEIK huMAb1_2
DIQMTQSPPSLSASVGGKVTITCKASQDIDR SEQ ID VL2
YMAWYQDKPGKGPKLLIHDTSTLQPGIPSRF NO: 57
SGSGSGRDYSFSISNLEPEDIATYYCLQYDN LWTFGGGTKLEIK huMAb1_3
DIQMTQSPSSLSASVGGKVTITCKASQDIDR SEQ ID VL3
YMAWYQQKPGKGPKLLIHDTSTLQPGVPSRF NO: 58
SGSGSGRDYSLTISSLEPEDIATYYCLQYDN LWTFGGGTKLEIK
Example 7.2.2: Production and Characterization of Three Humanized
Anti-LAMP1 huMAb1 Variants
[0810] The corresponding nucleic acid sequences encoding the
humanized variable VH and VL domains described in example 7.2.1
were synthesized at Geneart and cloned into expression vectors in
fusion with the human IgG1 or the human Ckappa constant domain
coding sequences, respectively, to then generate batches of
humanized mAbs by transient expression in 293-F cells as described
in Example 6.2. The three mAbs were referred to--huMAb1_1 that
contains LC1 (VL1-huCk) (SEQ ID NO: 59) and HC1 (VH1-hulgG1) (SEQ
ID NO: 60), [0811] huMAb1_2 that contains LC2 (VL2-huCk) (SEQ ID
NO: 61) and HC2 (VH2-hulgG1) (SEQ ID NO: 62), [0812] huMAb1_3 that
contains LC3 (VL3-huCk) (SEQ ID NO: 63) and HC3 (VH3-hulgG1) (SEQ
ID NO: 64).
[0813] A negative control was generated and referred to as
huMAb1_negA. It contains LCnegA (VL1_36 A-95A-huCk) (SEQ ID NO: 65)
and HCnegA (VH1_101 A-hulgG1) (SEQ ID NO: 67).
[0814] Another control was generated and referred to as
huMAb1_negB. It contains LC1 (VL1-huCk) (SEQ ID NO: 59) and HCnegB
(VH1-hulgG1_266 A) (SEQ ID NO: 68). The mutation 266A in the hulgG1
corresponds to the D265A mutation according to the nomenclature
described by Kabat et al., Sequences of Proteins of Immunological
Interest, 5th edition, National Institute of Health, Bethesda, Md.,
1991. It was reported to significantly decrease binding to
Fc.gamma.Rs and ADCC (Lund et al., J. Immunol., 157:4963-4969,
1996; Shields et al., J. Biol. Chem., 276(1): 6591-6604, 2001).
[0815] Significant decrease in binding to Fc.gamma.RI, II and III
was also verified by ELISA with recombinant proteins (recombinant
human Fc.gamma.RI/CD64 reference 1257-FC-050, recombinant human
Fc.gamma.RIIA/CD32a reference 1330-CD-050/CF, recombinant human
Fc.gamma.RIIIa/CD16a, reference 4325-FC-050, all obtained from
R&D System).
[0816] Batches were purified by protein A affinity chromatography
(MabSelect, GE Heathcare). The eluate was dialyzed against PBS
before sterile filtration and storage at 4.degree. C. Batches were
analysed by High Resolution Mass Spectrometry as described in
Example 7. Data were in agreement with the in silico value
retrieved from amino acid sequences, Table 26.
TABLE-US-00026 TABLE 26 Mass spectrometry analysis of humanized
anti-LAMP1 mAbs Mass (Da) by LC/MS in silico value mAb ID Chain
from batch retrieved from sequence huMAb1_1 LC1 23483 Da 23484 Da
HC1 (G0F) 50219 Da 50219 Da huMab1_2 LC2 23375 Da 23376 Da HC2
(G0F) 50209 Da 50209 Da huMAb1_3 LC3 23318 Da 23318 Da HC3 (G0F)
50176 Da 50175 Da huMAb1_negA LCnegA 23277 Da 23277 Da HCnegA 50103
Da 50104 Da (G0F) huMAb1_negB LC1 23484 Da 23484 Da HCnegB 50175 Da
50175 Da (G0F)
[0817] Secreted human LAMP1 protein described in example 6.2 was
used to determine the binding domain to the humanized anti-LAMP1
mAbs by ELISA. Affinity to LAMP1 remained similar for chimer and
humanized mAbs as illustrated by the EC.sub.50 obtained by ELISA
with LAMP1 in Table 27. No binding is detected with
huMAb1_negA.
TABLE-US-00027 TABLE 27 EC.sub.50 (nM) obtained with LAMP1 for
chimer and humanized mAbs mAb ID hLAMP1 chMAb1 0.09 nM huMAb1_1
0.11 nM huMAb1_2 0.11 nM huMAb1_3 0.12 nM huMAb1_negA No binding
detected huMAb1_negB 0.07 nM
Example 7.2.3: Cross Reactivity of huMAb1_1; huMAb1_2 and huMAb1_3
with Cynomolgus Monkey LAMP1
[0818] HuMAb1_1, huMAb1_2 and huMAb1_3 antibodies were assessed by
flow cytometry for their ability to bind to human LAMP1 or
cynomolgus LAMP1 proteins expressed respectively at the surface of
HCT116 or HEK293 stable clones. HCT116 stable clone was obtained as
described in example 4.7. HEK293 stable clone was obtained
according to the protocol described in example 4.7. EC.sub.50s,
estimated using BIOST@T-SPEED software, are listed in Table 28.
TABLE-US-00028 TABLE 28 Apparent affinity of huMAb1_1; huMAb1_2 and
huMAb1_3 to human LAMP1 or cynomolgus monkey LAMP1 EC.sub.50 (nM)
HCT116 HEK293 huLAMP1 cynoLAMP1 Ratio clone 8 clone 44 of
EC.sub.50s huMAb1_1 15.0 30.1 2.0 huMAb1_2 6.6 13.3 2.0 huMAb1_3
10.3 17.7 1.7
[0819] The result show, that huMAb1_1 binds to LAMP1 of human and
cynomolgus origin with similar affinity with a ratio of EC.sub.50s
of 2. HuMAb1_1 cross-reacts with cynomolgus LAMP1. HuMAb1_2 binds
to LAMP1 of human and cynomolgus origin with similar affinity with
a ratio of EC.sub.50s of 2.01. HuMAb1_2 cross-reacts with
cynomolgus LAMP1. HuMAb1_3 binds to LAMP1 of human and cynomolgus
origin with similar affinity with a ratio of EC.sub.50s of 1.71.
HuMAb1_3 cross-reacts with cynomolgus LAMP1.
Example 7.3: Identification of the Epitope Binding Site of huMAb1_1
by Crystallography
Example 73.1: Obtention of Fab1/LAMP1 Complex
[0820] Expression and Purification of Fab from huMAb1_1
[0821] Recombinant Fab from huMAb1_1 (Fab1) was obtained from
transiently transfected HEK293 cells, using two plasmids encoding
the light chain LC1 or the C-terminal His-tagged heavy chain
derived from HC1 with SEQ ID NO: 68 and 69, respectively. After
cell clarification, growth supernatant was applied on an
immobilized-metal affinity resin (IMAC). After elution from the
resin, the fractions containing highly pure Fab1 were pooled &
extensively dialysed against PBS. Fab1 solution was stored at
4.degree. C.
Expression and Purification of Human Non-Glycosylated
LAMP1-29-195
[0822] In order to obtain a non-glycosylated LAMP1 domain,
bacterial expression system was used. A thioredoxin fusion protein
was designed for expressing the domain L1-L2 of human LAMP1 protein
with SEQ ID NO: 70(TrxA-His-Thr-LAMP1-29-195 where Thr means
thrombin cleavage site). The fusion protein was expressed using a
T7 promoter, in a trxB-gor deficient E. coli strain. High cell
density culture of the recombinant strain was performed in a
proprietary chemically defined medium, in bioreactor. From cell
paste, the fusion protein was extracted by French press lysis, the
cell lysate was clarified by ultracentrifugation and the clarified
supernatant was applied on an IMAC column. After elution from the
resin, the fractions containing the recombinant protein were pooled
and the thrombin protease (Sigma-Aldrich) was used for cleaving off
the TrxA-His, one hour at room temperature. The solution was then
applied on a Benzamidine Sepharose column (GE Healthcare) and on an
IMAC column, for removing the thrombin and the free TrxA-His fusion
partner, respectively. Purified untagged LAMP1-29-195 domain was
stored at 4.degree. C. till complex preparation. The sequence of
untagged LAMP1-29-195 domain is referenced under SEQ ID NO: 71.
Preparation and Purification of the Complexes
[0823] Recombinant Fab (Fab1) and antigen (untagged LAMP1-29-195
domain) were mixed at a 1.5:1 molar ratio, incubated 30 min at room
temperature & the complexes were further purified by
preparative size exclusion on a Superdex 200 PG column (GE
Healthcare), equilibrated with PBS. The fractions containing highly
pure complex were pooled & stored at 4.degree. C. till
crystallography assays.
Example 73.2: Structure Determination of Fab1/LAMP1
Crystallization and Data Collection
[0824] The complex was concentrated to 12 mg/mL in PBS10 mM pH7.
Crystallization was done using the sitting drop method. It
crystallized in 20% PEG3350, 200 mM NaF (cond1) and 20% PEG3350,
200 mM DL-Malic acid pH7 (cond2). 25% ethylene glycol was included
as cryoprotectant prior freezing.
Datasets were collected from both crystals at beamline ID29 ESRF.
Crystals diffracted in the same spacegroup C2 at 2.37 .ANG. (cond1)
or 2.51 .ANG. (cond2).
Structure Solution
[0825] A model of the constant domain of the Fab1 was obtained
using the PDB structure referenced under 4JG0. A model of the
variable domain was constructed in Maestro (Schroedinger).
[0826] Molecular replacement was carried out using Phaser (Coy et
al, J. Appl. Cryst. (2007) 40, 658-674) of the CCP4 suite (Winn et
al, Acta Cryst D67 (2011), 235-242) in both datasets but was
successful only in cond2: an initial refinement run confirmed the
presence of two Fabs in the asymmetric unit. Additional density was
visible above the variable domains but too partial to place the
antigen.
[0827] A second molecular replacement was carried out in cond1,
using the results from the previous run in cond2. This time, clear
density could be visible above one of the variable domain, allowing
the manual construction of a Lamp1 molecule. The second Lamp1
molecule was then constructed using the non-crystallographic
symmetry between the two complexes.
[0828] The structure was refined using Buster (Buster-TNT 2.11.5,
Global Phasing Ltd) at 2.37 .ANG. to a Rfree of 26.1% and Rfactor
22.6%
Results
[0829] There are two Fab1/LAMP1 complexes in the asymmetric unit,
with significantly different overall temperature factors.
Interactions between the two proteins are identical in both
complexes; in consequence, the most stable complex was taken as
reference for analysis.
[0830] The first luminal domain of LAMP1 corresponding to amino
acids Ala29 to Arg195 of SEQ ID NO: 24 interacts mostly with the
heavy chain of Fab1. In FIG. 13 are indicated the residues of Fab1
which are part of the paratope (ie residues with atoms within 4A of
the antigen atoms). The amino acids that are part of the paratope
are localized in the light chain, more exactly in the CDR1-L with
Asp30, Arg31 and Tyr32 of SEQ ID NO: 68 and CDR2-L with Asp50 of
SEQ ID NO: 68. They are further localized in the heavy chain, more
precisely in CDR1-H (Ile28, Asn31, Tyr32, Asn33), CDR2-H (Tyr52,
Asn55, Asp57, Pro59), in FR3 loop (Thr74, Ser75, Ser77) and CDR3-H
(Asn100, Trp101, Asp102, Phe105) SEQ ID NO: 69.
[0831] The epitope of LAMP1 for Fab1, determined as residues with
atoms within 4A of the Fab1 atoms, is indicated in bold in the
sequence below and displayed in FIG. 14:
TABLE-US-00029 (SEQ ID NO 80)
GSHMAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDAT
VVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTV
TLHDATIQAYLSNSSFSRGETRCEQDR
[0832] Said epitope identified by crystallography consist of the
amino adis Asn35, Cys80, Gly 81, Glu83, Asn84, Arg106, Asn107,
Ala108, Ile149, Asp150, Lys151, Tyr 178, Ser180, Asn181, Arg186 and
Gly187 of SEQ ID NO:24.
[0833] As visible in the alignment displayed in FIG. 1, there is
only one residue difference in the epitope region between Macacus
fascicularis and Homo sapiens: at Position 187 of SEQ ID NO: 24
with Gly187Glu. A model of this mutation was built and minimized:
the results show that binding to Fab1 remains possible provided
side-chain movement of light chain Tyr32 and slight movement of
LAMP1 Lys151 as indicated in FIG. 15.
[0834] Based on the crystallographic structure that was herein
obtained, it is possible to suggest regions for affinity
maturation. Two hot spots may be the amino acid Ile28 in the heavy
chain sequence of SEQ ID NO: 53 and the amino acid Asn55 in the
heavy chain sequence of SEQ ID NO: 53. Replacing the hydrophobic
residue Ile 28 by a Glutamine might lead to interaction with nearby
Gly81 and Asn35 of LAMP1 (SEQ ID: 24) and should improve binding
between the two proteins as shown in FIG. 16. Mutating Asn55 to an
Arginine would add interactions to Asn87, Arg106 and Thr107 of
LAMP1 (SEQ ID: 24) as shown in FIG. 17.
Example 8: Production and Characterization of ADC
Example 8.1: Production and Characterization of ADC with a
Maytansinoid
DAR Calculation:
[0835] A conjugate comprises generally from 1 to 10 molecule(s) of
the maytansinoid attached covalently to the antibody (so called,
"drug-to-antibody ratio" or "DAR"). This number can vary with the
nature of the antibody and of the maytansinoid used along with the
experimental conditions used for the conjugation (like the ratio
maytansinoid/antibody, the reaction time, the nature of the solvent
and of the cosolvent if any). Thus the contact between the antibody
and the maytansinoid leads to a mixture comprising: several
conjugates differing from one another by different drug-to-antibody
ratios; optionally the naked antibody; optionally aggregates. The
DAR that is determined is thus a mean value.
[0836] The method used herein to determine the DAR consists in
measuring spectrophotometrically the ratio of the absorbance at 252
nm and 280 nm of a solution of the substantially purified
conjugate. In particular, said DAR can be determined
spectrophotometrically using the measured extinction coefficients
at respectively 280 and 252 nm for the antibody (.epsilon..sub.A280
and .epsilon..sub.A252) and for the maytansinoid
(.epsilon..sub.D280=5,180 M.sup.-1cm.sup.-1 and
.epsilon..sub.D252=26,159 M.sup.-1cm.sup.-1). The method of
calculation is derived from Antony S. Dimitrov (ed), LLC, 2009,
Therapeutic Antibodies and Protocols, vol 525, 445, Springer
Science and is described in more details below:
[0837] The absorbances for the conjugate at 252 nm (A252) and at
280 nm (A280) are measured on a spectrophotometer apparatus to
calculate the DAR. The absorbances can be expressed as follows:
A.sub.252=(C.sub.D.times..epsilon..sub.D252)+(C.sub.A.times..epsilon..su-
b.A252)
A.sub.280=(C.sub.D.times..epsilon..sub.D280)+(C.sub.A.times..epsilon..su-
b.A280)
wherein: [0838] C.sub.D and C.sub.A are respectively the
concentrations in the solution of the maytansinoid and of the
antibody [0839] .epsilon..sub.D252 and .epsilon..sub.D280 are
respectively the molar extinction coefficients of the maytansinoid
at 252 nm and 280 nm [0840] .epsilon..sub.A252 and
.epsilon..sub.A280 are respectively the molar extinction
coefficients of the antibody at 252 nm and 280 nm.
[0841] Resolution of these two equations with two unknowns leads to
the following equations:
C.sub.D=[(.epsilon..sub.A280.times.A.sub.252)-(.epsilon..sub.A252.times.-
A.sub.280)]/[(.epsilon..sub.D252.times..epsilon..sub.A280)-(.epsilon..sub.-
A252.times..epsilon..sub.D280)]
C.sub.A=[A.sub.280-(C.sub.D.times..epsilon..sub.D280)]/.epsilon..sub.A28-
0
[0842] The average DAR is then calculated from the ratio of the
drug concentration to that of the antibody:
DAR=C.sub.D/C.sub.A
Deglycosylation and High Resolution Mass Spectrometry of Conjugates
(HRMS)
[0843] Deglycosylation is a technique of enzymatic digestion by
means of glycosidase. The deglycosylation is made from 50 .mu.l of
conjugated+10 .mu.l of N-glycosidase-F (PN Gase F) enzyme (100
units of freeze-dried enzyme/100 .mu.l of water). The medium is
vortexed and maintained one night at 37.degree. C. The
deglycosylated sample is then ready to be analyzed in HRMS. Mass
spectra were obtained on a Waters XEVO QT of system in electrospray
positive mode (ES+). Chromatographic conditions are the following:
column: UPLC BEH300 C4 1.7 .mu.m 2.1.times.150 mm; solvents: A:
H.sub.2O+0.1% formic acid: B; CH.sub.3CN+0.1% formic acid; column
temperature: 70.degree. C.; flow rate 0.5 mL/min; gradient elution
(10 min): 20% B for 2 min 50 sec; from 20 to 80% of B in 2 min 5
sec; 8 min 50 sec: 80% B; 8 min 55 sec: 20% B; 10 min: 20% B.
Buffers Content
[0844] Buffer A (pH 6.5): NaCl (50 mM), Potassium Phosphate buffer
(50 mM), EDTA (2 mM) [0845] Buffer HGS (pH 5.5): histidine (10 mM),
glycine (130 mM), sucrose 5% (w/v), HCl (8 mM) [0846] PBS (pH 7.4):
KH.sub.2PO.sub.4 (1.03 mM), NaCl (155.17 mM),
Na.sub.2HPO.sub.4-7H.sub.2O (2.97 mM)
Abbreviations Used
[0846] [0847] DAR: Drug Antibody Ratio; DMA: dimethylacetamide;
HEPES: 4-(2-hydroxyethyl)-1-piperazine-ethanesulfonic acid; HRMS:
High Resolution Mass Spectroscopy; Nitro-SPDB: butanoic acid,
4-[(5-nitro-2-pyridinyl)dithio]-, 2,5-dioxo-1-pyrrolidinyl ester
(could be prepared as described in WO2004016801 patent); RT: room
temperature.
Example 8.1.1: Antibody Drug Conjugate (ADC) (Chimer chMAb 1)
[0848] The naked chimer of MAb1 was prepared. It is a chimeric mAb
(chMAb1) derived from the murine clone MAb1 with a human IgG1, Ck
isotype having a heavy chain of sequence SEQ ID NO: 17 and a light
chain of sequence SEQ ID NO: 18.
[0849] In this example, a cleavable conjugate (indifferently called
DM4-SPDB-chMAb1 or chMAb1-SPDB-DM4) was obtained from the naked
chMAb1, as described in example 7, and from DM4 with LC and HC
sequences of the chimeric mAb corresponding to SEQ ID NO: 17 and
18.
[0850] DM4 has the following chemical name
N.sup.2'-deacetyl-N.sup.2'-(4-mercapto-4-methyl-1-oxopentyl)
maytansine.
[0851] For chMAb1, .epsilon..sub.A280=223,400 M.sup.-1cm.sup.-1 and
.epsilon..sub.A252=80,240 M.sup.-1cm.sup.-1
Preparation and Analytical Data of the Cleavable Chimer
chMAb1-SPDB-DM4 Conjugate
[0852] To 12.1 mL of a solution of chMAb1 antibody at a
concentration of 8.23 mg/mL in buffer A is added under magnetic
stirring 465 .mu.L of HEPES 1N, 1 mL DMA and a 5.9-fold molar
excess of a 15 mM solution of nitro-SPDB in DMA. After 1 h30 at RT,
the reaction mixture is diluted with 17.3 mL of PBS buffer and 1.64
mL DMA, prior to addition of a 15 mM solution of DM4 in DMA.
[0853] The reaction mixture is stirred at RT for 2 h40 and then
purified by TFF on Sius-LSn Prostream 30 kD cassette. The sample is
diafiltrated against 600 mL of HGS buffer, concentrated, collected
and filtered over Millex.RTM. 0.22 .mu.M PVDF filter to yield
product (11 mL).
[0854] The final conjugate is assayed spectrophotometrically; an
average DAR of 4.5 DM4 per molecule of antibody (5.7 mg/mL) was
determined. HRMS data: see FIG. 7.
Example 8.1.2: Antibody Drug Conjugate (Humanized huMAb1_3)
[0855] The naked humanized huMAb1_3 was prepared as described in
example 7.2.2. It is a humanized mAb derived from the murine clone
MAb1 with a human IgG1 and Ck isotype, Ck isotype having a heavy
chain (VH3-hulgG1) sequence of SEQ ID NO: 64 and a light chain
(VL3-huCk) sequence SEQ ID NO: 63. [0856] Extinction coefficients
mentioned herein were measured at respectively 280 and 252 nm for
the antibody .epsilon..sub.A280=223,400 M.sup.-1cm.sup.-1 and
.epsilon..sub.A252=79,413
Preparation of DM4-SPDB-huMAb1_3 Conjugate
[0857] To 3.6 mL of a solution of huMAb1_3 antibody at a
concentration of 5.18 mg/mL in DPBS is added under magnetic
stirring, 0.316 mL DMA and a 5.2-fold molar excess of a 15 mM
solution of nitro-SPDB in DMA. After 2 h15 at RT 0.3 equivalent of
a 15 mM solution of nitro-SPDB in DMA is added. After 1 h45 the
reaction mixture is diluted with 1.99 mL of PBS buffer and 0.187 mL
DMA, prior to addition of a 15 mM solution of DM4 in DMA.
[0858] The reaction mixture is stirred at RT for 2 h and then
purified by gel filtration (HiPrep 26/10 desalting, Sephadex G25,
GE Healthcare) previously equilibrated with buffer HGS pH=5.5. The
collected sample is filtered over Millex.RTM. 0.22 .mu.M PVDF
filter to yield product (9.4 mL). This solution is injected on a
Chromasorb.RTM. Millipore 0.08 mL device (CHRFA1PD09), The
collected sample is concentrated over Amicon Ultra-15 10KD,
Millipore and filtered over Millex.RTM. 0.22 .mu.M PVDF filter to
yield product (4.3 mL). The final conjugate is assayed
spectrophotometrically; an average DAR of 3.5 DM4 per molecule of
antibody (1.9 mg/mL) was determined. HRMS data: see FIG. 18.
Example 8.1.3: Antibody Drug Conjugate (humanized huMAb1_1)
[0859] The naked humanized huMAb1_1 was prepared as described in
example 7.2.2. It is a humanized mAb derived from the murine clone
MAb1 with a human IgG1 and Ck isotype, Ck isotype having a heavy
chain (VH1-hulgG1) sequence of SEQ ID NO: 60 and a light chain
sequence (VL1-huCk) of SEQ ID NO: 59 Extinction coefficients are
measured at respectively 280 and 252 nm for the antibody
.epsilon..sub.A280=223,400 M.sup.-1cm.sup.-1 and
.epsilon..sub.A252=80,041 M.sup.-1 cm.sup.-1
Preparation of DM4-SPDB-huMAb1_1 Conjugate
[0860] To 3.6 mL of a solution of huMAb1_1 antibody at a
concentration of 4.81 mg/mL in DPBS is added under magnetic
stirring, 0.321 mL DMA and a 5.0-fold molar excess of a 15 mM
solution of nitro-SPDB in DMA. After 2 h at RT 0.3 equivalent of a
15 mM solution of nitro-SPDB in DMA is added. After 1 h30 the
reaction mixture is diluted with 1.59 mL of PBS buffer and 0.147 mL
DMA, prior to addition of a 15 mM solution of DM4 in DMA.
[0861] The reaction mixture is stirred at RT for 1 h30 and then
purified by gel filtration (HiPrep 26/10 desalting, Sephadex G25,
GE Healthcare) previously equilibrated with buffer HGS pH=5.5. The
collected sample is filtered over Millex.RTM. 0.22 .mu.M PVDF
filter to yield 9.4 mL of solution. This solution is injected on a
Chromasorb.RTM. Millipore 0.08 mL device (CHRFA1PD09), The
collected sample is concentrated over Amicon Ultra-15 10KD,
Millipore and filtered over Millex.RTM. 0.22 .mu.M PVDF filter to
yield product (4.9 mL). The final conjugate is assayed
spectrophotometrically; an average DAR of 3.4 DM4 per molecule of
antibody (1.45 mg/mL) was determined. HRMS data: see FIG. 19.
Example 8.1.4: Antibody Drug Conjugate (Humanized huMAb1_2)
[0862] The naked humanized huMAb1_2 was prepared as described in
example B7. It is a humanized mAb derived from the murine clone
MAb1 with a human IgG1 and Ck isotype, Ck isotype having a heavy
chain sequence (VH2-hulgG1) of SEQ ID NO: 62 and a light chain
sequence (VL2-huCk) SEQ ID NO: 61.
[0863] Extinction coefficients are measured at respectively 280 and
252 nm for the antibody .epsilon..sub.A250=223,400
M.sup.-1cm.sup.-1 and .epsilon..sub.A252=79,474
Preparation of DM4-SPDB-huMAb1_2 Conjugate
[0864] To 3.6 mL of a solution of huMAb1_2 antibody at a
concentration of 5.06 mg/mL in b DPBS is added under magnetic
stirring, 0.317 mL DMA and a 5.2-fold molar excess of a 15 mM
solution of nitro-SPDB in DMA. After 2 h the reaction mixture is
diluted with 1.89 mL of PBS buffer and 0.179 mL DMA, prior to
addition of a 15 mM solution of DM4 in DMA.
[0865] The reaction mixture is stirred at RT for 1 h30 and then
purified by gel filtration (HiPrep 26/10 desalting, Sephadex G25,
GE Healthcare) previously equilibrated with buffer HGS pH=5.5. The
collected sample is filtered over Millex.RTM. 0.22 .mu.M PVDF
filter to yield product (9.7 mL).
[0866] The final conjugate is assayed spectrophotometrically; an
average DAR of 4.05 DM4 per molecule of antibody (1.36 mg/mL) was
determined. HRMS data: see FIG. 20.
Example 8.1.5: Antibody Drug Conjugate (Chimer chMAb2can)
[0867] The naked chimer chMAb2can was prepared as described in
example 7. It is a chimer mAb derived from the murine clone MAb2
with a human IgG1 and Ck isotype. Ck isotype having a heavy chain
sequence of SEQ ID NO: 21 and a light chain of sequence SEQ ID NO:
22.
[0868] Extinction coefficients at respectively 280 and 252 nm for
the antibody .epsilon..sub.A280=223,400 M.sup.-1cm.sup.-1 and
.epsilon..sub.A252=74,417 M.sup.-1cm.sup.-1
Preparation of DM4-SPDB-chMAb2can Conjugate
[0869] To 9.2 mL of a solution of chMAb2can antibody at a
concentration of 5.21 mg/mL in DPBS is added under magnetic
stirring, 0.813 mL DMA and a 5.0-fold molar excess of a 15 mM
solution of nitro-SPDB in DMA. After 2 h at RT 0.2 equivalent of a
15 mM solution of nitro-SPDB in DMA is added. After 1 h30 the
reaction mixture is diluted with 5.17 mL of PBS buffer and 0.497 mL
DMA, prior to addition of a 15 mM solution of DM4 in DMA.
[0870] The reaction mixture is stirred at RT for 1 h30 and then
purified by gel filtration (HiPrep 26/10 desalting, Sephadex G25,
GE Healthcare) previously equilibrated with buffer HGS pH=5.5. The
collected sample is filtered over Millex.RTM. 0.22 .mu.M PVDF
filter to yield product (23 mL).
[0871] The final conjugate is assayed spectrophotometrically; an
average DAR of 3.7 DM4 per molecule of antibody (1.58 mg/mL) was
determined. HRMS data: see FIG. 21.
Example 8.1.6: Antibody Drug Conjugate (chimer chMAb3
VLR24-R93)
[0872] The naked chimer chMAb3_VLR24-R93 was prepared as described
in example 7. It is a chimer mAb derived from the murine clone MAb3
with a human IgG1 and Ck isotype, Ck isotype having a heavy chain
sequence of SEQ ID NO: 49 and a light chain of sequence SEQ ID NO:
81.
[0873] Extinction coefficients are measured at respectively 280 and
252 nm for the antibody .epsilon..sub.A280=234539 M.sup.-1cm.sup.-1
and .epsilon..sub.A252=85303 M.sup.-1cm.sup.-1.
Preparation of DM4-SPDB-chMAb3 VLR24-R93 conjugate
[0874] To 7.3 mL of a solution of chMAb3_VLR24-R93 antibody at a
concentration of 6.85 mg/mL in DPBS were added under magnetic
stirring, 7.7 mL of PBS, 1.5 mL DMA and a 5.0-fold molar excess of
a 10 mM solution of nitro-SPDB in DMA. After 3 h30, 155 .mu.L of a
solution of L-DM4 (15.1 mM in DMA) were added to the reaction
mixture. The reaction mixture was stirred at RT for 1 h30 and then
purified by gel filtration (HiPrep 26/10 desalting, Sephadex G25,
GE Healthcare) previously equilibrated with buffer HGS pH=5.5. The
collected sample was filtered over Millex.RTM. 0.22 .mu.M PVDF
filter to yield product (23 mL). The final conjugate was assayed
spectrophotometrically; an average DAR of 3.7 DM4 per molecule of
antibody (2.0 mg/mL) was determined. HRMS data: see FIG. 22.
Example 8.1.7: Cross Reactivity of DM4-SPDB-chMAb1,
DM4-SPDB-chMAb2, and DM4-SPDB-chMAb3, to Human LAMP1/Cyno LAMP1
[0875] DM4-SPDB-chMAb1, DM4-SPDB-chMAb2 and DM4-SPDB-chMAb3 were
assessed by flow cytometry for their ability to bind to human LAMP1
or cynomolgus LAMP1 proteins expressed respectively at the surface
of HCT116 or HEK293 stable clones. HCT116 stable clone and HEK293
stable clone were obtained as described in the protocol in example
4.7 EC.sub.50s, estimated using BIOST@T-SPEED software, are listed
in Table 29.
TABLE-US-00030 TABLE 29 Apparent affinity of DM4-SPDB-chMAb1,
DM4-SPDB-chMAb2, DM4-SPDB-chMAb3 to human LAMP1 or cynomolgus
monkey LAMP1 EC.sub.50 (nM) HCT116 HEK293 huLAMP1 cynoLAMP1 Ratio
clone 8 clone 44 of EC.sub.50s DM4-SPDB-chMAb1 6.6 6.6 1.0
DM4-SPDB-chMAb2 5.5 12.8 2.3 DM4-SPDB-chMAb3 9.1 6.1 0.7
[0876] DM4-SPDB-chMAb1 binds to LAMP1 of human and cynomolgus
origin with similar affinity. EC.sub.50s ratio was 1 and therefore
DM4-SPDB-chMAb1 cross-reacted with cynomolgus LAMP1.
DM4-SPDB-chMAb2 binds to LAMP1 of human and cynomolgus origin with
similar affinity. EC.sub.50s ratio was 2.3 and therefore
DM4-SPDB-chMAb2 cross-reacted with cynomolgus LAMP1.
DM4-SPDB-chMAb3 binds to LAMP1 of human and cynomolgus origin with
similar affinity. EC.sub.50s ratio was 0.7 and therefore
DM4-SPDB-chMAb2 cross-reacted with cynomolgus LAMP1.
Example 8.1.8: Cross Reactivity of DM4-SPDB-huMAb1_1 to Human
LAMP1/Cyno LAMP1
[0877] DM4-SPDB-huMAb1_1 was assessed by flow cytometry for its
ability to bind to human LAMP1 or cynomolgus LAMP1 proteins
expressed respectively at the surface of HCT116 or HEK293 stable
clones, both obtained as described in the protocol of example 4.7.
EC.sub.50s, estimated using BIOST@T-SPEED software, are listed in
Table 30.
TABLE-US-00031 TABLE 30 Apparent affinity of DM4-SPDB-huMAb1_1 to
human LAMP1 or cynomolgus monkey LAMP1 EC.sub.50 (nM) HCT116 HEK293
huLAMP1 cynoLAMP1 Ratio clone 8 clone 44 of EC.sub.50s
DM4-SPDBhuMAb1_1 12.65 33.50 2.65
[0878] DM4-SPDB-huMAb1_1 binds to LAMP1 of human and cynomolgus
origin with similar affinity with a ratio of EC.sub.50s of 2.65.
Therefore, DM4-SPDBhuMAb1_1 cross-reacts with cynomolgus LAMP1.
Example 8.2: Production and Characterization of ADC with a
Tomaymycine Dimer
DAR Calculation:
[0879] DAR calculation is determined similarly than for
maytansinoid ADC, using the measured extinction coefficients at
respectively 280 and 322 nm for the antibody
(.epsilon..sub.A280=223,400 M.sup.-1cm.sup.-1 and
.epsilon..sub.A322.sup.=0 M.sup.-1cm.sup.-1) and for the
tomaymycine dimer (.epsilon..sub.D280=4,436 M.sup.-1cm.sup.-1 and
.epsilon..sub.D322=7,843 M.sup.-1cm.sup.-1).
[0880] Preparation of a huMAb1_1 conjugate modified with SNPP
(N-succinimidyl 4-(5-nitro-2-pyridyldithio)pentanoate) with
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy)ethoxy)pyridine-2,6-diyl)
bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2, 3-dihydro-1
Hbenzo[e]pyrrolo[1,2-a][1, 4] diazepin-5(11aH)-one)
[0881] To 56 mg of huMAb1_1 in 2.8 ml of buffer A are added 0.48 mg
of SNPP (N-succinimidyl 4-(5-nitro-2-pyridyldithio)pentanoate)
dissolved in 67 .mu.L of DMA under stirring. After 3 hours at room
temperature, the solution of modified antibody is fractionated into
two and purified by gel filtration on two Sephadex G25 columns
(PD-10 GE column) pre-equilibrated in an aqueous buffer with a
concentration of 0.05 M
N-(2-hydroxyethyl)-piperazine-N'-2-ethanesulfonic acid (HEPES),
0.05 M NaCl and 2 mM ethylenediaminetetraacetic acid (EDTA) of
pH=8. After mixing and homogenizing the two filtrates thus
obtained, the modified antibody is assayed by spectrophotometry
using the extinction coefficients of nitropyridinethiol
(.epsilon..sub.280 nm=3344 M.sup.-1 cm.sup.-1 and .epsilon..sub.325
nm=10964 M.sup.-1cm.sup.-1): an average of 3.32
dithio-nitropyridine groups per antibody molecule was determined at
a concentration of 6.28 mg/mL.
[0882] To 9.4 mg of modified antibody above in 1.5 ml of an aqueous
buffer with a concentration of 0.05 M
N-(2-hydroxyethyl)-piperazine-N'-2-ethanesulfonic acid (HEPES),
0.05 M NaCl and 2 mM ethylenediaminetetraacetic acid (EDTA) of pH=8
are added 0.56 mL of DMA and 1.12 mg of
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy) ethoxy)pyridine-2,
6-diyl)bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hb-
enzo[e] pyrrolo[1,2-a][1,4]diazepin-5(11aH)-one) dissolved in 0.06
mL of dimethylacetamide (DMA) under stirring. After 17 at
30.degree. C., 0.01N HCl is added until pH=6.6 and the resulting
mixture is purified on a CHT 80 (type II) column (20 mm.times.8 mm
I.D.) initially equilibrated with 2 mL of a 200 mM potassium
phosphate buffer of pH 6.5 followed by 4 mL of a 10 mM potassium
phosphate buffer of pH 6.5. After injection and washing with 5 mL
of the last 10 mM phosphate buffer, elution is realized with 6 mL
of the previous 200 mM phosphate buffer. 2.5 mL of the resulting
batch is then filtered on a Sephadex G25 column (PD-10 GE column)
pre-equilibrated in an aqueous buffer of pH=6.5 with a
concentration of 10 mM histidine, containing 10% sucrose.
[0883] The chemical structure for
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)
(methyl)amino)ethoxy)ethoxy)ethoxy)pyridine-2,
6-diyl)bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hb-
enzo[e]pyrrolo[1,2-a][1,4] diazepin-5(11aH)-one) is as follows:
##STR00007##
[0884] The conjugate obtained (3.5 mL) is assayed by
spectrophotometry: an average of 2.85
(2E,2'E,11aS,11a'S)-8,8'-(((4-(2-(2-(2-((2-mercapto-2-methylpropyl)(methy-
l)amino)ethoxy)ethoxy) ethoxy)pyridine-2,
6-diyl)bis(methylene))bis(oxy))bis(2-ethylidene-7-methoxy-2,3-dihydro-1Hb-
enzo[e] pyrrolo[1,2-a][1,4]diazepin-5(11aH)-one) per antibody
molecule was determined at a concentration of 1.84 mg/mL. HRMS
data: see FIG. 37.
Example 9: In Vitro Cytotoxicity
Example 9.1: In Vitro Cytotoxicity of DM4-SPDB-chMAb1
[0885] HCT116 cells were infected by a lentiviral vector allowing
stable integration of the LAMP1 CDS in genomic DNA of cells, as
reported in example 4.7 Individual clones with different densities
of LAMP1 cell surface localization were derived from pool of HCT116
infected cells. HCT116 clone 8 was used to compare EC50 of chMAb1
and DM4-SPDB-chMAb1. Cells were plated in 96-well plates at 200 000
per well and MAb1 or DM4-SPDB-chMAb1 was added in 2-fold serial
dilution up to 12 dilutions in assay diluant for 1 h at 4.degree.
C. and washed two times with PBS 1% BSA. 100 .mu.L/well of goat
anti-human IgG conjugated with Alexa488 (Invitrogen; # A11013) was
added for 1 h at 4.degree. C. and washed two times with PBS 1% BSA.
The antibody binding was evaluated after centrifugation and
resuspension of cells in 100 ul fixing solution (paraformaldehyde
at 4% in PBS). Samples were read using Galaxy.RTM. Flow Cytometry
System (Partec). EC50 values were estimated using BIOST@T-SPEED
software. chMAb1 and DM4-SPDB-chMAb1 bind with similar affinity and
EC.sub.50 of 6.0 and 6.6 nM respectively.
[0886] Several HCT116 clones with different antigen densities were
used to evaluate cytotoxicity of DM4-SPDB-chMAb1 by assessment of
cell viability using the Cell Titer-Glo kit (Promega).
[0887] HCT116-LAMP1 cells were plated in 96-well plates and allowed
to adhere during 4 hours in 37.degree. C./5% CO.sub.2 atmosphere.
Different concentrations of DM4-SPDB-chMAb1 were added to the
seeded cells, in triplicate for each concentration. The cells were
then incubated for 96 hours in the same atmosphere. Cell Titer-Glo
reagent was then added to the wells for 10 min at room temperature
and the luminescent signal was measured using a Victor plate reader
(Perkin-Elmer). The half maximal inhibitory concentration
(IC.sub.50) is a measure of the effectiveness of a compound in
inhibiting biological function. It is defined as the concentration
of the antibody which led to cell killing with a response halfway
between the baseline and maximum after some specified exposure
time. The IC.sub.50 values were estimated using BIOST@T-SPEED
software. DM4-SPDB-chMAb1 killed cells with an IC.sub.50 of around
0.2 nM.
TABLE-US-00032 TABLE 31 Cytotoxicity of DM4-SPDB-chMAb1 on HCT116
cell lines expressing LAMP1 Cytotoxic activity IC.sub.50 (nM)
HCT116-LAMP1 Antigen density (mean .+-. SD; n = 3) Clone 5 451 000
0.2 .+-. 0.1 Clone 8 160 000 0.1 .+-. 0.1
[0888] Cytotoxic IC50 of DM4-SPDB-chMAb1 is sub-nM for clones of
HCT116 with high expression of LAMP1.
Example 9.2: In Vitro Cytotoxicity of DM4-SPDB-huMAb1_1
DM4-SPDB-huMAb1_2, DM4-SPDB-huMAb1_3
[0889] HCT116 clone 8, as described in example 9, was used to
evaluate cytotoxicity of DM4-SPDB-huMAb1_1, DM4-SPDB-huMAb1_2 and
DM4-SPDB-huMAb1_3. The same protocol as described in example 9 was
applied.
[0890] The three constructs killed cells with an equivalent
efficacy. IC.sub.50 are 0.10 nM, 0.07 nM and 0.12 nM for
DM4-SPDB-huMAb1_1, DM4-SPDB-huMAb1_2 and DM4-SPDB-huMAb1_3
respectively.
Example 9.3: In Vitro Cytotoxicity of DM4-SPDB-chMAb2 and
DM4-SPDB-chMAb3
[0891] HCT116 clone 8, as described in example 9, was used to
compare cytotoxicity of DM4-SPDB-chMAb2 and DM4-SPDB-chMAb3. Same
protocol as described in example 9 was applied. The two constructs
killed cells with an equivalent efficacy. 10.sub.50 are 0.07 nM and
0.06 nM for DM4-SPDB-chMAb2 and DM4-SPDB-chMAb3 respectively.
Example 9.4: Evaluation of the Inhibition of Proliferation of the
Cell Lines HCT116 and HT29 with ADC with Tomaymycine Dimer
[0892] HCT116 (respectively HT29) cells in their exponential growth
phase are trypsinized and resuspended in their culture medium (DMEM
Gibco#11960+10% SVF+2 mM glutamine). The cell suspension is seeded
in Cytostar 96-well plates (GE Healthcare Europe, #RPNQ0163) in
whole culture medium containing serum to a density of 3000
(respectively 5000) cells/well. After incubation for 4 hours,
successive dilutions of the antibody-cytotoxic agent
immunoconjugate are added to the wells at decreasing concentrations
from 10.sup.-1 to 10.sup.-12 M (in duplicate (respectively in
quadruplate) for each concentration). The cells are cultured at
37.degree. C. under an atmosphere containing 5% CO.sub.2 in the
presence of the antibody-cytotoxic agent immunoconjugate for 3
days. On the fourth day, 10 .mu.l of a solution 14C-thymidine (0.1
.mu.Ci/well, Perkin Elmer #NEC56825000) are added to each well. The
incorporation of 14C-thymidine is measured 96 hours after the start
of the experiment with a Microbeta radioactivity counter (Perkin
Elmer). The data are expressed in the form of a percentage of
survival by determining the ratio between accounts obtained with
the cells treated with the immunoconjugate and that obtained with
the cells of the control wells (treated with the culture medium
alone).
[0893] The construct killed the HCT116 and HT29 cells with an
equivalent efficacy. IC.sub.50 are 56 pM for the HCT116 cells and
72 nM for the HT29 cells.
Example 10: In Vivo Efficacy
Example 10.1: In Vivo Efficacy of DM4-SPDB-chMAb1
[0894] In this example, the cleavable DM4-SPDB-chMAb1 conjugate was
shown to lead to in vivo efficacy.
Example 10.1.1: Evaluation of the Antitumor Activity of
DM4-SPDB-chMAb1 Against Primary Human Colon Adenocarcinoma
CR-LRB-010P
Materials and Methods
[0895] The conjugate DM4-SPDB-chMAb1 was evaluated at 3 doses
against measurable primary colon CR-LRB-010P tumors implanted
subcutaneously in female SCID mice. Control groups were left
untreated. DM4-SPDB-chMAb1 was administered at 10, 5 and 2.5 mg/kg
by an intravenous (IV) bolus injection, on day 17 post tumor
implantation. Animals were weighed daily and tumors were measured 2
times weekly by caliper. A dosage producing a 20% weight loss or
15% weight loss for 3 consecutive days or 10% or more drug deaths,
was considered an excessively toxic dosage. Animal body weights
included the tumor weights. Tumor volumes were estimated from 2
dimensional tumor measurements and calculated according to the
following formula (Corbett, T. H. et al., 1977, Cancer 40:
2660-2680): Tumor volume (mm.sup.3)=[Length (mm).times.Width.sup.2
(mm.sup.2)]/2. The primary efficacy end points are ratio of change
in tumor volume changes from baseline between treated and control
groups (.DELTA.T/.DELTA.C), percent median regression, partial
regression (PR) and complete regression (CR).
[0896] Changes in tumor volume for each treated (T) and control (C)
are calculated for each tumor by substracting the tumor volume on
the day of first treatment from the tumor volume on the specified
observation day. The median .DELTA.C is calculated for the
untreated control group and the median .DELTA.T is calculated for
the treated group. Then the ratio .DELTA.T/.DELTA.C is calculated
and expressed as a percentage: .DELTA.T/.DELTA.C=(delta T/delta
C).times.100 as described before
[0897] The dose is considered as therapeutically active when
.DELTA.T/.DELTA.C is lower than 40% and very active when
.DELTA.T/.DELTA.C is lower than 10%. If .DELTA.T/.DELTA.C is lower
than 0, the dose is considered as highly active and the percentage
of regression is dated (Plowman J, Dykes D J, Hollingshead M,
Simpson-Herren L and Alley M C. Human tumor xenograft models in NCI
drug development. In: Feibig H H BA, editor. Basel: Karger.; 1999 p
101-125):
[0898] % tumor regression: is defined as the % of tumor volume
decrease in the treated group at a specified observation day
compared to its volume on the first day of first treatment.
[0899] At a specific time point and for each animal, % regression
is calculated. The median % regression is then calculated for the
group.
% regression ( at t ) = volume t 0 - volume t volume t 0 .times.
100 ##EQU00004##
[0900] Partial regression (PR): Regressions are defined as partial
if the tumor volume decreases to 50% of the tumor volume at the
start of treatment.
[0901] Complete regression (CR): Complete regression is achieved
when tumor volume=0 mm.sup.3 (CR is considered when tumor volume
cannot be recorded).
Results:
[0902] The results are presented on FIG. 5 and Table 32 (below).
DM4-SPDB-chMAb1 given at 10.0, 5.0 and 2.5 mg/kg was well tolerated
with a maximal body weight loss of 3.7% at 10 mg/kg. After a single
administration at 10.0 and 5.0 mg/kg DM4-SPDB-chMAb1 was highly
active and statistically significant (p<0.0001 for each dose),
as compared to control, producing a .DELTA.T/.DELTA.C<0 and
regressions of the initial tumor volume of 75% and 7%, respectively
with 5/6 PR and 2/6 CR at 10 mg/kg and 1/6 PR at 5 mg/kg. The
dosage below 2.5 mg/kg was active with .DELTA.T/.DELTA.C=31% and no
regressions.
TABLE-US-00033 TABLE 32 Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb1 against primary human colon adenocarcinoma
CR-LRB-010P in SCID female mice Average body Route/ Dosage Drug
weight change Median % Dosage in in mg/kg death in % per Median of
Tumor free Biostatistic mL/kg per (total Schedule (Day of mouse at
nadir .DELTA.T/.DELTA.c regression Regressions survivors at p value
Agent.sup.1 injection dose) in days deatch) (day of nadir) in %
(day) (day) Partial Complete day 55 (day) .sup.2 DM4- IV (10 10.0
(10.0) 17 0/6 -3.7 (18) -11 (31) 75 (31) 5/6 2/6 0/6 P < 0.0001
SPDB- mL/Kg) (31) chMAb1 DM4- IV (5 5.0 (5.0) 0/6 -3.2 (18) -2 (27)
7 (27) 1/6 0/6 0/6 P < 0.0001 SPDB- mL/Kg) (27) chMAb1 DM4- IV
(2.5 2.5 (2.5) 0/6 +0.1 (18) 31 (31) 0/6 0/6 0/6 P = 0.0001 SPDB-
mL/Kg) (31) chMAb1 Controls 0/10 -2.7 (18) 0/10 0/10 0/10
.sup.1Drug formulation: buffer HGS pH 5.5 (10 mM histidine, 130 mM
glycine, 5% (w/v) sucrose, 0.01% Tween 80) .sup.2 p-value:
Dunnett's test versus control following a two-way Anova with
repeated measures performed separately for each compounds on ranks
of changes from baseline. A probability less than 5% (p < 0.05)
was considered as significant. NS = non significant. Tumor doubling
time = 4.3 days. Tumor size at start of therapy was 96-216
mm.sup.3, with a median tumor burden per group of 126-138
mm.sup.3.
Example 10.1.2: Evaluation of the Antitumor Activity of
DM4-SPDB-chMAb1 Against Primary Human Lung Tumor LUN-NIC-0014
Materials and Methods
[0903] DM4-SPDB-chMAb1 was evaluated at 3 doses against measurable
primary lung tumor LUN-NIC-0014 implanted s.c in female SCID mice.
Control groups were left untreated. DM4-SPDB-chMAb1 was
administered at 10.0, 5.0 and 2.5 mg/kg by an intravenous (IV)
bolus injection, on day 26 post tumor implantation. Animals were
weighed daily and tumors were measured 2 times weekly by caliper. A
dosage producing a 20% weight loss or 15% weight loss for 3
consecutive days or 10% or more drug deaths, was considered an
excessively toxic dosage. Animal body weights included the tumor
weights.
[0904] Toxicity and efficacy evaluation were performed as reported
in example 10-1.
Results
[0905] DM4-SPDB-chMAb1 given at 10.0, 5.0 and 2.5 mg/kg was well
tolerated with a maximal body weight loss of 3.3% at 2.5 mg/kg.
After a single administration at 10.0 and 5.0 mg/kg DM4-SPDB-chMAb1
was highly active as compared to control, producing a
.DELTA.T/.DELTA.C<0 and regressions of the initial tumor volume
of 81% and 65%, respectively, and with 6/6 CR at 10 mg/kg and 5/6
PR at 5 mg/kg. The dosage below 2.5 mg/kg was active with
.DELTA.T/.DELTA.C=33% and no regressions. (Table 33, FIG. 6).
TABLE-US-00034 TABLE 33 Evaluation of the antitumor activity of
DM4-SPDB-chMAb1 against primary human lung tumor LUN-NIC-0014 in
SCID female mice Average body Median Route/Dosage Dosage in weight
change .DELTA.T/.DELTA.c Median % of in mL/kg per mg/kg per in %
(on day in % (on regression Regressions Agent.sup.1 injection
injection of trough) day 42) (on day 42) Partial Complete DM4-SPDB-
10 Single dose -2.52 (28) <0 81 6/6 6/6 chMAb1 mL/kg IV day 26
DM4-SPDB- 5 Single dose -1.34 (28) <0 65 5/6 0/6 chMAb1 mL/kg IV
day 26 DM4-SPDB- 2.5 Single dose -3.32 (28) 33 0/6 0/6 chMAb1 mL/kg
IV day 26 Control -2.83 (27) 0/6 0/6 Drug formulation: HGS buffer
at pH 5.5 (10 mM histidine, 130 mM glycine, 5% (w/v) sucrose, 0.01%
Tween 80) Tumor doubling time = 7.5 days. Tumor size at start of
therapy was 99-230 mm.sup.3, with amedian tumor burden per group of
148-162 mm.sup.3.
Example 10.2: In Vivo Efficacy of DM4-SPDB-huMAb1_1
Example 10.2.1: Evaluation of the Anti-Tumor Activity of
DM4-SPDB-huMAb1_1 Against Primary Human Colon Adenocarcinoma
CR-LRB-010P
Material and Method
[0906] DM4-SPDB-huMAb1_1 was evaluated at 2 doses against
measurable primary colon CR-LRB-010P tumors implanted s.c in female
SCID mice. Control groups were left untreated. DM4-SPDB-huMAb1_1
was administered at 5 and 2.5 mg/kg by an intravenous (IV) bolus
injection, on day 19 post tumor implantation. Animals were weighed
daily and tumors were measured 2 times weekly by caliper.
[0907] Toxicity and efficacy evaluation were performed as reported
in example 10.1. Results
[0908] DM4-SPDB-huMAb1_1 given at 5.0 and 2.5 mg/kg was well
tolerated with a maximal body weight loss of 4.4% at 2.5 mg/kg.
After a single administration at 5.0 mg/kg DM4-SPDB-huMAb1_1 was
active and statistically significant (p<0.0001), as compared to
control, producing a .DELTA.T/.DELTA.C=0 without regressions. The
dosage below 2.5 mg/kg yielded a .DELTA.T/.DELTA.C=47%. (Table 34,
FIG. 23)
TABLE-US-00035 TABLE 34 Evaluation of the anti-tumor activity of
DM4-SPDB-huMAb1_1 against primary human colon adenocarcinoma
CR-LRB-010P in SCID female mice. Dosage in Average body Route/
mg/kg per Drug weight change Median Median % Dosage in injection
death in % per .DELTA.T/.DELTA.C of mL/kg per (total Schedule (Day
of mouse at nadir in % regression Regressions Biostatistic Agent
injection dose) in days death) (day of nadir) day 25 on day Partial
Complete p value (25) DM4-SPDB- IV 10 5 (5) 19 0/6 -0.9 (21) 0 --
0/6 0/6 p < 0.0001 huMAb1_1 mL/kg 2.5 (2.5) 0/6 -4.4 (45) 47 --
0/6 0/6 p = 0.2258 Control 0/10 -3.5 (37) -- -- 0/6 0/6 -- Tumor
doubling time = 6.0 days. Tumor size at start of therapy was 88-277
mm.sup.3, with a median tumor burden per group of 138-157 mm.sup.3.
Mice average weight range = 18.10-22.40 g dosages were adjusted to
the individual body weights. Drug formulation: His-Gly-Sucrose
buffer pH = 5.5; Statistical analysis: Dunnett's test versus
control following a two-way Anova with repeated measures performed
separately for each compounds on ranks of changes from baseline. A
probability less than 5% (p < 0.05) was considered as
significant.
Example 10.2.2: Evaluation of the Anti-Tumor Activity of
DM4-SPDB-huMAb1_1 Against Primary Invasive Ductal Carcinoma
BRE-IGR-0159
Material and Method
[0909] DM4-SPDB-huMAb1_1 was evaluated at four doses against
measurable primary invasive ductal carcinoma BRE-IGR-0159 tumors
implanted s.c in female SCID mice. Control groups were left
untreated. DM4-SPDB-huMAb1_1 was administered at 5, 2.5, 1.25 and
0.62 mg/kg by an intravenous (IV) bolus injection, on day 17 post
tumor implantation. Animals were weighed daily and tumors were
measured 2 times weekly by caliper.
[0910] Toxicity and efficacy evaluation were performed as reported
in example 10.1.
Results
[0911] After a single administration at 5.0 and 2.5 mg/kg,
DM4-SPDB-huMAb1_1 was well tolerated and was active producing a
.DELTA.T/.DELTA.C<0 and regressions of the initial tumor, volume
of 100%, with 6/6 CR at 5 mg/kg and 4/6 CR at 2.5 mg/kg. The
dosages below 1.25 mg/kg was active with .DELTA.T/.DELTA.C=30%
(p=0.0015) and no regressions. The lower dose 0.62 mg/kg yielded a
.DELTA.T/.DELTA.C=86% (Table 35, FIG. 24)
TABLE-US-00036 TABLE 35 Evaluation of the anti-tumor activity of
DM4-SPDB-huMAb1_1 against human primary invasive ductal carcinoma
BRE-IGR-0159 in SCID female mice Average body weight Route/ Dosage
in Drug change in % Median Median % Tumor Dosage in mg/kg per death
per mouse .DELTA.T/.DELTA.C of free mL/kg per injection Schedule
(Day of at nadir in % regression Regressions survivors Biostatistic
Agent injection (total dose) in days death) (day of nadir) day 24
on day 27 Partial Complete day 49 p value 24 DM4-SPDB- IV 10 5.0
(5.0) 17 0/6 -1.7 (18) <0 100 6/6 6/6 6/6 p < 0.0001 huMAb1_1
mL/kg 2.5 (2.5) 17 0/6 -3.0 (32) <0 100 6/6 4/6 3/6 p <
0.0001 1.25 (1.25) 17 0/6 -3.3 (34) 30 -- 0/6 0/6 0/6 p = 0.0015
0.62 (0.62) 17 0/6 -8.1 (31) 86 -- 0/6 0/6 0/6 p = 0.9232 Control
0/6 -13 (31) Tumor doubling time = 5.3 days. Tumor size at start of
therapy was 80-270 mm.sup.3, with a median tumor burden per group
of 144-153 mm.sup.3. Mice average weight: Due to body weight
heterogeneity (range: SAR428926 = 20.50-26.10 g) dosages were
adjusted to the individual body weights. Drug formulation: HGS
buffer pH = 5.5. Statistical analysis: Dunnett's test versus
control following a two-way Anova with repeated measures performed
separately for each compounds on ranks of changes from baseline. A
probability less than 5% (p < 0.05) was considered as
significant.
Example 10.2.3: Evaluation of the Anti-Tumor Activity of
DM4-SPDB-huMAb1_1 Against Primary Human Lung Tumor LUN-NIC-0070
Material and Method
[0912] DM4-SPDB-huMAb1_1 was evaluated at 4 doses against
measurable primary colon CR-LRB-010P tumors implanted s.c in female
SCID mice. Control groups were left untreated. DM4-SPDB-chMAb2 was
administered at 10, 5, 2.5 and 1.25 mg/kg by an intravenous (IV)
bolus injection, on day 35 at 10, 5, 2.5 mg/kg and 49 at 1.25 mg/kg
19 post tumor implantation. Animals were weighed daily and tumors
were measured 2 times weekly by caliper.
[0913] Toxicity and efficacy evaluation were performed as reported
in example 10.1.
Results
[0914] DM4-SPDB-huMAb1_1 given at 10.0; 5.0 2.5 and 1.25 mg/kg was
well tolerated. After a single administration at 10; 5 and 2.5
mg/kg DM4-SPDB-huMAb1_1 was active with a .DELTA.T/.DELTA.C<0
((p<0.0001) and 100% complete regressions. The dosage below 1.25
mg/kg was active with 2.5 mg/kg .DELTA.T/.DELTA.C<0
((p<0.0001) and 4/6 PR (Table 36 a) and b), FIG. 25).
TABLE-US-00037 TABLE 36 Evaluation of the anti-tumor activity of
DM4-SPDB-huMAb1 gainst primary human lung tumor LUN-NIC-0070 in
SCID female mice. a) Average body weight Route/ Dosage in Drug
change in % Median Median % Tumor Dosage in mg/kg per death per
mouse .DELTA.T/.DELTA.C of free mL/kg per injection Schedule (Day
of at nadir in % regression Regressions survivors Biostatistic
Agent injection (total dose) in days death)c (day of nadir) day 59
on day 59 Partial Complete at day 84 p value DM4-SPDB- IV/10 10
(10) 35 0/6 -4.1 (64) <0 100 6/6 6/6 6/6 p < 0.0001 huMAb1 5
(5) 0/6.sup.a) -4.9 (50) <0 100 5/5 5/5 5/5 p < 0.0001 2.5
(2.5) 0/6 -4.2 (64) <0 100 6/6 6/6 5/6 p < 0.0001 controls
0/9 -2.0 (37) 0/6 0/6 0/6. Tumor doubling time = 8.8 days. Tumor
size at start of therapy was 96-218 mm.sup.3 with a median tumor
burden per group of 132-138 mm.sup.3. Drug formulation:
His-Gly-Sucrose buffer pH = 5.5; Statistical analysis: Dunnett's
test versus control following a two-way Anova with repeated
measures performed separately for each compounds on ranks of
changes from baseline. A probability less than 5% (p < 0.05) was
considered as significant b) Average body weight Route/ Dosage in
change in % Median Median % Tumor Dosage in mg/kg per per mouse
.DELTA.T/.DELTA.C of free mL/kg per injection Schedule Drug at
nadir in % regression Regressions survivors Biostatistic Agent
injection (total dose) in days death (day of nadir) day 59 on day
59 Partial Complete at day 84 p value DM4-SPDB- IV/10 1.25 (1.25)
49 0/6 -4.3 (63) <0 (64 on 4/6 0/6 0/6 p < 0.0001 huMAb1 day
71) controls 0/6 -2.8 (56) 0/6 0/6 0/6 Tumor doubling time = 10.3
days. Tumor size at start of therapy was 118-220 mm.sup.3 with a
median tumor burden per group of 171-176 mm.sup.3. Drug
formulation: His-Gly-Sucrose buffer pH = 5.5; Statistical analysis:
Dunnett's test versus control following a two-way Anova with
repeated measures performed separately for each compounds on ranks
of changes from baseline. A probability less than 5% (p < 0.05)
was considered as significant.
Example 10.3: In Vivo Efficacy of DM4-SPDB-chMAb2
Example 10.3.1: Evaluation of the Anti-Tumor Activity of
DM4-SPDB-chMAb2 Against Primary Human Colon Adenocarcinoma
CR-LRB-010P
Material and Method
[0915] DM4-SPDB-chMAb2 was evaluated at 3 doses against measurable
primary colon CR-LRB-010P tumors implanted s.c in female SCID mice.
Control groups were left untreated. DM4-SPDB-chMAb2 was
administered at 10, 5 and 2.5 mg/kg by an intravenous (IV) bolus
injection, on day 19 post tumor implantation. Animals were weighed
daily and tumors were measured 2 times weekly by caliper.
[0916] Toxicity and efficacy evaluation were performed as reported
in example 10.1.
Results
[0917] DM4-SPDB-chMAb2 given at 10.0; 5.0 and 2.5 mg/kg was well
tolerated. After a single administration at 10 and 5 mg/kg
DM4-SPDB-chMAb2 was active with a .DELTA.T/.DELTA.C<0
((p<0.0001) and 1/6 PR and .DELTA.T/.DELTA.C=10 (p<0.0001)
and no regressions respectively. The dosage below 2.5 mg/kg
produced a .DELTA.T/.DELTA.C=68%. (Table 37, FIG. 26)
TABLE-US-00038 TABLE 37 Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb2 against primary human colon adenocarcinoma
CR-LRB-010P in SCID female mice. Average body weight Route/ Dosage
in Drug change in % Median % Dosage in mg/kg per death per mouse
Median of mL/kg per injection Schedule (Day of at nadir
.DELTA.T/.DELTA.C regression Regressions Biostatistic Agent
injection (total dose) in days death) (day of nadir) in % day on
day Partial Complete p value (day) DM4-SPDB- IV 10 10 (10) 19 0/6
-1.6 (20) <0 (31) 36 (31) 1/6 0/6 p < 0.0001 (31) chMAb2
mL/kg 5 (5) 19 0/6 -2.4 (37) 10 (28) -- 0/6 0/6 p < 0.0001 (28)
2.5 (2.5) 19 0/6 -2.5 (36) 66 (28) -- 0/6 0/6 p = 0.7711 (28)
Control 0/10 -3.5 (37) -- -- 0/6 0/6 -- Tumor doubling time = 6.0
days. Tumor size at start of therapy was 88-277 mm.sup.3, with a
median tumor burden per group of 138-157 mm.sup.3. Mice average
weight range = 18.10-22.40 g dosages were adjusted to the
individual body weights. Drug formulation: His-Gly-Sucrose buffer
pH = 5.5; Statistical analysis: Dunnett's test versus control
following a two-way Anova with repeated measures performed
separately for each compounds on ranks of changes from baseline. A
probability less than 5% (p < 0.05) was considered as
significant.
Example 10.3.2: Evaluation of the Anti-Tumor Activity of
DM4-SPDB-chMAb2 Against Human Primary Invasive Ductal Carcinoma
BRE-IGR-0159 in SCID Female Mice
Material and Method
[0918] DM4-SPDB-chMAb2 was evaluated at 3 doses against measurable
primary invasive ductal carcinoma BRE-IGR-0159 tumors implanted s.c
in female SCID mice. Control groups were left untreated.
DM4-SPDB-chMAb2 was administered at 10, 5 and 2.5 mg/kg by an
intravenous (IV) bolus injection, on day 14 post tumor
implantation. Animals were weighed daily and tumors were measured 2
times weekly by caliper.
Toxicity and efficacy evaluation were performed as reported in
example 10.1.
Results
[0919] DM4-SPDB-chMAb2 given at 10.0; 5.0 and 2.5 mg/kg was well
tolerated. After a single administration at 10, 5 and 2.5 mg/kg
DM4-SPDB-chMAb2 was active with a .DELTA.T/.DELTA.C<0
((p<0.0001) and 100% complete regressions at all doses tested.
(Table 38, FIG. 27)
TABLE-US-00039 TABLE 38 Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb2 against human primary invasive ductal carcinoma
BRE-IGR-0159 in SCID female mice Average body weight Route/ Dosage
in Drug change in % Median Median % Tumor Dosage in mg/kg per death
per mouse .DELTA.T/.DELTA.C of Biostatistic Free Agent mL/kg per
injection Schedule (Day of at nadir in % regression Regressions p
value survivor (batch) injection (total dose) in days death) (day
of nadir) day 24 on day 24 Partial Complete day 24 on day 124
DM4-SPDB- IV 10 10.0 (10.0) 14 0/6 -5.2 (17) <0 100 5/5 5/5 p
< 0.0001 5/5 chMAb2 mL/kg 5.0 (5.0) 14 0/6 -6.9 (17) <0 100
6/6 6/6 p < 0.0001 6/6 2.5 (2.5) 14 0/6 -4.2 (17) <0 100 6/6
6/6 p < 0.0001 4/6 Control -- -- -- 0/10 -15.9 (24) -- -- 0/6
0/6 0/6 Tumor doubling time = 2.9 days. Tumor size at start of
therapy was 88-245 mm3, with a median tumor burden per group of
120-135 mm3. Statistical analysis: Dunnett's test versus control
following a two-way Anova with repeated measures performed
separately for each compounds on ranks of changes from baseline. A
probability less than 5% (p < 0.05) was considered as
significant.
Example 10.4: Efficacy of the Anti-Tumor Activity of
DM4-SPDB-chMAb3 Against Human Primary Invasive Ductal Carcinoma
BRE-IGR-0159 in SCID Female Mice
Material and Method
[0920] DM4-SPDB-chMAb3 was evaluated at 3 doses against measurable
primary invasive ductal carcinoma BRE-IGR-0159 tumors implanted s.c
in female SCID mice. Control groups were left untreated.
DM4-SPDB-chMAb3 was administered at 5.0, 2.5 and 1.25 mg/kg by an
intravenous (IV) bolus injection, on day 16 post tumor
implantation. Animals were weighed daily and tumors were measured 2
times weekly by caliper.
[0921] Toxicity and efficacy evaluation were performed as reported
in example 10.1.
Results
[0922] DM4-SPDB-chMAb3 given at 5.0, 2.5 and 1.25 mg/kg was well
tolerated. After a single administration at 5.0, 2.5 and 1.25 mg/kg
DM4-SPDB-chMAb3 was active with a .DELTA.T/.DELTA.C<0
((p<0.0001) and 100% of regressions at all dose tested. (Table
39, FIG. 28)
TABLE-US-00040 TABLE 39 Evaluation of the anti-tumor activity of
DM4-SPDB-chMAb3 against human primary invasive ductal carcinoma
BRE-IGR-0159 in SCID female mice Average body weight Route/ Dosage
in Drug change in % Median % Tumor Dosage in mg/kg per death per
mouse Median of free mL/kg per injection Schedule (Day of at nadir
.DELTA.T/.DELTA.C regression Regressions survivors Biostatistic
Agent injection (total dose) in days death) (day of nadir) in %
(day) on day 35 Partial Complete day 76 p value DM4-SPDB- IV 10 5.0
(5.0) 16 0/6 -2.8 (17) <0 (35) 100 6/6 6/6 6/6 p < 0.0001
chMAb3 ml/kg 2.5 (2.5) 16 0/6 -3.2 (17) <0 (35) 100 6/6 5/6 5/6
p < 0.0001 1.25 (1.25) 16 0/6 -1.7 (17) <0 (35) 100 6/6 6/6
2/6 p < 0.0001 Control 0/10 -17.8 (32) -- 0/6 0/6 0/6 Tumor
doubling time = 7.4 days. Tumor size at start of therapy was 88-221
mm.sup.3, with a median tumor burden per group of 135-151 mm.sup.3.
Mice average weight range = 18.10-22.40 g dosages were adjusted to
the individual body weights. Drug formulation: His-Gly-Sucrose
buffer pH = 5.5. Statistical analysis: Dunnett's test versus
control following a two-way Anova with repeated measures performed
separately for each compounds on ranks of changes from baseline. A
probability less than 5% (p < 0.05) was considered as
significant.
Example 11: In Vitro ADCC Activity
[0923] ADCC activity was evaluated using HCT116 huLAMP1 clone 8 (as
described in example 9) as target cells and human natural killer
(NK) cells as effector cells. A lactate dehydrogenase (LDH) release
assay was used to measure cell lysis (R. L. Shields et al., 2001, J
Biol Chem, 276: 6591-6604).
Peripheral Blood Mononuclear Cells Isolation
[0924] Blood was diluted 2-3-fold with phosphate-Buffered Saline
(PBS). Thirty five mL of diluted blood was carefully layered over
15 mL of Ficoll-Paque Plus (GE healthcare) in a 50 mL conical tube
and centrifuged at 400 g for 40 min at room temperature. The
peripheral blood mononuclear cells (PBMC) were collected from the
interface, transferred into a new conical 50 mL tube, and washed
twice with PBS.
NK Isolation
[0925] According to Miltenyi NK cell isolation kit protocol
(130-092-657, Miltenyi Biotech). The PBMC were suspended in
NK-isolation buffer (40 .mu.l of buffer for 10.sup.7 total cells),
and then Biotin-Antibody Cocktail (10 .mu.l for 10.sup.7 total
cells) was added to the cell suspension. The Biotin-Antibody
Cocktail contains biotinylated antibodies that bind to the
mononuclear cells, except for NK cells. The mixture was incubated
at 4.degree. C. for 5 min, and then NK-isolation buffer (30 .mu.l
of buffer for 10.sup.7 total cells) and NK cells MicroBead cocktail
(20 .mu.l for 10.sup.7 total cells) were added. The cell-antibody
mixture was incubated for another 10 min at 4.degree. C. Next,
cells were washed (centrifugation at 400 g for 10 min) once with 50
mL of NK-isolation buffer, suspended in 1 mL of NK-isolation buffer
for 2.10E+8 cell and loaded on isolated by the autoMACS Pro
Separator (Miltenyi) using the depletion program. Collected and
pooled negative fractions (containing NK cells) were washed once
(centrifugation at 400 g for 10 min) and suspended at
2.5.times.10.sup.6/mL in RPMI-1640 supplemented with 10% fetal
bovine serum, 2 mM of L-Glutamine, 1% of penicillin/streptomycin,
1% Hepes, 1% Na-pyruvate and 1% non-essential amino-acids.
ADCC Protocol
[0926] 10-fold serial dilutions, from 1.5.times.10.sup.-7 M to
1.5.times.10.sup.-17 M of tested antibody as well as isotypic
control antibody were prepared in RPMI-1640 medium supplemented
with 0.1% BSA, 2 mM HEPES, pH 7 0.4 (denoted below as RHBP medium).
Triplicate of each antibody concentration were distributed (50
.mu.L/well) into a round bottom 96-well plate. HCT116 huLAMP1 clone
8 cells were suspended at 0.075.times.10.sup.6 cells/mL in RHBP
medium and added to each well (100 .mu.L/well) containing antibody
dilutions. The plate containing target cells and antibody dilutions
was incubated for 10 min at room temperature. NK cells were washed
and suspended in RHBP medium at 0.75.times.10.sup.6 cells/mL, 50
.mu.L of NK cells were then added to each well, leading to a
typically ratio of 5 NK cells to 1 target cell. Control A consisted
of wells containing only target cells (no antibody and no NK cells
added) where RHBP medium (50 .mu.L/well) was added instead of NK
cells. Control B consisted of wells containing only target cells
(no antibody and no NK cells added) where 20 .mu.L of Triton X-100
solution (RPMI-1640 medium, 10% TritonX-100) was added, to
determine the maximum possible LDH release of target cells. The
mixtures were incubated at 37.degree. C. for 4 h, and then
centrifuged for 10 min at 1200 rpm, 100 .mu.L of the supernatant
was carefully transferred to a new flat-bottom 96-well plate.
Freshly prepared LDH reaction mixture (100 .mu.L/well) from
Cytotoxicity Detection Kit (Roche 11644793001) was added to each
well and incubated in dark at room temperature for 30 min.
[0927] The optical density of samples was measured at 490 mn
(0D490). 100% of lysis corresponded to OD490 value of control B
wells and 0% of lysis to the OD490 value of the control A wells.
The percent specific lysis of each sample was determined by the
following formula: (0D490 sample-OD490 of control A)/(0D490 control
B-OD490 control A)*100
[0928] The samples containing only NK cells gave negligible OD490
readings.
Example 11.1: In Vitro ADCC Mediated by chMAb1, chMAb2 and
chMAb3
[0929] The chMAb1, chMAb2 and chMAb3 antibodies specifically
induced similar and potent ADCC activities as shown in FIG. 29.
Isotype control antibody had no significant ADCC activity
Example 11.2: Variability of In Vitro ADCC
[0930] ADCC activities of chMAb1 or chMAb2 were evaluated for
several batches of purified NK, each batch correspond to an
individual blood donor. As depicted in table 40, ADCC activities
varied from one batch of NK cells to the other. EC.sub.50 values
were estimated using BIOST@T-SPEED software.
TABLE-US-00041 TABLE 40 Maximum of ADCC and EC.sub.50 for
individual batches of isolated NK cells Highest ADCC value (% of
maximal NK batch # LDH release) EC.sub.50 (nM) Comment chMAb1
67125903091 36 0.76 67125626389 51 0.05 6712562616 44 Not EC.sub.50
could not be determined as determined high plateau not reach for
highest concentration of MAb assayed 67130127373 33 0.009
67130127429 60 Not EC.sub.50 could not be determined as determined
high plateau not reach for highest concentration of MAb assayed
67130496259 20 0.6 67130494552 33 0.2 chMAb2 67125903091 32 0.5
67125626389 52 0.1 6712562616 31 2 67130127429 61 Not EC.sub.50
could not be determined as determined high plateau not reach for
highest concentration of MAb assayed
Example 11.3: In Vitro ADCC Dependency on LAMP1 Antigen Density
[0931] Using the same NK batch, ADCC was analyzed for HCT116
huLAMP1 clones displaying different antigen densities. As
illustrated by data of FIG. 30, antigen density >20 000 is
required to lead to noticeable in vitro ADCC activity.
Example 11.4: Comparison of In Vitro ADCC of chMAb1 and
DM4-SPDB-chMAb1 or chMAb2 and DM4-SPDB-chMAb2
[0932] DM4-SPDB conjugation did not significantly impacts ADCC
activity of chMAb1 or chMAb2 (FIGS. 31a and b).
Example 11.5: In Vitro ADCC Mediated by huMAb1_1
[0933] ChMAb1 was included in the experiments a reference
comparator. HuMAb1_1 induced ADCC activity similar to chMAb1 as
shown in FIG. 32.
Example 11.6: In Vitro ADCC Mediated by DM4-SPDB-huMAb1_1
[0934] HuMAb1_1 was included in the experiments a reference
comparator. DM4-SPDB-huMAb1_1 induced ADCC activity similar to
huMAb1 as shown in FIG. 33.
Example 12: In Vitro ADCP Activity
[0935] ADCP activity was evaluated using HCT116 huLAMP1 clones with
different LAMP1 antigen densities as target cells and human
macrophages as effector cells. HCT116 huLAMP1 clones were labeled
by PKH67 fluorescent dye, macrophages were labeled by CD14-PC7
fluorescent dye.
Peripheral Blood Mononuclear Cells Isolation
[0936] The peripheral blood mononuclear cells (PBMC) were isolated
as described in example 11.
Monocytes Isolation
[0937] From isolated PBMC and according to Miltenyi monocytes cell
isolation kit protocol (130-050-201, Miltenyi Biotech). Cells
labeled by CD14-MicroBead were isolated using the positive
selection program of the autoMACS Pro Separator (Milteny Biotech).
Collected fraction (containing monocytes cells) were suspended in
13.6 mL of RPMI-1640 supplemented with 10% fetal bovine serum,
washed once (centrifugation at 400 g for 10 min) and suspended at a
final concentration of 10.sup.6 cells/mL in 64 mL of RPMI-1640
supplemented with 10% fetal bovine serum, 1% of heat inactivated
human serum (AB; #14-490E), 2 mM of L-glutamine and 50 ng/mL of
GM-CSF (Miltenyi Biotech; #130-093-866).
Macrophages Differentiation
[0938] The 64 mL of isolated monocytes were added to T75 flasks
(NUNC; #156472), 10 mL per flasks. Flasks were put in a 37.degree.
C. 5% CO2 incubator where cells were allowed to adhere for 8 days.
RPMI-1640 supplemented with 10% fetal bovine serum, 1% of heat
inactivated human serum, 2 mM of L-glutamine and 50 ng/mL of GM-CSF
was changed after 4 days of incubation.
ADCP Protocol
[0939] Macrophages were suspended by accutase (Invitrogen Stempro;
# A111-0501), washed once (centrifugation at 400 g for 10 min) and
suspended in RPMI-1640 medium supplemented with 2% fetal bovine
serum and 2 mM L-glutamine at a concentration of 1.5.times.10.sup.6
cells/mL for a ratio of 6/1 or 0.75.times.10.sup.6 cells/mL for a
ratio of 3/1. 100 .mu.L of suspended macrophages were distributed
into a round bottom 96-well polypropylene plate. 10.sup.7 of
suspended target cells (HCT116 huLAMP1 clone 4; HCT116 huLAMP1
clone 5; HCT116 huLAMP1 clone 8 or HCT116 huLAMP1 clone 12) were
labeled by PKH67 fluorescent dye following provider's procedure
(SIGMA-ALDRICH; # MIDI67-1KT), then suspended at 5.times.10.sup.5
cells/ml in RPMI-1640 supplemented with 2% fetal bovine serum and 2
mM of L-glutamine. 1/3 serial dilutions, from 9.times.10.sup.-8 M
to 3.times.10.sup.-12 M of tested huMAb1_1 as well as isotypic
control antibody were prepared in RPMI-1640 medium supplemented
with 2% fetal bovine serum. Duplicate of each antibody
concentration were distributed (150 .mu.L/well) into a round bottom
96-well polypropylene plate. 150 .mu.L of PKH67-labeled target
cells were added to each well containing antibody dilutions. The
plate containing target cells and antibody dilutions was incubated
for 15 min at 37.degree. C. 100 .mu.L of mixture (target
cells+antibody) were added to the 96-well plate containing
macrophages which was then placed for 4 h to 17 h in a 37.degree.
C. 5% CO2 incubator. Cells were suspended by accutase (Invitrogen
stempro; # A111-0501), washed twice (centrifugation at 400 g for 10
min) and suspended in buffer (PBS supplemented with 5% of heat
inactivated human serum) containing CD14-PC7 antibody (Beckman
Coulter; # PN A22331). After 20 minutes of incubation at 4.degree.
C., cells were washed once and suspended in 250 .mu.L of PBS,
washed once and suspended in 50 .mu.L of fixing paraformaldehyde
solution (PFA 4% in PBS, USB; #19943). Samples were stored at
4.degree. C. up to cytometry analysis.
Cytometry Analysis
[0940] Samples were analyzed using a MACSQUANT apparatus.
Phagocytosis was determined as double-labeled cells (PKH67 positive
and PC7 positive cells). Typical data obtained are shown in FIG.
34.
Example 12.1: In Vitro ADCP Mediated by huMAb1_1
[0941] Two ratios of macrophages/HCT116 huLAMP1 clone 8 were
analyzed. EC.sub.50 values were estimated using BIOST@T-SPEED
software. HuMAb1_1 induces significant in vitro ADCP at a ratio
macrophages/target cell of 3/1. Higher ratio, 6/1, did not lead to
lower EC.sub.50 or higher % of phagocytosis as shown in Table
41.
TABLE-US-00042 TABLE 41 In vitro ADCP mediated by huMAb1_1 Ratio
macrophages/ Batch of Maximum of target cell macrophages EC.sub.50
(nM) phagocytosis 3/1 67131617438 0.28 32 67131617470 0.56 39
67131354967 0.5 43 67130713495 0.47 33 67130713495 0.36 34 6/1
67130713495 0.98 41 67130713495 0.34 40
Example 12.2: In Vitro ADCP Dependency on LAMP1 Cell Surface
Expression
[0942] ADCP was analyzed for HCT116 huLAMP1 clones displaying
different antigen densities. The level of in vitro ADCP induced by
huMAb1_1 is linked to antigen density of LAMP1 as maximum of
phagocytosis decreased as LAMP1 antigen density decreased as
deducabkle from Table 42.
TABLE-US-00043 TABLE 42 In vitro ADCP dependency on LAMP1 cell
surface expression Mean Maximum Antigen Mean EC.sub.50 of
phagocytosis Target cell density (nM) +/- STD (%) +/- STD HCT116
huLAMP1 300 000 0.33 +/- 0.21 45.5 +/- 15.5 clone 5 HCT116 huLAMP1
100 000 0.43 +/- 0.11 36.2 +/- 4.7 clone 8 HCT116 huLAMP1 20 000
0.73 +/- 0.17 34.0 +/- 9.1 clone 4 HCT116 huLAMP1 2500 0.65 +/-
0.49 8.7 +/- 4.1 clone 12
Example 12.3: In Vitro ADCP for huMAb1_negB
[0943] FC.gamma.RIIIa mediated phagocytosis was evaluated by
assessing ADCP induced by huMAb1_negB (described in example 7.2).
As expected (macrophages not being strictly dependent on
FC.gamma.RIIIa for activation), huMAb1_negB leaded to lower ADCP
than huMAb1_1, however ADCP still occurred when huMAb1_negB was
used. Typical data obtained are displayed in FIG. 35.
Example 12.4: In Vitro ADCP for huMAb1_negA
[0944] ADCP mediated by huMAb1_negA (described in example B7.2) was
tested to evaluate antigen specificity mediated phagocytosis. As
displayed in FIG. 36, huMAb1_negA did not induce any ADCP,
validating specificity of data obtained for huMAb1_1.
Example 13: LAMP1 Gene Copy Number Change
Materials and Methods:
[0945] Array-Based Oligonucleotide Comparative Genomic
Hybridization (aCGH)
[0946] Genomic DNA was analyzed using the Human Genome CGH
Microarray 400k-(Agilent Technologies, Santa Clara, Calif., USA).
Digestion, labeling and hybridization were performed using Agilent
Oligo aCGH Bravo platform protocols for Human CGH 2.times.400K
microarrays. In all experiments, sex-matched DNA from a human
well-characterized normal female (NA12878) or one
well-characterized normal male (NA10858) was used as reference DNA.
The normal human genomic DNA used in these experiences is
commercialized by Coriell reference.
[0947] Oligonucleotide aCGH processing was performed as detailed in
the manufacturer's protocol (version 6.2 Oct. 2009;
http://www.agilent.com). The microarray required 600 ng of genomic
DNA from the reference sample and from the experimental sample.
Array was scanned with an Agilent DNA Microarray Scanner
(G2565CA).
[0948] Data were extracted from scanned images and normalized using
the Feature Extraction software (v10.7.3.1, Agilent).
[0949] The log 2 ratio and segmentation were generated using Array
Studio software. Array Studio, Array Viewer and Array Server and
all other Omicsoft products or service names are registered
trademarks or trademarks of Omicsoft Corporation, Research Triangle
Park, N.C., USA.
[0950] Centralization of the log 2 ratio distribution was verified
and segmentation was performed using the CBS algorithm (Olshen et
al.; Biostatistics (2004), 5(4): 557). Aberration status calling
was automatically performed for each profile according to its
internal noise (variation of log 2 ratio values across consecutive
probes on the genome). All genomic coordinates were established on
the UCSC human genome build hg19 (Karolchik D et al. Nucleic Acids
Res 2003, 31: 51). The value log Ratio and Copy Number Change, for
each region or gene, was introduced in an internal database for
subsequent analysis.
[0951] Gene Expression
[0952] The gene expression analysis was performed using a GeneChip
Expression 3'-Amplification Reagents Kit and U133Plus GeneChip
arrays (Affymetrix, Santa Clara, Calif., USA), using the Expression
Analysis Cia platforme. All data were imported into Resolver
software (Rosetta Biosoftware, Kirkland, Wash., USA) for database
management, quality controls and Analysis. Each mRNA is represented
by one or more qualifier. The value of expression from each
qualifier was downloaded in the Patient-Derived Tumor Xenograft
Tumor Bank database (Tumor bank database) for analysis.
[0953] Animals
[0954] Animals were maintained in the animal facilities of each
institution following standard animal regulation and strict health
controls allowing transfer between members of the consortium.
Swiss-nude and CB17-SCID female mice, as well as NIH-nude rats were
bred at Charles River France (Les Oncins, France). Mouse weights
were over 18 g and rat weights were over 160 g at the start of
experiments. Their care and housing were in accordance with
institutional guidelines, as well as national and European laws and
regulations as put forth by the French Forest and Agriculture
Ministry and the standards required by the UKCCCR guidelines.
[0955] Sample Preparation
[0956] Frozen fragments were cut in a cryostat at -20.degree. C.
then beginning and end sections were stained with HES
(Haematoxylin-Eosin-Saffron) for histological control and
evaluation of tumor cell percentage by pathologists. Genomic DNA
was extracted according to QIAamp DNA Kit protocols v01 (Qiagen,
Hilden, Germany). Total RNA was extracted from tumor samples and
purified with an RNAeasy kit (Qiagen), using the RNA extraction
Qiagen protocols v01.
[0957] Molecular Characterization of PDX
[0958] The molecular characterization (CGH, RNA expression and IHC)
of each tumoral model of PDX was performed using the same
Xenografts passage.
Immunohistochemistry
[0959] To associate genomic copy number aberration of LAMP1 gene
and its region (13q34) with changes in the protein levels (Strong,
medium, Faint and Negative) of the membrane localization of LAMP1
on PDXs (Frozen-Oct), specific staining (mAb1) was carried out on
the same passage of PDX used for CGH and RNA expression
characterization.
[0960] After avidin and biotin blocking (Endogenous Block, Ventana,
760-050), frozen sections (Frozen-OCT format) were incubated with
murine monoclonal antibody MAb1 (final concentration 1 .mu.g/mL
(for human samples) and 1 and 5 .mu.g/mL (for monkey samples) in
Phosphate Buffer Saline, PBS) for 32 min at 37.degree. C. A
postfixation step with glutaraldehyde (0.05% in NaCl 0.9% w/v) for
4 min was done. The secondary goat anti-mouse IgG2a-biotinylated
was incubated for 12 min at 37.degree. C. (Southern Biotech, Ref
1080-08, dilution 1/200 in Ventana's diluent). Immunostaining was
done with DAB Map chromogenic detection kit according to
manufacturer's recommendations. A counterstaining step was applied
to the cryostat sections with hematoxylin II (790-2208, Ventana
Medical Systems, Inc USA) and bluing reagent was applied for 4 min
(760-2037). Stained slides were dehydrated and coverslipped with
Coverquick 2000 mounting medium (Labonord, Ref 05547530).
[0961] The negative controls used in this study consisted in
omission of primary antibody and the use of IgG2a isotype (final
concentration 1 .mu.g/mL in PBS).
[0962] For data analysis sections immunostained with purified
murine antibody MAb1 were scanned and digitized at a magnification
of .times.20 using Scan Scope XT system (Aperio Technologies, Vista
Calif.). Digitized images were then captured using Image Scope
software (v10.2.2.2319 Aperio, Technologies).
[0963] The positive samples were scored with a scale of intensity
from 1 to 3. Ranges of intensities were described as negative (0),
weak (1), moderate (2) and strong (3). Cell frequency was the
percentage of immunostained cells and was estimated by the
histologist observation as a median by sample. The cell frequency
was ordered in 5 categories: 1 (0-5%), 2 (6-25%), 3 (26-50%), 4
(51-75%) and 5 (76-100%).
[0964] A global expression was calculated according the Allred
Score (AS) description. AS was obtained by adding the intensity and
the proportion scores to obtain a total score that ranged from 0-8.
The AS was reported as a percent of the maximum global score and
ranged in 5 categories: very low (0-25%), weak (26-50%), moderate
(51-75%) and high (75-100%). The prevalence was defined as the
percent of positive cases for the indication.
[0965] Basic descriptive statistics were calculated with Microsoft
Excel 2003. For each indication, number of cases, positive cases
number, prevalence, intensity score mean, frequency mean and Allred
score were described.
Statistical Analyses
[0966] In order to study the relation between the mRNA expression
and the LAMP1 gene change (gain or amplification), we applied a
Student test on PDX data to compare the mRNA expression levels of
the tumor PDX with or without Copy Number change. We also
determined the correlation between mRNA expression levels of the
CRC PDXs and their respective genomic copy number variation of
LAMP1 gene and their region (13q34) by a Person correlation
test.
[0967] In addition, a correlation analysis using a larger set of
colorectal patients tissues samples (n=574) from the TCGA (The
Cancer Genome Atlas) database, was performed between mRNA
expression normalized and Copy Number using a Spearman correlation
test. In order to study the association of LAMP1 expression or no
expression at the plasma membrane of PDX tumors cells determined by
IHC analysis and the Copy Number factor change or no change, a
Cochran-Mantel-Haenszel statistics was performed. For colon PDX the
test was performed using IHC score (Negative-Faint, Medium and
Strong) versus Copy Number (CN<2.5 and CN.gtoreq.2.5). For lung
and stomach PDXs, a stratified Cochran-Mantel-Haenszel statistics
was performed using IHC score (Negative-Faint, Medium-Strong)
versus Copy Number (CN<2.5 and C.gtoreq.2.5). The statistical
analyses were conducted using SAS 9.2; SAS Institute Inc. and
Everstat V6 (Sanofi based on SAS 9 SAS Institute Inc.).
Bioinformatics Analyses: Copy Number Changes in the TCGA (the
Cancer Genome Atlas)
[0968] DNA samples are analyzed using the GISTIC (Genomic
Identification of Significant Targets in Cancer) methodology
(Beroukhim, R. et al.; Nature 2010 463, 899; Beroukhim, R. et al.;
Proc Natl Acad Sci USA (2007); 104, 20007). Briefly, each marker is
scored according to the mean amplitude and frequency of focal
amplification across the dataset, and significance values are
computed by comparing to the distribution of scores obtained by
random permutation of the markers across the genome. Significant
peak regions of amplification (or deletion) are identified using an
iterative peel-off procedure that distributes the score associated
with amplified (or deleted) segments among all peaks that overlap
them (weighted according to each peak's score) until no new region
crosses the significance threshold of q-value .ltoreq.0.25 on each
chromosome. Finally, by taking into account the auto-correlation
within the GISTIC score profiles, a confidence interval is computed
for each peak region that is predicted to contain the true driver
gene or genes with at least 99% probability (TCGA Network. Nature
2008; 455: 1061).
[0969] The gene-based calls from GISTIC output were used. Genes
were defined as possessing deep deletions, shallow deletions,
neutral copy number, low gain, and high gain using specific
thresholds, as follows. High gains are log 2 ratios that exceed
1.32; low gains are from 0.3 to the high gain threshold; neutral
segments have copy numbers between -0.5 to 0.3; shallow losses have
copy numbers between -0.5 and the deep deletion threshold; and deep
deletions have copy numbers that are below -0.737.
Example 14: LAMP1 Gene Copy Number Change
Using CRC PDXs Tumors Samples
[0970] A total of 61 Colon tumor PDX were analyzed using whole
genome high-density aCGH 400K-oligonucleotide arrays. As indicated
in Table 44, 6 out of 61 (9.8%) colorectal cancer PDXs displays a
high-level LAMP1 gene amplification (i.e: CN .gtoreq.5 or log 2
ratio .gtoreq.1.32) and 57.4% shows a LAMP1 gene gain (i.e:
2.5.ltoreq.CN <5 or 0.32.ltoreq. log 2 ratio <1.32).
Using Lung PDXs Tumor Samples
[0971] A total of 35 Lung tumor PDXs were analyzed using whole
genome high-density aCGH 400K-oligonucleotide arrays. As depicted
in Table 45; one Lung tumor PDX (3%) studied displays a high-level
amplification of LAMP1 gene (CN=9.26) and 26% shows a LAMP1 gene
gain (i.e: 2.5 CN .ltoreq.5 or 0.32.ltoreq. log 2 ratio
<1.32).
Using Commercial Tumor DNA Tissues Samples
[0972] The CGH analysis was performed also using whole genome
high-density aCGH 400K-oligonucleotide arrays in the esophageal
tumor DNA samples (Asterand). As indicated in Table 46 there is a
gain or amplification of the LAMP1 gene in 2 out of 46 (4.3%)
esophageal tumor samples studied, one of these (2%) shows a focal
amplification of LAMP1 equal to 39.81 copy. This high level and
focal amplification of LAMP1 is detected in an Asian female
(ES01_F12), 64 years old; the biopsy contains 80% of tumor
cells.
Using Patient Tumor Samples by the Cancer Genome Atlas (TCGA)
Data
[0973] Following analyses of Copy number changes were performed
using the TOGA (The Cancer Genome Atlas) data. Using a larger set
of colorectal samples (n=574); the results are extremely similar
with those obtained using internal data (CRC PDX). Colorectal and
rectum human adenocarninoma analysis (the Cancer Genome Atlas)
discloses 14.4% high amplification (HighAmp). Subsequent Copy
Number Alteration analyses using TOGA data were performed to search
other tumor types for which LAMP1 was amplified. In summary, LAMP1
DNA gene low-level gains (LowAmp; Log 2 Ratio=0.3<LowAmp
<1.32) and high-gain (amplifications) (HighAmp, Log 2 Ratio
.gtoreq.1.32 (theoretically, overall 5.0 copies or more)) is
detected in 28 tumor types, including Colorectal adenocarcionoma,
Stomach, Liver, Lung (Adenocarcinoma and Squamous), Breast (Basal,
BRCA, LUMA, LUMB and HER2), Ovary, Head & neck, Kidney (Kidney
Chromophobe, Kidney Renal Clear Cell Carcinoma, Kidney Renal
Papilliary Cell Carcinoma, Cervical squamous Cell, Pancreatic,
Prostate, Bladder urothelial, Glioma (Low grade glyoma and
Glioblastoma multiform), Uterus, Thyroid, Leukemia, Lymphoma,
Esophageal, Melanoma and Soft tissue sarcoma, LAMP1 high gain or
amplification data of 12 of these tumor types including colorectal
adenocarcionoma, stomach, liver, lung, breast, ovary, head and
neck, cervical squamous cell, glioblastoma, glioma, uterus, thyroid
and soft tissue sarcoma are displayed in Table 43 and FIG. 10A.
TABLE-US-00044 TABLE 43 LAMP1 Genomic Alteration Summary: 18 TCGA
tumor types Average Average Number % of <Log2> % of
<Log2> of HighAmp HighAmp LowAmp LowAmp Cases Tumor Type
Tumor 0.000 0.000 16.071 0.688 56 BLCA Bladder Urothelial Carcinoma
1.578 2.084 9.587 0.626 824 BRCA Breast Invasive Carcinoma 1.471
1.347 10.294 0.504 68 CESC Cervical Squamous Cell 14.460 1.892
41.463 0.714 574 COADREAD Colon and Rectum Adenocarcinoma 0.536
4.495 1.964 0.642 560 GBM Glioblastoma 0.694 4.058 11.111 0.526 288
HNSC Head and Neck Squamous Cell 0.000 0.000 4.090 0.516 489 KIRC
Kidney Renal Clear Cell 0.000 0.000 13.333 0.673 75 KIRP Kidney
Renal Papilliary Cell 0.694 2.018 2.083 0.462 144 LGG Lower Grade
Glioma 1.754 3.268 15.789 0.620 57 LIHC Liver Hepatocellular
carcinoma 1.132 1.661 7.925 0.471 265 LUAD Lung adenocarcinoma
1.418 4.565 6.383 0.581 282 LUSC Lung squamous cell 1.792 2.061
15.950 0.601 558 OV Serous Ovarian 0.000 0.000 7.143 0.329 14 PAAD
Pancreatic adenocarinoma 0.000 0.000 2.000 0.475 100 PRAD Prostate
Adenocarcinoma 2.273 1.430 23.485 0.517 132 STAD Stomach
Adenocarcinoma 0.000 0.000 0.877 0.450 228 THCA Thyroid
adenocarcinoma 0.234 2.780 7.009 0.659 428 UCEC Uterine Corpus
Endometrioid Carcinoma Log2 = 1.32 .ltoreq. HighAmp < .infin.;
Log2 = 0.32 < LowAmp < 1.32
Genomic Definition of LAMP1 (13q34) Change (Gain/Amplification) on
the PDXs
[0974] LAMP1 gene gain or amplification can be related to a focal
somatic gain or amplification, a somatic large region gain or
amplification on 13 q, a somatic chromosome duplication, a somatic
chromosome triplication or polyploidy.
[0975] In colon tumor PDX, the LAMP1 DNA gain or amplification is
included in a larger amplicon involving: CUL4A, LAMP1, TFDP1, and
GAS6. As show in the Table 44, for the Colon cancer PDX, the mean
size segments are 8489.5 kb and 49292.7 kb for Amplification and
gain, respectively. The minimum region involves 454 kb, which
starts at base 113319683, ends at base 115107245 and contains
others genes than LAMP1: ADPRHL1, CUL4A, DCUNID2, GRTP1,
LOC100130463, PCID2, PRO7, TFDP1, TMCO3 and F10. Most of DNA gain
or amplification contains at least the genes: ADPRHL1,
.DELTA.TP11A, .DELTA.TP4B, CUL4A, DCUN1D2, F10, F7, FAM70B,
FLJ41484, FLJ44054, GAS6, GRK1, GRTP1, LAMP1, LINC00552,
LOC100128430, LOC100130463, LOC100506063, LOC100506394, MCF2L,
MCF2L-AS1, PCID2, PROZ, RASA3, TFDP1 and TMCO3C13orf35. The largest
gain region covers 95.8 Mb (19,296,544-115,107,245).
TABLE-US-00045 TABLE 44 Description analysis of LAMP1 Copy number
analysis of studied groups (LAMP1 Amplification, Gain, Diploid and
Heteroloss (Complete or partial loss of one allele of LAMP1 gene)
on Colon cancer PDX. Descriptive statistics for parameter Segment
(size in kb) Standard Status N Mean Deviation Hetloss 1 41152 .
Diploid 19 65768.5 31068.78 Gain 35 49292.7 37513.6 Amplification 6
8489.5 13016.03
[0976] In Lung Tumors PDX (Table 45), the mean of size segments is
14966.4 kb for gain. The minimum region covers 1186 kb.
TABLE-US-00046 TABLE 45 Description analysis of LAMP1 Copy number
analysis of studied groups (LAMP1 Amplification, Gain, Diploid,
Deletion and Heteroloss (Complete or partial loss of one allele of
LAMP1 gene) on Lung cancer PDX. Descriptive statistics for
parameter Segment (size in kb) Standard Status N Mean Deviation
Deletion 1 1460 . Hetloss 7 44592.4 39478.32 Diploid 17 26744.9
37016.96 Gain 9 14966.4 31033.29 Amplification 1 4874 .
Genomic Definition of LAMP1 (13q34) Gain on Esophageal Human Tumor
Cancer
[0977] In the Esophageal cancer DNA samples (Asterand), the LAMP1
gain or amplification is also including in a large amplicon, the
largest gain region involves 4523 kb (110584050-115107245) and the
smallest region present a LAMP1 amplification (Chr13q34) equal to
39.81 copy number. This focal amplification of LAMP1 covers 378 kb
and includes 10 genes: ADPRHL1, CUL4A, F10, F7, GRTP1, LAMP1,
LOC100130463, PCID2, PROZ and MCF2L.
TABLE-US-00047 TABLE 46 Description analysis of LAMP1 Copy number
analysis of studied groups (LAMP1 Amplification, Gain, Diploid and
Heteroloss (Complete or partial loss of one allele of LAMP1 gene)
on Eosophagus cancer tissues. Descriptive statistics for parameter
Segment (size in kb) Standard Status N Mean Deviation Loss 5 70415
29317.91 NoChange 39 48109.4 37656.46 Gain 1 4523 . Amplification 1
378 .
Example 15: Relation Between LAMP1 Gene Copy Number and mRNA Gene
Expression
[0978] Analyses of the mRNA Expression Level by Gene Expression
Profile and the Copy Number Change at LAMP1 Region
[0979] In addition to the analysis of LAMP1 Copy Number Change
(amplification and gain), using the CRC tumors PDX, the correlation
between LAMP1 amplification was evaluated by CGH analysis and LAMP1
expression by using mRNA (Affymetrix technology). Results from the
mRNA analysis, using Pearson correlation test (Table 47) indicated
high correlation ((r)=0.59; p<0.0001) between LAMP1 Copy Numbers
and LAMP1 mRNA expression levels (FIG. 8A). For the Colon tumors
PDX, a Student test is performed to compare LAMP1 gene copy number
(with or without gain/amplification) and LAMP1 mRNA expression.
mRNA expression analysis was performed using Affymetrix technology
(Table 48 and FIG. 8B).
TABLE-US-00048 TABLE 47 LAMP1: Copy Number Alteration Data and
correlation with mRNA data on CRC PDX Tumor Total of Number of
Number of Number of Number of Corr with P Type models Gain cases
gain cases >4.5 diploid Hetloss mRNA (r) values CRC 58 45161.2
+/- 30710.7 +/- 66942.5 +/- 91670 +/- 0.59 <0.0001 PDX
6987.02(Kb) 11123.32 (Kb) 6795.47 (Kb) (n = 1) (n = 29) (n = 9) (n
= 19) (<1%) (50%) (~15.5%) (~33%)
TABLE-US-00049 TABLE 48 Student t-test of mRNA expression for
factor copy number Student t-test for factor CopyNumber Mean +/-
SEM t Parameter <2.5 .gtoreq.2.5 DF value p RNA 11785.30 +/-
14987.09 +/- 55 -4.04 p = Intensity 496.501 (n = 18) 486.708 (n =
39) 0.0002 If p < 0.05, the factor has significant influence on
parameter
[0980] The mRNA expression is significantly higher for LAMP1 Copy
Numbers change (CN2.5).
[0981] The correlation analysis, using Pearson test between LAMP1
amplification by CGH analysis and LAMP1 expression by using mRNA,
shows a significantly correlation between these two parameter
studied.
[0982] As shown in FIG. 8a, the group with LAMP1 high amplification
(Amp) shows higher mRNA expression levels than groups with LAMP1
low amplification (Gain), Diploid and Hetloss.
[0983] The correlation analysis using a larger set of colorectal
patients tissues samples (n=574) from the TCGA (The Cancer Genome
Atlas) data, disclosed 14.4% amplification that correlates with
mRNA expression ((r)=0.57; p<0.0001), this result is extremely
similar with that observed on the CRC PDX.
[0984] Moreover, using the same dataset, a significant correlation
of LAMP1 copy number change and mRNA expression level was evidenced
for: Bladder Urothelial Carcinoma (BLCA), Breast Invasive Carcinoma
(BRCA), Lung adenocarcinoma (LUAD), Lung squamous cell (LUSC) and
Ovary (OV) (FIG. 9).
Example 16: LAMP1 Copy Number Variation and its Impact on the LAMP1
Protein Cell Membrane Expression Level
Association of LAMP1 Copy Number Change and the Protein Cell
Membrane Expression Level Detected by Immunohistochemistry
(IHC).
[0985] In addition to the analysis of LAMP1 gain and its relation
with the LAMP1 RNA expression, we also evaluated association of
LAMP1 copy number change (gain or amplification) to cell membrane
LAMP1 protein localization, using IHC expression scoring (strong,
medium, faint and negative) with antibody mAb1 for colon, lung and
stomach tumor PDXs.
[0986] As shown in tables 49 and 50 below, and FIG. 11, analysis of
IHC cell membrane expression in colon, lung and stomach PDXs
samples shows that LAMP1 protein is expressed in the membrane cells
in 39 out of 95 PDXs (41.1%) models studied; 33 of these PDXs
samples positive for LAMP1 membrane expression (33 out of 39; 85%)
present also LAMP1 gain or amplification, most of these are Colon
PDX.
TABLE-US-00050 TABLE 49 Frequency of LAMP1 Copy Number data and IHC
scoring data of colon tumor PDX Copy Number IHC Frequency Neg_Faint
Medium Strong Total <2.5 15 4 0 19 .gtoreq.2.5 13 18 10 41 Total
28 22 10 60
TABLE-US-00051 TABLE 50 Frequency of LAMP1 Copy number data and IHC
scoring data of lung and stomach tumor PDXs Copy Number IHC
Frequency Tumor Type Neg_Faint Medium_Strong Total <2.5 Lung 9 2
11 Stomach 11 0 11 .gtoreq.2.5 Lung 5 1 6 Stomach 3 4 7
[0987] The association between IHC membrane expression and the copy
number change was studied using Cochran-Mantel-Haenszel statistics
(Tables 51 and 52).
TABLE-US-00052 TABLE 51 Cochran-Mantel-Haenszel statistics of LAMP1
IHC membrane expression by the Copy Number of LAMP1 in the Colon
PDX tumor samples. Cochran-Mantel-Haenszel Statistics (Based on
Rank Scores) Alternative Hypothesis DF Value Prob Nonzero
Correlation 1 12.4418 0.0004
[0988] In Colon tumor PDX, the association between LAMP1 IHC
membrane expression and Copy Number of LAMP1 is significant.
TABLE-US-00053 TABLE 52 Cochran-Mantel-Haenszel statistics of LAMP1
IHC membrane expression by the Copy Number of LAMP1 in Lung and
Stomach PDX tumor samples. Cochran-Mantel-Haenszel Statistics
(Based on Rank Scores) Alternative Hypothesis DF Value Prob Nonzero
Correlation 1 4.5416 0.0331
[0989] After adjusting for tumor type, the association between
LAMP1 IHC membrane expression and Copy Number of LAMP1 is
significant.
[0990] We conclude that the level of LAMP1 cell surface
localization (Strong and medium) is associated with copy number
change on tumor PDX samples. Most of cell surface localization of
LAMP1 appears to be a consequence of LAMP1 gain or
amplification.
TABLE-US-00054 TABLE 53 Table summarizing LAMP1 gene gain and LAMP1
expression Segment Log2 ratio Membrane- Sample Name Indication
Status Class (size in kb) (Mean) Copynumber IHC_Score IHC_Level2
Expression LUN-NIC-0070 Lung Amplification Gain 4874 2.21 9.26 **
Medium Yes CR-LRB-0010-P Colon Amplification Gain 1029 2.15 8.88
*** Strong Yes CR-LRB-0011-M Colon Amplification Gain 34252 1.78
6.85 *** Strong Yes IMM-COLO-0010 Colon Amplification Gain 454 1.75
6.73 ** Medium Yes CR-IGR-0002-C Colon Amplification Gain 4451 1.62
6.14 ** Medium Yes CR-IC-0029-P Colon Amplification Gain 9080 1.58
5.99 *** Strong Yes IMM-COLO-0020 Colon Amplification Gain 1671
1.41 5.32 neg neg No CR-IC-0028-M Colon Gain Gain 95810 1.27 4.84
** Medium Yes CR-LRB-0017-P Colon Gain Gain 56497 1.27 4.83 neg neg
No CR-IGR-0025-P Colon Gain Gain 14032 1.27 4.82 ** Medium Yes
CR-IGR-0002-P Colon Gain Gain 59574 1.23 4.69 ** Medium Yes GAS0232
Stomach Gain Gain 1787 1.19 4.57096889 *** Strong Yes CR-IGR-0052-M
Colon Gain Gain 17965 1.16 4.47 ** Medium Yes IMM-COLO-0006 Colon
Gain Gain 95810 1.04 4.12 ** Medium Yes CR-IC-0010-P Colon Gain
Gain 92308 1.04 4.11 neg neg No CR-IGR-0007-P Colon Gain Gain 85070
0.99 3.97 *** Strong Yes CR-IGR-0047-P Colon Gain Gain 45330 0.97
3.91 ** Medium Yes CR-LRB-0013-P Colon Gain Gain 1575 0.89 3.71 **
Medium Yes LUN-NIC-0004 Lung Gain Gain 4305 0.89 3.7 neg neg No
CR-IGR-0014-P Colon Gain Gain 95810 0.89 3.7 * Faint No
CR-IGR-0016-P Colon Gain Gain 20181 0.82 3.54 ** Medium Yes
CR-LRB-0019-C Colon Gain Gain 941 0.8 3.49 *** Strong Yes
LUN-NIC-0040 Lung Gain Gain 5329 0.79 3.46 neg neg No LUN-NIC-0047
Lung Gain Gain 1560 0.77 3.42 neg neg No CR-IC-0007-M Colon Gain
Gain 25657 0.76 3.39 * Faint No CR-IC-0006-M Colon Gain Gain 4915
0.74 3.33 neg neg No CR-IC-0008-P Colon Gain Gain 19106 0.71 3.27
** Medium Yes CR-IGR-0048-M Colon Gain Gain 95810 0.71 3.26 * Faint
No CR-LRB-0014-P Colon Gain Gain 16868 0.69 3.22 ** Medium Yes
SA-STO-0073 Stomach Gain Gain 3160 0.67 3.19 *** Strong Yes
CR-IGR-0008-P Colon Gain Gain 523 0.64 3.12 neg neg No GAS0081
Stomach Gain Gain 209 0.63 3.100283186 neg neg No SA-STO-0043
Stomach Gain Gain 1984 0.61 3.05 ** Medium Yes CR-IGR-0009-P Colon
Gain Gain 73073 0.59 3 *** Strong Yes CR-IGR-0038-C Colon Gain Gain
14246 0.58 2.99 ** Medium Yes CR-LRB-0009-C Colon Gain Gain 54677
0.55 2.93 ** Medium Yes GAS0080 Stomach Gain Gain 1773 0.546
2.920671295 ** Medium Yes CR-IGR-0023-M Colon Gain Gain 95810 0.54
2.91 * Faint No IMM-COLO-0004 Colon Gain Gain 95810 0.47 2.78 ***
Strong Yes GAS0832 Stomach Gain Gain 57217 0.47 2.767915691 neg neg
No CR-IC-0005-P Colon Gain Gain 95810 0.47 2.76 *** Strong Yes
LUN-NIC-0002 Lung Gain Gain 1590 0.45 2.73 neg neg No IMM-COLO-0023
Colon Gain Gain 10757 0.45 2.72 *** Strong Yes CR-IC-0020-P Colon
Gain Gain 4364 0.44 2.71 ** Medium Yes CR-IC-0019-P Colon Gain Gain
95810 0.44 2.71 * Faint No CR-IC-0013-M Colon Gain Gain 39036 0.43
2.69 ** Medium Yes GAS0819 Stomach Gain Gain 1994 0.41 2.665858119
neg neg No CR-IGR-0011-C Colon Gain Gain 45835 0.38 2.6 ** Medium
Yes CR-IC-0009-M Colon Gain Gain 45566 0.38 2.6 *** Strong Yes
CR-LRB-0022-P Colon Gain Gain 4874 0.37 2.59 * Faint No
CR-IGR-0034-P Colon Gain Gain 16139 0.36 2.56 ** Medium Yes
LUN-NIC-0051 Lung Gain Gain 95810 0.33 2.51 neg neg No
CR-LRB-0007-P Colon Gain Gain 94994 0.32 2.5 * Faint No
CR-IC-0016-M Colon Gain Gain 94661 0.32 2.5 * Faint No CR-IC-0032-P
Colon NoChange NoGain 41073 0.3 2.47 * Faint No LUN-NIC-0011 Lung
NoChange NoGain 1560 0.3 2.46 neg neg No CR-IC-0025-M Colon
NoChange NoGain 57313 0.3 2.46 ** Medium Yes CR-IC-0002-P Colon
NoChange NoGain 86532 0.29 2.44 ** Medium Yes LUN-NIC-0006 Lung
NoChange NoGain 1587 0.28 2.42 ** Medium Yes CR-IC-0021-M Colon
NoChange NoGain 57313 0.23 2.35 * Faint No LUN-NIC-0034 Lung
NoChange NoGain 5334 0.22 2.33 neg neg No LUN-NIC-0041 Lung
NoChange NoGain 1753 0.2 2.29 neg neg No GAS0773 Stomach NoChange
NoGain 46737 0.17 2.25 neg neg No CR-IC-0003-P Colon NoChange
NoGain 95810 0.16 2.24 * Faint No CR-IC-0004-M Colon NoChange
NoGain 14209 0.14 2.2 * Faint No CR-IGR-0032-P Colon NoChange
NoGain 95810 0.1 2.15 * Faint No SA-STO-0014 Stomach NoChange
NoGain 7816 0.1 2.14 neg neg No GAS0720 Stomach NoChange NoGain
4061 0.099 2.14 neg neg No CR-IGR-0029-P Colon NoChange NoGain
57313 0.07 2.11 neg neg No IMM-COLO-0018 Colon NoChange NoGain 4936
0.06 2.09 neg neg No IMM-COLO-0008 Colon NoChange NoGain 95810 0.04
2.05 * Faint No IMM-COLO-0001 Colon NoChange NoGain 95810 0.03 2.05
neg neg No LUN-NIC-0060 Lung NoChange NoGain 33461 0.02 2.03 neg
neg No GAS0517 Stomach NoChange NoGain 1739 0.001 2.001 neg neg No
STO-IND-0006 Stomach NoChange NoGain 95810 0 2 neg neg No
SA-STO-0039 Stomach NoChange NoGain 14361 0 2 neg neg No
CR-LRB-0018-P Colon NoChange NoGain 62941 -0.02 1.97 neg neg No
CR-LRB-0003-P Colon NoChange NoGain 57313 -0.02 1.97 ** Medium Yes
SA-STO-0024 Stomach NoChange NoGain 7831 -0.03 1.96 neg neg No
CR-LRB-0004-P Colon NoChange NoGain 57313 -0.03 1.96 ** Medium Yes
CR-IGR-0012-P Colon NoChange NoGain 78930 -0.03 1.96 * Faint No
IMM-COLO-0009 Colon NoChange NoGain 95810 -0.04 1.95 * Faint No
CR-IC-0022-P Colon NoChange NoGain 7897 -0.08 1.89 * Faint No
GAS0928 Stomach NoChange NoGain 95810 -0.107 1.86 neg neg No
LUN-NIC-0001 Lung NoChange NoGain 1567 -0.19 1.75 neg neg No
GAS0680 Stomach NoChange NoGain 1217 -0.31 1.61 neg neg No
LUN-NIC-0007 Lung NoChange NoGain 1481 -0.32 1.6 neg neg No
CR-IGR-0003-P Colon NoChange NoGain 91670 -0.34 1.58 * Faint No
LUN-NIC-0066 Lung Loss NoGain 20716 -0.53 1.38 neg neg No GAS0248
Stomach Loss NoGain 57313 -0.5852 1.333113855 neg neg No
LUN-NIC-0081 Lung Loss NoGain 52860 -0.59 1.33 neg neg No
CR-IGR-0043-P Colon Loss NoGain 41152 -0.83 1.12 neg neg No
LUN-NIC-0030 Lung Loss NoGain 95810 -0.85 1.11 ** Medium Yes
GAS0707 Stomach Loss NoGain 3462 -0.9479 1.036772962 neg neg No
LUN-NIC-0033 Lung Deletion NoGain 1460 -1.16 0.89 neg neg No
Example 17:--Specific Peptide and mAb to Detect LAMP1 Membrane
Reinforcement on FFPE Tumor Tissue by Immunohistochemistry
(IHC)
[0991] IHC analysis of tumor tissues from biobanks or from
hospitals before or during patient treatment is routinely done with
formalin-fixed paraffin-embedded (FFPE) samples. Although
commercially available mAbs and the three mAbs described previously
(MAb1, MAb2 and MAb3) can allow intracellular detection of LAMP1
and some of them, including MAb1, 2 and 3, LAMP1 membrane
reinforcement in frozen-OCT and AFA (Alcohol Formalin Acetic acid
Fixative) sample format, none can lead to the detection of LAMP1
reinforcement in FFPE format. One of the reasons is probably the
effect of the formalin fixative combined to the complexity of the
protein. Samples processed in frozen OCT or AFA are not routinely
prepared in hospitals. Therefore, there is a need to have a mAb
that would allow complete and fast coverage of the FFPE tumor
biobanks and hospital samples.
[0992] It is shown in the examples below that it was possible to
overcome the difficulties by identifying a peptide (peptide 4)
located in the second luminal domain at positions 360 to 375 of SEQ
ID NO: 24, and having the amino acid sequence of SEQ ID NO: 82.
Said peptide permitted the obtention of rabbit polyclonal
antibodies and mouse monoclonal antibody that led to the detection
of LAMP1 membrane reinforcement in FFPE tissues.
TABLE-US-00055 TABLE 54 List of antiLAMP1 mAb tested and showing no
LAMP1 membrane reinforcement on FFPE tissues by IHC Species clone
number MAbs obtained from the following supplier Epitomics Rabbit
ERP4204 Novus Biologicals Mouse B-T47 Biolegend Mouse H4A3 United
States Biol Mouse 5K76 Santa Cruz Mouse E-5 Santa Cruz Mouse H5G11
Biorbyt Mouse monoclonal Biorbyt Rabbit monoclonal MAbs described
in this application MAb1 Mouse monoclonal MAb2 Mouse monoclonal
MAb3 Mouse monoclonal
Example 17.1: Production of Rabbit Polyclonal Antibodies that LED
to LAMP1 Membrane Reinforcement on FFPE Tumor Tissues
[0993] This example describes the selection of peptides in the
human LAMP1 luminal domains, the generation of polyclonal
antibodies and the IHC screening. It demonstrates the feasibility
to obtain polyclonal antibodies that allow the detection of LAMP1
membrane reinforcement on formalin-fixed paraffin-embedded tissues
when using the specific peptide ("peptide 4") of SEQ ID NO:82
corresponding to the amino acids at positions 360 to 375 on the
human LAMP1 sequence of SEQ ID NO:24.
Example 17.1.1: Rabbit Immunisation with Peptides or Soluble LAMP1
Protein. Purification of Polyclonal Antibodies
Peptide Preparation:
[0994] Peptides of 15-16 amino acids were selected within the two
luminal domains without a N-glycosylation site and no internal
cysteine. A total of four peptides were chemically synthesised and
coupled to the Keyhole Limpet Hemocyanin (KLH) carrier protein.
When needed, a terminal cysteine was previously added to the
peptide so that coupling occurred via its thiol group to maleimide
activated KLH protein.
TABLE-US-00056 TABLE 55 Description of the four selected peptides
Localisation on human LAMP1 sequence of SEQ ID NO: 24 Immunogen SEQ
ID 47-61 Peptide 1-KLH SEQ ID NO: 90 140-155 Peptide 2-KLH SEQ ID
NO: 91 307-321 Peptide 3-KLH SEQ ID NO: 92 360-375 Peptide 4-KLH
SEQ ID NO: 82
Immunisation and Obtention of Polyclonal Antibodies.
[0995] A total of three programs of rabbit immunisations were
performed. Rabbits were immunized in the first program, with
peptide 1 SEQ ID NO: 90 and peptide 2 of SEQ ID NO: 91, in the
second program with peptide 4 of SEQ ID NO: 82 and peptide 3 of SEQ
IOD NO: 92 and in the third program with heated denatured human
LAMP1::histag protein produced as described in example 6.2. In
brief, the immunisation schedule comprised four injections and a
final bleed after 28 days. Polyclonal response was determined by
ELISA on a sample from the final bleeds.
Purifications of Polyclonal Antibodies.
[0996] Reactive AF-aminoTOYOPEARL was used to couple each peptide
described on Table 55 and to generate four affinity chromatography
columns. The serum final bleeds on rabbits immunized with the
respective peptides were purified by peptide affinity
chromatography. The purified polyclonal batches were then
characterized by SDS-PAGE and ELISA.
[0997] The serum final bleed on the rabbit immunized with LAMP1
protein was purified by protein G affinity chromatography. The
purified polyclonal batch was then characterized by SDS-PAGE.
Example 17.1.2: IHC Screening and Identification of Polyclonal rAb4
(Rabbit Antibody 4) Obtained by Peptide 4 Immunization
[0998] Rabbit polyclonal antibodies generated with peptides
described in example 17.1.1 were tested by IHC on FFPE sample of
colon adenocarcinoma patient derived xenograft CR-LRB-010P and
human breast carcinoma. After antigen retrieval procedure and
endogen biotins blocking steps, slides were incubated with the
primary anti-antibody for 1 hour at 24.degree. C. Negative controls
were performed by omission of the primary antibody. The biotin free
anti-rabbit UltraMap.TM. horseradish peroxidase (HRP) conjugate
(760-4315, Ventana Medical Systems, Inc, USA) was used as secondary
antibody system according to manufacturer's recommendations.
Negative controls were performed by omission of the primary
antibody. A counterstaining step was done with hematoxylin
(760-2037, Ventana Medical Systems, Inc, USA) and bluing reagent
was applied (760-2037, Ventana Medical Systems, Inc, USA). Stained
slides were dehydrated and coverslipped with cytoseal XYL (8312-4,
Richard-Allan Scientific, USA). Only antibodies from peptide 4 of
SEQ ID NO: 82 immunization displayed LAMP1 membrane reinforcement
in FFPE samples as shown in FIG. 38.
Example 17.1.3: Validation of Polyclonal Rabbit (rAb4) Batch
[0999] ICC with Cells Expressing or not LAMP1 at the Membrane
[1000] Human-LAMP1 and empty-vector HEK transfected cells were
tested with the polyclonal rabbit rAb4 Antibody by
immunocytochemistry (ICC) in FFPE format. High level of
intracellular and surface cell LAMP1 immunostaining was obtained
using the polyclonal rabbit rAb4 Antibody Ab at 1 .mu.g/mL as shown
in FIG. 39.
Affinity to LAMP1 Protein
[1001] Secreted LAMP1::histag (29-382) with SEQ ID NO: 28 described
in example 6.2 was used to determine the affinity of the polyclonal
antibodies poly rAb4 by ELISA as described in example 6.3. The
polyclonal rabbit antibody poly rAb4 binds to LAMP1 with an
EC.sub.50 of around 3 nM whereas MAb1 binds with an EC.sub.50 of
0.16 nM.
Example 17.2: Obtention and Characterization of Mouse Monoclonal
Antibodies that LED to LAMP1 Membrane Reinforcement on FFPE Tumor
Tissues
Example 171.1: Mouse Immunisation and Selection of Mature IgG
LAMP1-Secreting Hybridoma
[1002] While immunizations have been performed with diverse protein
antigens including recombinant chimer human/mouse LAMP1 protein,
recombinant denatured human LAMP1 protein or recombinant human
LAMP1 protein, these approaches were not successful in identifying
antibody able to detect LAMP1 membrane reinforcement on FFPE tumor
tissues. These approaches used immunization protocol described in
example 2 for generation of anti-LAMP1 monoclonal antibodies and
LAMP1 proteins described in example 6.2. On the contrary, the
peptide 4-based immunization strategy has been shown to identify an
antibody eligible to detect LAMP1 membrane reinforcement on FFPE
tumor tissues.
[1003] Therefore mouse were immunised with peptide 4 and
anti-LAMP1-secreting hybridomas were selected as described
below.
Generation of Anti-LAMP1 Monoclonal Antibodies
[1004] Five BALB/cJ mice, about 6-8 weeks old (Charles River) were
immunized with 40 .mu.g of peptide 4 of SEQ ID NO: 82 using RIMMS
approach as described by Kilpatrick et al.; hybridoma, 1997: volume
16, number 4. B cells immortalization using P3X63-AG8.653 (ATCC,
ref CRL-1580) as fusion partner and hybridoma selection was
performed as described in example 2.
Selection of Anti-LAMP1 Antibodies by ELISA
[1005] The primary screen was an enzyme-linked immunosorbent assay
(ELISA) assay (described in example 6.3 for anti-LAMP1 IgG
production) using the LAMP1::histag protein described in example
6.2 as capturing antigen.
Example 17.2.2: IHC Screening and Identification of MAb4
[1006] As the same manner as in example 17.1.2, IHC screening was
performed with the hybridoma supernatant to identify mouse
monoclonal antibody showing LAMP1 membrane reinforcement on FFPE
sample of colon adenocarcinoma patient derived xenograft
CR-LRB-010P. The biotin free anti-mouse UltraMap.TM. horseradish
peroxidase (HRP) conjugate (760-152, Ventana Medical Systems, Inc,
USA) was used as secondary antibody system according to
manufacturer's recommendations.
[1007] The supernatant of the selected hybridoma 88LAMP1-2
displayed membrane reinforcement immunostaining in FFPE sample of
colon adenocarcinoma patient derived xenograft CR-LRB-010P. Other
irrelevant antibodies were negative or displayed intracellular
immunostaining as shown in FIG. 40.
Example 17.2.3: Validation of Hybridoma 88LAMP1-2
[1008] Purification and Characterisation of Mab4 Obtained from
Hybridoma 88LAMP1-2
[1009] Hybridoma 88LAMP1-2 was produced in medium A Clonacell-Hy
(StemCell Technologies #03801) supplemented with 5% HCS (PAA;
#F05-009) at the 400 mL scale and purified by protein A affinity
chromatography. The purified antibody MAb4 was characterized by
SDS-PAGE, and Mass Spectrometry. Masses of heavy and light chains
from MAb4 were identified as reported in example 7 and are reported
on the Table 55 below. Nucleic acid sequences encoding the variable
domains were retrieved from hybridoma cells by RT-PCR as described
in example 7. The corresponding amino acids from the heavy and
light chains led to masses in agreement with the respective masses
from MAb4.
TABLE-US-00057 TABLE 56 Mass characterization of MAb4 Mass obtained
by Mass calculated from mAb4 Isotype Mass Spectrometry amino acid
sequence Heavy chain mlgG1 (G0F) 50 169 Da 50 168 Da Light chain
mCk 23651 Da 23 650 Da
Example 17.3: In Vitro Characterisation of MAb4
Example 17.3.1: Apparent Affinity to Human LAMP1 and Cynomolgus
LAMP1 by ELISA
[1010] Antibody MAb4 was assessed for its ability to bind primate
LAMP1 protein by enzyme-linked immunosorbent assay (ELISA) assay as
described in example 4.7 and EC50 values determined as described in
example 6.2. Antibody MAb4 binds to human LAMP1 and cynomolgus
LAMP1 with similar affinity in range of 0.2 to 0.4 nM as shown in
Table 57 below.
TABLE-US-00058 TABLE 57 EC.sub.50 determined by ELISA values on
recombinant human LAMP1 and cynomolgus LAMP1 LAMP1 protein
EC.sub.50 Human LAMP1 0.39 nM cynomolgus LAMP1 0.22 nM
Example 17.3.2: Specificity to LAMP1
[1011] LAMP2 is the closest member of the LAMP family with 35%
sequence identity to LAMP1. Specificity of MAb4 was evaluated by
ELISA as described in example 4.6 with either LAMP1 or LAMP2
soluble proteins, as shown in FIG. 41. No binding to LAMP2 was
detected with MAb4 and a difference of more than 100 fold is
observed between the EC.sub.50 of MAb4 towards LAMP1 versus
LAMP2.
Example 17.3.3: Binding of Antibody MAb4 to Multiple Cancer Cells
and Determination of Antibody Binding Capacity by Flow
Cytometry
[1012] Antibody MAb4 was found to be able of binding to multiple
tumor cells by Flow Cytometry using the conditions described in
example 4.1. The panel of tumor cells comprises Patient-derived
tumor xenografts from different origins and tumor cell lines. The
Mean Flurescence Intensity (MFI) obtained from the flow cytometry
analysis is reported in Table 58. Table 59 summarizes the antibody
binding capacity results.
TABLE-US-00059 TABLE 58 Mean Florescence Intensity by FACS on
Patient-derived xenografts Mean Florescence Intensity (MFI)
CR-IGR-034P/colorectal 424 LUN-NIC-006/lung 162 LUN-NIC-033/lung
154 BRE-IGR-0159/breast 400 Colo205/colon 7
TABLE-US-00060 TABLE 59 Antibody Binding Capacity by FACS on
Patient-derived xenograft Antibody Binding Capacity (ABC) MAb4
PDX/origin CR-IGR-034P/colorectal 260 000 LUN-NIC-006/lung 92 000
LUN-NIC-033/lung 87 000 Cell lines/origin Colo205/colon 3000
Example 17.3. 4: Apparent Affinity of Antibody MAb4 to Human
Primary Colon Tumor PDX (CR-IGR-034P) by Row Cytometry
[1013] Apparent affinity of antibody MAb4 was evaluated to human
primary colon tumor PDX CR-IGR-034P by Flow Cytometry using the
conditions described in example 4.1. EC.sub.50 obtained with
CR-IGR-034P with MAb4 was 1.3 nM.
Example 17.3. 5: IHC Validation
[1014] Results obtained with purified batch are similar to those
obtained in example 17.2.2 with none purified MAb4.
Sequence CWU 1
1
991118PRTArtificial SequenceAntibody Fragment 1Gln Val Gln Leu Gln
Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys
Met Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Asn
Ile His Trp Val Lys Lys Ser Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ser Gln Lys Phe
50 55 60 Lys Asp Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr
Thr Tyr 65 70 75 80 Met Gln Leu Ser Arg Leu Thr Ser Glu Asp Ser Ala
Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp Val Ala Phe Ala
Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Ser Val Ser Ala 115
28PRTArtificial Sequenceantibody fragment 2Gly Tyr Ile Phe Thr Asn
Tyr Asn 1 5 38PRTArtificial Sequenceantibody fragment 3Ile Tyr Pro
Gly Asn Gly Asp Ala 1 5 411PRTArtificial Sequenceantibody fragment
4Val Arg Ala Asn Trp Asp Val Ala Phe Ala Tyr 1 5 10
5106PRTArtificial Sequenceantibody fragment 5Asp Ile Gln Met Thr
Gln Ser Pro Pro Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Gly Lys Val
Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asp Arg Tyr 20 25 30 Met
Ala Trp Tyr Gln Asp Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40
45 His Asp Thr Ser Thr Leu Gln Pro Gly Ile Pro Ser Arg Phe Ser Gly
50 55 60 Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu
Glu Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp
Asn Leu Trp Thr 85 90 95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
100 105 66PRTArtificial Sequenceantibody fragment 6Gln Asp Ile Asp
Arg Tyr 1 5 78PRTArtificial Sequenceantibody fragment 7Leu Gln Tyr
Asp Asn Leu Trp Thr 1 5 8122PRTArtificial Sequenceantibod fragment
8Gln Val Gln Leu Gln Gln Ser Ala Ala Glu Leu Ala Arg Pro Gly Ala 1
5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser
Tyr 20 25 30 Thr Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu
Glu Trp Ile 35 40 45 Gly Tyr Phe Asn Pro Ser Ser Gly Tyr Pro Glu
Tyr Asn Gln Lys Phe 50 55 60 Lys Asp Lys Thr Thr Leu Thr Ala Asp
Lys Ser Ser Asn Thr Ala Phe 65 70 75 80 Ile Gln Leu Asn Ser Leu Thr
Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ser Arg Gly Tyr Tyr
Tyr Gly Ser Arg Gly Tyr Ala Leu Asp Phe Trp 100 105 110 Gly Gln Gly
Ala Ser Val Thr Val Ser Ser 115 120 98PRTArtificial
Sequenceantibody fragment 9Gly Tyr Thr Phe Thr Ser Tyr Thr 1 5
108PRTArtificial Sequenceantibody fragment 10Phe Asn Pro Ser Ser
Gly Tyr Pro 1 5 1115PRTArtificial Sequenceantibody fragment 11Ser
Arg Gly Tyr Tyr Tyr Gly Ser Arg Gly Tyr Ala Leu Asp Phe 1 5 10 15
12111PRTArtificial Sequenceantibody fragment 12Asn Ile Val Leu Thr
Gln Ser Pro Val Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala
Thr Ile Ser Cys Arg Ala Ser Glu Ser Val Asp Ile Asn 20 25 30 Gly
Asn Thr Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro 35 40
45 Lys Leu Val Ile Tyr Ala Ala Ser Asn Ile Glu Ser Gly Val Pro Ala
50 55 60 Arg Phe Ser Gly Ser Gly Ser Ser Thr Asp Phe Thr Phe Thr
Ile Asp 65 70 75 80 Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys
Gln Gln Asn Ile 85 90 95 Glu Asp Pro Trp Thr Phe Gly Gly Gly Thr
Lys Val Glu Ile Lys 100 105 110 1310PRTArtificial Sequenceantibody
fragment 13Glu Ser Val Asp Ile Asn Gly Asn Thr Phe 1 5 10
149PRTArtificial Sequenceantibody fragment 14Gln Gln Asn Ile Glu
Asp Pro Trp Thr 1 5 15122PRTArtificial Sequenceantibody fragment
15Gln Val Gln Leu Gln Gln Ser Ala Ala Glu Leu Ala Arg Pro Gly Ala 1
5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser
Tyr 20 25 30 Thr Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu
Glu Trp Ile 35 40 45 Gly Tyr Phe Asn Pro Ser Ser Gly Tyr Pro Glu
Tyr Asn Gln Lys Phe 50 55 60 Lys Asp Lys Thr Thr Leu Thr Ala Asp
Lys Ser Ser Asn Thr Ala Phe 65 70 75 80 Ile Gln Leu Asn Ser Leu Thr
Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ser Arg Gly Tyr Tyr
Tyr Gly Ser Arg Gly Tyr Ala Leu Asp Phe Trp 100 105 110 Gly Gln Gly
Thr Ser Val Thr Val Ser Ser 115 120 16111PRTArtificial
Sequenceantibody fragment 16Asn Ile Val Leu Thr Gln Ser Pro Ala Ser
Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg
Ala Ser Glu Ser Val Asp Ile Asn 20 25 30 Gly Asn Thr Phe Met His
Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro 35 40 45 Lys Leu Leu Ile
Tyr Ala Ala Ser Asn Leu Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Asp 65 70 75 80
Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys Gln Gln Asn Ile 85
90 95 Glu Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
100 105 110 17447PRTArtificial Sequenceantibody fragment 17Gln Val
Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10 15
Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20
25 30 Asn Ile His Trp Val Lys Lys Ser Pro Gly Gln Gly Leu Glu Trp
Ile 35 40 45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ser
Gln Lys Phe 50 55 60 Lys Asp Lys Ala Thr Leu Thr Ala Asp Lys Ser
Ser Ser Thr Thr Tyr 65 70 75 80 Met Gln Leu Ser Arg Leu Thr Ser Glu
Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp Val
Ala Phe Ala Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Ser Val Ser
Ala Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115 120 125 Leu Ala Pro
Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140 Cys
Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 145 150
155 160 Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
Gln 165 170 175 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val
Pro Ser Ser 180 185 190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
Asn His Lys Pro Ser 195 200 205 Asn Thr Lys Val Asp Lys Lys Val Glu
Pro Lys Ser Cys Asp Lys Thr 210 215 220 His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro Ser 225 230 235 240 Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255 Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275
280 285 Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val 290 295 300 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr 305 310 315 320 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr 325 330 335 Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350 Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360 365 Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380 Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 385 390 395
400 Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
405 410 415 Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu Ala 420 425 430 Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly 435 440 445 18213PRTArtificial Sequenceantibody
fragment 18Asp Ile Gln Met Thr Gln Ser Pro Pro Ser Leu Ser Ala Ser
Leu Gly 1 5 10 15 Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp
Ile Asp Arg Tyr 20 25 30 Met Ala Trp Tyr Gln Asp Lys Pro Gly Lys
Gly Pro Arg Leu Leu Ile 35 40 45 His Asp Thr Ser Thr Leu Gln Pro
Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp
Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro 65 70 75 80 Glu Asp Ile Ala
Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95 Phe Gly
Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala Pro 100 105 110
Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr 115
120 125 Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala
Lys 130 135 140 Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn
Ser Gln Glu 145 150 155 160 Ser Val Thr Glu Gln Asp Ser Lys Asp Ser
Thr Tyr Ser Leu Ser Ser 165 170 175 Thr Leu Thr Leu Ser Lys Ala Asp
Tyr Glu Lys His Lys Val Tyr Ala 180 185 190 Cys Glu Val Thr His Gln
Gly Leu Ser Ser Pro Val Thr Lys Ser Phe 195 200 205 Asn Arg Gly Glu
Cys 210 19451PRTArtificial Sequenceantibody fragment 19Gln Val Gln
Leu Gln Gln Ser Ala Ala Glu Leu Ala Arg Pro Gly Ala 1 5 10 15 Ser
Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25
30 Thr Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45 Gly Tyr Phe Asn Pro Ser Ser Gly Tyr Pro Glu Tyr Asn Gln
Lys Phe 50 55 60 Lys Asp Lys Thr Thr Leu Thr Ala Asp Lys Ser Ser
Asn Thr Ala Phe 65 70 75 80 Ile Gln Leu Asn Ser Leu Thr Ser Glu Asp
Ser Ala Val Tyr Tyr Cys 85 90 95 Ser Arg Gly Tyr Tyr Tyr Gly Ser
Arg Gly Tyr Ala Leu Asp Phe Trp 100 105 110 Gly Gln Gly Ala Ser Val
Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 115 120 125 Ser Val Phe Pro
Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr 130 135 140 Ala Ala
Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr 145 150 155
160 Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro
165 170 175 Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val
Val Thr 180 185 190 Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile
Cys Asn Val Asn 195 200 205 His Lys Pro Ser Asn Thr Lys Val Asp Lys
Lys Val Glu Pro Lys Ser 210 215 220 Cys Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu 225 230 235 240 Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 245 250 255 Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 260 265 270 His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 275 280
285 Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
290 295 300 Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn 305 310 315 320 Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro 325 330 335 Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln 340 345 350 Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys Asn Gln Val 355 360 365 Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 370 375 380 Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 385 390 395 400
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr 405
410 415 Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val 420 425 430 Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu 435 440 445 Ser Pro Gly 450 20218PRTArtificial
Sequenceantibody fragment 20Asn Ile Val Leu Thr Gln Ser Pro Val Ser
Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg
Ala Ser Glu Ser Val Asp Ile Asn 20 25 30 Gly Asn Thr Phe Met His
Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro 35 40 45 Lys Leu Val Ile
Tyr Ala Ala Ser Asn Ile Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe
Ser Gly Ser Gly Ser Ser Thr Asp Phe Thr Phe Thr Ile Asp 65 70 75 80
Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys Gln Gln Asn Ile 85
90 95 Glu Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
Arg 100 105 110 Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln 115 120 125 Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr 130 135 140 Pro Arg Glu Ala Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln Ser 145 150 155 160 Gly Asn Ser Gln Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 165 170 175 Tyr Ser Leu Ser
Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 180 185 190 His Lys
Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro 195 200 205
Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215 21451PRTArtificial
Sequenceantibody fragment 21Gln Val Gln Leu Gln Gln Ser Ala Ala Glu
Leu Ala Arg Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Thr Met His Trp Val Lys
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Phe Asn
Pro Ser Ser Gly Tyr Pro Glu Tyr Asn Gln Lys Phe 50 55 60 Lys Asp
Lys Thr Thr Leu
Thr Ala Asp Lys Ser Ser Asn Thr Ala Phe 65 70 75 80 Ile Gln Leu Asn
Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ser Arg
Gly Tyr Tyr Tyr Gly Ser Arg Gly Tyr Ala Leu Asp Phe Trp 100 105 110
Gly Gln Gly Thr Ser Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 115
120 125 Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly
Thr 130 135 140 Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val Thr 145 150 155 160 Val Ser Trp Asn Ser Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro 165 170 175 Ala Val Leu Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr 180 185 190 Val Pro Ser Ser Ser Leu
Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn 195 200 205 His Lys Pro Ser
Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser 210 215 220 Cys Asp
Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 225 230 235
240 Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
245 250 255 Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp
Val Ser 260 265 270 His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu 275 280 285 Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr Asn Ser Thr 290 295 300 Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn 305 310 315 320 Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 325 330 335 Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 340 345 350 Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 355 360
365 Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
370 375 380 Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro 385 390 395 400 Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu Thr 405 410 415 Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser Val 420 425 430 Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu 435 440 445 Ser Pro Gly 450
22218PRTArtificial Sequenceantibody fragment 22Asn Ile Val Leu Thr
Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala
Thr Ile Ser Cys Arg Ala Ser Glu Ser Val Asp Ile Asn 20 25 30 Gly
Asn Thr Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro 35 40
45 Lys Leu Leu Ile Tyr Ala Ala Ser Asn Leu Glu Ser Gly Val Pro Ala
50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr
Ile Asp 65 70 75 80 Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys
Gln Gln Asn Ile 85 90 95 Glu Asp Pro Trp Thr Phe Gly Gly Gly Thr
Lys Leu Glu Ile Lys Arg 100 105 110 Thr Val Ala Ala Pro Ser Val Phe
Ile Phe Pro Pro Ser Asp Glu Gln 115 120 125 Leu Lys Ser Gly Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe Tyr 130 135 140 Pro Arg Glu Ala
Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser 145 150 155 160 Gly
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 165 170
175 Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys
180 185 190 His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser
Ser Pro 195 200 205 Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215
231254DNAHomo sapiens 23atggcggccc ccggcagcgc ccggcgaccc ctgctgctgc
tactgctgtt gctgctgctc 60ggcctcatgc attgtgcgtc agcagcaatg tttatggtga
aaaatggcaa cgggaccgcg 120tgcataatgg ccaacttctc tgctgccttc
tcagtgaact acgacaccaa gagtggccct 180aagaacatga cctttgacct
gccatcagat gccacagtgg tgctcaaccg cagctcctgt 240ggaaaagaga
acacttctga ccccagtctc gtgattgctt ttggaagagg acatacactc
300actctcaatt tcacgagaaa tgcaacacgt tacagcgtcc agctcatgag
ttttgtttat 360aacttgtcag acacacacct tttccccaat gcgagctcca
aagaaatcaa gactgtggaa 420tctataactg acatcagggc agatatagat
aaaaaataca gatgtgttag tggcacccag 480gtccacatga acaacgtgac
cgtaacgctc catgatgcca ccatccaggc gtacctttcc 540aacagcagct
tcagcagggg agagacacgc tgtgaacaag acaggccttc cccaaccaca
600gcgccccctg cgccacccag cccctcgccc tcacccgtgc ccaagagccc
ctctgtggac 660aagtacaacg tgagcggcac caacgggacc tgcctgctgg
ccagcatggg gctgcagctg 720aacctcacct atgagaggaa ggacaacacg
acggtgacaa ggcttctcaa catcaacccc 780aacaagacct cggccagcgg
gagctgcggc gcccacctgg tgactctgga gctgcacagc 840gagggcacca
ccgtcctgct cttccagttc gggatgaatg caagttctag ccggtttttc
900ctacaaggaa tccagttgaa tacaattctt cctgacgcca gagaccctgc
ctttaaagct 960gccaacggct ccctgcgagc gctgcaggcc acagtcggca
attcctacaa gtgcaacgcg 1020gaggagcacg tccgtgtcac gaaggcgttt
tcagtcaata tattcaaagt gtgggtccag 1080gctttcaagg tggaaggtgg
ccagtttggc tctgtggagg agtgtctgct ggacgagaac 1140agcatgctga
tccccatcgc tgtgggtggt gccctggcgg ggctggtcct catcgtcctc
1200atcgcctacc tcgtcggcag gaagaggagt cacgcaggct accagactat ctag
125424417PRTHomo sapiens 24Met Ala Ala Pro Gly Ser Ala Arg Arg Pro
Leu Leu Leu Leu Leu Leu 1 5 10 15 Leu Leu Leu Leu Gly Leu Met His
Cys Ala Ser Ala Ala Met Phe Met 20 25 30 Val Lys Asn Gly Asn Gly
Thr Ala Cys Ile Met Ala Asn Phe Ser Ala 35 40 45 Ala Phe Ser Val
Asn Tyr Asp Thr Lys Ser Gly Pro Lys Asn Met Thr 50 55 60 Phe Asp
Leu Pro Ser Asp Ala Thr Val Val Leu Asn Arg Ser Ser Cys 65 70 75 80
Gly Lys Glu Asn Thr Ser Asp Pro Ser Leu Val Ile Ala Phe Gly Arg 85
90 95 Gly His Thr Leu Thr Leu Asn Phe Thr Arg Asn Ala Thr Arg Tyr
Ser 100 105 110 Val Gln Leu Met Ser Phe Val Tyr Asn Leu Ser Asp Thr
His Leu Phe 115 120 125 Pro Asn Ala Ser Ser Lys Glu Ile Lys Thr Val
Glu Ser Ile Thr Asp 130 135 140 Ile Arg Ala Asp Ile Asp Lys Lys Tyr
Arg Cys Val Ser Gly Thr Gln 145 150 155 160 Val His Met Asn Asn Val
Thr Val Thr Leu His Asp Ala Thr Ile Gln 165 170 175 Ala Tyr Leu Ser
Asn Ser Ser Phe Ser Arg Gly Glu Thr Arg Cys Glu 180 185 190 Gln Asp
Arg Pro Ser Pro Thr Thr Ala Pro Pro Ala Pro Pro Ser Pro 195 200 205
Ser Pro Ser Pro Val Pro Lys Ser Pro Ser Val Asp Lys Tyr Asn Val 210
215 220 Ser Gly Thr Asn Gly Thr Cys Leu Leu Ala Ser Met Gly Leu Gln
Leu 225 230 235 240 Asn Leu Thr Tyr Glu Arg Lys Asp Asn Thr Thr Val
Thr Arg Leu Leu 245 250 255 Asn Ile Asn Pro Asn Lys Thr Ser Ala Ser
Gly Ser Cys Gly Ala His 260 265 270 Leu Val Thr Leu Glu Leu His Ser
Glu Gly Thr Thr Val Leu Leu Phe 275 280 285 Gln Phe Gly Met Asn Ala
Ser Ser Ser Arg Phe Phe Leu Gln Gly Ile 290 295 300 Gln Leu Asn Thr
Ile Leu Pro Asp Ala Arg Asp Pro Ala Phe Lys Ala 305 310 315 320 Ala
Asn Gly Ser Leu Arg Ala Leu Gln Ala Thr Val Gly Asn Ser Tyr 325 330
335 Lys Cys Asn Ala Glu Glu His Val Arg Val Thr Lys Ala Phe Ser Val
340 345 350 Asn Ile Phe Lys Val Trp Val Gln Ala Phe Lys Val Glu Gly
Gly Gln 355 360 365 Phe Gly Ser Val Glu Glu Cys Leu Leu Asp Glu Asn
Ser Met Leu Ile 370 375 380 Pro Ile Ala Val Gly Gly Ala Leu Ala Gly
Leu Val Leu Ile Val Leu 385 390 395 400 Ile Ala Tyr Leu Val Gly Arg
Lys Arg Ser His Ala Gly Tyr Gln Thr 405 410 415 Ile 25406PRTMus
musculus 25Met Ala Ala Pro Gly Ala Arg Arg Pro Leu Leu Leu Leu Leu
Leu Ala 1 5 10 15 Gly Leu Ala His Gly Ala Ser Ala Leu Phe Glu Val
Lys Asn Asn Gly 20 25 30 Thr Thr Cys Ile Met Ala Ser Phe Ser Ala
Ser Phe Leu Thr Thr Tyr 35 40 45 Glu Thr Ala Asn Gly Ser Gln Ile
Val Asn Ile Ser Leu Pro Ala Ser 50 55 60 Ala Glu Val Leu Lys Asn
Gly Ser Ser Cys Gly Lys Glu Asn Val Ser 65 70 75 80 Asp Pro Ser Leu
Thr Ile Thr Phe Gly Arg Gly Tyr Leu Leu Thr Leu 85 90 95 Asn Phe
Thr Lys Asn Thr Thr Arg Tyr Ser Val Gln His Met Tyr Phe 100 105 110
Thr Tyr Asn Leu Ser Asp Thr Glu His Phe Pro Asn Ala Ile Ser Lys 115
120 125 Glu Ile Tyr Thr Met Asp Ser Thr Thr Asp Ile Lys Ala Asp Ile
Asn 130 135 140 Lys Ala Tyr Arg Cys Val Ser Asp Ile Arg Val Tyr Met
Lys Asn Val 145 150 155 160 Thr Val Val Leu Arg Asp Ala Thr Ile Gln
Ala Tyr Leu Ser Ser Gly 165 170 175 Asn Phe Ser Lys Glu Glu Thr His
Cys Thr Gln Asp Gly Pro Ser Pro 180 185 190 Thr Thr Gly Pro Pro Ser
Pro Ser Pro Pro Leu Val Pro Thr Asn Pro 195 200 205 Thr Val Ser Lys
Tyr Asn Val Thr Gly Asn Asn Gly Thr Cys Leu Leu 210 215 220 Ala Ser
Met Ala Leu Gln Leu Asn Ile Thr Tyr Leu Lys Lys Asp Asn 225 230 235
240 Lys Thr Val Thr Arg Ala Phe Asn Ile Ser Pro Asn Asp Thr Ser Ser
245 250 255 Gly Ser Cys Gly Ile Asn Leu Val Thr Leu Lys Val Glu Asn
Lys Asn 260 265 270 Arg Ala Leu Glu Leu Gln Phe Gly Met Asn Ala Ser
Ser Ser Leu Phe 275 280 285 Phe Leu Gln Gly Val Arg Leu Asn Met Thr
Leu Pro Asp Ala Leu Val 290 295 300 Pro Thr Phe Ser Ile Ser Asn His
Ser Leu Lys Ala Leu Gln Ala Thr 305 310 315 320 Val Gly Asn Ser Tyr
Lys Cys Asn Thr Glu Glu His Ile Phe Val Ser 325 330 335 Lys Met Leu
Ser Leu Asn Val Phe Ser Val Gln Val Gln Ala Phe Lys 340 345 350 Val
Asp Ser Asp Arg Phe Gly Ser Val Glu Glu Cys Val Gln Asp Gly 355 360
365 Asn Asn Met Leu Ile Pro Ile Ala Val Gly Gly Ala Leu Ala Gly Leu
370 375 380 Val Leu Ile Val Leu Ile Ala Tyr Leu Ile Gly Arg Lys Arg
Ser His 385 390 395 400 Ala Gly Tyr Gln Thr Ile 405 26407PRTRattus
norvegicus 26Met Ala Ala Pro Gly Ala Arg Arg Pro Leu Leu Leu Leu
Leu Leu Ala 1 5 10 15 Gly Leu Ala His Ser Ala Pro Ala Leu Phe Glu
Val Lys Asp Asn Asn 20 25 30 Gly Thr Ala Cys Ile Met Ala Ser Phe
Ser Ala Ser Phe Leu Thr Thr 35 40 45 Tyr Asp Ala Gly His Val Ser
Lys Val Ser Asn Met Thr Leu Pro Ala 50 55 60 Ser Ala Glu Val Leu
Lys Asn Ser Ser Ser Cys Gly Glu Lys Asn Ala 65 70 75 80 Ser Glu Pro
Thr Leu Ala Ile Thr Phe Gly Glu Gly Tyr Leu Leu Lys 85 90 95 Leu
Thr Phe Thr Lys Asn Thr Thr Arg Tyr Ser Val Gln His Met Tyr 100 105
110 Phe Thr Tyr Asn Leu Ser Asp Thr Gln Phe Phe Pro Asn Ala Ser Ser
115 120 125 Lys Gly Pro Asp Thr Val Asp Ser Thr Thr Asp Ile Lys Ala
Asp Ile 130 135 140 Asn Lys Thr Tyr Arg Cys Val Ser Asp Ile Arg Val
Tyr Met Lys Asn 145 150 155 160 Val Thr Ile Val Leu Trp Asp Ala Thr
Ile Gln Ala Tyr Leu Pro Ser 165 170 175 Ser Asn Phe Ser Lys Glu Glu
Thr Arg Cys Pro Gln Asp Gln Pro Ser 180 185 190 Pro Thr Thr Gly Pro
Pro Ser Pro Ser Pro Pro Leu Val Pro Thr Asn 195 200 205 Pro Ser Val
Ser Lys Tyr Asn Val Thr Gly Asp Asn Gly Thr Cys Leu 210 215 220 Leu
Ala Ser Met Ala Leu Gln Leu Asn Ile Thr Tyr Met Lys Lys Asp 225 230
235 240 Asn Thr Thr Val Thr Arg Ala Phe Asn Ile Asn Pro Ser Asp Lys
Tyr 245 250 255 Ser Gly Thr Cys Gly Ala Gln Leu Val Thr Leu Lys Val
Gly Asn Lys 260 265 270 Ser Arg Val Leu Glu Leu Gln Phe Gly Met Asn
Ala Thr Ser Ser Leu 275 280 285 Phe Phe Leu Gln Gly Val Gln Leu Asn
Met Thr Leu Pro Asp Ala Ile 290 295 300 Glu Pro Thr Phe Ser Thr Ser
Asn Tyr Ser Leu Lys Ala Leu Gln Ala 305 310 315 320 Ser Val Gly Asn
Ser Tyr Lys Cys Asn Ser Glu Glu His Ile Phe Val 325 330 335 Ser Lys
Ala Leu Ala Leu Asn Val Phe Ser Val Gln Val Gln Ala Phe 340 345 350
Arg Val Glu Ser Asp Arg Phe Gly Ser Val Glu Glu Cys Val Gln Asp 355
360 365 Gly Asn Asn Met Leu Ile Pro Ile Ala Val Gly Gly Ala Leu Ala
Gly 370 375 380 Leu Val Leu Ile Val Leu Ile Ala Tyr Leu Ile Gly Arg
Lys Arg Ser 385 390 395 400 His Ala Gly Tyr Gln Thr Ile 405
27416PRTMacaca mulatta 27Met Ala Ala Pro Gly Ser Ala Arg Arg Ser
Leu Leu Leu Leu Leu Leu 1 5 10 15 Leu Leu Leu Gly Leu Thr His Cys
Ala Ser Ala Ala Met Phe Ile Val 20 25 30 Lys Asn Gly Asn Gly Thr
Ala Cys Ile Met Ala Asn Phe Ser Ala Ala 35 40 45 Phe Ser Val Asn
Tyr Asp Thr Lys Ser Gly Pro Lys Asn Met Thr Phe 50 55 60 Asp Leu
Pro Ser Asp Ala Lys Val Val Leu Asn Ser Ser Ser Cys Gly 65 70 75 80
Lys Glu Asn Thr Ser Asp Pro Ser Leu Val Ile Ala Phe Gly Arg Gly 85
90 95 Gln Thr Leu Thr Leu Asn Phe Thr Arg Asn Ala Thr Arg Tyr Ser
Val 100 105 110 Gln Leu Met Ser Phe Val Tyr Asn Leu Ser Asp Thr His
Leu Phe Pro 115 120 125 Asn Ala Ser Ser Lys Glu Ile Lys Thr Val Glu
Ser Ile Thr Asp Ile 130 135 140 Arg Ala Asp Ile Asp Lys Lys Tyr Arg
Cys Val Ser Gly Thr Gln Val 145 150 155 160 His Met Asn Asn Val Thr
Val Thr Leu His Asp Ala Thr Ile Gln Ala 165 170 175 Tyr Leu Ser Asn
Ser Ser Phe Ser Arg Glu Glu Thr Arg Cys Glu Gln 180 185 190 Asp Arg
Pro Ser Pro Thr Thr Ala Pro Pro Ala Pro Pro Ser Pro Ser 195 200 205
Pro Ser Pro Val Pro Glu Ser Pro Ser Val Asp Lys Tyr Asn Val Ser 210
215 220 Gly Thr Asn Gly Thr Cys Leu Leu Ala Ser Met Gly Leu Gln Leu
Asn 225 230 235 240 Leu Thr Tyr Glu Arg Lys Asp Asn Thr Thr Val Thr
Arg Leu Leu Asn 245 250 255 Ile Asn Pro Asn Lys Thr Leu Ala Ser
Gly
Ser Cys Gly Ala His Leu 260 265 270 Val Thr Leu Glu Leu His Ser Glu
Gly Ser Thr Val Leu Leu Phe Gln 275 280 285 Phe Gly Met Asn Ala Ser
Ser Ser Arg Phe Phe Leu Gln Gly Ile Gln 290 295 300 Leu Asn Thr Thr
Leu Pro Asp Ala Arg Asp Pro Ala Phe Lys Ala Ala 305 310 315 320 Asn
Ser Ser Leu Arg Ala Leu Gln Ala Thr Val Gly Asn Ser Tyr Lys 325 330
335 Cys Asn Ala Glu Glu His Val Arg Val Thr Lys Ala Phe Ser Val Asn
340 345 350 Ile Phe Lys Val Trp Val Gln Ala Phe Lys Val Glu Gly Gly
Gln Phe 355 360 365 Gly Ser Val Glu Glu Cys Leu Leu Asp Glu Asn Asn
Met Leu Ile Pro 370 375 380 Ile Ala Val Gly Gly Ala Leu Ala Gly Leu
Val Leu Ile Val Leu Ile 385 390 395 400 Ala Tyr Leu Val Gly Arg Lys
Arg Ser His Ala Gly Tyr Gln Thr Ile 405 410 415 28360PRTArtificial
Sequencehuman LAMP1 expression construct 28Ala Met Phe Met Val Lys
Asn Gly Asn Gly Thr Ala Cys Ile Met Ala 1 5 10 15 Asn Phe Ser Ala
Ala Phe Ser Val Asn Tyr Asp Thr Lys Ser Gly Pro 20 25 30 Lys Asn
Met Thr Phe Asp Leu Pro Ser Asp Ala Thr Val Val Leu Asn 35 40 45
Arg Ser Ser Cys Gly Lys Glu Asn Thr Ser Asp Pro Ser Leu Val Ile 50
55 60 Ala Phe Gly Arg Gly His Thr Leu Thr Leu Asn Phe Thr Arg Asn
Ala 65 70 75 80 Thr Arg Tyr Ser Val Gln Leu Met Ser Phe Val Tyr Asn
Leu Ser Asp 85 90 95 Thr His Leu Phe Pro Asn Ala Ser Ser Lys Glu
Ile Lys Thr Val Glu 100 105 110 Ser Ile Thr Asp Ile Arg Ala Asp Ile
Asp Lys Lys Tyr Arg Cys Val 115 120 125 Ser Gly Thr Gln Val His Met
Asn Asn Val Thr Val Thr Leu His Asp 130 135 140 Ala Thr Ile Gln Ala
Tyr Leu Ser Asn Ser Ser Phe Ser Arg Gly Glu 145 150 155 160 Thr Arg
Cys Glu Gln Asp Arg Pro Ser Pro Thr Thr Ala Pro Pro Ala 165 170 175
Pro Pro Ser Pro Ser Pro Ser Pro Val Pro Lys Ser Pro Ser Val Asp 180
185 190 Lys Tyr Asn Val Ser Gly Thr Asn Gly Thr Cys Leu Leu Ala Ser
Met 195 200 205 Gly Leu Gln Leu Asn Leu Thr Tyr Glu Arg Lys Asp Asn
Thr Thr Val 210 215 220 Thr Arg Leu Leu Asn Ile Asn Pro Asn Lys Thr
Ser Ala Ser Gly Ser 225 230 235 240 Cys Gly Ala His Leu Val Thr Leu
Glu Leu His Ser Glu Gly Thr Thr 245 250 255 Val Leu Leu Phe Gln Phe
Gly Met Asn Ala Ser Ser Ser Arg Phe Phe 260 265 270 Leu Gln Gly Ile
Gln Leu Asn Thr Ile Leu Pro Asp Ala Arg Asp Pro 275 280 285 Ala Phe
Lys Ala Ala Asn Gly Ser Leu Arg Ala Leu Gln Ala Thr Val 290 295 300
Gly Asn Ser Tyr Lys Cys Asn Ala Glu Glu His Val Arg Val Thr Lys 305
310 315 320 Ala Phe Ser Val Asn Ile Phe Lys Val Trp Val Gln Ala Phe
Lys Val 325 330 335 Glu Gly Gly Gln Phe Gly Ser Val Glu Glu Cys Leu
Leu Asp Glu Asn 340 345 350 Ser Met His His His His His His 355 360
29362PRTArtificial Sequencecynomologous protein expression
construct 29Ala Met Phe Ile Val Lys Asn Gly Asn Gly Thr Ala Cys Ile
Met Ala 1 5 10 15 Asn Phe Ser Ala Ala Phe Ser Val Asn Tyr Asp Thr
Lys Ser Gly Pro 20 25 30 Lys Asn Met Thr Phe Asp Leu Pro Ser Asp
Ala Lys Val Val Leu Asn 35 40 45 Ser Ser Ser Cys Gly Lys Glu Asn
Thr Ser Asp Pro Ser Leu Val Ile 50 55 60 Ala Phe Gly Arg Gly Gln
Thr Leu Thr Leu Asn Phe Thr Arg Asn Ala 65 70 75 80 Thr Arg Tyr Ser
Val Gln Leu Met Ser Phe Val Tyr Asn Leu Ser Asp 85 90 95 Thr His
Leu Phe Pro Asn Ala Ser Ser Lys Glu Ile Lys Thr Val Glu 100 105 110
Ser Ile Thr Asp Ile Arg Ala Asp Ile Asp Lys Lys Tyr Arg Cys Val 115
120 125 Ser Gly Thr Gln Val His Met Asn Asn Val Thr Val Thr Leu His
Asp 130 135 140 Ala Thr Ile Gln Ala Tyr Leu Ser Asn Ser Ser Phe Ser
Arg Glu Glu 145 150 155 160 Thr Arg Cys Glu Gln Asp Arg Pro Ser Pro
Thr Thr Ala Pro Pro Ala 165 170 175 Pro Pro Ser Pro Ser Pro Ser Pro
Val Pro Glu Ser Pro Ser Val Asp 180 185 190 Lys Tyr Asn Val Ser Gly
Thr Asn Gly Thr Cys Leu Leu Ala Ser Met 195 200 205 Gly Leu Gln Leu
Asn Leu Thr Tyr Glu Arg Lys Asp Asn Thr Thr Val 210 215 220 Thr Arg
Leu Leu Asn Ile Asn Pro Asn Lys Thr Leu Ala Ser Gly Ser 225 230 235
240 Cys Gly Ala His Leu Val Thr Leu Glu Leu His Ser Glu Gly Ser Thr
245 250 255 Val Leu Leu Phe Gln Phe Gly Met Asn Ala Ser Ser Ser Arg
Phe Phe 260 265 270 Leu Gln Gly Ile Gln Leu Asn Thr Thr Leu Pro Asp
Ala Arg Asp Pro 275 280 285 Ala Phe Lys Ala Ala Asn Ser Ser Leu Arg
Ala Leu Gln Ala Thr Val 290 295 300 Gly Asn Ser Tyr Lys Cys Asn Ala
Glu Glu His Val Arg Val Thr Lys 305 310 315 320 Ala Phe Ser Val Asn
Ile Phe Lys Val Trp Val Gln Ala Phe Lys Val 325 330 335 Glu Gly Gly
Gln Phe Gly Ser Val Glu Glu Cys Leu Leu Asp Glu Asn 340 345 350 Asn
Met Ala Ser His His His His His His 355 360 30358PRTArtificial
Sequenceprotein expression construct 30Leu Phe Glu Val Lys Asn Asn
Gly Thr Thr Cys Ile Met Ala Ser Phe 1 5 10 15 Ser Ala Ser Phe Leu
Thr Thr Tyr Glu Thr Ala Asn Gly Ser Gln Ile 20 25 30 Val Asn Ile
Ser Leu Pro Ala Ser Ala Glu Val Leu Lys Asn Gly Ser 35 40 45 Ser
Cys Gly Lys Glu Asn Val Ser Asp Pro Ser Leu Thr Ile Thr Phe 50 55
60 Gly Arg Gly Tyr Leu Leu Thr Leu Asn Phe Thr Arg Asn Ala Thr Arg
65 70 75 80 Tyr Ser Val Gln Leu Met Ser Phe Val Tyr Asn Leu Ser Asp
Thr His 85 90 95 Leu Phe Pro Asn Ala Ser Ser Lys Glu Ile Lys Thr
Val Glu Ser Ile 100 105 110 Thr Asp Ile Arg Ala Asp Ile Asp Lys Lys
Tyr Arg Cys Val Ser Gly 115 120 125 Thr Gln Val His Met Asn Asn Val
Thr Val Thr Leu His Asp Ala Thr 130 135 140 Ile Gln Ala Tyr Leu Ser
Asn Ser Ser Phe Ser Arg Gly Glu Thr Arg 145 150 155 160 Cys Glu Gln
Asp Arg Pro Ser Pro Thr Thr Ala Pro Pro Ala Pro Pro 165 170 175 Ser
Pro Ser Pro Ser Pro Val Pro Lys Ser Pro Ser Val Asp Lys Tyr 180 185
190 Asn Val Ser Gly Thr Asn Gly Thr Cys Leu Leu Ala Ser Met Gly Leu
195 200 205 Gln Leu Asn Leu Thr Tyr Glu Arg Lys Asp Asn Thr Thr Val
Thr Arg 210 215 220 Leu Leu Asn Ile Asn Pro Asn Lys Thr Ser Ala Ser
Gly Ser Cys Gly 225 230 235 240 Ala His Leu Val Thr Leu Glu Leu His
Ser Glu Gly Thr Thr Val Leu 245 250 255 Leu Phe Gln Phe Gly Met Asn
Ala Ser Ser Ser Arg Phe Phe Leu Gln 260 265 270 Gly Ile Gln Leu Asn
Thr Ile Leu Pro Asp Ala Arg Asp Pro Ala Phe 275 280 285 Lys Ala Ala
Asn Gly Ser Leu Arg Ala Leu Gln Ala Thr Val Gly Asn 290 295 300 Ser
Tyr Lys Cys Asn Ala Glu Glu His Val Arg Val Thr Lys Ala Phe 305 310
315 320 Ser Val Asn Ile Phe Lys Val Trp Val Gln Ala Phe Lys Val Glu
Gly 325 330 335 Gly Gln Phe Gly Ser Val Glu Glu Cys Leu Leu Asp Glu
Asn Ser Met 340 345 350 His His His His His His 355
31358PRTArtificial Sequenceprotein expression construct 31Leu Phe
Glu Val Lys Asn Asn Gly Thr Thr Cys Ile Met Ala Ser Phe 1 5 10 15
Ser Ala Ser Phe Leu Thr Thr Tyr Glu Thr Ala Asn Gly Ser Gln Ile 20
25 30 Val Asn Ile Ser Leu Pro Ala Ser Ala Glu Val Leu Lys Asn Gly
Ser 35 40 45 Ser Cys Gly Lys Glu Asn Val Ser Asp Pro Ser Leu Thr
Ile Thr Phe 50 55 60 Gly Arg Gly Tyr Leu Leu Thr Leu Asn Phe Thr
Lys Asn Thr Thr Arg 65 70 75 80 Tyr Ser Val Gln His Met Tyr Phe Thr
Tyr Asn Leu Ser Asp Thr Glu 85 90 95 His Phe Pro Asn Ala Ile Ser
Lys Glu Ile Tyr Thr Met Asp Ser Thr 100 105 110 Thr Asp Ile Lys Ala
Asp Ile Asn Lys Ala Tyr Arg Cys Val Ser Asp 115 120 125 Ile Arg Val
Tyr Met Lys Asn Val Thr Val Val Leu Arg Asp Ala Thr 130 135 140 Ile
Gln Ala Tyr Leu Ser Ser Gly Asn Phe Ser Lys Glu Glu Thr His 145 150
155 160 Cys Thr Gln Asp Gly Pro Ser Pro Thr Thr Ala Pro Pro Ala Pro
Pro 165 170 175 Ser Pro Ser Pro Ser Pro Val Pro Lys Ser Pro Ser Val
Asp Lys Tyr 180 185 190 Asn Val Ser Gly Thr Asn Gly Thr Cys Leu Leu
Ala Ser Met Gly Leu 195 200 205 Gln Leu Asn Leu Thr Tyr Glu Arg Lys
Asp Asn Thr Thr Val Thr Arg 210 215 220 Leu Leu Asn Ile Asn Pro Asn
Lys Thr Ser Ala Ser Gly Ser Cys Gly 225 230 235 240 Ala His Leu Val
Thr Leu Glu Leu His Ser Glu Gly Thr Thr Val Leu 245 250 255 Leu Phe
Gln Phe Gly Met Asn Ala Ser Ser Ser Arg Phe Phe Leu Gln 260 265 270
Gly Ile Gln Leu Asn Thr Ile Leu Pro Asp Ala Arg Asp Pro Ala Phe 275
280 285 Lys Ala Ala Asn Gly Ser Leu Arg Ala Leu Gln Ala Thr Val Gly
Asn 290 295 300 Ser Tyr Lys Cys Asn Ala Glu Glu His Val Arg Val Thr
Lys Ala Phe 305 310 315 320 Ser Val Asn Ile Phe Lys Val Trp Val Gln
Ala Phe Lys Val Glu Gly 325 330 335 Gly Gln Phe Gly Ser Val Glu Glu
Cys Leu Leu Asp Glu Asn Ser Met 340 345 350 His His His His His His
355 32355PRTArtificial Sequenceprotein expression construct 32Ala
Met Phe Met Val Lys Asn Gly Asn Gly Thr Ala Cys Ile Met Ala 1 5 10
15 Asn Phe Ser Ala Ala Phe Ser Val Asn Tyr Asp Thr Lys Ser Gly Pro
20 25 30 Lys Asn Met Thr Phe Asp Leu Pro Ser Asp Ala Thr Val Val
Leu Asn 35 40 45 Arg Ser Ser Cys Gly Lys Glu Asn Thr Ser Asp Pro
Ser Leu Val Ile 50 55 60 Ala Phe Gly Arg Gly His Thr Leu Thr Leu
Asn Phe Thr Arg Asn Ala 65 70 75 80 Thr Arg Tyr Ser Val Gln Leu Met
Ser Phe Val Tyr Asn Leu Ser Asp 85 90 95 Thr His Leu Phe Pro Asn
Ala Ser Ser Lys Glu Ile Lys Thr Val Glu 100 105 110 Ser Ile Thr Asp
Ile Arg Ala Asp Ile Asp Lys Lys Tyr Arg Cys Val 115 120 125 Ser Gly
Thr Gln Val His Met Asn Asn Val Thr Val Thr Leu His Asp 130 135 140
Ala Thr Ile Gln Ala Tyr Leu Ser Asn Ser Ser Phe Ser Arg Gly Glu 145
150 155 160 Thr Arg Cys Glu Gln Asp Arg Pro Ser Pro Thr Thr Gly Pro
Pro Ser 165 170 175 Pro Ser Pro Pro Leu Val Pro Thr Asn Pro Thr Val
Ser Lys Tyr Asn 180 185 190 Val Thr Gly Asn Asn Gly Thr Cys Leu Leu
Ala Ser Met Ala Leu Gln 195 200 205 Leu Asn Ile Thr Tyr Leu Lys Lys
Asp Asn Lys Thr Val Thr Arg Ala 210 215 220 Phe Asn Ile Ser Pro Asn
Asp Thr Ser Ser Gly Ser Cys Gly Ile Asn 225 230 235 240 Leu Val Thr
Leu Lys Val Glu Asn Lys Asn Arg Ala Leu Glu Leu Gln 245 250 255 Phe
Gly Met Asn Ala Ser Ser Ser Leu Phe Phe Leu Gln Gly Val Arg 260 265
270 Leu Asn Met Thr Leu Pro Asp Ala Leu Val Pro Thr Phe Ser Ile Ser
275 280 285 Asn His Ser Leu Lys Ala Leu Gln Ala Thr Val Gly Asn Ser
Tyr Lys 290 295 300 Cys Asn Thr Glu Glu His Ile Phe Val Ser Lys Met
Leu Ser Leu Asn 305 310 315 320 Val Phe Ser Val Gln Val Gln Ala Phe
Lys Val Asp Ser Asp Arg Phe 325 330 335 Gly Ser Val Glu Glu Cys Val
Gln Asp Gly Asn Ser Met His His His 340 345 350 His His His 355
33360PRTArtificial Sequenceprotein expression construct 33Ala Met
Phe Met Val Lys Asn Gly Asn Gly Thr Ala Cys Ile Met Ala 1 5 10 15
Asn Phe Ser Ala Ala Phe Ser Val Asn Tyr Asp Thr Lys Ser Gly Pro 20
25 30 Lys Asn Met Thr Phe Asp Leu Pro Ser Asp Ala Thr Val Val Leu
Asn 35 40 45 Arg Ser Ser Cys Gly Lys Glu Asn Thr Ser Asp Pro Ser
Leu Val Ile 50 55 60 Ala Phe Gly Arg Gly His Thr Leu Thr Leu Asn
Phe Thr Arg Asn Ala 65 70 75 80 Thr Arg Tyr Ser Val Gln Leu Met Ser
Phe Val Tyr Asn Leu Ser Asp 85 90 95 Thr His Leu Phe Pro Asn Ala
Ser Ser Lys Glu Ile Lys Thr Val Glu 100 105 110 Ser Ile Thr Asp Ile
Arg Ala Asp Ile Asp Lys Lys Tyr Arg Cys Val 115 120 125 Ser Gly Thr
Gln Val His Met Asn Asn Val Thr Val Thr Leu His Asp 130 135 140 Ala
Thr Ile Gln Ala Tyr Leu Ser Asn Ser Ser Phe Ser Arg Gly Glu 145 150
155 160 Thr Arg Cys Glu Gln Asp Arg Pro Ser Pro Thr Thr Ala Pro Pro
Ala 165 170 175 Pro Pro Ser Pro Ser Pro Ser Pro Val Pro Lys Ser Pro
Ser Val Asp 180 185 190 Lys Tyr Asn Val Ser Gly Thr Asn Gly Thr Cys
Leu Leu Ala Ser Met 195 200 205 Gly Leu Gln Leu Asn Leu Thr Tyr Glu
Arg Lys Asp Asn Thr Thr Val 210 215 220 Thr Arg Leu Leu Asn Ile Asn
Pro Asn Lys Thr Ser Ala Ser Gly Ser 225 230 235 240 Cys Gly Ala His
Leu Val Thr Leu Glu Leu His Ser Glu Gly Thr Thr 245 250 255 Val Leu
Leu Phe Gln Phe Gly Met Asn Ala Ser Ser Ser Arg Phe Phe 260 265 270
Leu Gln Gly Ile Gln Leu Asn Thr Ile Leu Pro Asp Ala Leu Val Pro 275
280 285 Thr Phe Ser Ile Ser Asn His Ser Leu Lys Ala Leu Gln Ala Thr
Val 290 295 300 Gly Asn Ser Tyr Lys Cys Asn Thr Glu Glu His Ile
Phe Val Ser Lys 305 310 315 320 Met Leu Ser Leu Asn Val Phe Ser Val
Gln Val Gln Ala Phe Lys Val 325 330 335 Asp Ser Asp Arg Phe Gly Ser
Val Glu Glu Cys Val Gln Asp Gly Asn 340 345 350 Ser Met His His His
His His His 355 360 34353PRTArtificial Sequenceprotein expression
construct 34Leu Phe Glu Val Lys Asn Asn Gly Thr Thr Cys Ile Met Ala
Ser Phe 1 5 10 15 Ser Ala Ser Phe Leu Thr Thr Tyr Glu Thr Ala Asn
Gly Ser Gln Ile 20 25 30 Val Asn Ile Ser Leu Pro Ala Ser Ala Glu
Val Leu Lys Asn Gly Ser 35 40 45 Ser Cys Gly Lys Glu Asn Val Ser
Asp Pro Ser Leu Thr Ile Thr Phe 50 55 60 Gly Arg Gly Tyr Leu Leu
Thr Leu Asn Phe Thr Lys Asn Thr Thr Arg 65 70 75 80 Tyr Ser Val Gln
His Met Tyr Phe Thr Tyr Asn Leu Ser Asp Thr Glu 85 90 95 His Phe
Pro Asn Ala Ile Ser Lys Glu Ile Tyr Thr Met Asp Ser Thr 100 105 110
Thr Asp Ile Lys Ala Asp Ile Asn Lys Ala Tyr Arg Cys Val Ser Asp 115
120 125 Ile Arg Val Tyr Met Lys Asn Val Thr Val Val Leu Arg Asp Ala
Thr 130 135 140 Ile Gln Ala Tyr Leu Ser Ser Gly Asn Phe Ser Lys Glu
Glu Thr His 145 150 155 160 Cys Thr Gln Asp Gly Pro Ser Pro Thr Thr
Gly Pro Pro Ser Pro Ser 165 170 175 Pro Pro Leu Val Pro Thr Asn Pro
Thr Val Ser Lys Tyr Asn Val Thr 180 185 190 Gly Asn Asn Gly Thr Cys
Leu Leu Ala Ser Met Ala Leu Gln Leu Asn 195 200 205 Ile Thr Tyr Leu
Lys Lys Asp Asn Lys Thr Val Thr Arg Ala Phe Asn 210 215 220 Ile Ser
Pro Asn Asp Thr Ser Ser Gly Ser Cys Gly Ile Asn Leu Val 225 230 235
240 Thr Leu Lys Val Glu Asn Lys Asn Arg Ala Leu Glu Leu Gln Phe Gly
245 250 255 Met Asn Ala Ser Ser Ser Leu Phe Phe Leu Gln Gly Val Arg
Leu Asn 260 265 270 Met Thr Leu Pro Asp Ala Leu Val Pro Thr Phe Ser
Ile Ser Asn His 275 280 285 Ser Leu Lys Ala Leu Gln Ala Thr Val Gly
Asn Ser Tyr Lys Cys Asn 290 295 300 Thr Glu Glu His Ile Phe Val Ser
Lys Met Leu Ser Leu Asn Val Phe 305 310 315 320 Ser Val Gln Val Gln
Ala Phe Lys Val Asp Ser Asp Arg Phe Gly Ser 325 330 335 Val Glu Glu
Cys Val Gln Asp Gly Asn Ser Met His His His His His 340 345 350 His
35213PRTArtificial Sequenceantibody fragment 35Asp Ile Gln Met Thr
Gln Ser Pro Pro Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Gly Lys Val
Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asp Arg Tyr 20 25 30 Met
Ala Trp Tyr Gln Asp Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40
45 His Asp Thr Ser Thr Leu Gln Pro Gly Ile Pro Ser Arg Phe Ser Gly
50 55 60 Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu
Glu Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp
Asn Leu Trp Thr 85 90 95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
Arg Ala Asp Ala Ala Pro 100 105 110 Thr Val Ser Ile Phe Pro Pro Ser
Ser Glu Gln Leu Thr Ser Gly Gly 115 120 125 Ala Ser Val Val Cys Phe
Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn 130 135 140 Val Lys Trp Lys
Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn 145 150 155 160 Ser
Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser 165 170
175 Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr
180 185 190 Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys
Ser Phe 195 200 205 Asn Arg Asn Glu Cys 210 36448PRTArtificial
Sequenceantibody fragment 36Gln Val Gln Leu Gln Gln Ser Gly Ala Glu
Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala
Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Asn Ile His Trp Val Lys
Lys Ser Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Ala Ile Tyr
Pro Gly Asn Gly Asp Ala Pro Tyr Ser Gln Lys Phe 50 55 60 Lys Asp
Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Thr Tyr 65 70 75 80
Met Gln Leu Ser Arg Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95 Val Arg Ala Asn Trp Asp Val Ala Phe Ala Tyr Trp Gly Gln Gly
Thr 100 105 110 Leu Val Ser Val Ser Ala Ala Lys Thr Thr Ala Pro Ser
Val Tyr Pro 115 120 125 Leu Ala Pro Val Cys Gly Asp Thr Thr Gly Ser
Ser Val Thr Leu Gly 130 135 140 Cys Leu Val Lys Gly Tyr Phe Pro Glu
Pro Val Thr Leu Thr Trp Asn 145 150 155 160 Ser Gly Ser Leu Ser Ser
Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170 175 Ser Asp Leu Tyr
Thr Leu Ser Ser Ser Val Thr Val Thr Ser Ser Thr 180 185 190 Trp Pro
Ser Gln Ser Ile Thr Cys Asn Val Ala His Pro Ala Ser Ser 195 200 205
Thr Lys Val Asp Lys Lys Ile Glu Pro Arg Gly Pro Thr Ile Lys Pro 210
215 220 Cys Pro Pro Cys Lys Cys Pro Ala Pro Asn Leu Leu Gly Gly Pro
Ser 225 230 235 240 Val Phe Ile Phe Pro Pro Lys Ile Lys Asp Val Leu
Met Ile Ser Leu 245 250 255 Ser Pro Ile Val Thr Cys Val Val Val Asp
Val Ser Glu Asp Asp Pro 260 265 270 Asp Val Gln Ile Ser Trp Phe Val
Asn Asn Val Glu Val His Thr Ala 275 280 285 Gln Thr Gln Thr His Arg
Glu Asp Tyr Asn Ser Thr Leu Arg Val Val 290 295 300 Ser Ala Leu Pro
Ile Gln His Gln Asp Trp Met Ser Gly Lys Glu Phe 305 310 315 320 Lys
Cys Lys Val Asn Asn Lys Asp Leu Pro Ala Pro Ile Glu Arg Thr 325 330
335 Ile Ser Lys Pro Lys Gly Ser Val Arg Ala Pro Gln Val Tyr Val Leu
340 345 350 Pro Pro Pro Glu Glu Glu Met Thr Lys Lys Gln Val Thr Leu
Thr Cys 355 360 365 Met Val Thr Asp Phe Met Pro Glu Asp Ile Tyr Val
Glu Trp Thr Asn 370 375 380 Asn Gly Lys Thr Glu Leu Asn Tyr Lys Asn
Thr Glu Pro Val Leu Asp 385 390 395 400 Ser Asp Gly Ser Tyr Phe Met
Tyr Ser Lys Leu Arg Val Glu Lys Lys 405 410 415 Asn Trp Val Glu Arg
Asn Ser Tyr Ser Cys Ser Val Val His Glu Gly 420 425 430 Leu His Asn
His His Thr Thr Lys Ser Phe Ser Arg Thr Pro Gly Lys 435 440 445
37218PRTArtificial Sequenceantibody fragment 37Asn Ile Val Leu Thr
Gln Ser Pro Val Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala
Thr Ile Ser Cys Arg Ala Ser Glu Ser Val Asp Ile Asn 20 25 30 Gly
Asn Thr Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro 35 40
45 Lys Leu Val Ile Tyr Ala Ala Ser Asn Ile Glu Ser Gly Val Pro Ala
50 55 60 Arg Phe Ser Gly Ser Gly Ser Ser Thr Asp Phe Thr Phe Thr
Ile Asp 65 70 75 80 Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys
Gln Gln Asn Ile 85 90 95 Glu Asp Pro Trp Thr Phe Gly Gly Gly Thr
Lys Val Glu Ile Lys Arg 100 105 110 Ala Asp Ala Ala Pro Thr Val Ser
Ile Phe Pro Pro Ser Ser Glu Gln 115 120 125 Leu Thr Ser Gly Gly Ala
Ser Val Val Cys Phe Leu Asn Asn Phe Tyr 130 135 140 Pro Lys Asp Ile
Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln 145 150 155 160 Asn
Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr 165 170
175 Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg
180 185 190 His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr
Ser Pro 195 200 205 Ile Val Lys Ser Phe Asn Arg Asn Glu Cys 210 215
38446PRTArtificial Sequenceantibody fragment 38Gln Val Gln Leu Gln
Gln Ser Ala Ala Glu Leu Ala Arg Pro Gly Ala 1 5 10 15 Ser Val Lys
Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Thr
Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Tyr Phe Asn Pro Ser Ser Gly Tyr Pro Glu Tyr Asn Gln Lys Phe
50 55 60 Lys Asp Lys Thr Thr Leu Thr Ala Asp Lys Ser Ser Asn Thr
Ala Phe 65 70 75 80 Ile Gln Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala
Val Tyr Tyr Cys 85 90 95 Ser Arg Gly Tyr Tyr Tyr Gly Ser Arg Gly
Tyr Ala Leu Asp Phe Trp 100 105 110 Gly Gln Gly Ala Ser Val Thr Val
Ser Ser Ala Lys Thr Thr Pro Pro 115 120 125 Ser Val Tyr Pro Leu Ala
Pro Gly Ser Ala Ala Gln Thr Asn Ser Met 130 135 140 Val Thr Leu Gly
Cys Leu Val Lys Gly Tyr Phe Pro Glu Pro Val Thr 145 150 155 160 Val
Thr Trp Asn Ser Gly Ser Leu Ser Ser Gly Val His Thr Phe Pro 165 170
175 Ala Val Leu Gln Ser Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr Val
180 185 190 Pro Ser Ser Thr Trp Pro Ser Glu Thr Val Thr Cys Asn Val
Ala His 195 200 205 Pro Ala Ser Ser Thr Lys Val Asp Lys Lys Ile Val
Pro Arg Asp Cys 210 215 220 Gly Cys Lys Pro Cys Ile Cys Thr Val Pro
Glu Val Ser Ser Val Phe 225 230 235 240 Ile Phe Pro Pro Lys Pro Lys
Asp Val Leu Thr Ile Thr Leu Thr Pro 245 250 255 Lys Val Thr Cys Val
Val Val Asp Ile Ser Lys Asp Asp Pro Glu Val 260 265 270 Gln Phe Ser
Trp Phe Val Asp Asp Val Glu Val His Thr Ala Gln Thr 275 280 285 Gln
Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Ser Val Ser Glu 290 295
300 Leu Pro Ile Met His Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys
305 310 315 320 Arg Val Asn Ser Ala Ala Phe Pro Ala Pro Ile Glu Lys
Thr Ile Ser 325 330 335 Lys Thr Lys Gly Arg Pro Lys Ala Pro Gln Val
Tyr Thr Ile Pro Pro 340 345 350 Pro Lys Glu Gln Met Ala Lys Asp Lys
Val Ser Leu Thr Cys Met Ile 355 360 365 Thr Asp Phe Phe Pro Glu Asp
Ile Thr Val Glu Trp Gln Trp Asn Gly 370 375 380 Gln Pro Ala Glu Asn
Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp 385 390 395 400 Gly Ser
Tyr Phe Val Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp 405 410 415
Glu Ala Gly Asn Thr Phe Thr Cys Ser Val Leu His Glu Gly Leu His 420
425 430 Asn His His Thr Glu Lys Ser Leu Ser His Ser Pro Gly Lys 435
440 445 39415PRTMacaca fascicularis 39Met Ala Ala Pro Gly Ser Ala
Arg Arg Ser Leu Leu Leu Leu Leu Leu 1 5 10 15 Leu Leu Gly Leu Thr
His Cys Ala Ser Ala Ala Met Phe Ile Val Lys 20 25 30 Asn Gly Asn
Gly Thr Ala Cys Ile Met Ala Asn Phe Ser Ala Ala Phe 35 40 45 Ser
Val Asn Tyr Asp Thr Lys Ser Gly Pro Lys Asn Met Thr Phe Asp 50 55
60 Leu Pro Ser Asp Ala Lys Val Val Leu Asn Ser Ser Ser Cys Gly Lys
65 70 75 80 Glu Asn Thr Ser Asp Pro Ser Leu Val Ile Ala Phe Gly Arg
Gly Gln 85 90 95 Thr Leu Thr Leu Asn Phe Thr Arg Asn Ala Thr Arg
Tyr Ser Val Gln 100 105 110 Leu Met Ser Phe Val Tyr Asn Leu Ser Asp
Thr His Leu Phe Pro Asn 115 120 125 Ala Ser Ser Lys Glu Ile Lys Thr
Val Glu Ser Ile Thr Asp Ile Arg 130 135 140 Ala Asp Ile Asp Lys Lys
Tyr Arg Cys Val Ser Gly Thr Gln Val His 145 150 155 160 Met Asn Asn
Val Thr Val Thr Leu His Asp Ala Thr Ile Gln Ala Tyr 165 170 175 Leu
Ser Asn Ser Ser Phe Ser Arg Glu Glu Thr Arg Cys Glu Gln Asp 180 185
190 Arg Pro Ser Pro Thr Thr Ala Pro Pro Ala Pro Pro Ser Pro Ser Pro
195 200 205 Ser Pro Val Pro Glu Ser Pro Ser Val Asp Lys Tyr Asn Val
Ser Gly 210 215 220 Thr Asn Gly Thr Cys Leu Leu Ala Ser Met Gly Leu
Gln Leu Asn Leu 225 230 235 240 Thr Tyr Glu Arg Lys Asp Asn Thr Thr
Val Thr Arg Leu Leu Asn Ile 245 250 255 Asn Pro Asn Lys Thr Leu Ala
Ser Gly Ser Cys Gly Ala His Leu Val 260 265 270 Thr Leu Glu Leu His
Ser Glu Gly Ser Thr Val Leu Leu Phe Gln Phe 275 280 285 Gly Met Asn
Ala Ser Ser Ser Arg Phe Phe Leu Gln Gly Ile Gln Leu 290 295 300 Asn
Thr Thr Leu Pro Asp Ala Arg Asp Pro Ala Phe Lys Ala Ala Asn 305 310
315 320 Ser Ser Leu Arg Ala Leu Gln Ala Thr Val Gly Asn Ser Tyr Lys
Cys 325 330 335 Asn Ala Glu Glu His Val Arg Val Thr Lys Ala Phe Ser
Val Asn Ile 340 345 350 Phe Lys Val Trp Val Gln Ala Phe Lys Val Glu
Gly Gly Gln Phe Gly 355 360 365 Ser Val Glu Glu Cys Leu Leu Asp Glu
Asn Asn Met Leu Ile Pro Ile 370 375 380 Ala Val Gly Gly Ala Leu Ala
Gly Leu Val Leu Ile Val Leu Ile Ala 385 390 395 400 Tyr Leu Val Gly
Arg Lys Arg Ser His Ala Gly Tyr Gln Thr Ile 405 410 415
40357PRTArtificial SequenceProtein expression construct human LAMP2
(AA29-375) 40Leu Glu Leu Asn Leu Thr Asp Ser Glu Asn Ala Thr Cys
Leu Tyr Ala 1 5 10 15 Lys Trp Gln Met Asn Phe Thr Val Arg Tyr Glu
Thr Thr Asn Lys Thr 20 25 30 Tyr Lys Thr Val Thr Ile Ser Asp His
Gly Thr Val Thr Tyr Asn Gly 35 40 45 Ser Ile Cys Gly Asp Asp Gln
Asn Gly Pro Lys Ile Ala Val Gln Phe 50 55 60 Gly Pro Gly Phe Ser
Trp Ile Ala Asn Phe Thr Lys Ala Ala Ser Thr 65 70 75 80 Tyr Ser Ile
Asp Ser Val Ser Phe Ser Tyr Asn Thr Gly Asp Asn Thr 85 90 95 Thr
Phe Pro Asp Ala Glu Asp Lys Gly Ile Leu Thr Val Asp Glu Leu 100 105
110 Leu Ala Ile Arg Ile Pro Leu Asn Asp
Leu Phe Arg Cys Asn Ser Leu 115 120 125 Ser Thr Leu Glu Lys Asn Asp
Val Val Gln His Tyr Trp Asp Val Leu 130 135 140 Val Gln Ala Phe Val
Gln Asn Gly Thr Val Ser Thr Asn Glu Phe Leu 145 150 155 160 Cys Asp
Lys Asp Lys Thr Ser Thr Val Ala Pro Thr Ile His Thr Thr 165 170 175
Val Pro Ser Pro Thr Thr Thr Pro Thr Pro Lys Glu Lys Pro Glu Ala 180
185 190 Gly Thr Tyr Ser Val Asn Asn Gly Asn Asp Thr Cys Leu Leu Ala
Thr 195 200 205 Met Gly Leu Gln Leu Asn Ile Thr Gln Asp Lys Val Ala
Ser Val Ile 210 215 220 Asn Ile Asn Pro Asn Thr Thr His Ser Thr Gly
Ser Cys Arg Ser His 225 230 235 240 Thr Ala Leu Leu Arg Leu Asn Ser
Ser Thr Ile Lys Tyr Leu Asp Phe 245 250 255 Val Phe Ala Val Lys Asn
Glu Asn Arg Phe Tyr Leu Lys Glu Val Asn 260 265 270 Ile Ser Met Tyr
Leu Val Asn Gly Ser Val Phe Ser Ile Ala Asn Asn 275 280 285 Asn Leu
Ser Tyr Trp Asp Ala Pro Leu Gly Ser Ser Tyr Met Cys Asn 290 295 300
Lys Glu Gln Thr Val Ser Val Ser Gly Ala Phe Gln Ile Asn Thr Phe 305
310 315 320 Asp Leu Arg Val Gln Pro Phe Asn Val Thr Gln Gly Lys Tyr
Ser Thr 325 330 335 Ala Gln Asp Cys Ser Ala Asp Asp Asp Asn Phe His
His His His His 340 345 350 His His His His His 355 41410PRTHomo
sapiens 41Met Val Cys Phe Arg Leu Phe Pro Val Pro Gly Ser Gly Leu
Val Leu 1 5 10 15 Val Cys Leu Val Leu Gly Ala Val Arg Ser Tyr Ala
Leu Glu Leu Asn 20 25 30 Leu Thr Asp Ser Glu Asn Ala Thr Cys Leu
Tyr Ala Lys Trp Gln Met 35 40 45 Asn Phe Thr Val Arg Tyr Glu Thr
Thr Asn Lys Thr Tyr Lys Thr Val 50 55 60 Thr Ile Ser Asp His Gly
Thr Val Thr Tyr Asn Gly Ser Ile Cys Gly 65 70 75 80 Asp Asp Gln Asn
Gly Pro Lys Ile Ala Val Gln Phe Gly Pro Gly Phe 85 90 95 Ser Trp
Ile Ala Asn Phe Thr Lys Ala Ala Ser Thr Tyr Ser Ile Asp 100 105 110
Ser Val Ser Phe Ser Tyr Asn Thr Gly Asp Asn Thr Thr Phe Pro Asp 115
120 125 Ala Glu Asp Lys Gly Ile Leu Thr Val Asp Glu Leu Leu Ala Ile
Arg 130 135 140 Ile Pro Leu Asn Asp Leu Phe Arg Cys Asn Ser Leu Ser
Thr Leu Glu 145 150 155 160 Lys Asn Asp Val Val Gln His Tyr Trp Asp
Val Leu Val Gln Ala Phe 165 170 175 Val Gln Asn Gly Thr Val Ser Thr
Asn Glu Phe Leu Cys Asp Lys Asp 180 185 190 Lys Thr Ser Thr Val Ala
Pro Thr Ile His Thr Thr Val Pro Ser Pro 195 200 205 Thr Thr Thr Pro
Thr Pro Lys Glu Lys Pro Glu Ala Gly Thr Tyr Ser 210 215 220 Val Asn
Asn Gly Asn Asp Thr Cys Leu Leu Ala Thr Met Gly Leu Gln 225 230 235
240 Leu Asn Ile Thr Gln Asp Lys Val Ala Ser Val Ile Asn Ile Asn Pro
245 250 255 Asn Thr Thr His Ser Thr Gly Ser Cys Arg Ser His Thr Ala
Leu Leu 260 265 270 Arg Leu Asn Ser Ser Thr Ile Lys Tyr Leu Asp Phe
Val Phe Ala Val 275 280 285 Lys Asn Glu Asn Arg Phe Tyr Leu Lys Glu
Val Asn Ile Ser Met Tyr 290 295 300 Leu Val Asn Gly Ser Val Phe Ser
Ile Ala Asn Asn Asn Leu Ser Tyr 305 310 315 320 Trp Asp Ala Pro Leu
Gly Ser Ser Tyr Met Cys Asn Lys Glu Gln Thr 325 330 335 Val Ser Val
Ser Gly Ala Phe Gln Ile Asn Thr Phe Asp Leu Arg Val 340 345 350 Gln
Pro Phe Asn Val Thr Gln Gly Lys Tyr Ser Thr Ala Gln Asp Cys 355 360
365 Ser Ala Asp Asp Asp Asn Phe Leu Val Pro Ile Ala Val Gly Ala Ala
370 375 380 Leu Ala Gly Val Leu Ile Leu Val Leu Leu Ala Tyr Phe Ile
Gly Leu 385 390 395 400 Lys His His His Ala Gly Tyr Glu Gln Phe 405
410 42122PRTArtificial SequenceVH MAb3 42Gln Ile Gln Leu Val Gln
Ser Gly Pro Glu Leu Lys Lys Pro Gly Glu 1 5 10 15 Thr Val Lys Ile
Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Gly Met
Asn Trp Val Lys Gln Ala Pro Gly Lys Gly Leu Lys Trp Met 35 40 45
Gly Trp Ile Asn Thr Tyr Thr Gly Glu Ser Arg Tyr Ala Asp Asp Phe 50
55 60 Lys Gly Arg Phe Ala Leu Ser Leu Glu Thr Ser Ala Ser Thr Ala
Tyr 65 70 75 80 Leu Gln Ile Asn Asn Leu Glu Asn Glu Asp Met Ala Thr
Tyr Phe Cys 85 90 95 Ala Arg Glu Asp Tyr Tyr Gly Asn Ser Pro Trp
Phe Phe Asp Val Trp 100 105 110 Gly Ala Gly Thr Thr Val Thr Val Ser
Ser 115 120 438PRTArtificial SequenceCDR1-H MAb3 43Gly Tyr Ile Phe
Thr Asn Tyr Gly 1 5 448PRTArtificial SequenceCDR2-H MAb3 44Ile Asn
Thr Tyr Thr Gly Glu Ser 1 5 4515PRTArtificial SequenceCDR3H MAb3
45Ala Arg Glu Asp Tyr Tyr Gly Asn Ser Pro Trp Phe Phe Asp Val 1 5
10 15 46107PRTArtificial SequenceVL MAb3 46Asp Ile Gln Met Thr Gln
Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Asp Arg Val Thr
Ile Ser Cys Asn Ala Ser Gln Gly Ile Asn Lys Tyr 20 25 30 Leu Asn
Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile 35 40 45
Tyr Tyr Thr Ser Thr Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly 50
55 60 Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Asn Asn Leu Glu
Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Thr Lys
Leu Pro Phe 85 90 95 Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys
100 105 476PRTArtificial SequenceCDR1-L MAb3 154L4 47Gln Gly Ile
Asn Lys Tyr 1 5 489PRTArtificial SequenceCDR3-L MAb3 48Gln Gln Tyr
Thr Lys Leu Pro Phe Thr 1 5 49451PRTArtificial SequenceHC chMAb3
49Gln Ile Gln Leu Val Gln Ser Gly Pro Glu Leu Lys Lys Pro Gly Glu 1
5 10 15 Thr Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn
Tyr 20 25 30 Gly Met Asn Trp Val Lys Gln Ala Pro Gly Lys Gly Leu
Lys Trp Met 35 40 45 Gly Trp Ile Asn Thr Tyr Thr Gly Glu Ser Arg
Tyr Ala Asp Asp Phe 50 55 60 Lys Gly Arg Phe Ala Leu Ser Leu Glu
Thr Ser Ala Ser Thr Ala Tyr 65 70 75 80 Leu Gln Ile Asn Asn Leu Glu
Asn Glu Asp Met Ala Thr Tyr Phe Cys 85 90 95 Ala Arg Glu Asp Tyr
Tyr Gly Asn Ser Pro Trp Phe Phe Asp Val Trp 100 105 110 Gly Ala Gly
Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 115 120 125 Ser
Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr 130 135
140 Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
145 150 155 160 Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His
Thr Phe Pro 165 170 175 Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr 180 185 190 Val Pro Ser Ser Ser Leu Gly Thr Gln
Thr Tyr Ile Cys Asn Val Asn 195 200 205 His Lys Pro Ser Asn Thr Lys
Val Asp Lys Lys Val Glu Pro Lys Ser 210 215 220 Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 225 230 235 240 Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 245 250 255
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 260
265 270 His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu 275 280 285 Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr 290 295 300 Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn 305 310 315 320 Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala Pro 325 330 335 Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 340 345 350 Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 355 360 365 Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 370 375 380
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 385
390 395 400 Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr 405 410 415 Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val 420 425 430 Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu 435 440 445 Ser Pro Gly 450
50214PRTArtificial SequenceLC chMAb3 50Asp Ile Gln Met Thr Gln Thr
Thr Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Asp Arg Val Thr Ile
Ser Cys Asn Ala Ser Gln Gly Ile Asn Lys Tyr 20 25 30 Leu Asn Trp
Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile 35 40 45 Tyr
Tyr Thr Ser Thr Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Asn Asn Leu Glu Pro
65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Thr Lys Leu
Pro Phe 85 90 95 Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys Arg
Thr Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro Pro Ser Asp
Glu Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val Cys Leu Leu
Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln Trp Lys Val
Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln 145 150 155 160 Glu Ser Val
Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175 Ser
Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185
190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser
195 200 205 Phe Asn Arg Gly Glu Cys 210 51107PRTArtificial
SequenceVL MAb3 R24R93 51Asp Ile Gln Met Thr Gln Thr Thr Ser Ser
Leu Ser Ala Ser Leu Gly 1 5 10 15 Asp Arg Val Thr Ile Ser Cys Arg
Ala Ser Gln Gly Ile Asn Lys Tyr 20 25 30 Leu Asn Trp Tyr Gln Gln
Lys Pro Asp Gly Thr Val Lys Leu Leu Ile 35 40 45 Tyr Tyr Thr Ser
Thr Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly
Ser Gly Thr Asp Tyr Ser Leu Thr Ile Asn Asn Leu Glu Pro 65 70 75 80
Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Thr Arg Leu Pro Phe 85
90 95 Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys 100 105
529PRTArtificial SequenceCDR3-L MAb3 R24R93 52Gln Gln Tyr Thr Arg
Leu Pro Phe Thr 1 5 53118PRTArtificial SequenceAntibody fragment
53Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn
Tyr 20 25 30 Asn Ile His Trp Val Lys Lys Ser Pro Gly Gln Gly Leu
Glu Trp Ile 35 40 45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro
Tyr Ser Gln Lys Phe 50 55 60 Gln Gly Lys Ala Thr Leu Thr Ala Asp
Thr Ser Thr Ser Thr Thr Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp
Asp Val Ala Phe Ala Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr
Val Ser Ser 115 54118PRTArtificial SequenceAntibody fragment 54Gln
Val Gln Leu Val Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10
15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr
20 25 30 Asn Ile His Trp Val Lys Lys Ser Pro Gly Gln Gly Leu Glu
Trp Ile 35 40 45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr
Ser Gln Lys Phe 50 55 60 Gln Asp Arg Ala Thr Leu Thr Ala Asp Thr
Ser Ser Ser Thr Thr Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Thr Ser
Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp
Val Ala Phe Ala Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Ser Val
Ser Ser 115 55118PRTArtificial SequenceAntibody fragment 55Gln Val
Gln Leu Val Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10 15
Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20
25 30 Asn Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp
Ile 35 40 45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ala
Gln Lys Phe 50 55 60 Gln Gly Arg Ala Thr Leu Thr Ala Asp Thr Ser
Ser Ser Thr Thr Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Thr Ser Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp Val
Ala Phe Ala Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser
Ser 115 56106PRTArtificial SequenceAntibody fragment 56Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp
Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asp Arg Tyr 20 25
30 Met Ala Trp Tyr Gln Asp Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile
35 40 45 His Asp Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp Tyr Thr Leu Thr Ile Ser
Asn Leu Glu Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln
Tyr Asp Asn Leu Trp Thr 85 90 95 Phe Gly Gly Gly Thr Lys Val Glu
Ile Lys 100 105 57106PRTArtificial SequenceAntibody fragment 57Asp
Ile Gln Met Thr Gln Ser Pro Pro Ser Leu Ser Ala Ser Val Gly 1 5 10
15 Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asp Arg Tyr
20 25 30 Met Ala Trp Tyr Gln Asp Lys Pro Gly Lys Gly Pro
Lys Leu Leu Ile 35 40 45 His Asp Thr Ser Thr Leu Gln Pro Gly Ile
Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp Tyr Ser
Phe Ser Ile Ser Asn Leu Glu Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr
Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95 Phe Gly Gly Gly
Thr Lys Leu Glu Ile Lys 100 105 58106PRTArtificial SequenceAntibody
fragment 58Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly 1 5 10 15 Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp
Ile Asp Arg Tyr 20 25 30 Met Ala Trp Tyr Gln Gln Lys Pro Gly Lys
Gly Pro Lys Leu Leu Ile 35 40 45 His Asp Thr Ser Thr Leu Gln Pro
Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp
Tyr Ser Leu Thr Ile Ser Ser Leu Glu Pro 65 70 75 80 Glu Asp Ile Ala
Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95 Phe Gly
Gly Gly Thr Lys Leu Glu Ile Lys 100 105 59213PRTArtificial
SequenceAntibody fragment 59Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys
Ala Ser Gln Asp Ile Asp Arg Tyr 20 25 30 Met Ala Trp Tyr Gln Asp
Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile 35 40 45 His Asp Thr Ser
Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly
Ser Gly Arg Asp Tyr Thr Leu Thr Ile Ser Asn Leu Glu Pro 65 70 75 80
Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85
90 95 Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala
Pro 100 105 110 Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly Thr 115 120 125 Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala Lys 130 135 140 Val Gln Trp Lys Val Asp Asn Ala Leu
Gln Ser Gly Asn Ser Gln Glu 145 150 155 160 Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser 165 170 175 Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala 180 185 190 Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe 195 200 205
Asn Arg Gly Glu Cys 210 60447PRTArtificial SequenceAntibody
fragment 60Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ser 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ile
Phe Thr Asn Tyr 20 25 30 Asn Ile His Trp Val Lys Lys Ser Pro Gly
Gln Gly Leu Glu Trp Ile 35 40 45 Gly Ala Ile Tyr Pro Gly Asn Gly
Asp Ala Pro Tyr Ser Gln Lys Phe 50 55 60 Gln Gly Lys Ala Thr Leu
Thr Ala Asp Thr Ser Thr Ser Thr Thr Tyr 65 70 75 80 Met Glu Leu Ser
Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Val Arg
Ala Asn Trp Asp Val Ala Phe Ala Tyr Trp Gly Gln Gly Thr 100 105 110
Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115
120 125 Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly 130 135 140 Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val
Ser Trp Asn 145 150 155 160 Ser Gly Ala Leu Thr Ser Gly Val His Thr
Phe Pro Ala Val Leu Gln 165 170 175 Ser Ser Gly Leu Tyr Ser Leu Ser
Ser Val Val Thr Val Pro Ser Ser 180 185 190 Ser Leu Gly Thr Gln Thr
Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200 205 Asn Thr Lys Val
Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210 215 220 His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 225 230 235
240 Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255 Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro 260 265 270 Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285 Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val 290 295 300 Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr 305 310 315 320 Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335 Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350 Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360
365 Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
370 375 380 Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp 385 390 395 400 Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser 405 410 415 Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala 420 425 430 Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly 435 440 445 61213PRTArtificial
SequenceAntibody fragment 61Asp Ile Gln Met Thr Gln Ser Pro Pro Ser
Leu Ser Ala Ser Val Gly 1 5 10 15 Gly Lys Val Thr Ile Thr Cys Lys
Ala Ser Gln Asp Ile Asp Arg Tyr 20 25 30 Met Ala Trp Tyr Gln Asp
Lys Pro Gly Lys Gly Pro Lys Leu Leu Ile 35 40 45 His Asp Thr Ser
Thr Leu Gln Pro Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly
Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro 65 70 75 80
Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85
90 95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala
Pro 100 105 110 Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly Thr 115 120 125 Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala Lys 130 135 140 Val Gln Trp Lys Val Asp Asn Ala Leu
Gln Ser Gly Asn Ser Gln Glu 145 150 155 160 Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser 165 170 175 Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala 180 185 190 Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe 195 200 205
Asn Arg Gly Glu Cys 210 62447PRTArtificial SequenceAntibody
fragment 62Gln Val Gln Leu Val Gln Ser Gly Ala Glu Leu Val Lys Pro
Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Ile
Phe Thr Asn Tyr 20 25 30 Asn Ile His Trp Val Lys Lys Ser Pro Gly
Gln Gly Leu Glu Trp Ile 35 40 45 Gly Ala Ile Tyr Pro Gly Asn Gly
Asp Ala Pro Tyr Ser Gln Lys Phe 50 55 60 Gln Asp Arg Ala Thr Leu
Thr Ala Asp Thr Ser Ser Ser Thr Thr Tyr 65 70 75 80 Met Glu Leu Ser
Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Val Arg
Ala Asn Trp Asp Val Ala Phe Ala Tyr Trp Gly Gln Gly Thr 100 105 110
Leu Val Ser Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115
120 125 Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly 130 135 140 Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val
Ser Trp Asn 145 150 155 160 Ser Gly Ala Leu Thr Ser Gly Val His Thr
Phe Pro Ala Val Leu Gln 165 170 175 Ser Ser Gly Leu Tyr Ser Leu Ser
Ser Val Val Thr Val Pro Ser Ser 180 185 190 Ser Leu Gly Thr Gln Thr
Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200 205 Asn Thr Lys Val
Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210 215 220 His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 225 230 235
240 Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255 Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro 260 265 270 Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285 Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val 290 295 300 Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr 305 310 315 320 Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335 Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350 Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360
365 Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
370 375 380 Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp 385 390 395 400 Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser 405 410 415 Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala 420 425 430 Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly 435 440 445 63213PRTArtificial
SequenceAntibody fragment 63Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly 1 5 10 15 Gly Lys Val Thr Ile Thr Cys Lys
Ala Ser Gln Asp Ile Asp Arg Tyr 20 25 30 Met Ala Trp Tyr Gln Gln
Lys Pro Gly Lys Gly Pro Lys Leu Leu Ile 35 40 45 His Asp Thr Ser
Thr Leu Gln Pro Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly
Ser Gly Arg Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu Pro 65 70 75 80
Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85
90 95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala
Pro 100 105 110 Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly Thr 115 120 125 Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala Lys 130 135 140 Val Gln Trp Lys Val Asp Asn Ala Leu
Gln Ser Gly Asn Ser Gln Glu 145 150 155 160 Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser 165 170 175 Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala 180 185 190 Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe 195 200 205
Asn Arg Gly Glu Cys 210 64447PRTHomo sapiens 64Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys
Met Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Asn
Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ala Gln Lys Phe
50 55 60 Gln Gly Arg Ala Thr Leu Thr Ala Asp Thr Ser Ser Ser Thr
Thr Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Thr Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp Val Ala Phe Ala
Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro 115 120 125 Leu Ala Pro Ser Ser Lys
Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140 Cys Leu Val Lys
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 145 150 155 160 Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170
175 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
180 185 190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205 Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser
Cys Asp Lys Thr 210 215 220 His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser 225 230 235 240 Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255 Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270 Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285 Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295
300 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
305 310 315 320 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr 325 330 335 Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu 340 345 350 Pro Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys 355 360 365 Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380 Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 385 390 395 400 Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430 Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
435 440 445 65213PRTArtificial SequenceAntibody fragment 65Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15
Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asp Arg Tyr 20
25 30 Met Ala Trp Ala Gln Asp Lys Pro Gly Lys Ala Pro Arg Leu Leu
Ile 35 40 45 His Asp Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp Tyr Thr Leu Thr Ile
Ser Asn Leu Glu Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Leu
Gln Tyr Asp Asn Leu Ala Thr 85 90 95 Phe Gly Gly Gly
Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro 100 105 110 Ser Val
Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr 115 120 125
Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys 130
135 140 Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln
Glu 145 150 155 160 Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr
Ser Leu Ser Ser 165 170 175 Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu
Lys His Lys Val Tyr Ala 180 185 190 Cys Glu Val Thr His Gln Gly Leu
Ser Ser Pro Val Thr Lys Ser Phe 195 200 205 Asn Arg Gly Glu Cys 210
66447PRTArtificial SequenceAntibody fragment 66Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Asn
Ile His Trp Val Lys Lys Ser Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ser Gln Lys Phe
50 55 60 Gln Gly Lys Ala Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr
Thr Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Ala Asp Val Ala Phe Ala
Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro 115 120 125 Leu Ala Pro Ser Ser Lys
Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140 Cys Leu Val Lys
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 145 150 155 160 Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170
175 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
180 185 190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205 Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser
Cys Asp Lys Thr 210 215 220 His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser 225 230 235 240 Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255 Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270 Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285 Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295
300 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
305 310 315 320 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr 325 330 335 Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu 340 345 350 Pro Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys 355 360 365 Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380 Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 385 390 395 400 Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430 Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
435 440 445 67447PRTHomo sapiens 67Gln Val Gln Leu Val Gln Ser Gly
Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys Val Ser Cys
Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Asn Ile His Trp
Val Lys Lys Ser Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Ala
Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ser Gln Lys Phe 50 55 60
Gln Gly Lys Ala Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr Thr Tyr 65
70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp Val Ala Phe Ala Tyr Trp
Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro 115 120 125 Leu Ala Pro Ser Ser Lys Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140 Cys Leu Val Lys Asp Tyr
Phe Pro Glu Pro Val Thr Val Ser Trp Asn 145 150 155 160 Ser Gly Ala
Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170 175 Ser
Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 180 185
190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser
195 200 205 Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp
Lys Thr 210 215 220 His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser 225 230 235 240 Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg 245 250 255 Thr Pro Glu Val Thr Cys Val
Val Val Ala Val Ser His Glu Asp Pro 260 265 270 Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285 Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295 300 Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 305 310
315 320 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr 325 330 335 Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu 340 345 350 Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys 355 360 365 Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu Ser 370 375 380 Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp 385 390 395 400 Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415 Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420 425 430
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440
445 68213PRTArtificial SequenceRecombinant Fab LC1 68Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp
Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asp Arg Tyr 20 25
30 Met Ala Trp Tyr Gln Asp Lys Pro Gly Lys Ala Pro Arg Leu Leu Ile
35 40 45 His Asp Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp Tyr Thr Leu Thr Ile Ser
Asn Leu Glu Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln
Tyr Asp Asn Leu Trp Thr 85 90 95 Phe Gly Gly Gly Thr Lys Val Glu
Ile Lys Arg Thr Val Ala Ala Pro 100 105 110 Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr 115 120 125 Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys 130 135 140 Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu 145 150 155
160 Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser
165 170 175 Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val
Tyr Ala 180 185 190 Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val
Thr Lys Ser Phe 195 200 205 Asn Arg Gly Glu Cys 210
69234PRTArtificial SequenceRecombinant Fab HC 69Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn Tyr 20 25 30 Asn
Ile His Trp Val Lys Lys Ser Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Ala Ile Tyr Pro Gly Asn Gly Asp Ala Pro Tyr Ser Gln Lys Phe
50 55 60 Gln Gly Lys Ala Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr
Thr Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Val Arg Ala Asn Trp Asp Val Ala Phe Ala
Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro 115 120 125 Leu Ala Pro Ser Ser Lys
Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140 Cys Leu Val Lys
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 145 150 155 160 Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170
175 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
180 185 190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205 Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser
Cys Asp Lys Thr 210 215 220 His Thr Ala Ser His His His His His His
225 230 70302PRTArtificial SequenceRecombinant
TrxA-His-Thr-LAMP1-29-195 70Met Gly Ser Asp Lys Ile Ile His Leu Thr
Asp Asp Ser Phe Asp Thr 1 5 10 15 Asp Val Leu Lys Ala Asp Gly Ala
Ile Leu Val Asp Phe Trp Ala Glu 20 25 30 Trp Cys Gly Pro Cys Lys
Met Ile Ala Pro Ile Leu Asp Glu Ile Ala 35 40 45 Asp Glu Tyr Gln
Gly Lys Leu Thr Val Ala Lys Leu Asn Ile Asp Gln 50 55 60 Asn Pro
Gly Thr Ala Pro Lys Tyr Gly Ile Arg Gly Ile Pro Thr Leu 65 70 75 80
Leu Leu Phe Lys Asn Gly Glu Val Ala Ala Thr Lys Val Gly Ala Leu 85
90 95 Ser Lys Gly Gln Leu Lys Glu Phe Leu Asp Ala Asn Leu Ala Gly
Ser 100 105 110 Gly Ser Met Gly Ser Ser His His His His His His Ser
Ser Gly Leu 115 120 125 Val Pro Arg Gly Ser His Met Ala Met Phe Met
Val Lys Asn Gly Asn 130 135 140 Gly Thr Ala Cys Ile Met Ala Asn Phe
Ser Ala Ala Phe Ser Val Asn 145 150 155 160 Tyr Asp Thr Lys Ser Gly
Pro Lys Asn Met Thr Phe Asp Leu Pro Ser 165 170 175 Asp Ala Thr Val
Val Leu Asn Arg Ser Ser Cys Gly Lys Glu Asn Thr 180 185 190 Ser Asp
Pro Ser Leu Val Ile Ala Phe Gly Arg Gly His Thr Leu Thr 195 200 205
Leu Asn Phe Thr Arg Asn Ala Thr Arg Tyr Ser Val Gln Leu Met Ser 210
215 220 Phe Val Tyr Asn Leu Ser Asp Thr His Leu Phe Pro Asn Ala Ser
Ser 225 230 235 240 Lys Glu Ile Lys Thr Val Glu Ser Ile Thr Asp Ile
Arg Ala Asp Ile 245 250 255 Asp Lys Lys Tyr Arg Cys Val Ser Gly Thr
Gln Val His Met Asn Asn 260 265 270 Val Thr Val Thr Leu His Asp Ala
Thr Ile Gln Ala Tyr Leu Ser Asn 275 280 285 Ser Ser Phe Ser Arg Gly
Glu Thr Arg Cys Glu Gln Asp Arg 290 295 300 71171PRTArtificial
SequenceLAMP1-29-195 71Gly Ser His Met Ala Met Phe Met Val Lys Asn
Gly Asn Gly Thr Ala 1 5 10 15 Cys Ile Met Ala Asn Phe Ser Ala Ala
Phe Ser Val Asn Tyr Asp Thr 20 25 30 Lys Ser Gly Pro Lys Asn Met
Thr Phe Asp Leu Pro Ser Asp Ala Thr 35 40 45 Val Val Leu Asn Arg
Ser Ser Cys Gly Lys Glu Asn Thr Ser Asp Pro 50 55 60 Ser Leu Val
Ile Ala Phe Gly Arg Gly His Thr Leu Thr Leu Asn Phe 65 70 75 80 Thr
Arg Asn Ala Thr Arg Tyr Ser Val Gln Leu Met Ser Phe Val Tyr 85 90
95 Asn Leu Ser Asp Thr His Leu Phe Pro Asn Ala Ser Ser Lys Glu Ile
100 105 110 Lys Thr Val Glu Ser Ile Thr Asp Ile Arg Ala Asp Ile Asp
Lys Lys 115 120 125 Tyr Arg Cys Val Ser Gly Thr Gln Val His Met Asn
Asn Val Thr Val 130 135 140 Thr Leu His Asp Ala Thr Ile Gln Ala Tyr
Leu Ser Asn Ser Ser Phe 145 150 155 160 Ser Arg Gly Glu Thr Arg Cys
Glu Gln Asp Arg 165 170 7210PRTHomo sapiens 72Thr Leu Asn Phe Thr
Arg Asn Ala Thr Arg 1 5 10 7314PRTHomo sapiens 73Asp Ile Arg Ala
Asp Ile Asp Lys Lys Tyr Arg Cys Val Ser 1 5 10 7415PRTHomo sapiens
74Thr Ile Gln Ala Tyr Leu Ser Asn Ser Ser Phe Ser Arg Gly Glu 1 5
10 15 7513PRTHomo sapiens 75Ala Met Phe Met Val Lys Asn Gly Asn Gly
Thr Ala Cys 1 5 10 7613PRTHomo sapiens 76Pro Ser Asp Ala Thr Val
Val Leu Asn Arg Ser Ser Cys 1 5 10 77144PRTHomo sapiens 77Ala Met
Phe Met Val Lys Asn Gly Asn Gly Thr Ala Cys Ile Met Ala 1 5 10 15
Asn Phe Ser Ala Ala Phe Ser Val Asn Tyr Asp Thr Lys Ser Gly Pro 20
25 30 Lys Asn Met Thr Phe Asp Leu Pro Ser Asp Ala Thr Val Val Leu
Asn 35 40 45 Arg Ser Ser Cys Gly Lys Glu Asn Thr Ser Asp Pro Ser
Leu Val Ile 50 55 60 Ala Phe Gly Arg Gly His Thr Leu Ala Met Phe
Met Val Lys Asn Gly 65 70 75 80 Asn Gly Thr Ala Cys Ile Met Ala Asn
Phe Ser Ala Ala Phe Ser Val 85 90 95 Asn Tyr Asp Thr Lys Ser Gly
Pro Lys Asn Met Thr Phe Asp Leu Pro 100 105 110 Ser Asp Ala Thr Val
Val Leu Asn Arg Ser Ser Cys Gly Lys Glu Asn 115 120 125 Thr Ser Asp
Pro Ser Leu Val Ile Ala Phe Gly Arg Gly His Thr Leu 130 135 140
7814PRTHomo sapiens 78Gly His Thr Leu Thr Leu Asn Phe Thr Arg Asn
Ala Thr Arg 1 5 10 7917PRTHomo sapiens 79Ala Thr Ile Gln Ala Tyr
Leu Ser Asn Ser Ser Phe Ser Arg Gly Glu 1 5 10 15 Thr 80171PRTHomo
sapiens 80Gly Ser His Met Ala Met Phe Met Val Lys Asn Gly Asn Gly
Thr Ala 1 5 10 15 Cys Ile Met Ala Asn Phe Ser Ala Ala Phe Ser Val
Asn Tyr Asp Thr 20 25 30 Lys Ser Gly Pro Lys Asn Met Thr Phe Asp
Leu Pro Ser Asp Ala Thr 35 40 45 Val Val Leu Asn Arg Ser Ser Cys
Gly Lys Glu Asn Thr Ser Asp Pro 50 55 60 Ser Leu Val Ile Ala Phe
Gly Arg Gly His Thr Leu Thr
Leu Asn Phe 65 70 75 80 Thr Arg Asn Ala Thr Arg Tyr Ser Val Gln Leu
Met Ser Phe Val Tyr 85 90 95 Asn Leu Ser Asp Thr His Leu Phe Pro
Asn Ala Ser Ser Lys Glu Ile 100 105 110 Lys Thr Val Glu Ser Ile Thr
Asp Ile Arg Ala Asp Ile Asp Lys Lys 115 120 125 Tyr Arg Cys Val Ser
Gly Thr Gln Val His Met Asn Asn Val Thr Val 130 135 140 Thr Leu His
Asp Ala Thr Ile Gln Ala Tyr Leu Ser Asn Ser Ser Phe 145 150 155 160
Ser Arg Gly Glu Thr Arg Cys Glu Gln Asp Arg 165 170
81214PRTArtificial Sequencechimeric 81Asp Ile Gln Met Thr Gln Thr
Thr Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Asp Arg Val Thr Ile
Ser Cys Arg Ala Ser Gln Gly Ile Asn Lys Tyr 20 25 30 Leu Asn Trp
Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile 35 40 45 Tyr
Tyr Thr Ser Thr Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Asn Asn Leu Glu Pro
65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Thr Arg Leu
Pro Phe 85 90 95 Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys Arg
Thr Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro Pro Ser Asp
Glu Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val Cys Leu Leu
Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln Trp Lys Val
Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln 145 150 155 160 Glu Ser Val
Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175 Ser
Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185
190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser
195 200 205 Phe Asn Arg Gly Glu Cys 210 8216PRTHomo sapiens 82Gln
Ala Phe Lys Val Glu Gly Gly Gln Phe Gly Ser Val Glu Glu Cys 1 5 10
15 838PRTMus musculus 83Gly Tyr Ala Phe Thr Asn Tyr Leu 1 5
848PRTMus musculus 84Ile Asn Pro Gly Ser Gly Gly Thr 1 5 8512PRTMus
musculus 85Ala Arg Tyr Arg Ser Tyr Asp Trp Tyr Phe Asp Val 1 5 10
866PRTMus musculus 86Gly Asn Ile His Asn Tyr 1 5 879PRTMus musculus
87Gln His Phe Trp Ser Asn Pro Tyr Thr 1 5 88119PRTMus musculus
88Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Arg Pro Gly Thr 1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ala Phe Thr Asn
Tyr 20 25 30 Leu Ile Glu Trp Val Lys Gln Arg Pro Gly Gln Gly Leu
Glu Trp Ile 35 40 45 Gly Val Ile Asn Pro Gly Ser Gly Gly Thr Asn
Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Ala Asp
Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Gln Leu Ser Ser Leu Thr
Ser Asp Asp Ser Ala Val Tyr Phe Cys 85 90 95 Ala Arg Tyr Arg Ser
Tyr Asp Trp Tyr Phe Asp Val Trp Gly Ala Gly 100 105 110 Thr Thr Val
Thr Val Ser Ser 115 89107PRTMus musculus 89Asp Ile Gln Met Thr Gln
Ser Pro Ala Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Glu Thr Val Thr
Ile Thr Cys Arg Val Ser Gly Asn Ile His Asn Tyr 20 25 30 Leu Ala
Trp Tyr Gln Gln Lys Gln Gly Lys Ser Pro Gln Leu Leu Val 35 40 45
Tyr Asn Ala Lys Thr Leu Ala Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60 Ser Gly Ser Gly Thr Gln Tyr Ser Leu Lys Ile Asn Ser Leu Gln
Pro 65 70 75 80 Glu Asp Phe Gly Ser Tyr Tyr Cys Gln His Phe Trp Ser
Asn Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
100 105 9015PRTHomo sapiens 90Ser Ala Ala Phe Ser Val Asn Tyr Asp
Thr Lys Ser Gly Pro Lys 1 5 10 15 9116PRTHomo sapiens 91Glu Ser Ile
Thr Asp Ile Arg Ala Asp Ile Asp Lys Lys Tyr Arg Cys 1 5 10 15
9215PRTHomo sapiens 92Asn Thr Ile Leu Pro Asp Ala Arg Asp Pro Ala
Phe Lys Ala Ala 1 5 10 15 936PRTArtificial SequenceConsensus
sequenceMISC_FEATURE(1)..(2)Xaa is any amino
acidMISC_FEATURE(3)..(3)Xaa is I, L or V 93Xaa Xaa Xaa Asp Arg Tyr
1 5 948PRTArtificial SequenceConsensus
sequenceMISC_FEATURE(4)..(6)Xaa is any amino acid 94Leu Gln Tyr Xaa
Xaa Xaa Trp Thr 1 5 958PRTArtificial SequenceConsensus
sequenceMISC_FEATURE(1)..(1)Xaa is any amino
acidMISC_FEATURE(2)..(2)Xaa is Y or F.MISC_FEATURE(5)..(5)Xaa is
any amino acid 95Xaa Xaa Ile Phe Xaa Asn Tyr Asn 1 5
9611PRTArtificial SequenceConsensus sequenceMISC_FEATURE(6)..(8)Xaa
is any amino acid 96Val Arg Ala Asn Trp Xaa Xaa Xaa Phe Ala Tyr 1 5
10 9750PRTHomo sapiens 97Asn Gly Asn Gly Thr Ala Cys Ile Met Ala
Asn Phe Ser Ala Ala Phe 1 5 10 15 Ser Val Asn Tyr Asp Thr Lys Ser
Gly Pro Lys Asn Met Thr Phe Asp 20 25 30 Leu Pro Ser Asp Ala Thr
Val Val Leu Asn Arg Ser Ser Cys Gly Lys 35 40 45 Glu Asn 50
98443PRTMus musculus 98Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu
Val Arg Pro Gly Thr 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Ala Phe Thr Asn Tyr 20 25 30 Leu Ile Glu Trp Val Lys Gln
Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Val Ile Asn Pro
Gly Ser Gly Gly Thr Asn Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys
Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met
Gln Leu Ser Ser Leu Thr Ser Asp Asp Ser Ala Val Tyr Phe Cys 85 90
95 Ala Arg Tyr Arg Ser Tyr Asp Trp Tyr Phe Asp Val Trp Gly Ala Gly
100 105 110 Thr Thr Val Thr Val Ser Ser Ala Lys Thr Thr Pro Pro Ser
Val Tyr 115 120 125 Pro Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser
Met Val Thr Leu 130 135 140 Gly Cys Leu Val Lys Gly Tyr Phe Pro Glu
Pro Val Thr Val Thr Trp 145 150 155 160 Asn Ser Gly Ser Leu Ser Ser
Gly Val His Thr Phe Pro Ala Val Leu 165 170 175 Gln Ser Asp Leu Tyr
Thr Leu Ser Ser Ser Val Thr Val Pro Ser Ser 180 185 190 Thr Trp Pro
Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala Ser 195 200 205 Ser
Thr Lys Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly Cys Lys 210 215
220 Pro Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro
225 230 235 240 Pro Lys Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro
Lys Val Thr 245 250 255 Cys Val Val Val Asp Ile Ser Lys Asp Asp Pro
Glu Val Gln Phe Ser 260 265 270 Trp Phe Val Asp Asp Val Glu Val His
Thr Ala Gln Thr Gln Pro Arg 275 280 285 Glu Glu Gln Phe Asn Ser Thr
Phe Arg Ser Val Ser Glu Leu Pro Ile 290 295 300 Met His Gln Asp Trp
Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn 305 310 315 320 Ser Ala
Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys 325 330 335
Gly Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu 340
345 350 Gln Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp
Phe 355 360 365 Phe Pro Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly
Gln Pro Ala 370 375 380 Glu Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp
Thr Asp Gly Ser Tyr 385 390 395 400 Phe Val Tyr Ser Lys Leu Asn Val
Gln Lys Ser Asn Trp Glu Ala Gly 405 410 415 Asn Thr Phe Thr Cys Ser
Val Leu His Glu Gly Leu His Asn His His 420 425 430 Thr Glu Lys Ser
Leu Ser His Ser Pro Gly Lys 435 440 99214PRTMus musculus 99Asp Ile
Gln Met Thr Gln Ser Pro Ala Ser Leu Ser Ala Ser Val Gly 1 5 10 15
Glu Thr Val Thr Ile Thr Cys Arg Val Ser Gly Asn Ile His Asn Tyr 20
25 30 Leu Ala Trp Tyr Gln Gln Lys Gln Gly Lys Ser Pro Gln Leu Leu
Val 35 40 45 Tyr Asn Ala Lys Thr Leu Ala Asp Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Gln Tyr Ser Leu Lys Ile
Asn Ser Leu Gln Pro 65 70 75 80 Glu Asp Phe Gly Ser Tyr Tyr Cys Gln
His Phe Trp Ser Asn Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys
Leu Glu Ile Lys Arg Ala Asp Ala Ala 100 105 110 Pro Thr Val Ser Ile
Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly 115 120 125 Gly Ala Ser
Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile 130 135 140 Asn
Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu 145 150
155 160 Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met
Ser 165 170 175 Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His
Asn Ser Tyr 180 185 190 Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser
Pro Ile Val Lys Ser 195 200 205 Phe Asn Arg Asn Glu Cys 210
* * * * *
References