U.S. patent application number 15/805269 was filed with the patent office on 2018-03-01 for hydrolases, nucleic acids encoding them and methods for making and using them.
The applicant listed for this patent is DSM IP ASSETS B.V.. Invention is credited to Nelson R. Barton, Christopher L.G. Dayton, Tim Hitchman, Katie A. Kline, Jonathan Lyon, Mark A. Wall.
Application Number | 20180057803 15/805269 |
Document ID | / |
Family ID | 41722322 |
Filed Date | 2018-03-01 |
United States Patent
Application |
20180057803 |
Kind Code |
A1 |
Hitchman; Tim ; et
al. |
March 1, 2018 |
HYDROLASES, NUCLEIC ACIDS ENCODING THEM AND METHODS FOR MAKING AND
USING THEM
Abstract
Provided are hydrolases, including lipases, saturases,
palmitases and/or stearatases, and polynucleotides encoding them,
and methods of making and using these polynucleotides and
polypeptides. Further provided are polypeptides, e.g., enzymes,
having a hydrolase activity, e.g., lipases, saturases, palmitases
and/or stearatases and methods for preparing low saturate or low
trans fat oils, such as low saturate or low trans fat animal or
vegetable oils, e.g., soy or canola oils.
Inventors: |
Hitchman; Tim; (Carlsbad,
CA) ; Dayton; Christopher L.G.; (Bourbonnais, IL)
; Kline; Katie A.; (San Diego, CA) ; Lyon;
Jonathan; (San Diego, CA) ; Wall; Mark A.;
(San Diego, CA) ; Barton; Nelson R.; (San Diego,
CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
DSM IP ASSETS B.V. |
Heerlen |
|
NL |
|
|
Family ID: |
41722322 |
Appl. No.: |
15/805269 |
Filed: |
November 7, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14964708 |
Dec 10, 2015 |
|
|
|
15805269 |
|
|
|
|
13471206 |
May 14, 2012 |
9238804 |
|
|
14964708 |
|
|
|
|
12202119 |
Aug 29, 2008 |
8198062 |
|
|
13471206 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61Q 19/00 20130101;
A61K 8/66 20130101; C12N 9/16 20130101; A61K 2800/10 20130101; C11D
3/38681 20130101; A61K 8/64 20130101; C12Y 301/01021 20130101; A23L
29/06 20160801; C12N 9/20 20130101; C11D 3/386 20130101; A23V
2002/00 20130101 |
International
Class: |
C12N 9/20 20060101
C12N009/20; C12N 9/16 20060101 C12N009/16; A61K 8/64 20060101
A61K008/64; A61K 8/66 20060101 A61K008/66; C11D 3/386 20060101
C11D003/386; A23L 29/00 20060101 A23L029/00; A61Q 19/00 20060101
A61Q019/00 |
Claims
1. An isolated, synthetic or recombinant variant polypeptide
comprising an amino acid sequence that is at least 85% identical to
the amino acid sequence of SEQ ID NO:2, and contains at least one
amino acid residue substitution modification relative to SEQ ID
NO:2, selected from the group consisting of: Y7R, D16M, G27Q, G27S,
L43V, G45A, G45L, A48T, S54H, D61A, D61E, D61S, V62E, V62A, V62G,
V62M, V62N, V62Q, V62S, V62T, R72E, R72K, R72P, R72S, R72T, R72Y,
F74I, F74L, F74P, F74R, G77P, G80P, V83C, V83M, D84V, R89S, A96C,
A96I, A96S, G98A, G98L, Y113F, E116A, E116F, E116G, E116H, E116L,
E116P, E116Q, E116R, E116S, E116T, E116V, K120I, K120L, K120F,
K120M, K120S, K146A, I147F, I147L, I151A, I151G, I151H, I151P,
I151S, I151T, T155C, D157S, D157G, D268T, N158A, L159M, P160T,
I167R, I167S, R172P, R172Q, R172S, D197K, A210V, A211T, A211S,
A211I, S212C, S212A, S212E, S212G, S212H, S212L, S212P, S212Q,
S212R, S212T, S212V, S212W, S212Y, K213I, K213G, K213T, T214V,
T214P, T214N, T214R, T214Y, G215A, G215H, G215S, G215M, G215V,
G215P, G215C, G215W, A216T, A216R, A216Y, A216V, A216C, A216C,
A216S, A216L, E217Q, E217R, E217S, E217A, E217G, E217P, A218M,
A218H, A218Q, A218R, A218W, A218W, A218S, A218T, A218T, A218K,
V223A, V223M, V223R, V223T, V223T, V223F, A224F, A224G, A224I,
A224Q, A224Y, A225G, A225L, A225M, A225Q, and A225T, and the
variant polypeptide has palmitase activity.
2. The polypeptide of claim 1, wherein the combination of amino
acid residue modifications is set forth in FIG. 8.
3. The polypeptide of claim 1, wherein the combination of amino
acid residue modifications is set forth in Table 5.
4. The polypeptide of claim 1, wherein the combination of amino
acid residue modifications is set forth in Table 6.
5. The polypeptide of claim 1, comprising at least one further
amino acid modification selected from the group consisting of D61A,
D61E, R72E, R72K, E116A, E116Q, E116R, E116T, E116V, S133A, I151A,
I151G, D164R, or a combination thereof.
6. A composition comprising the polypeptide of claim 1, wherein the
composition is a detergent, a cosmetic, a cream, a pharmaceutical,
a liposome, a tablet, a capsule, a formulation, a drug delivery
agent, a food, feed, food supplement, feed supplement, dietary aid,
dietary composition, or enzyme delivery matrix.
7. A protein preparation comprising the polypeptide of claim 1,
wherein the protein preparation comprises a liquid, a solid or a
gel.
8. A food, feed, food supplement, feed supplement, dietary aid or
dietary composition comprising a polypeptide of claim 1.
9. An edible enzyme delivery matrix comprising the polypeptide of
claim 1.
10. A detergent composition comprising the polypeptide of claim
1.
11. The detergent composition of claim 10, wherein the polypeptide
is formulated in a non-aqueous liquid composition, a cast solid, a
granular form, a particulate form, a compressed tablet, a gel form,
a powder, a gel, a hydrogel, a liposome, an aerosol, a paste or a
slurry form.
12. A cosmetic or a cream comprising the polypeptide of claim
1.
13. A heterodimer or a homodimer comprising the polypeptide of
claim 1.
14. The polypeptide of claim 1 wherein the polypeptide is
immobilized on a cell, a metal, a resin, a polymer, a ceramic, a
glass, a microelectrode, a graphitic particle, a bead, a gel, a
plate, an array or a capillary tube.
15. A method of producing the polypeptide of claim 1, comprising:
(a) providing an isolated, synthetic or recombinant polynucleotide
comprising a nucleic acid sequence that encodes the polypeptide of
claim 1 operably linked to a promoter; and (b) expressing the
nucleic acid of step (a) under conditions that allow expression of
the polypeptide, thereby producing the polypeptide.
16. An isolated, synthetic or recombinant polynucleotide comprising
a nucleic acid sequence that encodes the polypeptide of claim
1.
17. An expression cassette, a vector, or a cloning vehicle
comprising the nucleic acid sequence of claim 16.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional application of U.S.
application Ser. No. 14/964,708, filed 10 Dec. 2015, currently
pending, which is a divisional application of U.S. application Ser.
No. 13/471,206, filed 14 May 2012 (now U.S. Pat. No. 9,238,206),
which is a divisional application of U.S. application Ser. No.
12/202,119, filed 29 Aug. 2008 (now U.S. Pat. No. 8,198,062), the
contents all of which are incorporated herein by reference in their
entireties.
REFERENCE TO SEQUENCE LISTING SUBMITTED AS A COMPLIANT ASCII TEXT
FILE (.txt)
[0002] Pursuant to the EFS-Web legal framework and 37 CFR .sctn.
.sctn. 1.821-825 (see MPEP .sctn. 2442.03(a)), a Sequence Listing
in the form of an ASCII-compliant text file (entitled
"Sequence_Listing_291928-183004_ST25.txt" created on 3 Nov. 2017,
and 34,489 bytes in size) is submitted concurrently with the
instant application, and the entire contents of the Sequence
Listing are incorporated herein by reference.
BACKGROUND
Field of the Invention
[0003] Provided herein are polypeptides having hydrolase activity,
including lipase, saturase, palmitase and/or stearatase activity,
polynucleotides encoding them, and methods of making and using
these polynucleotides and polypeptides. Also provided herein are
peptides and polypeptides, e.g., enzymes, having a hydrolase
activity, e.g., lipases, saturases, palmitases and/or stearatases,
and methods for treatment of fats and oils with such peptides and
polypeptides to prepare hydrolyzed oil products such as low
saturate animal or vegetable oils, e.g., soy or canola oils, the
oil products so treated, and products comprising such treated
oils.
[0004] The major industrial applications for hydrolases, e.g.,
lipases, saturases, palmitases and/or stearatases, include the food
and beverage industry, as antistaling agents for bakery products,
and in the production of margarine and other spreads with natural
butter flavors; in waste systems; and in the pharmaceutical
industry where they are used as digestive aids.
[0005] Processed oils and fats are a major component of foods, food
additives and food processing aids, and are also important
renewable raw materials for the chemical industry. They are
available in large quantities from the processing of oilseeds from
plants like rice bran, corn, rapeseed, canola, sunflower, olive,
palm or soy. Other sources of valuable oils and fats include fish,
restaurant waste, and rendered animal fats. These fats and oils are
a mixture of triacylglycerides or lipids, i.e. fatty acids (FA)
esterified on a glycerol scaffold. Each oil or fat contains a wide
variety of different lipid structures, defined by the FA content
and their regiochemical distribution on the glycerol backbone.
These properties of the individual lipids determine the physical
properties of the pure triacylglyceride. Hence, the
triacylglyceride content of a fat or oil to a large extent
determines the physical, chemical and biological properties of the
oil. The value of lipids increases greatly as a function of their
purity. High purity can be achieved by fractional chromatography or
distillation, separating the desired triacylglyceride from the
mixed background of the fat or oil source. However, this is costly
and yields are often limited by the low levels at which the
triacylglyceride occurs naturally. In addition, the ease of
purifying the product is often compromised by the presence of many
structurally and physically or chemically similar triacylglycerides
in the oil.
[0006] An alternative to purifying triacylglycerides or other
lipids from a natural source is to synthesize the lipids. The
products of such processes are called structured lipids because
they contain a defined set of fatty acids distributed in a defined
manner on the glycerol backbone. The value of lipids also increases
greatly by controlling the fatty acid content and distribution
within the lipid. Elimination from triglycerides, fats or oils of
undesirable FA, or replacement of FA with undesirable properties by
fatty acids with better or more desirable chemical, physical or
biological properties, increases the value of the lipids. In
particular, a need exists for lipases that can hydrolyze, e.g.
selectively hydrolyze, a saturated fatty acid (a "saturase"), or
those that in particular, can hydrolyze, e.g. selectively
hydrolyze, a palmitic acid (a "palmitase") or a stearic acid (a
"stearatase") from a glycerol backbone. Lipases, such as saturases,
e.g. palmitases and/or stearatases can be used to effect such
control where the FA being removed, added or replaced are saturated
fatty acids, e.g. palmitatic acid or stearic acid.
SUMMARY
[0007] Provided herein are polypeptides having hydrolase activity,
including lipase activity. In one aspect, provided herein are novel
classes of lipases termed "saturases", "palmitases" and
"stearatases". Also provided are polynucleotides encoding
polypeptides having saturase, e.g. palmitase and/or stearatase
activity, and methods of making and using these polynucleotides and
polypeptides. In one aspect, provided herein are polypeptides,
e.g., enzymes, having a hydrolase activity, e.g., lipase, saturase,
palmitase and/or stearatase activity having thermostable and/or
thermotolerant enzyme (catalytic) activity. The enzymatic
activities of the polypeptides and peptides as provided herein
include (comprise or consist of) a saturase activity or a lipase
activity, including hydrolysis of lipids, acidolysis reactions
(e.g., to replace an esterified fatty acid with a free fatty acid),
transesterification reactions (e.g., exchange of fatty acids
between triacylglycerides), ester synthesis, ester interchange
reactions and lipid acyl hydrolase (LAH) activity. In another
aspect, the polypeptides as provided herein are used to synthesize
enantiomerically pure chiral products.
[0008] The polypeptides as provided herein can be used in a variety
of pharmaceutical, agricultural and industrial contexts, including
the manufacture of cosmetics and nutraceuticals. Additionally, the
polypeptides as provided herein can be used in food processing,
brewing, bath additives, alcohol production, peptide synthesis,
enantioselectivity, hide preparation in the leather industry, waste
management and animal waste degradation, silver recovery in the
photographic industry, medical treatment, silk degumming, biofilm
degradation, biomass conversion to ethanol, biodefense,
antimicrobial agents and disinfectants, personal care and
cosmetics, biotech reagents, in increasing starch yield from corn
wet milling, and as pharmaceuticals such as digestive aids and
anti-inflammatory (anti-phlogistic) agents.
[0009] In certain embodiments, provided herein are compositions
(e.g., lipases, saturases, palmitases and/or stearatases) and
methods for producing low saturate oils, e.g., oils with a lower
saturated fatty acid content, including oils low in palmitate,
stearate, myristate, laurate or butyrate fatty acids and/or
caprylic acid (octanoic acid). Any vegetable oil, e.g. canola oil,
soybean oil, or animal oil or fat, e.g., tallow, can be treated
with a composition, or by a method, as provided herein. Any foods,
edible items, or baking, frying or cooking products (e.g., sauces,
marinades, condiments, spray oils, margarines, baking oils,
mayonnaise, cooking oils, salad oils, spoonable and pourable
dressings, and the like, and products made therewith) can comprise
a vegetable oil or animal fat that has been treated with a
composition or by a method as provided herein. Vegetable oils
modified to be lower saturate oils can be used in any foods, edible
items or baking or cooking products, e.g., sauces, marinades,
condiments, spray oils, margarines, baking oils, mayonnaise,
cooking oils, salad oils, spoonable and pourable dressings and the
like. In one embodiment, provided herein are oils, such as
vegetable oils, e.g., canola oil or soybean oil, and foods or
baking or cooking products, including sauces, marinades,
condiments, spray oils, margarines, mayonnaise, baking oils,
cooking oils, frying oils, salad oils, spoonable and pourable
dressings, and the like, wherein the oil or food, baking or cooking
product has been modified using an enzyme as provided herein. In
one aspect, these vegetable oils, e.g. canola oil, castor oil,
coconut oil, coriander oil, corn oil, cottonseed oil, hazelnut oil,
hempseed oil, linseed oil, meadowfoam oil, olive oil, palm oil,
palm kernel oil, peanut oil, rapeseed oil, rice bran oil, safflower
oil, sasanqua oil, soybean oil, sunflower seed oil, tall oil,
tsubaki oil, varieties of "natural" oils having altered fatty acid
compositions via Genetically Modified Organisms (GMO) or
traditional "breeding" such as high oleic, low linolenic, or low
saturate oils (high oleic canola oil, low linolenic soybean oil or
high stearic sunflower oils), animal fats (tallow, lard, butter
fat, and chicken fat), fish oils (candlefish oil, cod-liver oil,
orange roughy oil, sardine oil, herring oil, and menhaden oil), or
blends of any of the above, and foods or baking, frying or cooking
products, comprise oils with a lower saturated fatty acid content,
including oils low in palmitic acid, myristic acid, lauric acid,
stearic acid, caprylic acid (octanoic acid) etc., processed by
using a composition or method as provided herein.
[0010] In one aspect, provided herein are polypeptides, for
example, enzymes and catalytic antibodies, having a hydrolase
activity, e.g., lipase, saturase, palmitase and/or stearatase
activity, including thermostable and thermotolerant enzymatic
activities, and fatty acid specific or fatty acid selective
activities, and low or high pH tolerant enzymatic activities, and
polynucleotides encoding these polypeptides, including vectors,
host cells, transgenic plants and non-human animals, and methods
for making and using these polynucleotides and polypeptides.
[0011] In another aspect, provided herein are isolated, synthetic
or recombinant nucleic acids comprising [0012] (a) a nucleic acid
(polynucleotide) encoding at least one polypeptide, wherein the
nucleic acid comprises a sequence having at least about 50%, 51%,
52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%,
65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%,
78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete
(100%) sequence identity to: [0013] (i) SEQ ID NO:1, SEQ ID NO:3,
SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13,
SEQ ID NO:15, SEQ ID NO:17, or SEQ ID NO:19 or [0014] (ii) the
nucleic acid of SEQ ID NO:1 having one or more nucleotide changes
(or the equivalent thereof) encoding one, two, three, four, five,
six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen,
fifteen, sixteen, seventeen, eighteen, nineteen, twenty,
twenty-one, twenty-two, twenty-three, twenty-four or more or all
the amino acid changes (or the equivalent thereof) as set forth in
Table 3 or Table 4, wherein the nucleic acid of (i) or (ii) encodes
at least one polypeptide having a hydrolase activity, e.g. a
lipase, a saturase, a palmitase and/or a stearatase activity, or
encodes a polypeptide or peptide capable of generating a hydrolase
(e.g. a lipase, a saturase, a palmitase and/or a stearatase)
specific antibody (a polypeptide or peptide that acts as an epitope
or immunogen), [0015] (b) the nucleic acid (polynucleotide) of (a),
wherein the sequence identities are determined: (A) by analysis
with a sequence comparison algorithm or by visual inspection, or
(B) over a region of at least about 10, 15, 20, 25, 30, 35, 40, 45,
50, 55, 60, 65, 70, 75, 100, 125, 150, 175, 200, 250, 300, 350,
400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000,
1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550 or
more residues, or the full length of a cDNA, transcript (mRNA) or
gene, [0016] (c) the nucleic acid (polypeptide) of (a) or (b),
wherein, the sequence comparison algorithm is a BLAST version 2.2.2
algorithm where a filtering setting is set to blastall -p blastp -d
"nr pataa"-F F, and all other options are set to default, [0017]
(d) a nucleic acid (polynucleotide) encoding at least one
polypeptide or peptide having a hydrolase activity, e.g. a lipase,
a saturase, a palmitase and/or a stearatase activity, wherein the
nucleic acid comprises a sequence that hybridizes under stringent
conditions to the complement of the nucleic acid of (a), (b) or
(c), wherein the stringent conditions comprise a wash step
comprising a wash in 0.2.times.SSC at a temperature of about
65.degree. C. for about 15 minutes, [0018] (e) a nucleic acid
(polynucleotide) encoding at least one polypeptide having a
hydrolase activity, e.g. a lipase, a saturase, a palmitase and/or a
stearatase activity, wherein the polypeptide comprises the sequence
of SEQ ID NO:2, or enzymatically active fragments thereof, having
at least one, two, three, four, five, six, seven, eight, nine, ten,
eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen,
eighteen, nineteen, twenty, twenty-one, twenty-two, twenty-three,
twenty-four, or more or all the amino acid changes (or the
equivalent thereof) as set forth in Table 3 or Table 4, [0019] (f)
a nucleic acid (polynucleotide) encoding at least one polypeptide
having a hydrolase activity, e.g. a lipase, a saturase, a palmitase
and/or a stearatase activity, wherein the polypeptide comprises the
sequence of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ
ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18,
or SEQ ID NO:20 or enzymatically active fragments thereof, [0020]
(g) (A) the nucleic acid (polynucleotide) of any of (a) to (f) and
encoding a polypeptide having at least one conservative amino acid
substitution and retaining its hydrolase activity, e.g. lipase,
saturase, palmitase and/or stearatase activity, or, (B) the nucleic
acid of (g)(A), wherein the at least one conservative amino acid
substitution comprises substituting an amino acid with another
amino acid of like characteristics; or, a conservative substitution
comprises: replacement of an aliphatic amino acid with another
aliphatic amino acid; replacement of a serine with a threonine or
vice versa; replacement of an acidic residue with another acidic
residue; replacement of a residue bearing an amide group with
another residue bearing an amide group; exchange of a basic residue
with another basic residue; or replacement of an aromatic residue
with another aromatic residue, [0021] (h) the nucleic acid
(polynucleotide) of any of (a) to (g) encoding a polypeptide having
a hydrolase activity, e.g. a lipase, a saturase, a palmitase and/or
a stearatase activity but lacking a signal sequence, [0022] (i) the
nucleic acid (polynucleotide) of any of (a) to (h) encoding a
polypeptide having a hydrolase activity, e.g. a lipase, a saturase,
a palmitase and/or a stearatase activity further comprising a
heterologous sequence, [0023] (j) the nucleic acid (polynucleotide)
of (i), wherein the heterologous sequence comprises, or consists of
a sequence encoding: (A) a heterologous signal sequence, (B) the
sequence of (A), wherein the heterologous signal sequence is
derived from a heterologous enzyme, or, (C) a tag, an epitope, a
targeting peptide, a cleavable sequence, a detectable moiety or an
enzyme, or [0024] (k) a nucleic acid sequence (polynucleotide)
fully (completely) complementary to the sequence of any of (a) to
(j).
[0025] In one aspect, the isolated, synthetic or recombinant
nucleic acid encodes a polypeptide or peptide having a hydrolase
activity, e.g., lipase, saturase, palmitase and/or stearatase
activity, which is thermostable. The polypeptides and peptides
encoded by nucleic acids as provided herein, or any polypeptide or
peptide as provided herein, can retain enzymatic or binding
activity (e.g., substrate binding) under conditions comprising a
temperature range of between about -100.degree. C. to about
-80.degree. C., about -80.degree. C. to about -40.degree. C., about
-40.degree. C. to about -20.degree. C., about -20.degree. C. to
about 0.degree. C., about 0.degree. C. to about 5.degree. C., about
5.degree. C. to about 15.degree. C., about 15.degree. C. to about
25.degree. C., about 25.degree. C. to about 37.degree. C., about
37.degree. C. to about 45.degree. C., about 45.degree. C. to about
55.degree. C., about 55.degree. C. to about 70.degree. C., about
70.degree. C. to about 75.degree. C., about 75.degree. C. to about
85.degree. C., about 85.degree. C. to about 90.degree. C., about
90.degree. C. to about 95.degree. C., about 95.degree. C. to about
100.degree. C., about 100.degree. C. to about 105.degree. C., 5
about 105.degree. C. to about 110.degree. C., about 110.degree. C.
to about 120.degree. C., or 95.degree. C., 96.degree. C.,
97.degree. C., 98.degree. C., 99.degree. C., 100.degree. C.,
101.degree. C., 102.degree. C., 103.degree. C., 104.degree. C.,
105.degree. C., 106.degree. C., 107.degree. C., 108.degree. C.,
109.degree. C., 110.degree. C., 111.degree. C., 112.degree. C.,
113.degree. C., 114.degree. C., 115.degree. C. or more. Provided
herein are the thermostable polypeptides that retain a hydrolase
activity, e.g., lipase, saturase, palmitase and/or stearatase
activity, at a temperature in the ranges described above, at about
pH 3.0, about pH 3.5, about pH 4.0, about pH 4.5, about pH 5.0,
about pH 5.5, about pH 6.0, about pH 6.5, about pH 7.0, about pH
7.5, about pH 8.0, about pH 8.5, about pH 9.0, about pH 9.5, about
pH 10.0, about pH 10.5, about pH 11.0, about pH 11.5, about pH 12.0
or more.
[0026] In one aspect, polypeptides as provided herein can be
thermotolerant and can retain a hydrolase activity, e.g. lipase,
saturase, palmitase and/or stearatase activity after exposure to a
temperature in the range from about -100.degree. C. to about
-80.degree. C., about -80.degree. C. to about -40.degree. C., about
-40.degree. C. to about -20.degree. C., about -20.degree. C. to
about 0.degree. C., about 0.degree. C. to about 5.degree. C., about
5.degree. C. to about 15.degree. C., about 15.degree. C. to about
25.degree. C., about 25.degree. C. to about 37.degree. C., about
37.degree. C. to about 45.degree. C., about 45.degree. C. to about
55.degree. C., about 55.degree. C. to about 70.degree. C., about
70.degree. C. to about 75.degree. C., about 75.degree. C. to about
85.degree. C., about 85.degree. C. to about 90.degree. C., about
90.degree. C. to about 95.degree. C., about 95.degree. C. to about
100.degree. C., about 100.degree. C. to about 105.degree. C., about
105.degree. C. to about 110.degree. C., about 110.degree. C. to
about 120.degree. C., or 95.degree. C., 96.degree. C., 97.degree.
C., 98.degree. C., 99.degree. C., 100.degree. C., 101.degree. C.,
102.degree. C., 103.degree. C., 104.degree. C., 105.degree. C.,
106.degree. C., 107.degree. C., 108.degree. C., 109.degree. C.,
110.degree. C., 111.degree. C., 112.degree. C., 113.degree. C.,
114.degree. C., 115.degree. C. or more.
[0027] In some embodiments, the thermotolerant polypeptides retain
a hydrolase activity, e.g. lipase, saturase, palmitase and/or
stearatase activity, after exposure to a temperature in the ranges
described above, at about pH 3.0, about pH 3.5, about pH 4.0, about
pH 4.5, about pH 5.0, about pH 5.5, about pH 6.0, about pH 6.5,
about pH 7.0, about pH 7.5, about pH 8.0, about pH 8.5, about pH
9.0, about pH 9.5, about pH 10.0, about pH 10.5, about pH 11.0,
about pH 11.5, about pH 12.0 or more.
[0028] In one embodiment, isolated, synthetic or recombinant
nucleic acids comprise a sequence that hybridizes under stringent
conditions to a nucleic acid as provided herein, e.g., an exemplary
nucleic acid as provided herein comprising a sequence as set forth
in SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9,
SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, or SEQ ID
NO:19 or a sequence as set forth in SEQ ID NO:1 having one, two,
three, four, five, six, seven, eight, nine, ten, eleven or twelve
or more or all the residue changes (sequence modifications to SEQ
ID NO:1) set forth in Table 3 or Table 4, or fragments or
subsequences thereof, and the sequences (fully) complementary
thereto. In one aspect, the nucleic acid encodes a polypeptide
having a hydrolase activity, e.g., lipase, saturase, palmitase
and/or stearatase activity. The nucleic acid can be at least about
10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 100, 125,
150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700 or
more residues in length or the full length of a gene or transcript
comprising SEQ ID NO:1, and having a sequence as set forth in SEQ
ID NO:1 having one, two, three, four, five, six, seven, eight,
nine, ten, eleven or twelve or more or all the residue changes
(amino acid sequence modifications) to SEQ ID NO:1 set forth in
Table 3 or Table 4; and the sequences (fully) complementary
thereto. In one aspect, the stringent conditions include a wash
step comprising a wash in 0.2.times.SSC at a temperature of about
65.degree. C. for about 15 minutes.
[0029] In one embodiment, a nucleic acid probe, e.g., a probe for
identifying a nucleic acid encoding a polypeptide having a
hydrolase activity, e.g., lipase, saturase, palmitase and/or
stearatase activity, comprises a probe comprising or consisting of
at least about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70,
75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500,
550, 600, 650, 700, 750, 800, 850, 900, 950, 1000 or more,
consecutive bases of a sequence as provided herein, or fragments or
subsequences thereof, wherein the probe identifies the nucleic acid
by binding or hybridization. The probe can comprise an
oligonucleotide comprising at least about 10 to 50, about 20 to 60,
about 30 to 70, about 40 to 80, or about 60 to 100 consecutive
bases of a sequence comprising a sequence as provided herein, or
fragments or subsequences thereof. The probe can comprise an
oligonucleotide comprising at least about 10 to 50, about 20 to 60,
about 30 to 70, about 40 to 80, or about 60 to 100 consecutive
bases of a nucleic acid sequence as provided herein, or a
subsequence thereof.
[0030] In one embodiment, an amplification primer sequence pair for
amplifying a nucleic acid encoding a polypeptide having a hydrolase
activity, e.g., lipase, saturase, palmitase and/or stearatase
activity, comprises a primer pair comprising or consisting of a
primer pair capable of amplifying a nucleic acid comprising a
sequence as provided herein, or fragments or subsequences thereof.
One or each member of the amplification primer sequence pair can
comprise an oligonucleotide comprising at least about 10 to 50
consecutive bases of the sequence.
[0031] In one embodiment, methods of amplifying a nucleic acid
encoding a polypeptide having a hydrolase activity, e.g., lipase,
saturase, palmitase and/or stearatase activity, comprise
amplification of a template nucleic acid with an amplification
primer sequence pair capable of amplifying a nucleic acid sequence
as provided herein, or fragments or subsequences thereof.
[0032] In one embodiment, expression cassettes comprise a nucleic
acid as provided herein or a subsequence thereof. In one aspect,
the expression cassette can comprise the nucleic acid that is
operably linked to a promoter. The promoter can be a viral,
bacterial, mammalian or plant promoter. In one aspect, the plant
promoter can be a potato, rice, corn, wheat, tobacco or barley
promoter. The promoter can be a constitutive promoter. The
constitutive promoter can comprise CaMV35S. In another aspect, the
promoter can be an inducible promoter. In one aspect, the promoter
can be a tissue-specific promoter or an environmentally regulated
or a developmentally regulated promoter. Thus, the promoter can be,
e.g., a seed-specific, a leaf-specific, a root-specific, a
stem-specific or an abscission-induced promoter. In one aspect, the
expression cassette can further comprise a plant or plant virus
expression vector.
[0033] In one embodiment, cloning vehicles comprise an expression
cassette (e.g., a vector) as provided herein or a nucleic acid as
provided herein. The cloning vehicle can be a viral vector, a
plasmid, a phage, a phagemid, a cosmid, a fosmid, a bacteriophage
or an artificial chromosome. The viral vector can comprise an
adenovirus vector, a retroviral vector or an adeno-associated viral
vector. The cloning vehicle can comprise a bacterial artificial
chromosome (BAC), a plasmid, a bacteriophage P1-derived vector
(PAC), a yeast artificial chromosome (YAC), or a mammalian
artificial chromosome (MAC).
[0034] In one embodiment, transformed cells comprise a nucleic acid
as provided herein or an expression cassette (e.g., a vector) as
provided herein, or a cloning vehicle as provided herein. In one
aspect, the transformed cell can be a bacterial cell, a mammalian
cell, a fungal cell, a yeast cell, an insect cell or a plant cell.
In one aspect, the plant cell can be a potato, wheat, rice, corn,
tobacco or barley cell. The transformed cell may be any of the host
cells familiar to those skilled in the art, including prokaryotic
cells, eukaryotic cells, such as bacterial cells, fungal cells,
yeast cells, mammalian cells, insect cells, or plant cells.
Exemplary bacterial cells include any species within the genera
Escherichia, Bacillus, Streptomyces, Salmonella, Pseudomonas and
Staphylococcus, including, e.g., Escherichia coli, Lactococcus
lactis, Bacillus subtilis, Bacillus cereus, Salmonella typhimurium,
Pseudomonas fluorescens. Exemplary fungal cells include any species
of Aspergillus. Exemplary yeast cells include any species of
Pichia, Saccharomyces, Schizosaccharomyces, or Schwanniomyces,
including Pichia pastoris, Saccharomyces cerevisiae, or
Schizosaccharomyces pombe. Exemplary insect cells include any
species of Spodoptera or Drosophila, including Drosophila S2 and
Spodoptera Sf9. Exemplary animal cells include CHO, COS or Bowes
melanoma or any mouse or human cell line.
[0035] In one embodiment, transgenic plants comprise a nucleic acid
as provided herein or an expression cassette (e.g., a vector) as
provided herein. The transgenic plant can be a corn plant, a potato
plant, a tomato plant, a wheat plant, an oilseed plant, a rapeseed
plant, a soybean plant, a rice plant, a barley plant or a tobacco
plant.
[0036] In one embodiment, transgenic seeds comprise a nucleic acid
as provided herein or an expression cassette (e.g., a vector) as
provided herein. The transgenic seed can be rice, a corn seed, a
wheat kernel, an oilseed, a rapeseed, a soybean seed, a palm
kernel, a sunflower seed, a sesame seed, a peanut or a tobacco
plant seed.
[0037] In one embodiment, isolated, synthetic or recombinant
polypeptides have a hydrolase activity, e.g. a lipase, a saturase,
a palmitase and/or a stearatase activity, or polypeptides capable
of generating an immune response specific for a hydrolase, e.g. a
lipase, a saturase, a palmitase and/or a stearatase (e.g., an
epitope); and in alternative aspects peptides and polypeptides as
provided herein comprise a sequence:
[0038] (a) having at least about 50%, 51%, 52%, 53%, 54%, 55%, 56%,
57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,
70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%,
83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, or more, or has 100% (complete) sequence
identity to: [0039] (i) the amino acid sequence of SEQ ID NO:2, or
enzymatically active fragments thereof, and having at least one,
two, three, four, five, six, seven, eight, nine, ten, eleven,
twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen,
nineteen, twenty, twenty-one, twenty-two, twenty-three, twenty-four
or more or all of the amino acid residue changes (or the equivalent
thereof) as set forth in Table 3 or Table 4, or [0040] (ii) the
amino acid sequence of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ
ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16,
SEQ ID NO:18, or SEQ ID NO:20 [0041] wherein the polypeptide or
peptide of (i) or (ii) has a hydrolase activity, e.g. a lipase, a
saturase, a palmitase and/or a stearatase activity, or the
polypeptide or peptide is capable of generating a hydrolase (e.g. a
lipase, a saturase, a palmitase and/or a stearatase) specific
antibody (a polypeptide or peptide that acts as an epitope or
immunogen),
[0042] (b) the polypeptide or peptide of (a), wherein the sequence
identities are determined: (A) by analysis with a sequence
comparison algorithm or by a visual inspection, or
[0043] (B) over a region of at least about 20, 25, 30, 35, 40, 45,
50, 55, 60, 75, 100, 150, 200, 250, 300 or more amino acid
residues, or over the full length of the polypeptide or peptide or
enzyme, and/or enzymatically active subsequences (fragments)
thereof,
[0044] (c) the polypeptide or peptide of (b), wherein the sequence
comparison algorithm is a
[0045] BLAST version 2.2.2 algorithm where a filtering setting is
set to blastall -p blastp -d "nr pataa"-F F, and all other options
are set to default;
[0046] (d) an amino acid sequence encoded by the nucleic acid
provided herin, wherein the polypeptide has (i) a hydrolase
activity, e.g. a lipase, a saturase, a palmitase and/or a
stearatase activity, or, (ii) has immunogenic activity in that it
is capable of generating an antibody that specifically binds to a
polypeptide having a sequence of (a), and/or enzymatically active
subsequences (fragments) thereof;
[0047] (e) the amino acid sequence of any of (a) to (d), and
comprising at least one conservative amino acid residue
substitution, and the polypeptide or peptide retains a hydrolase
activity, e.g. a lipase, a saturase, a palmitase and/or a
stearatase activity;
[0048] (f) the amino acid sequence of (e), wherein the conservative
substitution comprises replacement of an aliphatic amino acid with
another aliphatic amino acid; replacement of a serine with a
threonine or vice versa; replacement of an acidic residue with
another acidic residue; replacement of a residue bearing an amide
group with another residue bearing an amide group; exchange of a
basic residue with another basic residue; or, replacement of an
aromatic residue with another aromatic residue, or a combination
thereof,
[0049] (g) the amino acid sequence of (f), wherein the aliphatic
residue comprises alanine, valine, leucine, isoleucine or a
synthetic equivalent thereof; the acidic residue comprises aspartic
acid, glutamic acid or a synthetic equivalent thereof; the residue
comprising an amide group comprises asparagine, glutamine or a
synthetic equivalent thereof; the basic residue comprises lysine,
arginine, histidine or a synthetic equivalent thereof; or, the
aromatic residue comprises phenylalanine, tyrosine, tryptophan or a
synthetic equivalent thereof;
[0050] (h) the polypeptide of any of (a) to (f) having a hydrolase
activity, e.g. a lipase, a saturase, a palmitase and/or a
stearatase activity but lacking a signal sequence,
[0051] (i) the polypeptide of any of (a) to (h) having a hydrolase
activity, e.g. a lipase, a saturase, a palmitase and/or a
stearatase activity further comprising a heterologous sequence;
[0052] (j) the polypeptide of (i), wherein the heterologous
sequence comprises, or consists of: (A) a heterologous signal
sequence, (B) the sequence of (A), wherein the heterologous signal
sequence is derived from a heterologous enzyme, and/or, (C) a tag,
an epitope, a targeting peptide, a cleavable sequence, a detectable
moiety or an enzyme; or
[0053] (m) comprising an amino acid sequence encoded by any nucleic
acid sequence as provided herein are.
[0054] Exemplary polypeptide or peptide sequences as provided
herein include SEQ ID NO:2, and subsequences thereof and variants
thereof, e.g., at least about 30, 35, 40, 45, 50, 75, 100, 150,
200, 250, 300, 350, 400, 450, 500 or more residues in length, or
over the full length of an enzyme, all having one, two, three,
four, five, six, seven, eight, nine, ten, eleven or twelve or more
or all the amino acid residue changes (amino acid sequence
modifications to SEQ ID NO:2) set forth in Table 3 or Table 4.
Exemplary polypeptide or peptide sequences as provided herein
include sequence encoded by a nucleic acid as provided herein.
Exemplary polypeptide or peptide sequences as provided herein
include polypeptides or peptides specifically bound by an antibody
as provided herein. In one aspect, a polypeptide as provided herein
has at least one hydrolase activity, e.g., lipase, saturase,
palmitase and/or stearatase activity. In one aspect, the activity
is a regioselective and/or chemoselective activity.
[0055] In one aspect, the isolated, synthetic or recombinant
polypeptide can comprise the polypeptide as provided herein that
lacks a signal (peptide) sequence, e.g., lacks its homologous
signal sequence, and in one aspect, comprises a heterologous signal
(peptide) sequence. In one aspect, the isolated, synthetic or
recombinant polypeptide can comprise the polypeptide as provided
herein comprising a heterologous signal sequence, such as a
heterologous hydrolase or non-hydrolase (e.g., non-lipase,
non-saturase or non-palmitase) signal sequence. In one aspect,
chimeric proteins comprise a first domain comprising a signal
sequence as provided herein and at least a second domain. The
protein can be a fusion protein. The second domain can comprise an
enzyme. The enzyme can be a hydrolase (e.g., a lipase, saturase,
palmitase and/or stearatase) as provided herein, or, another
hydrolase.
[0056] In one aspect, the hydrolase (e.g., lipase, saturase,
palmitase and/or stearatase) activity comprises a specific activity
at about 37.degree. C. in the range from about 100 to about 1000
units per milligram of protein. In another aspect, the hydrolase
(e.g., lipase, saturase, palmitase and/or stearatase) activity
comprises a specific activity from about 500 to about 750 units per
milligram of protein. Alternatively, the hydrolase activity
comprises a specific activity at 37.degree. C. in the range from
about 500 to about 1200 units per milligram of protein. In one
aspect, the hydrolase activity comprises a specific activity at
37.degree. C. in the range from about 750 to about 1000 units per
milligram of protein. In another aspect, the thermotolerance
comprises retention of at least half of the specific activity of
the hydrolase at 37.degree. C. after being heated to an elevated
temperature. Alternatively, the thermotolerance can comprise
retention of specific activity at 37.degree. C. in the range from
about 500 to about 1200 units per milligram of protein after being
heated to an elevated temperature.
[0057] In one embodiment, the isolated, synthetic or recombinant
polypeptides as provided herein comprise at least one glycosylation
site. In one aspect, glycosylation can be an N-linked
glycosylation. In one aspect, the polypeptide can be glycosylated
after being expressed in a P. pastoris or a S. pombe or in plants,
such as oil producing plants e.g. soy bean, canola, rice,
sunflower, or genetically-modified (GMO) variants of these
plants.
[0058] In one aspect, the polypeptide can retain a hydrolase (e.g.,
lipase, saturase, palmitase and/or stearatase) activity under
conditions comprising about pH 6.5, pH 6, pH 5.5, pH 5, pH 4.5 or
pH 4.0 or lower. In another aspect, the polypeptide can retain a
hydrolase (e.g., lipase, saturase, palmitase and/or stearatase)
activity under conditions comprising about pH 7, pH 7.5, pH 8.0, pH
8.5, pH 9, pH 9.5, pH 10, pH 10.5, pH 11, pH 11.5, pH 12.0 or
more.
[0059] In one embodiment, protein preparations comprise a
polypeptide as provided herein, wherein the protein preparation
comprises a liquid, a solid or a gel.
[0060] In one aspect, heterodimers as provided herein comprise a
polypeptide and a second domain. In one aspect, the second domain
can be a polypeptide and the heterodimer can be a fusion protein.
In one aspect, the second domain can be an epitope or a tag. In one
aspect, homodimers as provided herein comprise a polypeptide as
provided herein.
[0061] In one embodiment, immobilized polypeptides as provided
herein have a hydrolase (e.g., lipase, saturase, palmitase and/or
stearatase) activity, wherein the polypeptide comprises a
polypeptide as provided herein, a polypeptide encoded by a nucleic
acid as provided herein, or a polypeptide comprising a polypeptide
as provided herein and a second domain. In one aspect, a
polypeptide as provided herein can be immobilized on a cell, a
vesicle, a liposome, a film, a membrane, a metal, a resin, a
polymer, a ceramic, a glass, a microelectrode, a graphitic
particle, a bead, a gel, a plate, a crystal, a tablet, a pill, a
capsule, a powder, an agglomerate, a surface, a porous structure,
an array or a capillary tube, or materials such as grains, husks,
bark, skin, hair, enamel, bone, shell and materials deriving from
them. Polynucleotides, polypeptides and enzymes as provided herein
can be formulated in a solid form such as a powder, a lyophilized
preparation, granules, a tablet, a bar, a crystal, a capsule, a
pill, a pellet, or in a liquid form such as an aqueous solution, an
aerosol, a gel, a paste, a slurry, an aqueous/oil emulsion, a
cream, a capsule, or a vesicular or micellar suspension.
[0062] In one embodiment, food supplements for an animal comprise a
polypeptide as provided herein, e.g., a polypeptide encoded by the
nucleic acid as provided herein. In one aspect, the polypeptide in
the food supplement can be glycosylated. In one embodiment, edible
enzyme delivery matrices comprise a polypeptide as provided herein,
e.g., a polypeptide encoded by the nucleic acid as provided herein.
In one aspect, the delivery matrix comprises a pellet. In one
aspect, the polypeptide can be glycosylated. In one aspect, the
hydrolase activity is thermotolerant. In another aspect, the
hydrolase activity is thermostable.
[0063] In one embodiment, methods of isolating or identifying a
polypeptide have a hydrolase (e.g., lipase, saturase, palmitase
and/or stearatase) activity comprising the steps of:
[0064] (a) providing an antibody as provided herein; (b) providing
a sample comprising polypeptides; and (c) contacting the sample of
step (b) with the antibody of step (a) under conditions wherein the
antibody can specifically bind to the polypeptide, thereby
isolating or identifying a polypeptide having a hydrolase (e.g.,
lipase, saturase, palmitase and/or stearatase) activity.
[0065] In one embodiment, methods of making an anti-hydrolase
antibody comprise administering to a non-human animal a nucleic
acid as provided herein or a polypeptide as provided herein or
subsequences thereof in an amount sufficient to generate a humoral
immune response, thereby making an anti-hydrolase antibody.
Provided herein are methods of making an anti-hydrolase antibody
comprising administering to a non-human animal a nucleic acid as
provided herein or a polypeptide as provided herein or subsequences
thereof in an amount sufficient to generate an immune response.
[0066] In one embodiment, methods of producing a recombinant
polypeptide comprise the steps of: (a) providing a nucleic acid as
provided herein operably linked to a promoter; and (b) expressing
the nucleic acid of step (a) under conditions that allow expression
of the polypeptide, thereby producing a recombinant polypeptide. In
one aspect, the method can further comprise transforming a host
cell with the nucleic acid of step (a) followed by expressing the
nucleic acid of step (a), thereby producing a recombinant
polypeptide in a transformed cell.
[0067] In one embodiment, methods for identifying a polypeptide
having a hydrolase (e.g., lipase, saturase, palmitase and/or
stearatase) activity comprise the following steps: (a) providing a
polypeptide as provided herein; or a polypeptide encoded by a
nucleic acid as provided herein; (b) providing a hydrolase
substrate; and (c) contacting the polypeptide or a fragment or
variant thereof of step (a) with the substrate of step (b) and
detecting a decrease in the amount of substrate or an increase in
the amount of a reaction product, wherein a decrease in the amount
of the substrate or an increase in the amount of the reaction
product detects a polypeptide having a hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) activity.
[0068] In one embodiment, methods for identifying a hydrolase
substrate comprise the following steps: (a) providing a polypeptide
as provided herein; or a polypeptide encoded by a nucleic acid as
provided herein; (b) providing a test substrate; and (c) contacting
the polypeptide of step (a) with the test substrate of step (b) and
detecting a decrease in the amount of substrate or an increase in
the amount of reaction product, wherein a decrease in the amount of
the substrate or an increase in the amount of a reaction product
identifies the test substrate as a hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) substrate.
[0069] In one embodiment, methods of determining whether a test
compound specifically binds to a polypeptide comprise the following
steps: (a) expressing a nucleic acid or a vector comprising the
nucleic acid under conditions permissive for translation of the
nucleic acid to a polypeptide, wherein the nucleic acid comprises a
nucleic acid as provided herein, or, providing a polypeptide as
provided herein; (b) providing a test compound; (c) contacting the
polypeptide with the test compound; and (d) determining whether the
test compound of step (b) specifically binds to the
polypeptide.
[0070] In one embodiment, methods for identifying a modulator of a
hydrolase (e.g., lipase, saturase, palmitase and/or stearatase)
activity comprise the following steps: (a) providing a polypeptide
as provided herein or a polypeptide encoded by a nucleic acid as
provided herein; (b) providing a test compound; (c) contacting the
polypeptide of step (a) with the test compound of step (b) and
measuring an activity of the hydrolase, wherein a change in the
hydrolase activity measured in the presence of the test compound
compared to the activity in the absence of the test compound
provides a determination that the test compound modulates the
hydrolase activity. In one aspect, the hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) activity can be measured by
providing a hydrolase substrate and detecting a decrease in the
amount of the substrate or an increase in the amount of a reaction
product, or, an increase in the amount of the substrate or a
decrease in the amount of a reaction product. A decrease in the
amount of the substrate or an increase in the amount of the
reaction product with the test compound as compared to the amount
of substrate or reaction product without the test compound
identifies the test compound as an activator of hydrolase activity.
An increase in the amount of the substrate or a decrease in the
amount of the reaction product with the test compound as compared
to the amount of substrate or reaction product without the test
compound identifies the test compound as an inhibitor of hydrolase
activity.
[0071] In one embodiment, computer systems comprise a processor and
a data storage device wherein said data storage device has stored
thereon a polypeptide sequence or a nucleic acid sequence as
provided herein (e.g., a polypeptide encoded by a nucleic acid as
provided herein). In one aspect, the computer system can further
comprise a sequence comparison algorithm and a data storage device
having at least one reference sequence stored thereon. In another
aspect, the sequence comparison algorithm comprises a computer
program that indicates polymorphisms. In one aspect, the computer
system can further comprise an identifier that identifies one or
more features in said sequence. In one embodiment, computer
readable media have stored thereon a polypeptide sequence or a
nucleic acid sequence as provided herein.
[0072] In one embodiment, methods for identifying a feature in a
sequence comprise the steps of: (a) reading the sequence using a
computer program which identifies one or more features in a
sequence, wherein the sequence comprises a polypeptide sequence or
a nucleic acid sequence as provided herein; and (b) identifying one
or more features in the sequence with the computer program.
[0073] In another embodiment, provided herein are methods for
comparing a first sequence to a second sequence comprising the
steps of: (a) reading the first sequence and the second sequence
through use of a computer program which compares sequences, wherein
the first sequence comprises a polypeptide sequence or a nucleic
acid sequence as provided herein; and (b) determining differences
between the first sequence and the second sequence with the
computer program. The step of determining differences between the
first sequence and the second sequence can further comprise the
step of identifying polymorphisms. In one aspect, the method can
further comprise an identifier that identifies one or more features
in a sequence. In another aspect, the method can comprise reading
the first sequence using a computer program and identifying one or
more features in the sequence.
[0074] In one embodiment, methods for isolating or recovering a
nucleic acid encoding a polypeptide have a hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) activity from a sample
comprising the steps of: (a) providing an amplification primer
sequence pair for amplifying a nucleic acid encoding a polypeptide
having a hydrolase activity, wherein the primer pair is capable of
amplifying a nucleic acid as provided herein; (b) isolating a
nucleic acid from the sample or treating the sample such that
nucleic acid in the sample is accessible for hybridization to the
amplification primer pair; and, (c) combining the nucleic acid of
step (b) with the amplification primer pair of step (a) and
amplifying nucleic acid from the sample, thereby isolating or
recovering a nucleic acid encoding a polypeptide having a hydrolase
activity from a sample. In one embodiment, the sample is an
environmental sample, e.g., a water sample, a liquid sample, a soil
sample, an air sample or a biological sample, e.g. a bacterial
cell, a protozoan cell, an insect cell, a yeast cell, a plant cell,
a fungal cell or a mammalian cell. One or each member of the
amplification primer sequence pair can comprise an oligonucleotide
comprising at least about 10 to 50 or more consecutive bases of a
sequence as provided herein.
[0075] In one embodiment, methods of increasing thermotolerance or
thermostability of a hydrolase polypeptide comprise glycosylating a
hydrolase polypeptide, wherein the polypeptide comprises at least
thirty contiguous amino acids of a polypeptide as provided herein;
or a polypeptide encoded by a nucleic acid sequence as provided
herein, thereby increasing the thermotolerance or thermostability
of the hydrolase polypeptide. In one aspect, the hydrolase specific
activity can be thermostable or thermotolerant at a temperature in
the range from greater than about 37.degree. C. to about 95.degree.
C.
[0076] In one embodiment, methods for overexpressing a recombinant
hydrolase (e.g., lipase, saturase, palmitase and/or stearatase)
polypeptide in a cell comprise expressing a vector comprising a
nucleic acid as provided herein or a nucleic acid sequence as
provided herein, wherein the sequence identities are determined by
analysis with a sequence comparison algorithm or by visual
inspection, wherein overexpression is effected by use of a high
activity promoter, a dicistronic vector or by gene amplification of
the vector.
[0077] In one embodiment, detergent compositions comprising a
polypeptide as provided herein or a polypeptide encoded by a
nucleic acid as provided herein comprise a hydrolase activity,
e.g., lipase, saturase, palmitase and/or stearatase activity. In
one aspect, the hydrolase can be a nonsurface-active hydrolase. In
another aspect, the hydrolase can be a surface-active
hydrolase.
[0078] In one embodiment, methods for washing an object comprise
the following steps: (a) providing a composition comprising a
polypeptide having a hydrolase activity, e.g., lipase, saturase,
palmitase and/or stearatase activity, wherein the polypeptide
comprises: a polypeptide as provided herein or a polypeptide
encoded by a nucleic acid as provided herein; (b) providing an
object; and (c) contacting the polypeptide of step (a) and the
object of step (b) under conditions wherein the composition can
wash the object.
[0079] In one embodiment, methods of making a transgenic plant
comprise the following steps: (a) introducing a heterologous
nucleic acid sequence into a plant cell, wherein the heterologous
nucleic sequence comprises a nucleic acid sequence as provided
herein, thereby producing a transformed plant cell; and (b)
producing a transgenic plant from the transformed cell. In one
aspect, the step (a) can further comprise introducing the
heterologous nucleic acid sequence by electroporation or
microinjection of plant cell protoplasts. In another aspect, the
step (a) can further comprise introducing the heterologous nucleic
acid sequence directly to plant tissue by DNA particle bombardment.
Alternatively, the step (a) can further comprise introducing the
heterologous nucleic acid sequence into the plant cell DNA using an
Agrobacterium tumefaciens host. In one aspect, the plant cell can
be a potato, corn, rice, wheat, tobacco, or barley cell.
[0080] In one embodiment, methods of expressing a heterologous
nucleic acid sequence in a plant cell comprise the following steps:
(a) transforming the plant cell with a heterologous nucleic acid
sequence operably linked to a promoter, wherein the heterologous
nucleic sequence comprises a nucleic acid as provided herein; (b)
growing the plant under conditions wherein the heterologous nucleic
acid sequence is expressed in the plant cell.
[0081] In one embodiment, a first method for biocatalytic synthesis
of a structured lipid comprises the following steps: (a) providing
a polypeptide (e.g., a lipase, saturase, palmitase and/or
stearatase) as provided herein; (b) providing a composition
comprising a triacylglyceride (TAG); (c) contacting the polypeptide
of step (a) with the composition of step (b) under conditions
wherein the polypeptide hydrolyzes an acyl residue at the Sn2
position of the triacylglyceride (TAG), thereby producing a
1,3-diacylglyceride (DAG); (d) providing an R1 ester; (e) providing
an R1-specific hydrolase, and (f) contacting the 1,3-DAG of step
(c) with the R1 ester of step (d) and the R1-specific hydrolase of
step (e) under conditions wherein the R1-specific hydrolase
catalyzes esterification of the Sn2 position, thereby producing the
structured lipid. The hydrolase as provided herein can be an
Sn2-specific lipase. The structured lipid can comprise a cocoa
butter alternative (CBA), a synthetic cocoa butter, a natural cocoa
butter, 1,3-dipalmitoyl-2-oleoylglycerol (POP),
1,3-distearoyl-2-oleoylglycerol (SOS),
1-palmitoyl-2-oleoyl-3-stearoylglycerol (POS) or
1-oleoyl-2,3-dimyristoylglycerol (OMM).
[0082] In one embodiment, a second method for biocatalytic
synthesis of a structured lipid comprises the following steps: (a)
providing a hydrolase (e.g., a lipase, saturase, palmitase and/or
stearatase) as provided herein; (b) providing a composition
comprising a triacylglyceride (TAG); (c) contacting the polypeptide
of step (a) with the composition of step (b) under conditions
wherein the polypeptide hydrolyzes an acyl residue at the Sn1 or
Sn3 position of the triacylglyceride (TAG), thereby producing a
1,2-DAG or 2,3-DAG; and (d) promoting acyl migration in the 1,2-DAG
or 2,3-DAG of the step (c) under kinetically controlled conditions,
thereby producing a composition comprising a 1,3-DAG.
[0083] This second method can further comprise providing an R1
ester and an R1-specific lipase, and contacting the 1,3-DAG of step
(d) with the R1 ester and the R1-specific lipase under conditions
wherein the R1-specific lipase catalyzes esterification of the Sn2
position, thereby producing a structured lipid. The hydrolase e.g.,
a lipase, saturase, palmitase and/or stearatase as provided herein
can be a Sn1 or a Sn3-specific enzyme. The structured lipid can
comprise any vegetable oil, e.g., a soy oil, a canola oil, cocoa
butter alternative (CBA), a synthetic cocoa butter, a natural cocoa
butter, 1,3-dipalmitoyl-2-oleoylglycerol (POP),
1,3-distearoyl-2-oleoylglycerol (SOS),
1-palmitoyl-2-oleoyl-3-stearoylglycerol (POS) or
1-oleoyl-2,3-dimyristoylglycerol (OMM).
[0084] The R1 ester can comprise a moiety of lower saturation than
the hydrolyzed acyl residue, in which case the structured lipid so
produced is a lower-saturated fat or oil than the original TAG. The
R1 ester can comprise one or more of an omega-3 fatty acid, an
omega-6 fatty acid, a mono-unsaturated fatty acid, a
poly-unsaturated fatty acid, a phospho-group, a phytosterol ester,
and oryzanol. More specifically the R1 ester can comprise a moiety
selected from the group consisting of alpha-linolenic acid,
eicosapentaenoic acid, docosahexaenoic acid, gamma-linolenic acid,
dihomo-gamma-linolenic acid, arachidonic acid, oleic acid,
palmoleic acid, choline, serine, beta-sitosterol, coumestrol,
diethylstilbestrol, and oryzanol.
[0085] In one aspect of this second method, step (d) further
comprises using ion exchange resins. The kinetically controlled
conditions can comprise non-equilibrium conditions resulting in
production of an end product having greater than a 2:1 ratio of
1,3-DAG to 2,3-DAG. The composition of step (b) can comprise a
fluorogenic fatty acid (FA). The composition of step (b) can
comprise an umbelliferyl FA ester. The end product can be
enantiomerically pure.
[0086] In one embodiment, a method for making a lower saturate fat
or oil comprises the following steps: (a) providing a polypeptide
(a hydrolase, e.g., a lipase, saturase, palmitase and/or
stearatase) as provided herein; (b) providing an oil or fat, and
(c) contacting the polypeptide of step (a) with the oil or fat of
step (b) under conditions wherein the hydrolase can modify the oil
or fat, e.g., remove at least one saturated fatty acid, e.g.,
palmitic, stearic, lauric, caprylic acid (octanoic acid) and the
like. The modification can comprise a hydrolase-catalyzed
hydrolysis of the fat or oil. The hydrolysis can be a complete or a
partial hydrolysis of the fat or oil. The hydrolyzed oil can
comprise a glycerol ester of a polyunsaturated fatty acid which can
replace the removed saturated fatty acid, or a fish, animal, or
vegetable oil. The vegetable oil can comprise an olive, canola,
sunflower, palm, soy or lauric oil or rice bran oil or a
combination thereof.
[0087] In one embodiment, a method for making a lower saturate fat
or oil, which may include essential fatty acids, comprises the
following steps: (a) providing a polypeptide (e.g., a lipase,
saturase, palmitase and/or stearatase) as provided herein; (b)
providing a composition comprising a triacylglyceride (TAG); (c)
contacting the polypeptide of step (a) with the composition of step
(b) under conditions wherein the polypeptide hydrolyzes an acyl
residue at the Sn1 or Sn3 position of the triacylglyceride (TAG),
thereby producing a 1,2-DAG or 2,3-DAG; and (d) promoting acyl
migration in the 1,2-DAG or 2,3-DAG of the step (c) under
kinetically controlled conditions, thereby producing a 1,3-DAG.
[0088] The method can further comprise providing an R1 ester and an
R1-specific lipase, and contacting the 1,3-DAG of step (d) with the
R1 ester and the R1-specific lipase under conditions wherein the
R1-specific lipase catalyzes esterification of the Sn2 position,
thereby producing a structured lipid. The R1 ester can comprise a
moiety of lower saturation than the hydrolyzed acyl residue, in
which case the structured lipid so produced is a lower-saturated
fat or oil than the original TAG. The R1 ester can comprise an
omega-3 fatty acid (alpha-linolenic, eicosapentaenoic (EPA),
docosahexaenoic (DHA)), an omega-6 fatty acid (gamma-linolenic,
dihomo-gama-linolenic (DGLA), or arachidonic), a mono-unsaturated
fatty acid (oleic, palmoleic, and the like), phospho-groups
(choline and serine), phytosterol esters (beta-sitosterol,
coumestrol, and diethylstilbestrol), and oryzanol. The hydrolase,
e.g., a lipase, saturase, palmitase and/or stearatase as provided
herein can be an Sn1 or an Sn3-specific enzyme. The lower saturated
fat or oil can be made by the above-described hydrolysis of any
algal oil, vegetable oil, or an animal fat or oil, e.g., Neochloris
oleoabundans oil, Scenedesmus dimorphus oil, Euglena gracilis oil,
Phaeodactylum tricornmutum oil, Pleurochrysis carterae oil,
Prymnesium parvum oil, Tetraselmis chui oil, Tetraselmis suecica
oil, Isochrysis galbana oil, Nannochloropsis sauna oil,
Botryococcus braunii oil, Dunaliella tertiolecta oil, Nannochloris
species oil, Spirulina species oil, Chlorophycease (green algae)
oil, and Bacilliarophy oil canola oil castor oil, coconut oil,
coriander oil, corn oil, cottonseed oil, hazelnut oil, hempseed
oil, linseed oil, meadowfoam oil, olive oil, palm oil, palm kernel
oil, peanut oil, rapeseed oil, rice bran oil, safflower oil,
sasanqua oil, soybean oil, sunflower seed oil, tall oil tsubaki
oil, varieties of "natural" oils having altered fatty acid
compositions via Genetically Modified Organisms (GMO) or
traditional "breeding" such as high oleic, low linolenic, or low
saturate oils (high oleic canola oil, low linolenic soybean oil or
high stearic sunflower oils); animal fats (tallow, lard, butter
fat, and chicken fat), fish oils (candlefish oil, cod-liver oil,
orange roughy oil, sardine oil, herring oil, and menhaden oil), or
blends of any of the above. The lower saturated fat or oil so made
can be used in foods or in baking, frying or cooking products
comprising oils or fats with a lower fatty acid content, including
oils low in palmitic acid, oleic acid, lauric acid, stearic acid,
caprylic acid (octanoic acid) etc., processed using a composition
or method as provided herein.
[0089] In one embodiment, a method for refining a lubricant
comprises the following steps: (a) providing a composition
comprising a hydrolase (e.g., a lipase, saturase, palmitase and/or
stearatase) as provided herein; (b) providing a lubricant; and (c)
treating the lubricant with the hydrolase under conditions wherein
the hydrolase (e.g., a lipase, saturase, palmitase and/or
stearatase) as provided herein can selective hydrolyze oils in the
lubricant, thereby refining it. The lubricant can be a hydraulic
oil.
[0090] In one embodiment, a method of treating a fabric comprises
the following steps: (a) providing a composition comprising a
hydrolase (e.g., a lipase, saturase, palmitase and/or stearatase)
as provided herein, wherein the hydrolase can selectively hydrolyze
carboxylic esters; (b) providing a fabric; and (c) treating the
fabric with the hydrolase under condition wherein the hydrolase can
selectively hydrolyze carboxylic esters thereby treating the
fabric. The treatment of the fabric can comprise improvement of the
hand and drape of the final fabric, dyeing, obtaining flame
retardancy, obtaining water repellency, obtaining optical
brightness, or obtaining resin finishing. The fabric can comprise
cotton, viscose, rayon, lyocell, flax, linen, ramie, all blends
thereof, or blends thereof with polyesters, wool, polyamides
acrylics or polyacrylics. In one embodiment, a fabric, yarn or
fiber comprising a hydrolase as provided herein can be adsorbed,
absorbed or immobilized on the surface of the fabric, yarn or
fiber.
[0091] In one embodiment, a method for removing or decreasing the
amount of a food or oil stain comprises contacting a hydrolase
(e.g., a lipase, saturase, palmitase and/or stearatase) as provided
herein with the food or oil stain under conditions wherein the
hydrolase can hydrolyze oil or fat in the stain. The hydrolase
(e.g., a lipase, saturase, palmitase and/or stearatase) as provided
herein can have an enhanced stability to denaturation by
surfactants and to heat deactivation. The hydrolase (e.g., a
lipase, saturase, palmitase and/or stearatase) as provided herein
can have a detergent or a laundry solution.
[0092] In one embodiment, a dietary composition comprises a
hydrolase (e.g., a lipase, saturase, palmitase and/or stearatase)
as provided herein. The dietary composition can further comprise a
nutritional base comprising a fat. The hydrolase can be activated
by a bile salt. The dietary composition can further comprise a
cow's milk-based infant formula. The hydrolase can hydrolyze long
chain fatty acids.
[0093] In one embodiment, a method of reducing fat content in milk
or vegetable-based dietary compositions comprises the following
steps: (a) providing a composition comprising a hydrolase (e.g., a
lipase, saturase, palmitase and/or stearatase) as provided herein;
(b) providing a composition comprising a milk or a vegetable oil,
and (c) treating the composition of step (b) with the hydrolase
under conditions wherein the hydrolase can hydrolyze the oil or fat
in the composition. In one embodiment, a dietary composition for a
human or for non-ruminant animals, comprises a nutritional base,
wherein the base comprises a fat and no or little hydrolase, and an
effective amount of a hydrolase (e.g., a lipase, saturase,
palmitase and/or stearatase) as provided herein to increase fat
absorption and growth of human or non-ruminant animal.
[0094] In one embodiment, a method of catalyzing an
interesterification reaction to produce new triacylglycerides
comprises the following steps: (a) providing a composition
comprising a polypeptide (e.g., a lipase, saturase, palmitase
and/or stearatase) as provided herein, wherein the polypeptide can
catalyze an interesterification reaction; (b) providing a mixture
of triacylglycerides and free fatty acids; (c) treating the mixture
of step (b) with the polypeptide under conditions wherein the
polypeptide can catalyze exchange of free fatty acids with the acyl
groups of triacylglycerides, thereby producing new
triacylglycerides enriched in the added fatty acids. The
polypeptide can be an Sn1,3-specific lipase.
[0095] In one embodiment, an interesterification method for
preparing an oil having a low trans-acid and a low intermediate
chain fatty acid content, comprises the following steps: (a)
providing an interesterification reaction mixture comprising a
stearic acid source material selected from the group consisting of
stearic acid, stearic acid monoesters of low molecular weight
monohydric alcohols and mixtures thereof, (b) providing a liquid
vegetable oil; (c) providing a polypeptide (e.g., a lipase,
saturase, palmitase and/or stearatase) as provided herein, wherein
the polypeptide comprises a 1,3-specific lipase activity; (d)
interesterifying the stearic acid source material and the vegetable
oil triacylglyceride, (e) separating interesterified free fatty
acid components from glyceride components of the
interesterification mixture to provide an interesterified margarine
oil product and a fatty acid mixture comprising fatty acids, fatty
acid monoesters or mixtures thereof released from the vegetable
oil, and (f) hydrogenating the fatty acid mixture. In one
embodiment of the interesterification method, the
interesterification reaction continues until there is substantial
equilibration of the ester groups in the 1-, 3-positions of the
glyceride component with non-glyceride fatty acid components of the
reaction mixture.
[0096] In one embodiment, a method for making a composition
comprises 1-palmitoyl-3-stearoyl-2-monoleine (POSt) and
1,3-distearoyl-2-monoleine (StOSt) comprising providing a
polypeptide (e.g., a lipase, saturase, palmitase and/or stearatase)
as provided herein, wherein the polypeptide is capable of
1,3-specific lipase-catalyzed interesterification of
1,3-dipalmitoyl-2-monoleine (POP) with stearic acid or tristearin,
and contacting said polypeptide with a composition comprising said
POP in the presence of a stearin source such as stearic acid or
tritearin to make a product enriched in the
1-palmitoyl-3-stearoyl-2-monoleine (POSt) or
1,3-distearoyl-2-monoleine (StOSt).
[0097] In one embodiment, a method for ameliorating or preventing
lipopolysaccharide (LPS)-mediated toxicity comprises administering
to a patient a pharmaceutical composition comprising a hydrolase
(e.g., a lipase, saturase, palmitase and/or stearatase) as provided
herein. In one embodiment, a method for detoxifying an endotoxin
comprises contacting the endotoxin with a hydrolase (e.g., a
lipase, saturase, palmitase and/or stearatase) as provided herein.
In one embodiment, a method for deacylating a 2' or a 3' fatty acid
chain from a lipid A comprises contacting the lipid A with a
polypeptide as provided herein.
[0098] In one embodiment, methods for altering the substrate
specificity or substrate preference of a parental lipase (fatty
acid hydrolase) enzyme having an amino acid sequence corresponding
to the amino acid sequence in SEQ ID NO:2 comprise the step of
generating (inserting) at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
or 12 or more amino acid residue mutations in SEQ ID NO:2 as shown
in Table 3 or Table 4, thereby generating a new hydrolase enzyme
having a modified amino acid sequence and an altered substrate
specificity or substrate preference as compared to the parental
lipase (fatty acid hydrolase) enzyme SEQ ID NO:2. In one aspect,
the substrate specificity or substrate preference of the new lipase
(fatty acid hydrolase) enzyme comprises preferential or increased
hydrolysis of palmitic acid from an oil, or, the substrate
specificity or substrate preference of the new lipase (fatty acid
hydrolase) enzyme comprises preferential or increased hydrolysis of
stearic acid from an oil.
[0099] In one aspect, the modified amino acid sequence (as compared
to the "parental" SEQ ID NO:2) comprises D61A; D61E; R72E; R72K;
E116A; E116Q; E116R; E116T; E116V; S133A; I151G; I151A; V163R;
D164R, or a combination thereof, and the substrate specificity or
substrate preference of the new lipase (fatty acid hydrolase)
enzyme comprises preferential or increased hydrolysis of palmitic
acid from an oil. In one aspect, the modified amino acid sequence
(as compared to the "parental" SEQ ID NO:2) comprises I20L; V62S;
G77P; V83C; D88H; Y113G; E116T; E116G; H140K; K146S; I167S; L180E;
E194M; A211Q; S212Y; G215C; G215V; G215W; A218H; A218S; V223A;
A225M; A225Q, or a combination thereof, and the substrate
specificity or substrate preference of the new lipase (fatty acid
hydrolase) enzyme comprises preferential or increased hydrolysis of
stearic acid from an oil.
[0100] In one embodiment, methods for making an enzyme having a
substrate specificity or substrate preference comprise preferential
or increased hydrolysis of palmitic acid from an oil, comprising
the steps of: (a) providing a parental hydrolase (e.g., a lipase,
saturase, palmitase and/or stearatase) enzyme having a substrate
specificity or substrate preference comprising preferential
hydrolysis of palmitic acid from an oil, wherein the parental
hydrolase (e.g., a lipase, saturase, palmitase and/or stearatase)
enzyme has a sequence as provided herein; and (b) making at least
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 or more amino acid residue
modifications to the parental hydrolase (e.g., a lipase, saturase,
palmitase and/or stearatase) enzyme, wherein the amino acid residue
modifications correspond to the amino acid sequence mutations to
SEQ ID NO:2 as shown in Table 3 or Table 4, thereby generating an
enzyme having a substrate specificity or substrate preference
comprising preferential or increased hydrolysis of palmitic acid
from an oil.
[0101] In one embodiment, methods for making an enzyme having a
substrate specificity or substrate preference comprise preferential
or increased hydrolysis of stearic acid from an oil, comprising the
steps of: (a) providing a parental hydrolase (e.g., a lipase,
saturase, palmitase and/or stearatase) enzyme having a substrate
specificity or substrate preference comprising preferential
hydrolysis of stearic acid from an oil, wherein the parental
hydrolase (e.g., a lipase, saturase, palmitase and/or stearatase)
enzyme has a sequence as provided herein; and (b) making at least
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 or more amino acid residue
modifications to the parental hydrolase (e.g., a lipase, saturase,
palmitase and/or stearatase) enzyme, wherein the amino acid residue
modifications correspond to the amino acid sequence mutations to
SEQ ID NO:2 as shown in Table 3 or Table 4, thereby generating an
enzyme having a substrate specificity or substrate preference
comprising preferential or increased hydrolysis of stearic acid
from an oil.
[0102] In one embodiment, methods for making a fatty acid hydrolase
(e.g., a lipase, saturase, palmitase and/or stearatase) enzyme
having a substrate specificity or substrate preference comprise
preferential hydrolysis of a particular fatty acid, comprising the
steps of (a) providing a fatty acid hydrolase (e.g., a lipase,
saturase, palmitase and/or stearatase) enzyme sequence as provided
herein; (b) generating (inserting) at least 1, 2, 3, 4, 5, 6, 7, 8,
9, 10, 11 or 12 or more base residue mutations in the nucleic acid,
wherein the mutations correspond to those sequence changes as set
forth Table 3 or Table 4; and, (c) testing the activity of the
newly generated enzyme for a substrate specificity or substrate
preference comprising preferential hydrolysis of a particular fatty
acid, thereby making the new fatty acid hydrolase (e.g., a lipase,
saturase, palmitase and/or stearatase) enzyme having a substrate
specificity or substrate preference comprising preferential
hydrolysis of a particular fatty acid. In one aspect, the fatty
acid hydrolase (e.g., a lipase, saturase, palmitase and/or
stearatase) enzyme comprises a sequence as set forth in SEQ ID
NO:2. In one aspect, the fatty acid is linolenic acid, linoleic
acid, oleic acid, palmitic acid or stearic acid.
[0103] In one embodiment, methods for making a fatty acid hydrolase
(e.g., a lipase, saturase, palmitase and/or stearatase) enzyme
having a substrate specificity or substrate preference comprise
preferential hydrolysis of a particular fatty acid, and comprise
the steps of (a) providing a fatty acid hydrolase (e.g., a lipase,
saturase, palmitase and/or stearatase) enzyme-encoding nucleic acid
sequence as provided herein; (b) generating (inserting) at least 1,
2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 or more base residue mutations
in the nucleic acid, wherein the mutations correspond to those
sequence changes as set forth Table 3 or Table 4; and, (c)
expressing the generated nucleic acid to make the new fatty acid
hydrolase (e.g., lipase, saturase, palmitase and/or stearatase)
enzyme, thereby making a fatty acid hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) enzyme having a substrate
specificity or substrate preference comprising preferential
hydrolysis of a particular fatty acid.
[0104] In one aspect, the fatty acid hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) enzyme-encoding sequence
comprises a sequence as set forth in SEQ ID NO:1. In one aspect,
the fatty acid is linolenic acid, linoleic acid, oleic acid,
palmitic acid or stearic acid. In one aspect, the substrate
specificity or substrate preference of the new fatty acid hydrolase
(e.g., lipase, saturase, palmitase and/or stearatase) enzyme is
palmitic acid as compared to a substrate specificity or substrate
preference of stearic acid for the parental fatty acid hydrolase
(e.g., lipase, saturase, palmitase and/or stearatase) enzyme, or
the substrate specificity or substrate preference of the new fatty
acid hydrolase (e.g., lipase, saturase, palmitase and/or
stearatase) enzyme is stearic acid as compared to a substrate
specificity or substrate preference of palmitic acid for the
parental fatty acid hydrolase (e.g., lipase, saturase, palmitase
and/or stearatase) enzyme.
[0105] In one embodiment, lipases comprise an amino acid sequence
as set forth in SEQ ID NO:2 but also comprising at least amino acid
residue modification D61A; D61E; R72E; R72K; E116A; E116Q; E116R;
E116T; E116V; S133A; I151G; I151A; V163R; D164R, or a combination
thereof. In one embodiment, lipases comprise an amino acid sequence
as set forth in SEQ ID NO:2 but also comprising at least amino acid
residue modification I20L; V62S; G77P; V83C; D88H; Y113G; E116T;
E116G; H140K; K146S; I167S; L180E; E194M; A211Q; S212Y; G215C;
G215V; G215W; A218H; A218S; V223A; A225M; A225Q, or a combination
thereof.
[0106] In one aspect, the substrate specificity or substrate
preference of the new lipase comprises preferential or increased
hydrolysis of a fatty acid from an oil as compared to the
"parental" SEQ ID NO:2. In one aspect, the fatty acid is linolenic
acid, linoleic acid, oleic acid, palmitic acid or stearic acid.
[0107] The details of one or more embodiments as provided herein
are set forth in the accompanying drawings and the description
below. Other features, objects, and advantages as provided herein
will be apparent from the description and drawings, and from the
claims.
[0108] All publications, patents, patent applications, GenBank
sequences and ATCC deposits, cited herein are hereby expressly
incorporated by reference for all purposes.
DESCRIPTION OF DRAWINGS
[0109] The following drawings are illustrative of embodiments as
provided herein and are not meant to limit the scope of the
claims.
[0110] The patent or application file contains at least one drawing
executed in color. Copies of this patent or patent application
publication with color drawing(s) will be provided by the Office
upon request and payment of the necessary fee.
[0111] FIG. 1 is a block diagram of a computer system.
[0112] FIG. 2 is a flow diagram illustrating one aspect of a
process for comparing a new nucleotide or protein sequence with a
database of sequences in order to determine the homology levels
between the new sequence and the sequences in the database.
[0113] FIG. 3 is a flow diagram illustrating one aspect of a
process in a computer for determining whether two sequences are
homologous.
[0114] FIG. 4 is a flow diagram illustrating one aspect of an
identifier process 300 for detecting the presence of a feature in a
sequence.
[0115] FIG. 5 illustrates an exemplary method as provided herein
comprising use of lipases as provided herein to process a lipid,
e.g., a lipid from a soy oil, to selectively hydrolyze a palmitic
acid to produce a "reduced palmitic soy oil".
[0116] FIG. 6a illustrates the effects of exemplary palmitase
GSSM.sup.SM mutations on palmitate and stearate hydrolysis relative
to parental SEQ ID NO:2, as discussed in detail in Example 4,
below. FIG. 6b illustrates the effects of exemplary stearatase
GSSM.sup.SM mutations on palmitate and stearate hydrolysis relative
to parental SEQ ID NO:2 as discussed in detail in Example 4,
below.
[0117] FIG. 7 shows SEQ ID NO:2, with the particular palmitate and
stearate mutation positions listed in bold type of a larger font.
Mutations underlined (e.g. 61A, E) are alternative amino acid
residue positions (alternative sequences for alternative
embodiments) for improving palmitate hydrolysis. Mutations in
italics (e.g., 20L) are alternative amino acid residue positions
(alternative sequences for alternative embodiments) for improving
stearate hydrolysis. Position 116 is an alternative amino acid
residue mutation position (an alternative sequence for an
alternative embodiment) for improving hydrolysis of both palmitate
and stearate.
[0118] FIGS. 8-1 to 8-24 shows confirmatory soy oil assay data for
selected clones from the palmitase library.
[0119] Like reference symbols in the various drawings indicate like
elements.
DETAILED DESCRIPTION
[0120] Alternative embodiments comprise polypeptides, including
lipases, saturases, palmitases and/or stearatases, polynucleotides
encoding them, and methods of making and using these
polynucleotides and polypeptides. Alternative embodiments comprise
polypeptides, e.g., enzymes, having a hydrolase activity, e.g.,
lipase, saturase, palmitase and/or stearatase activity, including
thermostable and thermotolerant hydrolase activity, and
polynucleotides encoding these enzymes, and making and using these
polynucleotides and polypeptides. The hydrolase activities of the
polypeptides and peptides as provided herein include lipase
activity (hydrolysis of lipids), interesterification reactions,
ester synthesis, ester interchange reactions, lipid acyl hydrolase
(LAH) activity) and related enzymatic activity. For the purposes of
this patent application, interesterification reactions can include
acidolysis reactions (involving the reaction of a fatty acid and a
triacylglyceride), alcoholysis (involving the reaction of an
alcohol and a triacylglyceride), glycerolysis (involving the
reaction of a glycerol and a triacylglyceride) and
transesterification reactions (involving the reaction of an ester
and a triacyglyceride). The polypeptides as provided herein can be
used in a variety of pharmaceutical, agricultural and industrial
contexts, including the manufacture of cosmetics and
nutraceuticals. In another aspect, the polypeptides as provided
herein are used to synthesize enantiomerically pure chiral
products.
[0121] In certain embodiments, enzymes as provided herein can be
highly selective catalysts. They can have the ability to catalyze
reactions with stereo-, regio-, and chemo-selectivities not
possible in conventional synthetic chemistry. In one embodiment,
enzymes as provided herein can be versatile. In various aspects,
they can function in organic solvents, operate at extreme pHs (for
example, high pHs and low pHs), extreme temperatures (for example,
high temperatures and low temperatures), extreme salinity levels
(for example, high salinity and low salinity), and catalyze
reactions with compounds that are structurally unrelated to their
natural, physiological substrates.
[0122] In one aspect, the polypeptides as provided herein comprise
hydrolases having lipase, saturase, palmitase and/or stearatase
activity and can be used, e.g., in the biocatalytic synthesis of
structured lipids (lipids that contain a defined set of fatty acids
distributed in a defined manner on the glycerol backbone),
including any vegetable oil, e.g., canola, soy, soy oil
alternatives, cocoa butter alternatives, 1,3-diacyl glycerides
(DAGs), 2-monoacylglycerides (MAGs) and triacylglycerides (TAGs),
such as 1,3-dipalmitoyl-2-oleoylglycerol (POP),
1,3-distearoyl-2-oleoylglycerol (StOSt),
1-palmitoyl-2-oleoyl-3-stearoylglycerol (POSt) or
1-oleoyl-2,3-dimyristoylglycerol (OMM), poly-unsaturated fatty
acids (PUFAs), long chain polyunsaturated fatty acids such as
arachidonic acid, docosahexaenoic acid (DHA) and eicosapentaenoic
acid (EPA).
[0123] In certain embodiment, the enzymes and methods as provided
herein can be used to remove, add or exchange any fatty acid from a
composition, e.g., make an oil with a lower saturated fatty acid
content (e.g., a "low saturate" oil) or a different fatty acid
content (e.g., converting an oil comprising "saturated" fatty acids
to an oil comprising alternative "unsaturated" fatty acids).
[0124] Examples of saturated fatty acids that can be removed, added
or "rearranged" on a lipid, e.g., an oil, using an enzyme or by
practicing a method as provided herein include: [0125] Acetic:
CH.sub.3COOH [0126] Butyric: CH.sub.3(CH.sub.2).sub.2COOH [0127]
Caproic: CH.sub.3(CH.sub.2).sub.4COOH [0128] Caprylic:
CH.sub.3(CH.sub.2).sub.6COOH [0129] Capric:
CH.sub.3(CH.sub.2).sub.8COOH [0130] Undacanoic:
CH.sub.3(CH.sub.2).sub.9COOH [0131] Lauric: (dodecanoic acid):
CH.sub.3(CH.sub.2).sub.10COOH [0132] Myristic: (tetradecanoic
acid): CH.sub.3(CH.sub.2).sub.12COOH [0133] Pentadecanoic:
CH.sub.3(CH.sub.2).sub.13COOH [0134] Palmitic: (hexadecanoic acid):
CH.sub.3(CH.sub.2).sub.14COOH [0135] Margaric:
CH.sub.3(CH.sub.2).sub.15COOH [0136] Stearic (octadecanoic acid):
CH.sub.3(CH.sub.2).sub.16COOH [0137] Arachidic (eicosanoic acid):
CH.sub.3(CH.sub.2).sub.18COOH [0138] Behenic:
CH.sub.3(CH.sub.2).sub.20COOH
[0139] Examples of omega-3 unsaturated fatty acids that can be
removed, added or "rearranged" on a lipid, e.g., an oil, using an
enzyme or by practicing a method as provided herein include: [0140]
.alpha.-linolenic (ALA):
CH.sub.3CH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CH(CH.sub-
.2).sub.7COOH [0141] stearaiadonic (octadecatetraenoic): [0142]
CH.sub.3CH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd-
.CH(CH.sub.2).sub.4COOH [0143] eicosapentaenoic (EPA): [0144]
CH.sub.3CH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd-
.CHCH.sub.2CH.dbd.CH(CH.sub.2).sub.3COOH [0145] docosahexaenoic
(DHA) [0146]
CH.sub.3CH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.-
2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CH(CH.sub.2).sub.2COOH
[0147] Examples of omega-6 unsaturated fatty acids that can be
removed, added or "rearranged" on a lipid, e.g., an oil, using an
enzyme or by practicing a method as provided herein include: [0148]
Linoleic (9,12-octadecadienoic acid):
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CH(CH.sub.2).sub.7COOH
[0149] Gamma-linolenic (6,9,12-octadecatrienoic acid): [0150]
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CH(CH.su-
b.2).sub.4COOH [0151] Eicosadienoic (11,14-eicosadienoic acid):
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CH(CH.sub.2).sub.9COOH
[0152] Dihomo-gamma-linolenic (8,11,14-eicosatrienoic acid): [0153]
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CH(CH.su-
b.2).sub.6COOH [0154] Arachidonic (5,8,11,14-eicosatetraenoic
acid): [0155]
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.C-
HCH.sub.2CH.dbd.CH(CH.sub.2).sub.3COOH [0156] Docosadienoic
(13,16-docosadienoic acid):
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CH(CH.sub.2).sub.11COOH
[0157] Adrenic (7,10,13,16-docosatetraenoic acid): [0158]
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub-
.2CH.dbd.CH(CH.sub.2).sub.5COOH [0159] Docosapentaenoic
(4,7,10,13,16-docosapentaenoic acid): [0160]
CH.sub.3(CH.sub.2).sub.4CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub-
.2CH.dbd.CHCH.sub.2CH.dbd.CH(CH.sub.2).sub.2COOH
[0161] Examples of omega-9 fatty acids that also can be removed,
added or "rearranged" on a lipid, e.g., an oil, using an enzyme or
by practicing a method as provided herein, include: [0162] Oleic
(9-octadecenoic acid):
CH.sub.3(CH.sub.2).sub.7CH.dbd.CH(CH.sub.2).sub.7COOH [0163]
Eicosenoic (11-eicosenoic acid)
CH.sub.3(CH.sub.2).sub.7CH.dbd.CH(CH.sub.2).sub.9COOH [0164] Mead
(5,8,11-eicosatrienoic acid): [0165]
CH.sub.3(CH.sub.2).sub.7CH.dbd.CHCH.sub.2CH.dbd.CHCH.sub.2CH.dbd.CH(CH.su-
b.2).sub.3COOH [0166] Euric (13-docosenoic acid):
CH.sub.3(CH.sub.2).sub.7CH.dbd.CH(CH.sub.2).sub.11COOH [0167]
Nervonic (15-tetracosenoic acid):
CH.sub.3(CH.sub.2).sub.7CH.dbd.CH(CH.sub.2).sub.13COOH. [0168]
Palmitoleic:
CH.sub.3(CH.sub.2).sub.7CH.dbd.CH(CH.sub.2).sub.5COOH
[0169] In one aspect, provided herein are novel classes of lipases
termed "saturases", e.g. "palmitases" and "stearatases". The term
"saturase" as previously used in the literature described an enzyme
that carries out the saturation of specific bonds in a metabolic
pathway, e.g. hydrogenation of a double bond (Moise, et. al., J
Biol Chem, 2005, 280(30):27815-27825). However, provided herein are
novel and previously undescribed "saturases", wherein the saturases
described herein hydrolyze saturated fatty acid esters, wherein the
hydrolyzed esters may be esters of saturated fatty acids and
glycerol, umbelliferol or other alcohols.
[0170] Also provided herein are previously undescribed "palmitases"
and "stearatases", wherein the palmitases and stearatases hydrolyze
palmitic acid and stearic acid, respectively, for example, from the
glycerol backbone. The "saturases" described herein may also be
termed "saturate hydrolases". Similarly, the "palmitases" described
herein may also be termed "palmitate hydrolases" and the
"stearatases" described herein may also be termed "stearate
hydrolases".
[0171] In another aspect, the saturases described herein
selectively hydrolyze at least 60%, 61%, 62%, 63%, 64%, 65%, 66%,
67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%,
80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of the saturated fatty
acids. In another aspect, the palmitases described herein
selectively hydrolyze fatty acids such that at least 60%, 61%, 62%,
63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%,
76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%,
89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of
the fatty acids hydrolyzed are palmitic acid. In another aspect,
the stearatases described herein selectively hydrolyze fatty acids
such that at least 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%,
69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%,
82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99% or 100% of the fatty acids hydrolyzed are
stearic acid.
[0172] In one aspect, as illustrated in FIG. 5, methods of using an
enzyme as provided herein can process a lipid, e.g., a lipid from a
soy or other vegetable oil, to selectively hydrolyze a saturated
fatty acid, e.g., a palmitic or stearic acid, (e.g., from an oil
containing these saturated fatty acids) to produce a "low (or
lower) saturate oil", e.g., a "reduced palmitic oil", such as a
"reduced palmitic vegetable oil", e.g., a "reduced palmitic soy
oil". Enzymes as provided herein can also be used to selectively
hydrolyze any fatty acid, particularly saturated fatty acids, from
a glycerol backbone to produce a "low (or lower) saturate oil",
including selectively hydrolyzing a saturated fatty acid, e.g., a
palmitic acid or a stearic acid, from an Sn1 or an Sn2 position of
a glycerol backbone, in addition to hydrolysis from an Sn3 position
(e.g., hydrolysis of palmitic acid from the illustrated Sn3
position in FIG. 5).
[0173] In one aspect, an exemplary synthesis of low saturate
triglycerides, oils or fats is provided. This exemplary synthesis
can use either free fatty acids or fatty acid esters, depending on
the enzyme used. In one aspect, the hydrolases, e.g. lipases,
saturases, palmitases and/or stearatases, as provided herein are
used to remove or hydrolyze saturated fatty acids, such as acetic
acid, butyric acid, caproic acid, caprylic acid, capric acid,
undecanoic acid, lauric acid, myrsitic acid, pentadecanoic acid,
palmitic acid, margaric acid, stearic acid, achidic acid, or
behenic acid from a triglyceride, oil or fat. In one aspect, the
removed or hydrolyzed fatty acids are replaced by fatty acids with
improved health benefits (such as reduced correlation with
cardiovascular disease), or improved chemical properties (such as
oxidative stability or reactivity) or improved physical properties
(such as melting point, or mouth feel). In one aspect the fatty
acids added are omega-3 unsaturated fatty acids, such as
a-linolenic acid, stearidonic acideicosapentaenoic acid (EPA), or
docosahexaenoic acid (DHA), or PUFAs or fish oil fatty acids. In
one aspect the fatty acids added are omega-6 unsaturated fatty
acids, such as linoleic acid, gamma-linoleic acid, eicosadienoic
acid, dihomo-gamma-linoleic acid, arachidonic acid, docoasdienoic
acid, adrenic acid, or docosapentaenoic acid. In one aspect the
added fatty acids are omega-9 unsaturated fatty acids, such as
oleic acid, eicosaenoic acid, mead acid, erucic acid, nervonic
acid, or palmitoleic acid. In one aspect the added fatty acids
(e.g. omega-3, omega-6, or omega-9) are added by reaction of fatty
acids with the triglycerides, oil or fat after the removal or
hydrolysis of saturated fatty acids by the hydrolases, e.g.
lipases, saturases, palmitases and/or stearatases, as provided
herein. In one aspect the added fatty acids (e.g. omega-3, omega-6,
or omega-9) are added by reaction of fatty acid esters, including
glycerol esters, or ethyl or methyl esters, with the triglycerides,
oil or fat after the removal or hydrolysis of saturated fatty acids
by the hydrolases, e.g. lipases, saturases, palmitases and/or
stearatases, as provided herein. In one aspect the reaction to add
fatty acids (e.g. omega-3, omega-6, or omega-9) is catalyzed by a
hydrolase or lipase, such as a non-specific lipase (including
non-regiospecific and non-fatty acid specific), or a Sn1,3-specific
lipase, or a Sn1-specific lipase, or a Sn3 specific lipase, or a
Sn2 specific lipase, or a fatty acid-specific lipase.
[0174] The methods and compositions (hydrolases, e.g. lipases,
saturases, palmitases and/or stearatases) as provided herein can be
used in the production of nutraceuticals (e.g., polyunsaturated
fatty acids and oils), various foods and food additives (e.g.,
emulsifiers, fat replacers, margarines and spreads), cosmetics
(e.g., emulsifiers, creams), pharmaceuticals and drug delivery
agents (e.g., liposomes, tablets, formulations), and animal feed
additives (e.g., polyunsaturated fatty acids, such as linoleic
acids).
[0175] In one aspect, lipases as provided herein can act on
fluorogenic fatty acid (FA) esters, e.g., umbelliferyl FA esters.
In one aspect, profiles of FA specificities of lipases made or
modified by the methods as provided herein can be obtained by
measuring their relative activities on a series of umbelliferyl FA
esters, such as palmitate, stearate, oleate, laurate, PUFA, or
butyrate esters.
[0176] In one aspect, a polypeptide (e.g., antibody or
enzyme--e.g., a lipase, saturase, palmitase and/or stearatase) as
provided herein for these reactions is immobilized, e.g., as
described below. In alternative aspects, the methods as provided
herein do not require an organic solvent, can proceed with
relatively fast reaction rates. See, e.g., U.S. Pat. No. 5,552,317;
5,834,259.
[0177] In certain embodiments, the methods and compositions
(lipases, saturases, palmitases and/or stearatases) as provided
herein can be used to hydrolyze (including selectively hydrolyze)
oils, such as fish, animal and vegetable oils, and lipids, such as
poly-unsaturated fatty acids. In one aspect, the polypeptides as
provided herein are used to make low saturate oils, e.g., by
removing (hydrolyzing) at least one fatty acid from an oil; and the
hydrolysis can be a selective hydrolysis, e.g., only removing a
particular fatty acid, such as a palmitic, stearic, or other
saturated fatty acid, or just removing a fatty acid from one
position, e.g., Sn1, Sn2 or Sn3. In one aspect, the polypeptides as
provided herein are used to process fatty acids (such as
poly-unsaturated fatty acids), e.g., fish oil fatty acids, e.g.,
for use in or as a food or feed additive, or a cooking, frying,
baking or edible oil. In another embodiment, the methods and
compositions (lipases, saturases, palmitases and/or stearatases) as
provided herein can be used to selectively hydrolyze saturated
esters over unsaturated esters into acids or alcohols. In another
embodiment, the methods and compositions (lipases, saturases,
palmitases and/or stearatases) as provided herein can be used to
treat latexes for a variety of purposes, e.g., to treat latexes
used in hair fixative compositions to remove unpleasant odors. In
another embodiment, the methods and compositions (lipases,
saturases, palmitases and/or stearatases) as provided herein can be
used in the treatment of a lipase deficiency in an animal, e.g., a
mammal, such as a human. In another embodiment, the methods and
compositions (lipases, saturases, palmitases and/or stearatases) as
provided herein can be used to prepare lubricants, such as
hydraulic oils. In another embodiment, the methods and compositions
(lipases, saturases, palmitases and/or stearatases) as provided
herein can be used in making and using detergents. In another
embodiment, the methods and compositions (lipases, saturases,
palmitases and/or stearatases) as provided herein can be used in
processes for the chemical finishing of fabrics, fibers or yarns.
In one aspect, the methods and compositions (lipases, saturases,
palmitases and/or stearatases) as provided herein can be used for
obtaining flame retardancy in a fabric using, e.g., a
halogen-substituted carboxylic acid or an ester thereof, i.e. a
fluorinated, chlorinated or bromated carboxylic acid or an ester
thereof. In one aspect, the methods of generating lipases from
environmental libraries are provided.
[0178] In one embodiment, the "hydrolases" as provided herein
encompass polypeptides (e.g., antibodies, enzymes) and peptides
(e.g., "active sites") having any hydrolase activity, i.e., the
polypeptides as provided herein can have any hydrolase activity,
including e.g., a lipase, saturase, palmitase and/or stearatase
activity. In another embodiment, the "hydrolases" as provided
herein include all polypeptides having any lipase, saturase,
palmitase and/or stearatase activity, including lipid synthesis or
lipid hydrolysis activity, i.e., the polypeptides as provided
herein can have any lipase, saturase, palmitase and/or stearatase
activity. In another embodiment, lipases, saturases, palmitases
and/or stearatases as provided herein include enzymes active in the
bioconversion of lipids through catalysis of hydrolysis,
alcoholysis, acidolysis, esterification and aminolysis reactions.
In one aspect, hydrolases (e.g. lipases, saturases, palmitases
and/or stearatases) as provided herein can hydrolyze lipid
emulsions. In one aspect, enzymes as provided herein can act
preferentially on Sn-1, Sn-2 and/or Sn-3 bonds of triacylglycerides
to release one or more fatty acids from the glycerol backbone. For
example, hydrolase, lipase, saturase, palmitase and/or stearatase
activity of the polypeptides as provided herein include synthesis
of cocoa butter, poly-unsaturated fatty acids (PUFAs), 1,3-diacyl
glycerides (DAGs), 2-monoacylglycerides (MAGs) and
triacylglycerides (TAGs). In another embodiment, lipase, saturase,
palmitase and/or stearatase activity of the polypeptides as
provided herein also comprises production of low saturate oils,
e.g., soy or canola oil, by removing a fatty acid, e.g., a
palmitic, oleic, lauric or stearic acid. In alternative aspects,
enzymes as provided herein also can hydrolyze and/or isomerize
bonds at high temperatures, low temperatures, alkaline pHs and at
acidic pHs. In one aspect the hydrolase e.g. lipase as provided
herein is a saturase that catalyzes hydrolysis, alcoholysis,
acidolysis, esterification and aminolysis reactions where the
carboxylic or fatty acid in the molecule formed or reacted is a
saturated fatty acid such as acetic acid, butyric acid, lauric
acid, myristic acid, palmitic acid, stearic acid or arachidic acid.
In one aspect the hydrolase e.g. lipase or saturase as provided
herein is a palmitase that catalyzes hydrolysis, alcoholysis,
acidolysis, esterification and aminolysis reactions where the
carboxylic or fatty acid in the molecule formed or reacted is a
palmitic acid. In one aspect the hydrolase e.g. lipase or saturase
as provided herein is a stearatase that catalyzes hydrolysis,
alcoholysis, acidolysis, esterification and aminolysis reactions
where the carboxylic or fatty acid in the molecule formed or
reacted is a stearic acid.
[0179] In certain embodiments, provided herein are enzymes
comprising hydrolase variants (e.g., "lipase variant", "saturase
variant", "palmitase variant" or "stearatase variant") of the
enzymes as provided herein; these enzymes can have an amino acid
sequence which is derived from the amino acid sequence of a
"precursor". The precursor can include naturally-occurring
hydrolase and/or a recombinant hydrolase. The amino acid sequence
of the hydrolase variant is "derived" from the precursor hydrolase
amino acid sequence by the substitution, deletion or insertion of
one or more amino acids of the precursor amino acid sequence. Such
modification is of the "precursor DNA sequence" which encodes the
amino acid sequence of the precursor lipase rather than
manipulation of the precursor hydrolase enzyme per se. Suitable
methods for such manipulation of the precursor DNA sequence include
methods disclosed herein, as well as methods known to those skilled
in the art.
Generating and Manipulating Nucleic Acids
[0180] In one aspect, nucleic acids, including expression cassettes
such as expression vectors, encoding the polypeptides (e.g.,
hydrolases, such as lipases saturases, palmitases and/or
stearatases, and antibodies) are provided herein. In another
aspect, provided herein are nucleic acids having a sequence as set
forth in SEQ ID NO:1 and having at least one, two, three, four,
five, six, seven, eight, nine, ten, eleven or twelve or more or all
the base residue changes described in Table 3 or Table 4 (or the
equivalent thereof). In one embodiment, provided herein are nucleic
acids encoding polypeptides having a sequence as set forth in SEQ
ID NO:2 and having at least one, two, three, four, five, six,
seven, eight, nine, ten, eleven or twelve or more or all the amino
acid residue changes described in Table 3 or Table 4 (or the
equivalent thereof).
TABLE-US-00001 SEQ ID NO: 1
ATGCTGAAACCGCCTCCCTACGGACGCCTGCTGCGCGAACTGGCCGATATCCCGGCCATCGTGACGGCACCGTT-
C
CGGGGCGCTGCGAAAATGGGCAAACTGGCGGATGGCGAGCCGGTACTGGTGCTGCCCGGCTTCCTGGCCGACGA-
C
AACGCCACCTCGGTGCTGCGCAAGACCTTCGATGTCGCGGGCTTTGCCTGTTCGGGCTGGGAACGCGGCTTCAA-
C
CTCGGCATTCGTGGCGACCTCGTGGACCGGCTGGTCGACCGGCTGCGGGCGGTGTCGGAGGCGGCCGGTGGTCA-
G
AAGGTGATCGTGGTCGGCTGGAGCCTCGGCGGCCTCTATGCGCGCGAGCTGGGCCACAAGGCGCCCGAACTGAT-
C
CGGATGGTCGTCACGCTCGGCAGTCCGTTCGCGGGCGACCTCCACGCCAACCATGCGTGGAAGATCTACGAGGC-
G
ATCAACAGCCACACGGTCGACAACCTGCCGATCCCGGTCGATTTCCAGATTAAGCCGCCGGTGCGCACCATCGC-
G
GTGTGGTCGCCGCTCGACGGGGTGGTGGCGCCGGAGACCTCGGAAGGCTCGCCCGAGCAGTCGGACGAGCGGCT-
A
GAGCTGGCGGTGACCCACATGGGCTTTGCCGCATCGAAGACCGGGGCCGAGGCTGTGGTCCGGCTGGTCGCGGC-
G CGGCTCTAG SEQ ID NO: 2 (encoded by SEQ ID NO: 1): 1-letter code:
MLKPPPYGRLLRELADIPAIVTAPFRGAAKMGKLADGEPVLVLPGFLADDNATSVLRKTFDVAGFACSGWERGF-
N
LGIRGDLVDRLVDRLRAVSEAAGGQKVIVVGWSLGGLYARELGHKAPELIRMVVTLGSPFAGDLHANHAWKIYE-
A
INSHTVDNLPIPVDFQIKPPVRTIAVWSPLDGVVAPETSEGSPEQSDERLELAVTHMGFAASKTGAEAVVRLVA-
A RL- 3-letter code: Met Leu Lys Pro Pro Pro Tyr Gly Arg Leu Leu
Arg Glu Leu Ala Asp Ile Pro Ala Ile Val Thr Ala Pro Phe Arg Gly Ala
Ala Lys Met Gly Lys Leu Ala Asp Gly Glu Pro Val Leu Val Leu Pro Gly
Phe Leu Ala Asp Asp Asn Ala Thr Ser Val Leu Arg Lys Thr Phe Asp Val
Ala Gly Phe Ala Cys Ser Gly Trp Glu Arg Gly Phe Asn Leu Gly Ile Arg
Gly Asp Leu Val Asp Arg Leu Val Asp Arg Leu Arg Ala Val Ser Glu Ala
Ala Gly Gly Gln Lys Val Ile Val Val Gly Trp Ser Leu Gly Gly Leu Tyr
Ala Arg Glu Leu Gly His Lys Ala Pro Glu Leu Ile Arg Met Val Val Thr
Leu Gly Ser Pro Phe Ala Gly Asp Leu His Ala Asn His Ala Trp Lys Ile
Tyr Glu Ala Ile Asn Ser His Thr Val Asp Asn Leu Pro Ile Pro Val Asp
Phe Gln Ile Lys Pro Pro Val Arg Thr Ile Ala Val Trp Ser Pro Leu Asp
Gly Val Val Ala Pro Glu Thr Ser Glu Gly Ser Pro Glu Gln Ser Asp Glu
Arg Leu Glu Leu Ala Val Thr His Met Gly Phe Ala Ala Ser Lys Thr Gly
Ala Glu Ala Val Val Arg Leu Val Ala Ala Arg Leu SEQ ID NO: 3:
ATGGCCGGCCACCAGGGCGCGCGGGGCCCCAAAGACGGTCCGCCGGCGATGGTGATCCCGGGCTTCCTCGCCCA-
C
GACAGGCACACGACACGATTGCGCCGGGAACTCGCCGAGGCGGGGTTCAGGGTTCACCCCTGGCGGCAGGGCTG-
G
AACATGGGAGCGCGTGCCGACACGCTCGAGAAATTGAAGCGGGCAGTGGACCAGTGCGGTCATGACGAGCCGAT-
C
CTGCTGGTCGGCTGGAGTCTGGGCGGGCTCTACGCGAGGGAGGTCGCGCGCGCCGAGCCGGATCAGGTGCGGGC-
G
GTGGTCACTCTTGGTTCCCCGGTGTCGGGCGACCGGCGCCGCTACACCAACGTGTGGAAGCTGTACGAATGGGT-
G
GCGGGTCACCCGGTGGACGACCCGCCGATCCCCGACAAGGAGGAAAAGCCGCCGGTGCCGACCCTGGCTTTGTG-
G
TCGGCGGATGACGGGATCGTCGGCGCCCCGTCGGCGCGCGGGACTCAGTTATCTCACGACAAGGCGGTCGAGAT-
G
CGAACGAGCCACATGGGCTTTGCCATGTCGGCGAAGAGCGCACGCTTTGTTGTCGCCGAGATCGTGAAGTTCCT-
G AAGAAAACCGAAGGTTCCGAGTCGCACGATTGA SEQ ID NO: 4 (encoded by SEQ ID
NO: 3):
MAGHQGARGPKDGPPAMVIPGFLAHDRHTTRLRRELAEAGFRVHPWRQGWNMGARADTLEKLKRAVDQCGHDEP-
I
LLVGWSLGGLYAREVARAEPDQVRAVVTLGSPVSGDRRRYTNVWKLYEWVAGHPVDDPPIPDKEEKPPVPTLAL-
W SADDGIVGAPSARGTQLSHDKAVEMRTSHMGFAMSAKSARFVVAEIVKFLKKTEGSESHD SEQ
ID NO: 5:
GTGAGCGAGAAAGGCGCACCCAAGGGAAGGCAGCGGCTGAAGGAGATCGGCGCGCTTCTGTTCCACGCGCCTCG-
C
AGCTTGGGCCATCTGGGCGCGCGCGGCCCCAAGGACGGTCCTCCGGTGATGGTCATCCCGGGATTCCTCGCGCA-
C
GACTTGCATACGACGCAGTTGCGCCGGGCGCTCGCGAAGGCAGGCTTCCGAGTGCATCCGTGGCGGCAGGGGAT-
G
AACCTTGGAGCGCGCGCCGATACGCTCGAAATTCTGAAGCGCGCGGTGGATTCCTGCGGCTCGAGCGAGCCGAT-
G
CTGCTCGTCGGCTGGAGCCTGGGCGGTCTCTATGCCCGGGAGATCGCGCGTGCGGAGCCGGACCGGGTGCGGGC-
G
GTGGTGACGATGGGATCGCCGGTGTGGGGCGACCGCAGGCGCTACACCAACGTGTGGAAGCTGTACGAACGGAT-
T
GCCGGCCATCCGGTCGACAAGCCGCCGATCCCGGACAAGAGCCAGAAGCCGCCGGTGCCGACTCTGGCTTTGTG-
G
TCGCAGCATGATGGCATCGTCGGCGCGCCCTCGGCGAGAGGGACGAAGAAGACCCGCGACAAGGCGGTCGCCAT-
C
GACACGACTCACATGGGGTTTGCCATGTCGCCCAAGACGACGCGCGCGGCAGTGCGTGAGATCGTGGGCTTTTT-
G AATGAAGTCGAAGGCGGTTCGTCACCCCGGGCGTGA SEQ ID NO: 6 (encoded by SEQ
ID NO: 5):
MSEKGAPKGRQRLKEIGALLFHAPRSLGHLGARGPKDGPPVMVIPGFLAHDLHTTQLRRALAKAGFRVHPWRQG-
M
NLGARADTLEILKRAVDSCGSSEPMLLVGWSLGGLYAREIARAEPDRVRAVVTMGSPVWGDRRRYTNVWKLYER-
I
AGHPVDKPPIPDKSQKPPVPTLALWSQHDGIVGAPSARGTKKTRDKAVAIDTTHMGFAMSPKTTRAAVREIVGF-
L NEVEGGSSPRA SEQ ID NO: 7:
ATGAGGCTGCGCGAGGGGGGCGCGCTCGTATCGCGGGCCTATCGCGCCTTCGGGCGCCTCGGCGAGCGCGGCCC-
G
GCGGACGGGCCGCCGCTGATGGTGATCCCGGGCTTCCTCGCCACCGATCGCACCACTTTGGGGCTGCAGCGGGC-
G
CTGGCCAAGGGCGGCTACAAGGTGACCGGATGGGGCATGGGCCTCAACAGCGGCGTCACCGAAGACATAGTCGA-
C
CGCATCGCCGCTCGGGTCGAAAGGTTTGGAGCCGGCCGCAAAGTGATCCTCGTCGGCTGGAGCCTCGGCGGACT-
C
TACGCGCGCGTGGTCGCGCAGGAGCGGCCGGATCTCGTCGACAAGGTGGTCACGCTCGGCTCGCCCTTTTCGGG-
C
GACAGGCGCCGCAACAACAATGTCTGGCGGCTCTACGAGTTCGTCGCCGGCCATCCGGTCAACAGCCCGCCGAT-
C
GACAAGGACCCCGAGGTGAAGCCGCCGGTGCCGACGCTCGCTATCTGGTCGCGGCGCGACGGCATCGTCTCTCC-
G
GCGGGCGCGCGCGGGCGGGAGGGAGAGCGCGACGCCGAGCTCGAGCTCGACTGCAGCCACATGGGCTTTGCGGT-
C
AGCGCCAGGGCTTATCCCAAGATCGTGGAGGCGGTGCGGGCGTTTCCGGAAAACATCCGTTCGCGCTGA
SEQ ID NO: 8 (encoded by SEQ ID NO: 7):
MRLREGGALVSRAYRAFGRLGERGPADGPPLMVIPGFLATDRTTLGLQRALAKGGYKVTGWGMGLNSGVTEDIV-
D
RIAARVERFGAGRKVILVGWSLGGLYARVVAQERPDLVDKVVTLGSPFSGDRRRNNNVWRLYEFVAGHPVNSPP-
I
DKDPEVKPPVPTLAIWSRRDGIVSPAGARGREGERDAELELDCSHMGFAVSARAYPKIVEAVRAFPENIRSR
SEQ ID NO: 9:
ATGAAGCCGCCGCCCGGATGGATGAAGATCCGGGAGGCGGGCTCGCTCCTCGCGCGCTTCTACCGCGCGTTCGG-
C
AAGCTCGAGCCGCGCGGGCCGGCGGACGGGCCGAAGCTGATGGTGATCCCGGGTTTCCTCGCGGGCGACAGGAC-
G
ACGCTCGGGCTGCAGCGAGCGCTGGCCGGCGGCGGCTACCGGGTCGCCGGCTGGGGGCTGGGGGTGAACCGCGG-
C
GTTTCGGAGGACGTGGTCGACCGGATCGGCCAGCAAGTCGCGCGGTTCGGGGCGGGCGAGAAGGTGATCCTGGT-
C
GGCTGGAGCCTTGGCGGGCTTTATGCGCGCGTGGTGGCGCAGGAGCGGCCCGACCTCGTCGAGAAGGTGGTGAC-
C
TTGGGCTCGCCGTTTTCGGGCGACCGGCGGCGCAACAACAATGTGTGGCGGCTCTATGAGTGGGTGGCTGGGCA-
T
CCGGTGAACGATCCGCCGATCGACAAGGACCCGGCGAAGAAGCCCCCGGTGCCGACGCTCGCGATCTGGTCGCG-
G
CGTGATGGGATCGTGGCGGTCGAAGGCGCGCGGGGGCGGCCGGAGGAGCGGGATGCCGAGCTGGAGATCGATTG-
C
AGCCACATGGGGTTTGGGGTCAGCGGCAAGGCGTTTCCCCGAATCGTAGAGGCGGTGAAGGGGTTCTAA
SEQ ID NO: 10 (encoded by SEQ ID NO: 9):
MKPPPGWMKIREAGSLLARFYRAFGKLEPRGPADGPKLMVIPGFLAGDRTTLGLQRALAGGGYRVAGWGLGVNR-
G
VSEDVVDRIGQQVARFGAGEKVILVGWSLGGLYARVVAQERPDLVEKVVTLGSPFSGDRRRNNNVWRLYEWVAG-
H
PVNDPPIDKDPAKKPPVPTLAIWSRRDGIVAVEGARGRPEERDAELEIDCSHMGFGVSGKAFPRIVEAVKGF
SEQ ID NO: 11:
GTGTTGGTGCTGCCGGCGTTCCTCGCCAACGACCTTCCCACTTCGCTTCTCCGCAGGACGCTGAAGGCGAACGG-
G
TTTCGCCCGTTCGGCTGGGCGAACGGTTTCAACTTAGGTGCACGGCCGGACACGCTCCAGCGCCTGAGCGCACG-
G
CTCGATGCGGTGGTTCAGGAAGCGGGCAGGCCGGTTGCATTGATCGGCTGGAGCCTTGGCGGGCTTTATGCCCG-
A
GAGCTGGCGAAACGCAGGTCGGCTGAGGTGTCGGCAGTGATCACGCTCGGCACGCCCTTCTCGGTTGACCTCAG-
A
CGCAACAACGCCTGGAAGCTGTACGAGCTCATCAACGATCATCCTGTCGATGCCCCTCCCTTGGATGTTCAGGT-
C
GACGCGAAGCCACCCGTCCGAACCTTCGCTTTGTGGTCGCGTCGCGACGGGATCGTAGCGCCCGCGAGCGCGCA-
C
GGCATGGAGGGCGAGTTCGACCAGGCGATCGAGCTGCAGTGCACGCACAACGAGATGGTCAGTGATCCGGAGGC-
C
CTCTCCACGATCGTTACCTTGCTGCGGGAAAATGTTGGCTCCTGA SEQ ID NO: 12
(encoded by SEQ ID NO: 11):
MLVLPAFLANDLPTSLLRRTLKANGFRPFGWANGFNLGARPDTLQRLSARLDAVVQEAGRPVALIGWSLGGLYA-
R
ELAKRRSAEVSAVITLGTPFSVDLRRNNAWKLYELINDHPVDAPPLDVQVDAKPPVRTFALWSRRDGIVAPASA-
H GMEGEFDQAIELQCTHNEMVSDPEALSTIVTLLRENVGS SEQ ID NO: 13:
GTGAATACAGCCGACCTATTGAAGCCACCACCCGCAAGCATGACAGTTCTCGAGGCGAGAGCGCTGCTGGACAT-
A
TGCAAGATGAGCGCCCCATTGGCGCGCTTGCTATTCAAAAAGAACTCGCCCTGGCGCAAACAACGGGTTCTCGT-
A
ATACCTGGCTTTGGCGCTGATGATCGCTACACCTGGCCGTTGCGCAATTTCGTCCAGGCACAGGGCTATGCCAC-
G
ACTGGCTGGGGCCTGGGCACCAACAAGGCAGGTCTCAATATGCCGCATCAACTATCCGACGTCCACCCCAGATG-
G
AAGCTAAAACCCAAGACGCCGTACCGTGGTGAGGCGGGCGTACCTTACGTGATTGACCGCTTGATCGAACGGTT-
T
GACGAATTGGCATCGACGGATCCGCAACCCATCGCACTTATAGGTTGGAGTCTGGGTGGTTTCATGGCCCGTGA-
A
GTTGCCCGAGAGCGCCCAAACCAGGTGAGTCAGGTTATTACCCTCGGTTCTCCTGTCATCGGAGGCCCAAAATA-
C
ACCCTCGCTGCATCGGCTTTCATCCGGCGCAAATACGATTTGGACTGGGTGGAGCAAGTGATCGCGGAGCGGGA-
A
GATCGCCCCATTACTGTTCCTATTACAGCAATAGTCAGCCAGTCTGATGGCATCGTCGGATATTCAGCGGCAAT-
C
GATCACCACAGTCCCGCTGTGCAGCATTTACATATGGATGTTGCCCATTTGGGCTTTCCTTACAACACGAGGGT-
T TGGTCAGAAATCGCCAATGCGCTCAACTCTTTAGAGGTGGAGAAGGAGCGTGTTTAG SEQ ID
NO: 14 (encoded by SEQ ID NO: 13):
MNTADLLKPPPASMTVLEARALLDICKMSAPLARLLFKKNSPWRKQRVLVIPGFGADDRYTWPLRNFVQAQGYA-
T
TGWGLGTNKAGLNMPHQLSDVHPRWKLKPKTPYRGEAGVPYVIDRLIERFDELASTDPQPIALIGWSLGGFMAR-
E
VARERPNQVSQVITLGSPVIGGPKYTLAASAFIRRKYDLDWVEQVIAEREDRPITVPITAIVSQSDGIVGYSAA-
I DHHSPAVQHLHMDVAHLGFPYNTRVWSEIANALNSLEVEKERV SEQ ID NO: 15:
ATGGAGCTCGCCAAGGTCACCGCCCTGATGAAGGCCACCGCCCTCGAGATCGCGATCCTCACCGGCCACCTCGT-
C
CTCTACCCCTCCGGGATCGTGGCCGAGCGCCTCGCGGCCGCCCCCTCTTCACCGTCCTCCCCGTCCGCGGGCCC-
G
ACGGGCCGACGTCCGGTCGTCCTGCTGCACGGTTTCGTGGACAACCGCTCGGTCTTCGTCCTGCTGCGCCGTGC-
C
CTCACCCGGAGCGGCCGTGACTGCGTCGAGTCGCTCAACTACTCGCCGCTCACCTGCGACCTGCGGGCCGCCGC-
C
GAACTGCTGGGGCGCCGGGTGGACGAGATCCGCGCCCGGACCGGACACGCCGAGGTCGACATCGTCGGCCACAG-
C
CTGGGCGGGCTCATCGCCCGTTATTACGTACAGCGTCTCGGCGGTGACAGCCGGGTGCGCACCCTGGTCATGCT-
C
GGCACCCCGCACTCCGGCACCACCGTGGCCCGGCTCGCCGACGCGCATCCGCTGGTGCGGCAGATGCGGCCGGG-
T
TCGGAGGTGCTGCGGGAGCTCGCCGCGCCCTCGCCCGGCTGCCGTACCCGGTTCGTGAGCTTCTGGAGCGACCT-
C
GACCAGGTGATGGTGCCGGTGGACACGGCCTGCCTGGACCACCCCGACCTGCTGGTGCACAACGTCCGGGTCAG-
C
GGGATCGGTCATCTCGCGCTGCCGGTCCATCCCACGGTGGCGGCCGGGGTCCGGGAGGCCCTCGACGCGAGCGG-
C GCGGGGGTCCCGGGGGTGCGGGAGGAGGGGCCCGGCGCCGGCGCCGTGGCGTGA SEQ ID NO:
16 (encoded by SEQ ID NO: 15):
MELAKVTALMKATALEIAILTGHLVLYPSGIVAERLAAAPSSPSSPSAGPTGRRPVVLLHGFVDNRSVFVLLRR-
A
LTRSGRDCVESLNYSPLTCDLRAAAELLGRRVDEIRARTGHAEVDIVGHSLGGLIARYYVQRLGGDSRVRTLVM-
L
GTPHSGTTVARLADAHPLVRQMRPGSEVLRELAAPSPGCRTRFVSFWSDLDQVMVPVDTACLDHPDLLVHNVRV-
S GIGHLALPVHPTVAAGVREALDASGAGVPGVREEGPGAGAVA SEQ ID NO: 17:
GTGGCCGCCGCGGACAGCGGGACGGCGGAAGGGCAAAGGCTTCGGCCGCCGAGCCTGTTCCTGATGCTGGCCGA-
G
GCGAGGGGCTTGCTCGAACTGAACTCGAGCCTGTTGTTGTCGCCGCTGTTGTTGCGGGCGCCGAAGGGCGACGG-
A
CATCCGGTGCTGGCGCTGCCGGGCTTTCTCGCCAGCGATCTGTCGATGGCGCCGATGCGGCGCTATCTGAAAGA-
A
CTCGGCTACGATGCCCATGCGTGGAACATGGGCCGCAATCTCGGCGGCGTCGCGTCCAAGCGCGAAGCCTTGCG-
C
GACCTGTTGCGGCGCATTTACAGCCAGACGGGCCGCAAGGTCAGCCTGGTCGGCTGGAGTCTCGGCGGCGTCTA-
T
GCGCGCGATCTCGCTTTGCAGGCGCCCGACATGGTGCGTTCCGTGATCACGCTCGGCAGTCCGTTTGCCAGCGA-
C
ATCAGGGCGACCAACGCCACGCGGCTCTACGAGGCGCTGTCGGGAGAAAGGGTCGACGACAATCCGGAGTTAAC-
A
GCGGCGATCGCCGGCGACCTGCCGGTGCCGGCGACCTCGATCTATTCCCGTACCGACGGTATCGTGAACTGGCA-
C
ACCAGCCTGCTGCGTCCTTCCGCAACGGCTGAAAACATCGAGGTTTACTTCGCCAGCCATATCGGGCTCGGCGT-
C
AACCCGGCAGCGCTGTGGGCGGTGGCCGACCGCCTGGCGCAGCCCGAGGGGGAATTTAAGCATTTTGACCGGTC-
G GGTCCCTTTGCCATTGCCTATGGCCCCCCTGAAAATGCACAATCCTGA SEQ ID NO: 18
(encoded by SEQ ID NO: 17):
MAAADSGTAEGQRLRPPSLFLMLAEARGLLELNSSLLLSPLLLRAPKGDGHPVLALPGFLASDLSMAPMRRYLK-
E
LGYDAHAWNMGRNLGGVASKREALRDLLRRIYSQTGRKVSLVGWSLGGVYARDLALQAPDMVRSVITLGSPFAS-
D
IRATNATRLYEALSGERVDDNPELTAAIAGDLPVPATSIYSRTDGIVNWHTSLLRPSATAENIEVYFASHIGLG-
V NPAALWAVADRLAQPEGEFKHFDRSGPFAIAYGPPENAQS SEQ ID NO: 19:
ATGCCGGAGCGAAACGAAGCGCAGGCCCCGCCGCGTCTTCGTCCGCCGGGGCTCGGGCTGTTCCTCGCCGAAGC-
G
CGGGGCATTTTCGAGCTCAACGCGAGCCTGTTGCTGTCGCCGCTTCTGTTGCGCGCGCCGCGCGGCGACGGCCA-
T
CCGGTGCTGGCGTTGCCGGGCTTTCTTGCCAGTGATCTATCGATGGCGCCGTTGCGCCGCTACCTCACCGAGCT-
C
GGCTACGACACCCACGCCTGGCGCATGGGCCGCAATGTCGGCGGCATCGCGAAGATGCGGATCGCGCTGCTCGA-
G
CGGCTCACGCAGATCCATGCCGAGTGCGGCCGCAAGGTCTCGATTGTCGGCTGGAGTCTCGGCGGCGTCTATGC-
G
CGCGACCTCGCGTTGCAGGCGCCCGAGATGGTGCGCTACGTCGTCACCCTCGGCAGCCCCTTCGCCAGCGACGT-
C
CGCGCCACCAATGCGACGCGGCTCTATGAGGCGATGTCGGGCGAAACGGTCGGCGACAATGTCGACCTCGTGCA-
G
GCGATTGCCGGCGACCTGCCGGTTCCCGTGACCTCGATCTATTCGAAGAGCGACGGCATCGTGAACTGGCGGAC-
C
TGCCTGCTGCGCCCGTCCGCGACCGCCGAGAATATCGAGGTCTATTTCGCGAGCCATGTCGGCATCGGCGTCAA-
T
CCGGCCGCGCTGTGGGCGATCGCGGACCGGCTGGCCCAGCGGGAAGGCGAATTCCGCCCCTTCGACCGGTCCGG-
T CCTTTTGCCATTGCCTACGCGCCCCCGGAACAGGCACAATCGATCTGA SEQ ID NO: 20
(encoded by SEQ ID NO: 19):
MPERNEAQAPPRLRPPGLGLFLAEARGIFELNASLLLSPLLLRAPRGDGHPVLALPGFLASDLSMAPLRRYLTE-
L
GYDTHAWRMGRNVGGIAKMRIALLERLTQIHAECGRKVSIVGWSLGGVYARDLALQAPEMVRYVVTLGSPFASD-
V
RATNATRLYEAMSGETVGDNVDLVQAIAGDLPVPVTSIYSKSDGIVNWRTCLLRPSATAENIEVYFASHVGIGV-
N PAALWAIADRLAQREGEFRPFDRSGPFAIAYAPPEQAQSI
[0181] Provided herein are methods for discovering new hydrolase
sequences using the nucleic acids as provided herein. Also provided
are methods for modifying the nucleic acids as provided herein by,
e.g., GSSM.sup.SM and GeneReassembly.sup.SM technologies. The
nucleic acids as provided herein can be made, isolated and/or
manipulated by, e.g., cloning and expression of cDNA libraries,
amplification of message or genomic DNA by PCR, and the like.
[0182] The initial source of selected exemplary polypeptides and
nucleic acids are:
TABLE-US-00002 SEQ ID NO: Source 1, 2 Obtained from environmental
sample 3, 4 Obtained from environmental sample 5, 6 Obtained from
environmental sample 7, 8 Obtained from environmental sample 9, 10
Obtained from environmental sample 11, 12 Obtained from
environmental sample 13, 14 Obtained from environmental sample 15,
16 Bacteria 17, 18 Obtained from environmental sample 19, 20
Obtained from environmental sample
[0183] In practicing the methods as provided herein, homologous
genes can be modified by manipulating a template nucleic acid, as
described herein. The claimed subject matter can be practiced in
conjunction with any method or protocol or device known in the art,
which are well described in the scientific and patent
literature.
General Techniques
[0184] In certain embodiments, provided herein are nucleic acids
including RNA, RNAi (e.g., siRNA, miRNA), antisense nucleic acid,
cDNA, genomic DNA, vectors, viruses or hybrids thereof, nucleic
acids isolated from a variety of sources, genetically engineered,
amplified, and/or expressed/generated recombinantly. Recombinant
polypeptides generated from these nucleic acids can be individually
isolated or cloned and tested for a desired activity (e.g.,
hydrolase, such as e.g., a lipase, saturase, palmitase and/or
stearatase activity). Any recombinant expression system can be
used, including bacterial, mammalian, yeast, fungal, insect or
plant cell expression systems.
[0185] Alternatively, these nucleic acids can be synthesized in
vitro by well-known chemical synthesis techniques, as described in,
e.g., Adams (1983) J. Am. Chem. Soc. 105:661; Belousov (1997)
Nucleic Acids Res. 25:3440-3444; Frenkel (1995) Free Radic. Biol.
Med. 19:373-380; Blommers (1994) Biochemistry 33:7886-7896; Narang
(1979) Meth. Enzymol. 68:90; Brown (1979) Meth. Enzymol. 68:109;
Beaucage (1981) Tetra. Lett. 22:1859; U.S. Pat. No. 4,458,066.
[0186] Techniques for the manipulation of nucleic acids, such as,
e.g., subcloning, labeling probes (e.g., random-primer labeling
using Klenow polymerase, nick translation, amplification),
sequencing, hybridization and the like are well described in the
scientific and patent literature, see, e.g., Sambrook, ed.,
MOLECULAR CLONING: A LABORATORY MANUAL (2ND ED.), Vols. 1-3, Cold
Spring Harbor Laboratory, (1989); CURRENT PROTOCOLS IN MOLECULAR
BIOLOGY, Ausubel, ed. John Wiley & Sons, Inc., New York (1997);
LABORATORY TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY:
HYBRIDIZATION WITH NUCLEIC ACID PROBES, Part I. Theory and Nucleic
Acid Preparation, Tijssen, ed. Elsevier, N.Y. (1993).
[0187] Another useful means of obtaining and manipulating nucleic
acids used to practice the methods as provided herein is to clone
from genomic samples, and, if desired, screen and re-clone inserts
isolated or amplified from, e.g., genomic clones or cDNA clones.
Sources of nucleic acid used in the methods as provided herein
include genomic or cDNA libraries contained in, e.g., mammalian
artificial chromosomes (MACs), see, e.g., U.S. Pat. Nos. 5,721,118;
6,025,155; human artificial chromosomes, see, e.g., Rosenfeld
(1997) Nat. Genet. 15:333-335; yeast artificial chromosomes (YAC);
bacterial artificial chromosomes (BAC); P1 artificial chromosomes,
see, e.g., Woon (1998) Genomics 50:306-316; P1-derived vectors
(PACs), see, e.g., Kern (1997) Biotechniques 23:120-124; cosmids,
recombinant viruses, phages or plasmids.
[0188] The phrases "nucleic acid" or "nucleic acid sequence" can
include an oligonucleotide, nucleotide, polynucleotide, or a
fragment of any of these, DNA or RNA (e.g., mRNA, rRNA, tRNA, RNAi)
of genomic or synthetic origin which may be single-stranded or
double-stranded and may represent a sense or antisense strand, a
peptide nucleic acid (PNA), or any DNA-like or RNA-like material,
natural or synthetic in origin, including, e.g., RNAi
(double-stranded "interfering" RNA), ribonucleoproteins (e.g.,
iRNPs). The term encompasses nucleic acids, i.e., oligonucleotides,
containing known analogues of natural nucleotides. The term also
encompasses nucleic-acid-like structures with synthetic backbones,
see e.g., Mata (1997) Toxicol. Appl. Pharmacol. 144:189-197;
Strauss-Soukup (1997) Biochemistry 36:8692-8698; Samstag (1996)
Antisense Nucleic Acid Drug Dev 6:153-156.
[0189] As used herein, the term "promoter" includes all sequences
capable of driving transcription of a coding sequence in a cell,
e.g., a plant cell. Thus, promoters used in the constructs as
provided herein include cis-acting transcriptional control elements
and regulatory sequences that are involved in regulating or
modulating the timing and/or rate of transcription of a gene. For
example, a promoter can be a cis-acting transcriptional control
element, including an enhancer, a promoter, a transcription
terminator, an origin of replication, a chromosomal integration
sequence, 5' and 3' untranslated regions, or an intronic sequence,
which are involved in transcriptional regulation. These cis-acting
sequences typically interact with proteins or other biomolecules to
carry out (turn on/off, regulate, modulate, etc.) transcription.
"Constitutive" promoters are those that drive expression
continuously under most environmental conditions and states of
development or cell differentiation. "Inducible" or "regulatable"
promoters direct expression of the nucleic acid as provided herein
under the influence of environmental conditions or developmental
conditions. Examples of environmental conditions that may affect
transcription by inducible promoters include anaerobic conditions,
elevated temperature, drought, or the presence of light.
[0190] "Tissue-specific" promoters are transcriptional control
elements that are only active in particular cells or tissues or
organs, e.g., in plants or animals. Tissue-specific regulation may
be achieved by certain intrinsic factors which ensure that genes
encoding proteins specific to a given tissue are expressed. Such
factors are known to exist in mammals and plants so as to allow for
specific tissues to develop.
[0191] The term "plant" includes whole plants, plant parts (e.g.,
leaves, stems, flowers, roots, etc.), plant protoplasts, seeds and
plant cells and progeny of same. The class of plants which can be
used in the method as provided herein is generally as broad as the
class of higher plants amenable to transformation techniques,
including angiosperms (monocotyledonous and dicotyledonous plants),
as well as gymnosperms. It includes plants of a variety of ploidy
levels, including polyploid, diploid, haploid and hemizygous
states. As used herein, the term "transgenic plant" includes plants
or plant cells into which a heterologous nucleic acid sequence has
been inserted, e.g., the nucleic acids and various recombinant
constructs (e.g., expression cassettes) as provided herein.
[0192] In one aspect, a nucleic acid encoding a polypeptide as
provided herein is assembled in appropriate phase with a leader
sequence capable of directing secretion of the translated
polypeptide or fragment thereof.
[0193] In one embodiment, provided herein are fusion proteins and
nucleic acids encoding them. A polypeptide as provided herein can
be fused to a heterologous peptide or polypeptide, such as
N-terminal identification peptides which impart desired
characteristics, such as increased stability or simplified
purification. Peptides and polypeptides as provided herein can also
be synthesized and expressed as fusion proteins with one or more
additional domains linked thereto for, e.g., producing a more
immunogenic peptide, to more readily isolate a recombinantly
synthesized peptide, to identify and isolate antibodies and
antibody-expressing B cells, and the like. Detection and
purification facilitating domains include, e.g., metal chelating
peptides such as polyhistidine tracts and histidine-tryptophan
modules that allow purification on immobilized metals, protein A
domains that allow purification on immobilized immunoglobulin, and
the domain utilized in the FLAGS extension/affinity purification
system (Immunex Corp, Seattle Wash.). The inclusion of a cleavable
linker sequence, such as Factor Xa or enterokinase cleavage
sequences (Invitrogen, San Diego Calif.) between a purification
domain and the motif-comprising peptide or polypeptide, can
facilitate purification. For example, an expression vector can
include an epitope-encoding nucleic acid sequence linked to six
histidine residues followed by a thioredoxin and an enterokinase
cleavage site (see e.g., Williams (1995) Biochemistry 34:1787-1797;
Dobeli (1998) Protein Expr. Purif 12:404-414). The histidine
residues facilitate detection and purification while the
enterokinase cleavage site provides a means for purifying the
epitope from the remainder of the fusion protein. Technology
pertaining to vectors encoding fusion proteins and application of
fusion proteins are well described in the scientific and patent
literature, see e.g., Kroll (1993) DNA Cell. Biol., 12:441-53.
Transcriptional and Translational Control Sequences
[0194] In another embodiment, provided herein are nucleic acid
(e.g., DNA, iRNA) sequences operatively linked to expression (e.g.,
transcriptional or translational) control sequence(s), e.g.,
promoters or enhancers, to direct or modulate RNA
synthesis/expression. The expression control sequence can be in an
expression vector. Exemplary bacterial promoters include lad, lacZ,
T3, T7, gpt, lambda PR, PL and trp. Exemplary eukaryotic promoters
include CMV immediate early, HSV thymidine kinase, early and late
SV40, LTRs from retrovirus, and mouse metallothionein.
[0195] Promoters suitable for expressing a polypeptide in bacteria
include the E. coli lac or trp promoters, the lad promoter, the
lacZ promoter, the T3 promoter, the T7 promoter, the gpt promoter,
the lambda PR promoter, the lambda PL promoter, promoters from
operons encoding glycolytic enzymes such as 3-phosphoglycerate
kinase (PGK), and the acid phosphatase promoter. Eukaryotic
promoters include the CMV immediate early promoter, the HSV
thymidine kinase promoter, heat shock promoters, the early and late
SV40 promoter, LTRs from retroviruses, and the mouse
metallothionein-I promoter. Other promoters known to control
expression of genes in prokaryotic or eukaryotic cells or their
viruses may also be used.
Tissue-Specific Plant Promoters
[0196] In one embodiment, provided herein are expression cassettes
that can be expressed in a tissue-specific manner, e.g., that can
express a hydrolase as provided herein in a tissue-specific manner.
In another embodiment, provided herein are plants or seeds that
express a hydrolase as provided herein in a tissue-specific manner.
The tissue-specificity can be seed specific, stem specific, leaf
specific, root specific, fruit specific and the like.
[0197] In one aspect, a constitutive promoter such as the CaMV 35S
promoter can be used for expression in specific parts of the plant
or seed or throughout the plant. For example, for overexpression of
a hydrolase as provided herein, a plant promoter fragment can be
employed which will direct expression of a nucleic acid in some or
all tissues of a plant, e.g., a regenerated plant. Such
"constitutive" promoters are active under most environmental
conditions and states of development or cell differentiation.
Examples of constitutive promoters include the cauliflower mosaic
virus (CaMV) 35S transcription initiation region, the 1'- or
2'-promoter derived from T-DNA of Agrobacterium tumefaciens, and
other transcription initiation regions from various plant genes
known to those of skill. Such genes include, e.g., ACT 11 from
Arabidopsis (Huang (1996) Plant Mol. Biol. 33:125-139); Cat3 from
Arabidopsis (GenBank No. U43147, Zhong (1996) Mol. Gen. Genet.
251:196-203); the gene encoding stearoyl-acyl carrier protein
desaturase from Brassica napus (Genbank No. X74782, Solocombe
(1994) Plant Physiol. 104:1167-1176); GPc1 from maize (GenBank No.
X15596; Martinez (1989) Mol. Biol 208:551-565); the Gpc2 from maize
(GenBank No. U45855, Manjunath (1997) Plant Mol. Biol. 33:97-112);
plant promoters described in U.S. Pat. Nos. 4,962,028;
5,633,440.
[0198] In one embodiment, provided herein are tissue-specific or
constitutive promoters derived from viruses which can include,
e.g., the tobamovirus subgenomic promoter (Kumagai (1995) Proc.
Natl. Acad. Sci. USA 92:1679-1683; the rice tungro bacilliform
virus (RTBV), which replicates only in phloem cells in infected
rice plants, with its promoter which drives strong phloem-specific
reporter gene expression; the cassava vein mosaic virus (CVMV)
promoter, with highest activity in vascular elements, in leaf
mesophyll cells, and in root tips (Verdaguer (1996) Plant Mol.
Biol. 31:1129-1139).
[0199] Alternatively, the plant promoter may direct expression of a
hydrolase-expressing nucleic acid in a specific tissue, organ or
cell type (i.e. tissue-specific promoters) or may be otherwise
under more precise environmental or developmental control or under
the control of an inducible promoter. Examples of environmental
conditions that may affect transcription include anaerobic
conditions, elevated temperature, the presence of light, or sprayed
with chemicals/hormones. In one embodiment, provided herein are
drought-inducible promoters of maize (Busk (1997) supra); the cold,
drought, and high salt inducible promoter from potato (Kirch (1997)
Plant Mol. Biol. 33:897 909).
[0200] Tissue-specific promoters can promote transcription only
within a certain time frame of developmental stage within that
tissue. See, e.g., Blazquez (1998) Plant Cell 10:791-800,
characterizing the Arabidopsis LEAFY gene promoter. See also Cardon
(1997) Plant J 12:367-77, describing the transcription factor SPL3,
which recognizes a conserved sequence motif in the promoter region
of the A. thaliana floral meristem identity gene AP1; and Mandel
(1995) Plant Molecular Biology, Vol. 29, pp 995-1004, describing
the meristem promoter eIF4. Tissue specific promoters which are
active throughout the life cycle of a particular tissue can be
used. In one aspect, the nucleic acids as provided herein are
operably linked to a promoter active primarily only in cotton fiber
cells. In one aspect, the nucleic acids as provided herein are
operably linked to a promoter active primarily during the stages of
cotton fiber cell elongation, e.g., as described by Rinehart (1996)
supra. The nucleic acids can be operably linked to the Fbl2A gene
promoter to be preferentially expressed in cotton fiber cells
(Ibid). See also, John (1997) Proc. Natl. Acad. Sci. USA
89:5769-5773; John, et al., U.S. Pat. Nos. 5,608,148 and 5,602,321,
describing cotton fiber-specific promoters and methods for the
construction of transgenic cotton plants. Root-specific promoters
may also be used to express the nucleic acids as provided herein.
Examples of root-specific promoters include the promoter from the
alcohol dehydrogenase gene (DeLisle (1990) Int. Rev. Cytol.
123:39-60). Other promoters that can be used to express the nucleic
acids as provided herein include, e.g., ovule-specific,
embryo-specific, endosperm-specific, integument-specific, seed
coat-specific promoters, or some combination thereof; a
leaf-specific promoter (see, e.g., Busk (1997) Plant J. 11:1285
1295, describing a leaf-specific promoter in maize); the ORF13
promoter from Agrobacterium rhizogenes (which exhibits high
activity in roots, see, e.g., Hansen (1997) supra); a maize pollen
specific promoter (see, e.g., Guerrero (1990) Mol. Gen. Genet.
224:161 168); a tomato promoter active during fruit ripening,
senescence and abscission of leaves and, to a lesser extent, of
flowers can be used (see, e.g., Blume (1997) Plant J. 12:731 746);
a pistil-specific promoter from the potato SK2 gene (see, e.g.,
Ficker (1997) Plant Mol. Biol. 35:425 431); the Blec4 gene from
pea, which is active in epidermal tissue of vegetative and floral
shoot apices of transgenic alfalfa making it a useful tool to
target the expression of foreign genes to the epidermal layer of
actively growing shoots or fibers; the ovule-specific BEL1 gene
(see, e.g., Reiser (1995) Cell 83:735-742, GenBank No. U39944);
and/or, the promoter in Klee, U.S. Pat. No. 5,589,583, describing a
plant promoter region is capable of conferring high levels of
transcription in meristematic tissue and/or rapidly dividing
cells.
[0201] Alternatively, plant promoters which are inducible upon
exposure to plant hormones, such as auxins, are used to express the
nucleic acids as provided herein. In one embodiment, provided
herein are promoters comprising auxin-response elements E1 promoter
fragment (AuxREs) in the soybean (Glycine max L.) (Liu (1997) Plant
Physiol. 115:397-407); the auxin-responsive Arabidopsis GST6
promoter (also responsive to salicylic acid and hydrogen peroxide)
(Chen (1996) Plant J. 10: 955-966); the auxin-inducible parC
promoter from tobacco (Sakai (1996) 37:906-913); a plant biotin
response element (Streit (1997) Mol. Plant Microbe Interact.
10:933-937); and, the promoter responsive to the stress hormone
abscisic acid (Sheen (1996) Science 274:1900-1902).
[0202] The nucleic acids as provided herein can also be operably
linked to plant promoters which are inducible upon exposure to
chemicals reagents which can be applied to the plant, such as
herbicides or antibiotics. For example, the maize In2-2 promoter,
activated by benzenesulfonamide herbicide safeners, can be used (De
Veylder (1997) Plant Cell Physiol. 38:568-577); application of
different herbicide safeners induces distinct gene expression
patterns, including expression in the root, hydathodes, and the
shoot apical meristem. Coding sequences can be under the control
of, e.g., a tetracycline-inducible promoter, e.g., as described
with transgenic tobacco plants containing the Avena sativa L. (oat)
arginine decarboxylase gene (Masgrau (1997) Plant J. 11:465-473);
or, a salicylic acid-responsive element (Stange (1997) Plant J.
11:1315-1324). Using chemically-(e.g., hormone- or pesticide-)
induced promoters, i.e., promoter responsive to a chemical which
can be applied to the transgenic plant in the field, expression of
a polypeptide as provided herein can be induced at a particular
stage of development of the plant. In certain embodiments, provided
herein are transgenic plants containing an inducible gene encoding
for polypeptides as provided herein whose host range is limited to
target plant species, such as corn, rice, barley, wheat, potato or
other crops, inducible at any stage of development of the crop.
[0203] Tissue-specific plant promoters may drive expression of
operably linked sequences in tissues other than the target tissue.
Thus, a tissue-specific promoter is one that drives expression
preferentially in the target tissue or cell type, but may also lead
to some expression in other tissues as well.
[0204] The nucleic acids as provided herein can also be operably
linked to plant promoters which are inducible upon exposure to
chemicals reagents. These reagents include, e.g., herbicides,
synthetic auxins, or antibiotics which can be applied, e.g.,
sprayed, onto transgenic plants. Inducible expression of the
hydrolase-producing nucleic acids as provided herein will allow the
grower to select plants with the optimal starch:sugar ratio. The
development of plant parts can thus be controlled.
[0205] In one embodiment, provided herein are means to facilitate
the harvesting of plants and plant parts. For example, in various
embodiments, the maize In2-2 promoter, activated by
benzenesulfonamide herbicide safeners, is used (De Veylder (1997)
Plant Cell Physiol. 38:568-577); application of different herbicide
safeners induces distinct gene expression patterns, including
expression in the root, hydathodes, and the shoot apical meristem.
Coding sequences as provided herein are also under the control of a
tetracycline-inducible promoter, e.g., as described with transgenic
tobacco plants containing the Avena sativa L. (oat) arginine
decarboxylase gene (Masgrau (1997) Plant J. 11:465-473); or, a
salicylic acid-responsive element (Stange (1997) Plant J.
11:1315-1324).
[0206] If proper polypeptide expression is desired, a
polyadenylation region at the 3'-end of the coding region should be
included. The polyadenylation region can be derived from the
natural gene, from a variety of other plant genes, or from genes in
the Agrobacterial T-DNA.
Expression Vectors and Cloning Vehicles
[0207] In one embodiment, provided herein are expression vectors,
expression cassettes and cloning vehicles comprising nucleic acids,
e.g., sequences encoding the hydrolases and antibodies. Expression
vectors and cloning vehicles as provided herein can comprise viral
particles, baculovirus, phage, plasmids, phagemids, cosmids,
fosmids, bacterial artificial chromosomes, viral DNA (e.g.,
vaccinia, adenovirus, foul pox virus, pseudorabies and derivatives
of SV40), P1-based artificial chromosomes, yeast plasmids, yeast
artificial chromosomes, and any other vectors specific for specific
hosts of interest (such as bacillus, Aspergillus and yeast).
Vectors as provided herein can include chromosomal, non-chromosomal
and synthetic DNA sequences. Large numbers of suitable vectors are
known to those of skill in the art, and are commercially available.
Exemplary vectors include: bacterial: pQE vectors (Qiagen),
pBLUESCRIPT.TM. plasmids, pNH vectors, (lambda-ZAP vectors
(Stratagene); ptrc99a, pKK223-3, pDR540, pRIT2T (Pharmacia);
Eukaryotic: pXT1, pSG5 (Stratagene), pSVK3, pBPV, pMSG, pSVLSV40
(Pharmacia). However, any other plasmid or other vector may be used
so long as they are replicable and viable in the host. Low copy
number or high copy number vectors may be employed.
[0208] In one embodiment, an "expression cassette" as provided
herein comprises a nucleotide sequence which is capable of
effecting expression of a structural gene (i.e., a protein coding
sequence, such as a hydrolase as provided herein) in a host
compatible with such sequences. Expression cassettes include at
least a promoter operably linked with the polypeptide coding
sequence; and, optionally, with other sequences, e.g.,
transcription termination signals. Additional factors necessary or
helpful in effecting expression may also be used, e.g., enhancers.
"Operably linked" as used herein refers to linkage of a promoter
upstream from a DNA sequence such that the promoter mediates
transcription of the DNA sequence. Thus, expression cassettes also
include plasmids, expression vectors, recombinant viruses, any form
of recombinant "naked DNA" vector, and the like. A "vector"
comprises a nucleic acid which can infect, transfect, transiently
or permanently transduce a cell. It will be recognized that a
vector can be a naked nucleic acid, or a nucleic acid complexed
with protein or lipid. The vector optionally comprises viral or
bacterial nucleic acids and/or proteins, and/or membranes (e.g., a
cell membrane, a viral lipid envelope, etc.). Vectors include, but
are not limited to replicons (e.g., RNA replicons, bacteriophages)
to which fragments of DNA may be attached and become replicated.
Vectors thus include, but are not limited to RNA, autonomous
self-replicating circular or linear DNA or RNA (e.g., plasmids,
viruses, and the like, see, e.g., U.S. Pat. No. 5,217,879), and
includes both the expression and non-expression plasmids. Where a
recombinant microorganism or cell culture is described as hosting
an "expression vector" this includes both extra-chromosomal
circular and linear DNA and DNA that has been incorporated into the
host chromosome(s). Where a vector is being maintained by a host
cell, the vector may either be stably replicated by the cells
during mitosis as an autonomous structure, or is incorporated
within the host's genome.
[0209] The expression vector may comprise a promoter, a ribosome
binding site for translation initiation and a transcription
terminator. The vector may also include appropriate sequences for
amplifying expression. Mammalian expression vectors can comprise an
origin of replication, any necessary ribosome binding sites, a
polyadenylation site, splice donor and acceptor sites,
transcriptional termination sequences, and 5' flanking
non-transcribed sequences. In some aspects, DNA sequences derived
from the SV40 splice and polyadenylation sites may be used to
provide the required non-transcribed genetic elements.
[0210] In one aspect, the expression vectors contain one or more
selectable marker genes to permit selection of host cells
containing the vector. Such selectable markers include genes
encoding dihydrofolate reductase or genes conferring neomycin
resistance for eukaryotic cell culture, genes conferring
tetracycline or ampicillin resistance in E. coli, and the S.
cerevisiae TRP1 gene. Promoter regions can be selected from any
desired gene using chloramphenicol transferase (CAT) vectors or
other vectors with selectable markers.
[0211] Vectors for expressing the polypeptide or fragment thereof
in eukaryotic cells may also contain enhancers to increase
expression levels. Enhancers are cis-acting elements of DNA,
usually from about 10 to about 300 bp in length that act on a
promoter to increase its transcription. Examples include the SV40
enhancer on the late side of the replication origin bp 100 to 270,
the cytomegalovirus early promoter enhancer, the polyoma enhancer
on the late side of the replication origin, and the adenovirus
enhancers.
[0212] A DNA sequence may be inserted into a vector by a variety of
procedures. In general, the DNA sequence is ligated to the desired
position in the vector following digestion of the insert and the
vector with appropriate restriction endonucleases. Alternatively,
blunt ends in both the insert and the vector may be ligated. A
variety of cloning techniques are known in the art, e.g., as
described in Ausubel and Sambrook. Such procedures and others are
deemed to be within the scope of those skilled in the art.
[0213] The vector may be in the form of a plasmid, a viral
particle, or a phage. Other vectors include chromosomal,
non-chromosomal and synthetic DNA sequences, derivatives of SV40;
bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors
derived from combinations of plasmids and phage DNA, viral DNA such
as vaccinia, adenovirus, fowl pox virus, and pseudorabies. A
variety of cloning and expression vectors for use with prokaryotic
and eukaryotic hosts are described by, e.g., Sambrook.
[0214] Particular bacterial vectors which may be used include the
commercially available plasmids comprising genetic elements of the
well known cloning vector pBR322 (ATCC 37017), pKK223-3 (Pharmacia
Fine Chemicals, Uppsala, Sweden), GEM1.TM. (Promega Biotec,
Madison, Wis., USA) pQE70, pQE60, pQE-9 (Qiagen), pD10, psiX174
Pbluescript II KS.TM., pNH8A, pNH16a, pNH18A, pNH46A (Stratagene),
ptrc99a, pKK223-3, pKK233-3, DR540, pRITS (Pharmacia), pKK232-8 and
pCM7. Particular eukaryotic vectors include pSV2CAT, pOG44, pXT1,
pSG (Stratagene) pSVK3, pBPV, pMSG, and pSVL (Pharmacia). However,
any other vector may be used as long as it is replicable and viable
in the host cell.
[0215] The nucleic acids as provided herein can be expressed in
expression cassettes, vectors or viruses and transiently or stably
expressed in plant cells and seeds. One exemplary transient
expression system uses episomal expression systems, e.g.,
cauliflower mosaic virus (CaMV) viral RNA generated in the nucleus
by transcription of an episomal mini-chromosome containing
supercoiled DNA, see, e.g., Covey (1990) Proc. Natl. Acad. Sci. USA
87:1633-1637. Alternatively, coding sequences, i.e., all or
sub-fragments of sequences as provided herein can be inserted into
a plant host cell genome becoming an integral part of the host
chromosomal DNA. Sense or antisense transcripts can be expressed in
this manner. A vector comprising the sequences (e.g., promoters or
coding regions) from nucleic acids as provided herein can comprise
a marker gene that confers a selectable phenotype on a plant cell
or a seed. For example, the marker may encode biocide resistance,
particularly antibiotic resistance, such as resistance to
kanamycin, G418, bleomycin, hygromycin, or herbicide resistance,
such as resistance to chlorosulfuron or Basta.
[0216] Expression vectors capable of expressing nucleic acids and
proteins in plants are well known in the art, and can include,
e.g., vectors from Agrobacterium spp., potato virus X (see, e.g.,
Angell (1997) EMBO J. 16:3675-3684), tobacco mosaic virus (see,
e.g., Casper (1996) Gene 173:69-73), tomato bushy stunt virus (see,
e.g., Hillman (1989) Virology 169:42-50), tobacco etch virus (see,
e.g., Dolja (1997) Virology 234:243-252), bean golden mosaic virus
(see, e.g., Morinaga (1993) Microbiol Immunol. 37:471-476),
cauliflower mosaic virus (see, e.g., Cecchini (1997) Mol. Plant
Microbe Interact. 10:1094-1101), maize Ac/Ds transposable element
(see, e.g., Rubin (1997) Mol. Cell. Biol. 17:6294-6302; Kunze
(1996) Curr. Top. Microbiol. Immunol. 204:161-194), and the maize
suppressor-mutator (Spm) transposable element (see, e.g., Schlappi
(1996) Plant Mol. Biol. 32:717-725); and derivatives thereof.
[0217] In one aspect, the expression vector can have two
replication systems to allow it to be maintained in two organisms,
for example in mammalian, yeast, fungal or insect cells for
expression and in a prokaryotic host for cloning and amplification.
Furthermore, for integrating expression vectors, the expression
vector can contain at least one sequence homologous to the host
cell genome. It can contain two homologous sequences which flank
the expression construct. The integrating vector can be directed to
a specific locus in the host cell by selecting the appropriate
homologous sequence for inclusion in the vector. Constructs for
integrating vectors are well known in the art.
[0218] Expression vectors as provided herein may also include a
selectable marker gene to allow for the selection of bacterial
strains that have been transformed, e.g., genes which render the
bacteria resistant to drugs such as ampicillin, chloramphenicol,
erythromycin, kanamycin, neomycin and tetracycline. Selectable
markers can also include biosynthetic genes, such as those in the
histidine, tryptophan and leucine biosynthetic pathways.
Host Cells and Transformed Cells
[0219] In one embodiment, provided herein are transformed cells
comprising a nucleic acid sequence, e.g., a sequence encoding a
hydrolase or an antibody, or a vector as provided herein. The host
cell may be any of the host cells familiar to those skilled in the
art, including prokaryotic cells, eukaryotic cells, such as
bacterial cells, fungal cells, yeast cells, mammalian cells, insect
cells, or plant cells.
[0220] Enzymes as provided herein can be expressed in any host
cell, e.g., any bacterial cell, any yeast cell, any Saccharomyces
or Schizosaccharomyces spp., any Pichia spp., e.g., Pichia
pastoris, Saccharomyces cerevisiae or Schizosaccharomyces pombe.
Exemplary bacterial cells include any Streptomyces or Bacillus
spp., e.g., E. coli, Lactococcus lactis, Bacillus subtilis,
Bacillus cereus, Salmonella typhimurium or any species within the
genera Bacillus, Streptomyces and Staphylococcus. Exemplary insect
cells include Drosophila S2 and Spodoptera Sf9. Exemplary animal
cells include CHO, COS or Bowes melanoma or any mouse or human cell
line. The selection of an appropriate host is within the abilities
of those skilled in the art. Techniques for transforming a wide
variety of higher plant species are well known and described in the
technical and scientific literature. See, e.g., Weising (1988) Ann.
Rev. Genet. 22:421-477, U.S. Pat. No. 5,750,870.
[0221] The vector may be introduced into the host cells using any
of a variety of techniques, including transformation, transfection,
transduction, viral infection, gene guns, or Ti-mediated gene
transfer. Particular methods include calcium phosphate
transfection, DEAE-Dextran mediated transfection, lipofection, or
electroporation (Davis, L., Dibner, M., Battey, I., Basic Methods
in Molecular Biology, (1986)).
[0222] Where appropriate, the engineered host cells can be cultured
in conventional nutrient media modified as appropriate for
activating promoters, selecting transformants or amplifying the
genes as provided herein. Following transformation of a suitable
host strain and growth of the host strain to an appropriate cell
density, the selected promoter may be induced by appropriate means
(e.g., temperature shift or chemical induction) and the cells may
be cultured for an additional period to allow them to produce the
desired polypeptide or fragment thereof.
[0223] In one aspect, the nucleic acids or vectors as provided
herein are introduced into the cells for screening, thus, the
nucleic acids enter the cells in a manner suitable for subsequent
expression of the nucleic acid. The method of introduction is
largely dictated by the targeted cell type. Exemplary methods
include CaPO.sub.4 precipitation, liposome fusion, lipofection
(e.g., LIPOFECTIN.TM.), electroporation, viral infection, etc. The
candidate nucleic acids may stably integrate into the genome of the
host cell (for example, with retroviral introduction) or may exist
either transiently or stably in the cytoplasm (i.e. through the use
of traditional plasmids, utilizing standard regulatory sequences,
selection markers, etc.). Alternative embodiments comprise
retroviral vectors capable of transfecting such targets (e.g.,
mammalian, human cells) because, e.g., many pharmaceutically
important screens require human or model mammalian cell
targets.
[0224] Cells can be harvested by centrifugation, disrupted by
physical or chemical means, and the resulting crude extract is
retained for further purification. Microbial cells employed for
expression of proteins can be disrupted by any convenient method,
including freeze-thaw cycling, sonication, mechanical disruption,
or use of cell lysing agents. Such methods are well known to those
skilled in the art. The expressed polypeptide or fragment thereof
can be recovered and purified from recombinant cell cultures by
methods including ammonium sulfate or ethanol precipitation, acid
extraction, anion or cation exchange chromatography,
phosphocellulose chromatography, hydrophobic interaction
chromatography, affinity chromatography, hydroxylapatite
chromatography and lectin chromatography. Protein refolding steps
can be used, as necessary, in completing configuration of the
polypeptide. If desired, high performance liquid chromatography
(HPLC) can be employed for final purification steps.
[0225] Various mammalian cell culture systems can also be employed
to express recombinant protein. Examples of mammalian expression
systems include the COS-7 lines of monkey kidney fibroblasts and
other cell lines capable of expressing proteins from a compatible
vector, such as the C127, 3T3, CHO, HeLa and BHK cell lines.
[0226] The constructs in host cells can be used in a conventional
manner to produce the gene product encoded by the recombinant
sequence. Depending upon the host employed in a recombinant
production procedure, the polypeptides produced by host cells
containing the vector may be glycosylated or may be
non-glycosylated. Polypeptides as provided herein may or may not
also include an initial methionine amino acid residue.
[0227] Cell-free translation systems can also be employed to
produce a polypeptide as provided herein. Cell-free translation
systems can use mRNAs transcribed from a DNA construct comprising a
promoter operably linked to a nucleic acid encoding the polypeptide
or fragment thereof. In some aspects, the DNA construct may be
linearized prior to conducting an in vitro transcription reaction.
The transcribed mRNA is then incubated with an appropriate
cell-free translation extract, such as a rabbit reticulocyte
extract, to produce the desired polypeptide or fragment
thereof.
[0228] The expression vectors can contain one or more selectable
marker genes to provide a phenotypic trait for selection of
transformed host cells such as dihydrofolate reductase or neomycin
resistance for eukaryotic cell culture, or such as tetracycline or
ampicillin resistance in E. coli.
Amplification of Nucleic Acids
[0229] In another embodiment, provided herein are nucleic acids
encoding the polypeptides, or modified nucleic acids, can be
reproduced by, e.g., amplification. In one embodiment, provided
herein are amplification primer pairs for amplifying nucleic acids
encoding a hydrolase, e.g., a lipase, saturase, palmitase and/or
stearatase, where the primer pairs are capable of amplifying
nucleic acid sequences as provided herein. One of skill in the art
can design amplification primer sequence pairs for any part of or
the full length of these sequences.
[0230] Amplification reactions can also be used to quantify the
amount of nucleic acid in a sample (such as the amount of message
in a cell sample), label the nucleic acid (e.g., to apply it to an
array or a blot), detect the nucleic acid, or quantify the amount
of a specific nucleic acid in a sample. In one aspect as provided
herein, message isolated from a cell or a cDNA library is
amplified. The skilled artisan can select and design suitable
oligonucleotide amplification primers. Amplification methods are
also well known in the art, and include, e.g., polymerase chain
reaction, PCR (see, e.g., PCR PROTOCOLS, A GUIDE TO METHODS AND
APPLICATIONS, ed. Innis, Academic Press, N.Y. (1990) and PCR
STRATEGIES (1995), ed. Innis, Academic Press, Inc., N.Y., ligase
chain reaction (LCR) (see, e.g., Wu (1989) Genomics 4:560;
Landegren (1988) Science 241:1077; Barringer (1990) Gene 89:117);
transcription amplification (see, e.g., Kwoh (1989) Proc. Natl.
Acad. Sci. USA 86:1173); and, self-sustained sequence replication
(see, e.g., Guatelli (1990) Proc. Natl. Acad. Sci. USA 87:1874); Q
Beta replicase amplification (see, e.g., Smith (1997) J. Clin.
Microbiol. 35:1477-1491), automated Q-beta replicase amplification
assay (see, e.g., Burg (1996) Mol. Cell. Probes 10:257-271) and
other RNA polymerase mediated techniques (e.g., NASBA, Cangene,
Mississauga, Ontario); see also Berger (1987) Methods Enzymol.
152:307-316; Sambrook; Ausubel; U.S. Pat. Nos. 4,683,195 and
4,683,202; Sooknanan (1995) Biotechnology 13:563-564.
[0231] In one embodiment, provided herein are amplification primer
pairs comprising sequences as provided herein, for example, wherein
the primer pair comprises a first member having a sequence as set
forth by about the first (the 5') 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39 or 40 or more residues of a nucleic acid as provided
herein, and a second member having a sequence as set forth by about
the first (the 5') 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or
40 or more residues of the complementary strand of the first
member.
Determining the Degree of Sequence Identity
[0232] In one embodiment, provided herein are nucleic acids having
at least nucleic acid, or complete (100%) sequence identity to a
nucleic acid as provided herein, e.g., an exemplary nucleic acid as
provided herein (e.g., having a sequence as set forth in SEQ ID
NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID
NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, or SEQ ID NO:19 or
SEQ ID NO:1 modified to encode one, two, three, four, five, six,
seven, eight or more (several) or all the base variations described
in Table 3 or Table 4, or the equivalent thereof); and polypeptides
having at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%,
60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%,
73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%,
86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, or more, or complete (100%) sequence identity to a polypeptide
as provided herein, e.g., an exemplary polypeptide having a
sequence as set forth in SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ
ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16,
SEQ ID NO:18, or SEQ ID NO:20 or SEQ ID NO:2 having one, two,
three, four, five, six, seven, eight or more (several) or all the
amino acid variations described in Table 3 or Table 4, or the
equivalent therof. In alternative aspects, the sequence identity
can be over a region of at least about 5, 10, 20, 30, 40, 50, 100,
150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750,
800, 850, 900, 950, 1000, or more consecutive residues, or the full
length of the nucleic acid or polypeptide. The extent of sequence
identity (homology) may be determined using any computer program
and associated parameters, including those described herein, such
as BLAST 2.2.2. or FASTA version 3.0t78, with the default
parameters. As used herein, the terms "computer," "computer
program" and "processor" are used in their broadest general
contexts and incorporate all such devices, as described in detail,
below.
[0233] The table below describes selected characteristics of
exemplary nucleic acids and polypeptides as provided herein,
including sequence identity comparison of the exemplary sequences
to public databases to identify activity of enzymes as provided
herein by homology (sequence identity) analysis. All sequences
described in the table (all the exemplary sequences as provided
herein) have been subject to a BLAST search (as described in
detail, below) against two sets of databases. The first database
set is available through NCBI (National Center for Biotechnology
Information). All results from searches against these databases are
found in the columns entitled "NR Description", "NRAccession Code",
"NR Evalue" or "NR Organism". "NR" refers to the Non-Redundant
nucleotide database maintained by NCBI. This database is a
composite of GenBank, GenBank updates, and EMBL updates. The
entries in the column "NR Description" refer to the definition line
in any given NCBI record, which includes a description of the
sequence, such as the source organism, gene name/protein name, or
some description of the function of the sequence--thus identifying
an activity of the listed exemplary enzymes as provided herein by
homology (sequence identity) analysis. The entries in the column
"NR Accession Code" refer to the unique identifier given to a
sequence record. The entries in the column "NR Evalue" refer to the
Expect value (Evalue), which represents the probability that an
alignment score as good as the one found between the query sequence
(the sequences as provided herein) and a database sequence would be
found in the same number of comparisons between random sequences as
was done in the present BLAST search. The entries in the column "NR
Organism" refer to the source organism of the sequence identified
as the closest BLAST (sequence homology) hit. The second set of
databases is collectively known as the GENESEQ.TM. database, which
is available through Thomson Derwent (Philadelphia, Pa.). All
results from searches against this database are found in the
columns entitled "GENESEQ.TM. Protein Description", "GENESEQ.TM.
Protein Accession Code", "GENESEQ.TM. Protein Evalue", "GENESEQ.TM.
DNA Description", "GENESEQ.TM. DNA Accession Code" or "GENESEQ.TM.
DNA Evalue". The information found in these columns is comparable
to the information found in the NR columns described above, except
that it was derived from BLAST searches against the GENESEQ.TM.
database instead of the NCBI databases. The columns "Query DNA
Length" and "Query Protein Length" refer to the number of
nucleotides or the number amino acids, respectively, in the
sequence as provided herein that was searched or queried against
either the NCBI or GENESEQ.TM. databases. The columns "GENESEQ.TM.
or NR DNA Length" and "GENESEQ.TM. or NR Protein Length" refer to
the number of nucleotides or the number amino acids, respectively,
in the sequence of the top match from the BLAST search. The results
provided in these columns are from the search that returned the
lower Evalue, either from the NCBI databases or the Geneseq
database. The columns "GENESEQ.TM./NR % ID Protein" and
"GENESEQ.TM./NR % ID DNA" refer to the percent sequence identity
between the sequence as provided herein and the sequence of the top
BLAST match. The results provided in these columns are from the
search that returned the lower Evalue, either from the NCBI
databases or the GENESEQ.TM. database.
TABLE-US-00003 Geneseq Geneseq Geneseq Protein Geneseq Geneseq DNA
Geneseq Geneseq/NR Protein Accession Protein DNA Accession DNA % ID
SEQ ID NO: NR Description NR Accession Code NR Evalue NR Organism
Description Code Evalue Description Code Evalue DNA 1, 2
hypothetical 103485777 7.00E-40 Sphingopyxis Hydrolase AQZ64879
1.00E-127 Hydrolase AQZ64878 0 protein Sala_0282 alaskensis
activity activity [Sphingopyxis RB2256 expressing expressing
alaskensis peptide SEQ peptide RB2256] ID NO: 2. SEQ ID NO:
gi|98975854|gb|ABF52005.1| 2. conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 3, 4 hypothetical 103485777
2.00E-40 Sphingopyxis Hydrolase AQZ64879 3.00E-39 Protein ACA26233
1.8 protein Sala_0282 alaskensis activity encoded by [Sphingopyxis
RB2256 expressing Prokaryotic alaskensis peptide SEQ essential
RB2256] ID NO: 2. gene gi|98975854|gb|ABF52005.1| #30232. conserved
hypothetical protein [Sphingopyxis alaskensis RB2256] 5, 6
hypothetical 103485777 8.00E-42 Sphingopyxis Hydrolase AQZ64879
3.00E-39 Hydrolase AQZ64878 0.53 protein Sala_0282 alaskensis
activity activity [Sphingopyxis RB2256 expressing expressing
alaskensis peptide SEQ peptide RB2256] ID NO: 2. SEQ ID NO:
gi|98975854|gb|ABF52005.1| 2. conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 7, 8 hypothetical 103485777
1.00E-46 Sphingopyxis Hydrolase AQZ64879 7.00E-44 Hydrolase
AQZ64878 1.00E-04 protein Sala_0282 alaskensis activity activity
[Sphingopyxis RB2256 expressing expressing alaskensis peptide SEQ
peptide RB2256] ID NO: 2. SEQ ID NO: gi|98975854|gb|ABF52005.1| 2.
conserved hypothetical protein [Sphingopyxis alaskensis RB2256] 9,
10 hypothetical 103485777 3.00E-51 Sphingopyxis Hydrolase AQZ64879
2.00E-42 Hydrolase AQZ64878 1.00E-07 protein Sala_0282 alaskensis
activity activity [Sphingopyxis RB2256 expressing expressing
alaskensis peptide SEQ peptide RB2256] ID NO: 2. SEQ ID NO:
gi|98975854|gb|ABF52005.1| 2. conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 11, 12 hypothetical 94497812
4.00E-46 Sphingomonas Hydrolase AQZ64879 3.00E-42 Human ACN41328
1.6 protein sp. activity diagnostic SKA58_17128 SKA58 expressing
and [Sphingomonas peptide SEQ therapeutic sp. SKA58] ID NO: 2.
pprotein gi|94422701|gb|EAT07736.1| SEQ ID hypothetical NO: 2739.
protein SKA58_17128 [Sphingomonas sp. SKA58] 13, 14 hypothetical
149921112 3.00E-32 Plesiocystis Hydrolase AOG53993 1.00E-155
Hydrolase AOG53992 0 protein pacifica activity activity
PPSIR1_24779 SIR-1 containing containing [Plesiocystis protein, SEQ
protein, pacifica SIR-1] ID 2. SEQ ID 2.
gi|149817999|gb|EDM77458.1| hypothetical protein PPSIR1_24779
[Plesiocystis pacifica SIR-1] 15, 16 lipase 29830004 1.00E-100
Streptomyces Hydrolase AQZ64645 5.00E-21 M. xanthus ACL64205 0.003
[Streptomyces avermitilis activity protein avermitilis MA- MA-
expressing sequence, 4680] 4680 peptide SEQ seq id 9726.
gi|29607114|dbj|BAC71173.1| ID NO: 2. putative lipase [Streptomyces
avermitilis MA- 4680] 17, 18 hypothetical 27377990 1.00E-115
Bradyrhizobium Mycobacterium ABM15916 8.00E-48 Hydrolase AQZ64878
1.00E-05 protein blr2879 japonicum tuberculosis activity
[Bradyrhizobium USDA mycobacterial expressing japonicum USDA 110
antigen peptide 110] protein SEQ SEQ ID NO:
gi|27351136|dbj|BAC48144.1| ID NO: 5. 2. blr2879 [Bradyrhizobium
japonicum USDA 110] 19, 20 hypothetical 27377990 1.00E-118
Bradyrhizobium Mycobacterium ABM15916 1.00E-44 Hydrolase AQZ64878
2.00E-04 protein blr2879 japonicum tuberculosis activity
[Bradyrhizobium USDA mycobacterial expressing japonicum USDA 110
antigen peptide 110] protein SEQ SEQ ID NO:
gi|27351136|dbj|BAC48144.1| ID NO: 5. 2. blr2879 [Bradyrhizobium
japonicum USDA 110] SEQ Query Query ID DNA Protein Geneseq/NR
Geneseq/NR Geneseq/NR Geneseq/NR NO: NR Description Length Length
DNA Length Protein Length % ID Protein % ID DNA 1, 2 hypothetical
protein Sala_0282 [Sphingopyxis 684 227 684 227 alaskensis RB2256]
gi|98975854|gb|ABF52005.1| conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 3, 4 hypothetical protein
Sala_0282 [Sphingopyxis 633 210 0 249 47 alaskensis RB2256]
gi|98975854|gb|ABF52005.1| conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 5, 6 hypothetical protein
Sala_0282 [Sphingopyxis 711 236 0 249 42 alaskensis RB2256]
gi|98975854|gb|ABF52005.1| conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 7, 8 hypothetical protein
Sala_0282 [Sphingopyxis 669 222 0 249 46 alaskensis RB2256]
gi|98975854|gb|ABF52005.1| conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 9, 10 hypothetical protein
Sala_0282 [Sphingopyxis 669 222 0 249 48 alaskensis RB2256]
gi|98975854|gb|ABF52005.1| conserved hypothetical protein
[Sphingopyxis alaskensis RB2256] 11, 12 hypothetical protein
SKA58_17128 [Sphingomonas 570 189 0 298 46 sp. SKA58]
gi|94422701|gb|EAT07736.1| hypothetical protein SKA58_17128
[Sphingomonas sp. SKA58] 13, 14 hypothetical protein PPSIR1_24779
[Plesiocystis 807 268 807 268 pacifica SIR-1]
gi|149817999|gb|EDM77458.1| hypothetical protein PPSIR1_24779
[Plesiocystis pacifica SIR-1] 15, 16 lipase [Streptomyces
avermitilis MA-4680] 804 267 0 286 69
gi|29607114|dbj|BAC71173.1|putative lipase [Streptomyces
avermitilis MA-4680] 17, 18 hypothetical protein blr2879
[Bradyrhizobium 798 265 0 266 79 japonicum USDA 110]
gi|27351136|dbj|BAC48144.1| blr2879 [Bradyrhizobium japonicum USDA
110] 19, 20 hypothetical protein blr2879 [Bradyrhizobium 798 265 0
266 79 japonicum USDA 110] gi|27351136|dbj|BAC48144.1| blr2879
[Bradyrhizobium japonicum USDA 110]
[0234] Homologous sequences also include RNA sequences in which
uridines replace the thymines in the nucleic acid sequences. The
homologous sequences may be obtained using any of the procedures
described herein or may result from the correction of a sequencing
error. It will be appreciated that the nucleic acid sequences as
set forth herein can be represented in the traditional single
character format (see, e.g., Stryer, Lubert. Biochemistry, 3rd Ed.,
W. H Freeman & Co., New York) or in any other format which
records the identity of the nucleotides in a sequence.
[0235] Various sequence comparison programs identified herein and
known to one of skill in the art can be used for comparison of
sequences. Protein and/or nucleic acid sequence identities
(homologies) may be evaluated using any of the variety of sequence
comparison algorithms and programs known in the art. Such
algorithms and programs include, but are not limited to, TBLASTN,
BLASTP, FASTA, TFASTA, and CLUSTALW (Pearson and Lipman, Proc.
Natl. Acad. Sci. USA 85(8):2444-2448, 1988; Altschul et al., J.
Mol. Biol. 215(3):403-410, 1990; Thompson et al., Nucleic Acids
Res. 22(2):4673-4680, 1994; Higgins et al., Methods Enzymol.
266:383-402, 1996; Altschul et al., J. Mol. Biol. 215(3):403-410,
1990; Altschul et al., Nature Genetics 3:266-272, 1993).
[0236] Homology or identity can be measured using sequence analysis
software (e.g., Sequence Analysis Software Package of the Genetics
Computer Group, University of Wisconsin Biotechnology Center, 1710
University Avenue, Madison, Wis. 53705). Such software matches
similar sequences by assigning degrees of homology to various
deletions, substitutions and other modifications. The terms
"homology" and "identity" in the context of two or more nucleic
acids or polypeptide sequences, refer to two or more sequences or
subsequences that are the same or have a specified percentage of
amino acid residues or nucleotides that are the same when compared
and aligned for maximum correspondence over a comparison window or
designated region as measured using any number of sequence
comparison algorithms or by manual alignment and visual inspection.
For sequence comparison, one sequence can act as a reference
sequence (e.g., an exemplary nucleic acid or polypeptide sequence
as provided herein) to which test sequences are compared. When
using a sequence comparison algorithm, test and reference sequences
are entered into a computer, subsequence coordinates are
designated, if necessary, and sequence algorithm program parameters
are designated. Default program parameters can be used, or
alternative parameters can be designated. The sequence comparison
algorithm then calculates the percent sequence identities for the
test sequences relative to the reference sequence, based on the
program parameters.
[0237] A "comparison window", as used herein, includes reference to
a segment of any one of the numbers of contiguous residues. For
example, in alternative aspects as provided herein, contiguous
residues ranging anywhere from 20 to the full length of an
exemplary polypeptide or nucleic acid sequence, are compared to a
reference sequence of the same number of contiguous positions after
the two sequences are optimally aligned. If the reference sequence
has the requisite sequence identity to an exemplary polypeptide or
nucleic acid sequence, e.g., in alternative aspects, 50%, 51%, 52%,
53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%,
66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%,
79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or complete (100%)
sequence identity to an exemplary polypeptide or nucleic acid
sequence as provided herein, that sequence is within the scope as
provided herein. In alternative embodiments, subsequences ranging
from about 20 to 600, about 50 to 200, and about 100 to 150 are
compared to a reference sequence of the same number of contiguous
positions after the two sequences are optimally aligned. Methods of
alignment of sequence for comparison are well known in the art.
Optimal alignment of sequences for comparison can be conducted,
e.g., by the local homology algorithm of Smith & Waterman, Adv.
Appl. Math. 2:482, 1981, by the homology alignment algorithm of
Needleman & Wunsch, J. Mol. Biol. 48:443, 1970, by the search
for similarity method of person & Lipman, Proc. Nat'l. Acad.
Sci. USA 85:2444, 1988, by computerized implementations of these
algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin
Genetics Software Package, Genetics Computer Group, 575 Science
Dr., Madison, Wis.), or by manual alignment and visual inspection.
Other algorithms for determining homology or identity include, for
example, in addition to a BLAST program (Basic Local Alignment
Search Tool at the National Center for Biological Information),
ALIGN, AMAS (Analysis of Multiply Aligned Sequences), AMPS (Protein
Multiple Sequence Alignment), ASSET (Aligned Segment Statistical
Evaluation Tool), BANDS, BESTSCOR, BIOSCAN (Biological Sequence
Comparative Analysis Node), BLIMPS (BLocks IMProved Searcher),
FASTA, Intervals & Points, BMB, CLUSTAL V, CLUSTAL W,
CONSENSUS, LCONSENSUS, WCONSENSUS, Smith-Waterman algorithm,
DARWIN, Las Vegas algorithm, FNAT (Forced Nucleotide Alignment
Tool), Framealign, Framesearch, DYNAMIC, FILTER, FSAP (Fristensky
Sequence Analysis Package), GAP (Global Alignment Program), GENAL,
GIBBS, GenQuest, ISSC (Sensitive Sequence Comparison), LALIGN
(Local Sequence Alignment), LCP (Local Content Program), MACAW
(Multiple Alignment Construction & Analysis Workbench), MAP
(Multiple Alignment Program), MBLKP, MBLKN, PIMA (Pattern-Induced
Multi-sequence Alignment), SAGA (Sequence Alignment by Genetic
Algorithm) and WHAT-IF. Such alignment programs can also be used to
screen genome databases to identify polynucleotide sequences having
substantially identical sequences. A number of genome databases are
available, for example, a substantial portion of the human genome
is available as part of the Human Genome Sequencing Project (Gibbs,
1995). Several genomes have been sequenced, e.g., M. genitalium
(Fraser et al., 1995), M. jannaschii (Bult et al., 1996), H.
influenzae (Fleischmann et al., 1995), E. coli (Blattner et al.,
1997), and yeast (S. cerevisiae) (Mewes et al., 1997), and D.
melanogaster (Adams et al., 2000). Significant progress has also
been made in sequencing the genomes of model organisms, such as
mouse, C. elegans, and Arabadopsis sp. Databases containing genomic
information annotated with some functional information are
maintained by different organizations, and are accessible via the
internet.
[0238] BLAST, BLAST 2.0 and BLAST 2.2.2 algorithms are also used.
They are described, e.g., in Altschul (1977) Nuc. Acids Res.
25:3389-3402; Altschul (1990) J. Mol. Biol. 215:403-410. Software
for performing BLAST analyses is publicly available through the
National Center for Biotechnology Information. This algorithm
involves first identifying high scoring sequence pairs (HSPs) by
identifying short words of length W in the query sequence, which
either match or satisfy some positive-valued threshold score T when
aligned with a word of the same length in a database sequence. T is
referred to as the neighborhood word score threshold (Altschul
(1990) supra). These initial neighborhood word hits act as seeds
for initiating searches to find longer HSPs containing them. The
word hits are extended in both directions along each sequence for
as far as the cumulative alignment score can be increased.
Cumulative scores are calculated using, for nucleotide sequences,
the parameters M (reward score for a pair of matching residues;
always >0). For amino acid sequences, a scoring matrix is used
to calculate the cumulative score. Extension of the word hits in
each direction are halted when: the cumulative alignment score
falls off by the quantity X from its maximum achieved value; the
cumulative score goes to zero or below, due to the accumulation of
one or more negative-scoring residue alignments; or the end of
either sequence is reached. The BLAST algorithm parameters W, T,
and X determine the sensitivity and speed of the alignment. The
BLASTN program (for nucleotide sequences) uses as defaults a
wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4 and a
comparison of both strands. For amino acid sequences, the BLASTP
program uses as defaults a wordlength of 3, and expectations (E) of
10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff
(1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50,
expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
The BLAST algorithm also performs a statistical analysis of the
similarity between two sequences (see, e.g., Karlin & Altschul
(1993) Proc. Natl. Acad. Sci. USA 90:5873). One measure of
similarity provided by BLAST algorithm is the smallest sum
probability (P(N)), which provides an indication of the probability
by which a match between two nucleotide or amino acid sequences
would occur by chance. For example, a nucleic acid is considered
similar to a reference sequence if the smallest sum probability in
a comparison of the test nucleic acid to the reference nucleic acid
is less than about 0.2, or alternatively, less than about 0.01, or
alternatively,less than about 0.001.
[0239] In one aspect, protein and nucleic acid sequence homologies
are evaluated using the Basic Local Alignment Search Tool
("BLAST"). For example, five specific BLAST programs can be used to
perform the following task: (1) BLASTP and BLAST3 compare an amino
acid query sequence against a protein sequence database; (2) BLASTN
compares a nucleotide query sequence against a nucleotide sequence
database; (3) BLASTX compares the six-frame conceptual translation
products of a query nucleotide sequence (both strands) against a
protein sequence database; (4) TBLASTN compares a query protein
sequence against a nucleotide sequence database translated in all
six reading frames (both strands); and, (5) TBLASTX compares the
six-frame translations of a nucleotide query sequence against the
six-frame translations of a nucleotide sequence database.
[0240] In one aspect, the BLAST programs identify homologous
sequences by identifying similar segments, which are referred to
herein as "high-scoring segment pairs," between a query amino or
nucleic acid sequence and a test sequence which is alternatively
obtained from a protein or nucleic acid sequence database.
High-scoring segment pairs can be alternatively identified (i.e.,
aligned) by means of a scoring matrix, many of which are known in
the art. In one aspect, the scoring matrix used is the BLOSUM62
matrix (Gonnet et al., Science 256:1443-1445, 1992; Henikoff and
Henikoff, Proteins 17:49-61, 1993). In one aspect, the PAM or
PAM250 matrices may also be used (see, e.g., Schwartz and Dayhoff,
eds., 1978, Matrices for Detecting Distance Relationships: Atlas of
Protein Sequence and Structure, Washington: National Biomedical
Research Foundation).
[0241] In one aspect, to determine if a nucleic acid has the
requisite sequence identity to be within the scope as provided
herein, the NCBI BLAST 2.2.2 programs is used, default options to
blastp. There are about 38 setting options in the BLAST 2.2.2
program. In this exemplary aspect as provided herein, all default
values are used except for the default filtering setting (i.e., all
parameters set to default except filtering which is set to OFF); in
its place a "-F F" setting is used, which disables filtering. Use
of default filtering often results in Karlin-Altschul violations
due to short length of sequence.
[0242] The default values used in this exemplary aspect as provided
herein, include:
[0243] "Filter for low complexity: ON
[0244] Word Size: 3
[0245] Matrix: Blosum62
[0246] Gap Costs: Existence:11
[0247] Extension:1"
[0248] Other default settings are: filter for low complexity OFF,
word size of 3 for protein, BLOSUM62 matrix, gap existence penalty
of -11 and a gap extension penalty of -1. In one aspect, the "-W"
option defaults to 0. This means that, if not set, the word size
defaults to 3 for proteins and 11 for nucleotides.
Computer Systems and Computer Program Products
[0249] To determine and identify sequence identities, structural
homologies, motifs and the like in silico, the sequence as provided
herein can be stored, recorded, and manipulated on any medium which
can be read and accessed by a computer. In certain embodiments,
provided herein are computers, computer systems, computer readable
media, computer program products and the like, containing therein
(comprising) nucleic acid and polypeptide sequences as provided
herein recorded or stored thereon. As used herein, the words
"recorded" and "stored" refer to a process for storing information
on a computer medium. A skilled artisan can readily adopt any known
methods for recording information on a computer readable medium to
generate manufactures comprising one or more of the nucleic acid
and/or polypeptide sequences as provided herein.
[0250] Another aspect as provided herein is a computer readable
medium having recorded thereon at least one nucleic acid and/or
polypeptide sequence as provided herein. Computer readable media
include magnetically readable media, optically readable media,
electronically readable media and magnetic/optical media. For
example, the computer readable media may be a hard disk, a floppy
disk, a magnetic tape, CD-ROM, Digital Versatile Disk (DVD), Random
Access Memory (RAM), or Read Only Memory (ROM) as well as other
types of other media known to those skilled in the art.
[0251] Aspects as provided herein include systems (e.g., internet
based systems), particularly computer systems, which store and
manipulate the sequences and sequence information described herein.
One example of a computer system 100 is illustrated in block
diagram form in FIG. 1. As used herein, "a computer system" refers
to the hardware components, software components, and data storage
components used to analyze a nucleotide or polypeptide sequence as
provided herein. The computer system 100 can include a processor
for processing, accessing and manipulating the sequence data. The
processor 105 can be any well-known type of central processing
unit, such as, for example, the Pentium III from Intel Corporation,
or similar processor from Sun, Motorola, Compaq, AMD or
International Business Machines. The computer system 100 is a
general purpose system that comprises the processor 105 and one or
more internal data storage components 110 for storing data, and one
or more data retrieving devices for retrieving the data stored on
the data storage components. A skilled artisan can readily
appreciate that any one of the currently available computer systems
are suitable.
[0252] In one aspect, the computer system 100 includes a processor
105 connected to a bus which is connected to a main memory 115
(alternatively implemented as RAM) and one or more internal data
storage devices 110, such as a hard drive and/or other computer
readable media having data recorded thereon. The computer system
100 can further include one or more data retrieving device 118 for
reading the data stored on the internal data storage devices 110.
The data retrieving device 118 may represent, for example, a floppy
disk drive, a compact disk drive, a magnetic tape drive, or a modem
capable of connection to a remote data storage system (e.g., via
the internet) etc. In some embodiments, the internal data storage
device 110 is a removable computer readable medium such as a floppy
disk, a compact disk, a magnetic tape, etc. containing control
logic and/or data recorded thereon. The computer system 100 may
advantageously include or be programmed by appropriate software for
reading the control logic and/or the data from the data storage
component once inserted in the data retrieving device. The computer
system 100 includes a display 120 which is used to display output
to a computer user. It should also be noted that the computer
system 100 can be linked to other computer systems 125a-c in a
network or wide area network to provide centralized access to the
computer system 100. Software for accessing and processing the
nucleotide or amino acid sequences as provided herein can reside in
main memory 115 during execution. In some aspects, the computer
system 100 may further comprise a sequence comparison algorithm for
comparing a nucleic acid sequence as provided herein. The algorithm
and sequence(s) can be stored on a computer readable medium. A
"sequence comparison algorithm" refers to one or more programs
which are implemented (locally or remotely) on the computer system
100 to compare a nucleotide sequence with other nucleotide
sequences and/or compounds stored within a data storage means. For
example, the sequence comparison algorithm may compare the
nucleotide sequences as provided herein stored on a computer
readable medium to reference sequences stored on a computer
readable medium to identify homologies or structural motifs.
[0253] The parameters used with the above algorithms may be adapted
depending on the sequence length and degree of homology studied. In
some aspects, the parameters may be the default parameters used by
the algorithms in the absence of instructions from the user. FIG. 2
is a flow diagram illustrating one aspect of a process 200 for
comparing a new nucleotide or protein sequence with a database of
sequences in order to determine the homology levels between the new
sequence and the sequences in the database. The database of
sequences can be a private database stored within the computer
system 100, or a public database such as GENBANK that is available
through the Internet. The process 200 begins at a start state 201
and then moves to a state 202 wherein the new sequence to be
compared is stored to a memory in a computer system 100. As
discussed above, the memory could be any type of memory, including
RAM or an internal storage device. The process 200 then moves to a
state 204 wherein a database of sequences is opened for analysis
and comparison. The process 200 then moves to a state 206 wherein
the first sequence stored in the database is read into a memory on
the computer. A comparison is then performed at a state 210 to
determine if the first sequence is the same as the second sequence.
It is important to note that this step is not limited to performing
an exact comparison between the new sequence and the first sequence
in the database. Well-known methods are known to those of skill in
the art for comparing two nucleotide or protein sequences, even if
they are not identical. For example, gaps can be introduced into
one sequence in order to raise the homology level between the two
tested sequences. The parameters that control whether gaps or other
features are introduced into a sequence during comparison are
normally entered by the user of the computer system. Once a
comparison of the two sequences has been performed at the state
210, a determination is made at a decision state 210 whether the
two sequences are the same. Of course, the term "same" is not
limited to sequences that are absolutely identical. Sequences that
are within the homology parameters entered by the user will be
marked as "same" in the process 200. If a determination is made
that the two sequences are the same, the process 200 moves to a
state 214 wherein the name of the sequence from the database is
displayed to the user. This state notifies the user that the
sequence with the displayed name fulfills the homology constraints
that were entered. Once the name of the stored sequence is
displayed to the user, the process 200 moves to a decision state
218 wherein a determination is made whether more sequences exist in
the database. If no more sequences exist in the database, then the
process 200 terminates at an end state 220. However, if more
sequences do exist in the database, then the process 200 moves to a
state 224 wherein a pointer is moved to the next sequence in the
database so that it can be compared to the new sequence. In this
manner, the new sequence is aligned and compared with every
sequence in the database. It should be noted that if a
determination had been made at the decision state 212 that the
sequences were not homologous, then the process 200 would move
immediately to the decision state 218 in order to determine if any
other sequences were available in the database for comparison.
Accordingly, one aspect as provided herein is a computer system
comprising a processor, a data storage device having stored thereon
a nucleic acid sequence as provided herein and a sequence comparer
for conducting the comparison. The sequence comparer may indicate a
homology level between the sequences compared or identify
structural motifs, or it may identify structural motifs in
sequences which are compared to these nucleic acid codes and
polypeptide codes. FIG. 3 is a flow diagram illustrating one
embodiment of a process 250 in a computer for determining whether
two sequences are homologous. The process 250 begins at a start
state 252 and then moves to a state 254 wherein a first sequence to
be compared is stored to a memory. The second sequence to be
compared is then stored to a memory at a state 256. The process 250
then moves to a state 260 wherein the first character in the first
sequence is read and then to a state 262 wherein the first
character of the second sequence is read. It should be understood
that if the sequence is a nucleotide sequence, then the character
would normally be either A, T, C, G or U. If the sequence is a
protein sequence, then it can be a single letter amino acid code so
that the first and sequence sequences can be easily compared. A
determination is then made at a decision state 264 whether the two
characters are the same. If they are the same, then the process 250
moves to a state 268 wherein the next characters in the first and
second sequences are read. A determination is then made whether the
next characters are the same. If they are, then the process 250
continues this loop until two characters are not the same. If a
determination is made that the next two characters are not the
same, the process 250 moves to a decision state 274 to determine
whether there are any more characters either sequence to read. If
there are not any more characters to read, then the process 250
moves to a state 276 wherein the level of homology between the
first and second sequences is displayed to the user. The level of
homology is determined by calculating the proportion of characters
between the sequences that were the same out of the total number of
sequences in the first sequence. Thus, if every character in a
first 100 nucleotide sequence aligned with an every character in a
second sequence, the homology level would be 100%.
[0254] Alternatively, the computer program can compare a reference
sequence to a sequence as provided herein to determine whether the
sequences differ at one or more positions. The program can record
the length and identity of inserted, deleted or substituted
nucleotides or amino acid residues with respect to the sequence of
either the reference or a sequence as provided herein. The computer
program may be a program which determines whether a reference
sequence contains a single nucleotide polymorphism (SNP) with
respect to a sequence as provided herein, or, whether a sequence as
provided herein comprises a SNP of a known sequence. Thus, in some
aspects, the computer program is a program which identifies SNPs.
The method may be implemented by the computer systems described
above and the method illustrated in FIG. 3. The method can be
performed by reading a sequence as provided herein and the
reference sequences through the use of the computer program and
identifying differences with the computer program.
[0255] In other aspects the computer based system comprises an
identifier for identifying features within a nucleic acid or
polypeptide as provided herein. An "identifier" refers to one or
more programs which identifies certain features within a nucleic
acid sequence. For example, an identifier may comprise a program
which identifies an open reading frame (ORF) in a nucleic acid
sequence. FIG. 4 is a flow diagram illustrating one aspect of an
identifier process 300 for detecting the presence of a feature in a
sequence. The process 300 begins at a start state 302 and then
moves to a state 304 wherein a first sequence that is to be checked
for features is stored to a memory 115 in the computer system 100.
The process 300 then moves to a state 306 wherein a database of
sequence features is opened. Such a database would include a list
of each feature's attributes along with the name of the feature.
For example, a feature name could be "Initiation Codon" and the
attribute would be "ATG". Another example would be the feature name
"TAATAA Box" and the feature attribute would be "TAATAA". An
example of such a database is produced by the University of
Wisconsin Genetics Computer Group. Alternatively, the features may
be structural polypeptide motifs such as alpha helices, beta
sheets, or functional polypeptide motifs such as enzymatic active
sites, helix-turn-helix motifs or other motifs known to those
skilled in the art. Once the database of features is opened at the
state 306, the process 300 moves to a state 308 wherein the first
feature is read from the database. A comparison of the attribute of
the first feature with the first sequence is then made at a state
310. A determination is then made at a decision state 316 whether
the attribute of the feature was found in the first sequence. If
the attribute was found, then the process 300 moves to a state 318
wherein the name of the found feature is displayed to the user. The
process 300 then moves to a decision state 320 wherein a
determination is made whether move features exist in the database.
If no more features do exist, then the process 300 terminates at an
end state 324. However, if more features do exist in the database,
then the process 300 reads the next sequence feature at a state 326
and loops back to the state 310 wherein the attribute of the next
feature is compared against the first sequence. If the feature
attribute is not found in the first sequence at the decision state
316, the process 300 moves directly to the decision state 320 in
order to determine if any more features exist in the database.
Thus, in one aspect, a computer program that identifies open
reading frames (ORFs).
[0256] A polypeptide or nucleic acid sequence as provided herein
may be stored and manipulated in a variety of data processor
programs in a variety of formats. For example, a sequence can be
stored as text in a word processing file, such as MICROSOFTWORD.TM.
or WORDPERFECT.TM. or as an ASCII file in a variety of database
programs familiar to those of skill in the art, such as DB2,
SYBASE, or ORACLE.TM.. In addition, many computer programs and
databases may be used as sequence comparison algorithms,
identifiers, or sources of reference nucleotide sequences or
polypeptide sequences to be compared to a nucleic acid sequence as
provided herein. The programs and databases can comprise:
MACPATTERN.TM. (EMBL), DISCOVERYBASE.TM. (Molecular Applications
Group), GENEMINE.TM. (Molecular Applications Group), LOOK.TM.
(Molecular Applications Group), MACLOOK.TM. (Molecular Applications
Group), BLAST and BLAST2 (NCBI), BLASTN and BLASTX (Altschul et al,
J. Mol. Biol. 215: 403, 1990), FASTA (Pearson and Lipman, Proc.
Natl. Acad. Sci. USA, 85: 2444, 1988), FASTDB.TM. (Brutlag et al.
Comp. App. Biosci. 6:237-245, 1990), CATALYST.TM. (Molecular
Simulations Inc.), CATALYST.TM./SHAPE.TM. (Molecular Simulations
Inc.), CERIUS2.DBACCESS.TM. (Molecular Simulations Inc.),
HYPOGEN.TM. (Molecular Simulations Inc.), Insight II, (Molecular
Simulations Inc.), DISCOVER.TM. (Molecular Simulations Inc.),
CHARMm.TM. (Molecular Simulations Inc.), FELIX.TM. (Molecular
Simulations Inc.), DELPHI.TM.s (Molecular Simulations Inc.),
QUANTEMM.TM., (Molecular Simulations Inc.), HOMOLOGY.TM. (Molecular
Simulations Inc.), MODELER.TM. (Molecular Simulations Inc.),
ISIS.TM. (Molecular Simulations Inc.), Quanta/Protein Design
(Molecular Simulations Inc.), WEBLAB.TM. (Molecular Simulations
Inc.), WEBLAB.TM. Diversity Explorer (Molecular Simulations Inc.),
GENE EXPLORER.TM. (Molecular Simulations Inc.), SEQFOLD.TM.
(Molecular Simulations Inc.), the MDL Available Chemicals Directory
database, the MDL Drug Data Report data base, the Comprehensive
Medicinal Chemistry database, Derwent's World Drug Index database,
the BioByteMasterFile database, the Genbank database, and the
Genseqn database. Many other programs and data bases would be
apparent to one of skill in the art given the present
disclosure.
[0257] Motifs which may be detected using the above programs
include sequences encoding leucine zippers, helix-turn-helix
motifs, glycosylation sites, ubiquitination sites, alpha helices,
and beta sheets, signal sequences encoding signal peptides which
direct the secretion of the encoded proteins, sequences implicated
in transcription regulation such as homeoboxes, acidic stretches,
enzymatic active sites, substrate binding sites, and enzymatic
cleavage sites.
Hybridization of Nucleic Acids
[0258] In certain embodiments, provided herein are isolated,
synthetic or recombinant nucleic acids that hybridize under
stringent conditions to nucleic acid provided herein, e.g., an
exemplary sequence provided herein, e.g., a sequence as set forth
in SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9,
SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, or SEQ ID
NO:19 or SEQ ID NO:1 modified to encode one, two, three, four,
five, six, seven, eight or more (several) or all the base
variations described in Table 3 or Table 4, or the equivalent
thereof, and subsequences and complementary sequences thereof, or a
nucleic acid that encodes a polypeptide as provided herein. The
stringent conditions can be highly stringent conditions, medium
stringency conditions, low stringency conditions, including the
high and reduced stringency conditions described herein.
[0259] "Hybridization" refers to the process by which a nucleic
acid strand joins with a complementary strand through base pairing.
Hybridization reactions can be sensitive and selective so that a
particular sequence of interest can be identified even in samples
in which it is present at low concentrations. Stringent conditions
can be defined by, for example, the concentrations of salt or
formamide in the prehybridization and hybridization solutions, or
by the hybridization temperature, and are well known in the art.
For example, stringency can be increased by reducing the
concentration of salt, increasing the concentration of formamide,
or raising the hybridization temperature, altering the time of
hybridization, as described in detail, below. In alternative
aspects, nucleic acids as provided herein are defined by their
ability to hybridize under various stringency conditions (e.g.,
high, medium, and low), as set forth herein.
[0260] In alternative embodiments, nucleic acids as provided herein
as defined by their ability to hybridize under stringent conditions
can be between about five residues and the full length of nucleic
acid as provided herein; e.g., they can be at least 5, 10, 15, 20,
25, 30, 35, 40, 50, 55, 60, 65, 70, 75, 80, 90, 100, 150, 200, 250,
300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900,
950, 1000, or more, residues in length. Nucleic acids shorter than
full length are also included. These nucleic acids can be useful
as, e.g., hybridization probes, labeling probes, PCR
oligonucleotide probes, iRNA, antisense or sequences encoding
antibody binding peptides (epitopes), motifs, active sites and the
like.
[0261] In one aspect, nucleic acids as provided herein are defined
by their ability to hybridize under high stringency comprises
conditions of about 50% formamide at about 37.degree. C. to
42.degree. C. In one aspect, nucleic acids as provided herein are
defined by their ability to hybridize under reduced stringency
comprising conditions in about 35% to 25% formamide at about
30.degree. C. to 35.degree. C.
[0262] Alternatively, nucleic acids as provided herein are defined
by their ability to hybridize under high stringency comprising
conditions at 42.degree. C. in 50% formamide, 5.times.SSPE, 0.3%
SDS, and a repetitive sequence blocking nucleic acid, such as cot-1
or salmon sperm DNA (e.g., 200 ug/ml sheared and denatured salmon
sperm DNA). In one aspect, nucleic acids as provided herein are
defined by their ability to hybridize under reduced stringency
conditions comprising 35% formamide at a reduced temperature of
35.degree. C.
[0263] Following hybridization, the filter may be washed with
6.times.SSC, 0.5% SDS at 50.degree. C. These conditions are
considered to be "moderate" conditions above 25% formamide and
"low" conditions below 25% formamide. A specific example of
"moderate" hybridization conditions is when the above hybridization
is conducted at 30% formamide. A specific example of "low
stringency" hybridization conditions is when the above
hybridization is conducted at 10% formamide.
[0264] The temperature range corresponding to a particular level of
stringency can be further narrowed by calculating the purine to
pyrimidine ratio of the nucleic acid of interest and adjusting the
temperature accordingly. Nucleic acids as provided herein are also
defined by their ability to hybridize under high, medium, and low
stringency conditions as set forth in Ausubel and Sambrook.
Variations on the above ranges and conditions are well known in the
art. Hybridization conditions are discussed further, below.
[0265] The above procedure may be modified to identify nucleic
acids having decreasing levels of homology to the probe sequence.
For example, to obtain nucleic acids of decreasing homology to the
detectable probe, less stringent conditions may be used. For
example, the hybridization temperature may be decreased in
increments of 5.degree. C. from 68.degree. C. to 42.degree. C. in a
hybridization buffer having a Na concentration of approximately 1M.
Following hybridization, the filter may be washed with 2.times.SSC,
0.5% SDS at the temperature of hybridization. These conditions are
considered to be "moderate" conditions above 50.degree. C. and
"low" conditions below 50.degree. C. A specific example of
"moderate" hybridization conditions is when the above hybridization
is conducted at 55.degree. C. A specific example of "low
stringency" hybridization conditions is when the above
hybridization is conducted at 45.degree. C.
[0266] Alternatively, the hybridization may be carried out in
buffers, such as 6.times.SSC, containing formamide at a temperature
of 42.degree. C. In this case, the concentration of formamide in
the hybridization buffer may be reduced in 5% increments from 50%
to 0% to identify clones having decreasing levels of homology to
the probe. Following hybridization, the filter may be washed with
6.times.SSC, 0.5% SDS at 50.degree. C. These conditions are
considered to be "moderate" conditions above 25% formamide and
"low" conditions below 25% formamide. A specific example of
"moderate" hybridization conditions is when the above hybridization
is conducted at 30% formamide. A specific example of "low
stringency" hybridization conditions is when the above
hybridization is conducted at 10% formamide.
[0267] However, the selection of a hybridization format is not
critical--it is the stringency of the wash conditions that set
forth the conditions which determine whether a nucleic acid is
within the scope as provided herein. Wash conditions used to
identify nucleic acids within the scope as provided herein include,
e.g.: a salt concentration of about 0.02 molar at pH 7 and a
temperature of at least about 50.degree. C. or about 55.degree. C.
to about 60.degree. C.; or, a salt concentration of about 0.15 M
NaCl at 72.degree. C. for about 15 minutes; or, a salt
concentration of about 0.2.times.SSC at a temperature of at least
about 50.degree. C. or about 55.degree. C. to about 60.degree. C.
for about 15 to about 20 minutes; or, the hybridization complex is
washed twice with a solution with a salt concentration of about
2.times.SSC containing 0.1% SDS at room temperature for 15 minutes
and then washed twice by 0.1.times.SSC containing 0.1% SDS at
68.degree. C. for 15 minutes; or, equivalent conditions. See
Sambrook, Tijssen and Ausubel for a description of SSC buffer and
equivalent conditions.
[0268] These methods may be used to isolate nucleic acids as
provided herein.
Oligonucleotides Probes and Methods for Using Them
[0269] In certain embodiments, provided herein are nucleic acid
probes for identifying nucleic acids encoding a polypeptide with a
hydrolase activity, e.g., lipase, saturase, palmitase and/or
stearatase activity. In one aspect, the probe comprises at least 10
consecutive bases of a nucleic acid as provided herein.
Alternatively, a probe as provided herein can be at least about 5,
6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90,
100, 110, 120, 130, 150, 160, 170, 180, 190, 200 or more, or about
10 to 50, about 20 to 60 about 30 to 70, consecutive bases of a
sequence as set forth in a nucleic acid as provided herein. The
probes identify a nucleic acid by binding and/or hybridization. The
probes can be used in arrays as provided herein, see discussion
below, including, e.g., capillary arrays. The probes as provided
herein can also be used to isolate other nucleic acids or
polypeptides.
[0270] The probes as provided herein can be used to determine
whether a biological sample, such as a soil sample, contains an
organism having a nucleic acid sequence as provided herein (e.g., a
hydrolase-encoding nucleic acid) or an organism from which the
nucleic acid was obtained. In such procedures, a biological sample
potentially harboring the organism from which the nucleic acid was
isolated is obtained and nucleic acids are obtained from the
sample. The nucleic acids are contacted with the probe under
conditions which permit the probe to specifically hybridize to any
complementary sequences present in the sample. Where necessary,
conditions which permit the probe to specifically hybridize to
complementary sequences may be determined by placing the probe in
contact with complementary sequences from samples known to contain
the complementary sequence, as well as control sequences which do
not contain the complementary sequence. Hybridization conditions,
such as the salt concentration of the hybridization buffer, the
formamide concentration of the hybridization buffer, or the
hybridization temperature, may be varied to identify conditions
which allow the probe to hybridize specifically to complementary
nucleic acids (see discussion on specific hybridization
conditions).
[0271] If the sample contains the organism from which the nucleic
acid was isolated, specific hybridization of the probe is then
detected. Hybridization may be detected by labeling the probe with
a detectable agent such as a radioactive isotope, a fluorescent dye
or an enzyme capable of catalyzing the formation of a detectable
product. Many methods for using the labeled probes to detect the
presence of complementary nucleic acids in a sample are familiar to
those skilled in the art. These include Southern Blots, Northern
Blots, colony hybridization procedures, and dot blots. Protocols
for each of these procedures are provided in Ausubel and
Sambrook.
[0272] Alternatively, more than one probe (at least one of which is
capable of specifically hybridizing to any complementary sequences
which are present in the nucleic acid sample), may be used in an
amplification reaction to determine whether the sample contains an
organism containing a nucleic acid sequence as provided herein
(e.g., an organism from which the nucleic acid was isolated). In
one aspect, the probes comprise oligonucleotides. In one aspect,
the amplification reaction may comprise a PCR reaction. PCR
protocols are described in Ausubel and Sambrook (see discussion on
amplification reactions). In such procedures, the nucleic acids in
the sample are contacted with the probes, the amplification
reaction is performed, and any resulting amplification product is
detected. The amplification product may be detected by performing
gel electrophoresis on the reaction products and staining the gel
with an intercalator such as ethidium bromide. Alternatively, one
or more of the probes may be labeled with a radioactive isotope and
the presence of a radioactive amplification product may be detected
by autoradiography after gel electrophoresis.
[0273] Probes derived from sequences near the 3' or 5' ends of a
nucleic acid sequence as provided herein can also be used in
chromosome walking procedures to identify clones containing
additional, e.g., genomic sequences. Such methods allow the
isolation of genes which encode additional proteins of interest
from the host organism.
[0274] In one aspect, nucleic acid sequences as provided herein are
used as probes to identify and isolate related nucleic acids. In
some aspects, the so-identified related nucleic acids may be cDNAs
or genomic DNAs from organisms other than the one from which the
nucleic acid as provided herein was first isolated. In such
procedures, a nucleic acid sample is contacted with the probe under
conditions which permit the probe to specifically hybridize to
related sequences. Hybridization of the probe to nucleic acids from
the related organism is then detected using any of the methods
described above.
[0275] In nucleic acid hybridization reactions, the conditions used
to achieve a particular level of stringency will vary, depending on
the nature of the nucleic acids being hybridized. For example, the
length, degree of complementarity, nucleotide sequence composition
(e.g., GC v. AT content), and nucleic acid type (e.g., RNA v. DNA)
of the hybridizing regions of the nucleic acids can be considered
in selecting hybridization conditions. An additional consideration
is whether one of the nucleic acids is immobilized, for example, on
a filter. Hybridization may be carried out under conditions of low
stringency, moderate stringency or high stringency. As an example
of nucleic acid hybridization, a polymer membrane containing
immobilized denatured nucleic acids is first prehybridized for 30
minutes at 45.degree. C. in a solution consisting of 0.9 M NaCl, 50
mM NaH.sub.2PO.sub.4, pH 7.0, 5.0 mM Na.sub.2EDTA, 0.5% SDS,
10.times. Denhardt's, and 0.5 mg/ml polyriboadenylic acid.
Approximately 2.times.10.sup.7 cpm (specific activity
4.times.9.times.10.sup.8 cpm/ug) of .sup.32P end-labeled
oligonucleotide probe are then added to the solution. After 12-16
hours of incubation, the membrane is washed for 30 minutes at room
temperature (RT) in 1.times. SET (150 mM NaCl, 20 mM Tris
hydrochloride, pH 7.8, 1 mM Na.sub.2EDTA) containing 0.5% SDS,
followed by a 30 minute wash in fresh 1.times. SET at Tm-10.degree.
C. for the oligonucleotide probe. The membrane is then exposed to
auto-radiographic film for detection of hybridization signals.
[0276] By varying the stringency of the hybridization conditions
used to identify nucleic acids, such as cDNAs or genomic DNAs,
which hybridize to the detectable probe, nucleic acids having
different levels of homology to the probe can be identified and
isolated. Stringency may be varied by conducting the hybridization
at varying temperatures below the melting temperatures of the
probes. The melting temperature, Tm, is the temperature (under
defined ionic strength and pH) at which 50% of the target sequence
hybridizes to a perfectly complementary probe. Very stringent
conditions are selected to be equal to or about 5.degree. C. lower
than the Tm for a particular probe. The melting temperature of the
probe may be calculated using the following exemplary formulas. For
probes between 14 and 70 nucleotides in length the melting
temperature (Tm) is calculated using the formula: Tm=81.5+16.6(log
[Na+])+0.41(fraction G+C)-(600/N) where N is the length of the
probe. If the hybridization is carried out in a solution containing
formamide, the melting temperature may be calculated using the
equation: Tm=81.5+16.6(log [Na+])+0.41(fraction G+C)-(0.63%
formamide)-(600/N) where N is the length of the probe.
Prehybridization may be carried out in 6.times.SSC, 5.times.
Denhardt's reagent, 0.5% SDS, 100 .mu.g denatured fragmented salmon
sperm DNA or 6.times.SSC, 5.times. Denhardt's reagent, 0.5% SDS,
100 .mu.g denatured fragmented salmon sperm DNA, 50% formamide.
Formulas for SSC and Denhardt's and other solutions are listed,
e.g., in Sambrook.
[0277] In one aspect, hybridization is conducted by adding the
detectable probe to the prehybridization solutions listed above.
Where the probe comprises double stranded DNA, it is denatured
before addition to the hybridization solution. The filter is
contacted with the hybridization solution for a sufficient period
of time to allow the probe to hybridize to cDNAs or genomic DNAs
containing sequences complementary thereto or homologous thereto.
For probes over 200 nucleotides in length, the hybridization may be
carried out at 15-25.degree. C. below the Tm. For shorter probes,
such as oligonucleotide probes, the hybridization may be conducted
at 5-10.degree. C. below the Tm. In one aspect, hybridizations in
6.times.SSC are conducted at approximately 68.degree. C. In one
aspect, hybridizations in 50% formamide containing solutions are
conducted at approximately 42.degree. C. All of the foregoing
hybridizations would be considered to be under conditions of high
stringency.
[0278] In one aspect, following hybridization, the filter is washed
to remove any non-specifically bound detectable probe. The
stringency used to wash the filters can also be varied depending on
the nature of the nucleic acids being hybridized, the length of the
nucleic acids being hybridized, the degree of complementarity, the
nucleotide sequence composition (e.g., GC v. AT content), and the
nucleic acid type (e.g., RNA v. DNA). Examples of progressively
higher stringency condition washes are as follows: 2.times.SSC,
0.1% SDS at room temperature for 15 minutes (low stringency);
0.1.times.SSC, 0.5% SDS at room temperature for 30 minutes to 1
hour (moderate stringency); 0.1.times.SSC, 0.5% SDS for 15 to 30
minutes at between the hybridization temperature and 68.degree. C.
(high stringency); and 0.15M NaCl for 15 minutes at 72.degree. C.
(very high stringency). A final low stringency wash can be
conducted in 0.1.times.SSC at room temperature. The examples above
are merely illustrative of one set of conditions that can be used
to wash filters. One of skill in the art would know that there are
numerous recipes for different stringency washes.
[0279] Nucleic acids which have hybridized to the probe can be
identified by autoradiography or other conventional techniques. The
above procedure may be modified to identify nucleic acids having
decreasing levels of homology to the probe sequence. For example,
to obtain nucleic acids of decreasing homology to the detectable
probe, less stringent conditions may be used. For example, the
hybridization temperature may be decreased in increments of
5.degree. C. from 68.degree. C. to 42.degree. C. in a hybridization
buffer having a Na+ concentration of approximately 1M. Following
hybridization, the filter may be washed with 2.times.SSC, 0.5% SDS
at the temperature of hybridization. These conditions are
considered to be "moderate" conditions above 50.degree. C. and
"low" conditions below 50.degree. C. An example of "moderate"
hybridization conditions is when the above hybridization is
conducted at 55.degree. C. An example of "low stringency"
hybridization conditions is when the above hybridization is
conducted at 45.degree. C.
[0280] Alternatively, the hybridization may be carried out in
buffers, such as 6.times.SSC, containing formamide at a temperature
of 42.degree. C. In this case, the concentration of formamide in
the hybridization buffer may be reduced in 5% increments from 50%
to 0% to identify clones having decreasing levels of homology to
the probe. Following hybridization, the filter may be washed with
6.times.SSC, 0.5% SDS at 50.degree. C. These conditions are
considered to be "moderate" conditions above 25% formamide and
"low" conditions below 25% formamide. A specific example of
"moderate" hybridization conditions is when the above hybridization
is conducted at 30% formamide. A specific example of "low
stringency" hybridization conditions is when the above
hybridization is conducted at 10% formamide.
[0281] These probes and methods as provided herein can be used to
isolate, or identify (e.g., using an array), nucleic acids having a
sequence with at least about 50%, 51%, 52%, 53%, 54%, 55%, 56%,
57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,
70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%,
83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, or more, sequence identity to a nucleic acid
sequence as provided herein comprising at least about 10, 15, 20,
25, 30, 35, 40, 50, 75, 100, 150, 200, 250, 300, 350, 400, 500,
550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, or more
consecutive bases thereof, and the sequences complementary thereto.
Homology may be measured using an alignment algorithm, as discussed
herein. For example, the homologous polynucleotides may have a
coding sequence which is a naturally occurring allelic variant of
one of the coding sequences described herein. Such allelic variants
may have a substitution, deletion or addition of one or more
nucleotides when compared to a nucleic acid as provided herein.
[0282] Additionally, the probes and methods as provided herein may
be used to isolate, or identify (e.g., using an array), nucleic
acids which encode polypeptides having at least about 50%, 51%,
52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%,
65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%,
78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence
identity (homology) to a polypeptide as provided herein comprising
at least 5, 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, or 150 or more
consecutive amino acids thereof as determined using a sequence
alignment algorithm, e.g., such as the FASTA version 3.0t78
algorithm with the default parameters, or a BLAST 2.2.2 program
with exemplary settings as set forth herein.
Inhibiting Expression of Hydrolases
[0283] In certain embodiments, provided herein are nucleic acids
complementary to (e.g., antisense sequences to) the nucleic acid
sequences as provided herein, e.g., hydrolase-encoding sequences.
Antisense sequences are capable of inhibiting the transport,
splicing or transcription of hydrolase-encoding genes. The
inhibition can be effected through the targeting of genomic DNA or
messenger RNA. The inhibition can be effected using DNA, e.g., an
inhibitory ribozyme, or an RNA, e.g., a double-stranded iRNA,
comprising a sequence as provided herein. The transcription or
function of targeted nucleic acid can be inhibited, for example, by
hybridization and/or cleavage. Provided herein are sets of
inhibitors comprising oligonucleotides capable of binding hydrolase
gene and/or message, in either case preventing or inhibiting the
production or function of hydrolase. The association can be through
sequence specific hybridization. Another useful class of inhibitors
includes oligonucleotides which cause inactivation or cleavage of
hydrolase message. The oligonucleotide can have enzyme activity
which causes such cleavage, such as ribozymes. The oligonucleotide
can be chemically modified or conjugated to an enzyme or
composition capable of cleaving the complementary nucleic acid. One
may screen a pool of many different such oligonucleotides for those
with the desired activity.
Antisense Oligonucleotides
[0284] In certain embodiments, provided herein are antisense
oligonucleotides capable of binding hydrolase message which can
inhibit hydrolase activity by targeting mRNA or genomic DNA.
Strategies for designing antisense oligonucleotides are well
described in the scientific and patent literature, and the skilled
artisan can design such hydrolase oligonucleotides using the novel
reagents as provided herein. For example, gene walking/RNA mapping
protocols to screen for effective antisense oligonucleotides are
well known in the art, see, e.g., Ho (2000) Methods Enzymol.
314:168-183, describing an RNA mapping assay, which is based on
standard molecular techniques to provide an easy and reliable
method for potent antisense sequence selection. See also Smith
(2000) Eur. J. Pharm. Sci. 11:191-198.
[0285] In one aspect, recombinantly generated, or, isolated
naturally occurring nucleic acids are used as antisense
oligonucleotides. The antisense oligonucleotides can be of any
length; for example, in alternative aspects, the antisense
oligonucleotides are between about 5 to 100, about 10 to 80, about
15 to 60, about 18 to 40. The antisense oligonucleotides can be
single stranded or double-stranded RNA or DNA. The optimal length
can be determined by routine screening. The antisense
oligonucleotides can be present at any concentration. The optimal
concentration can be determined by routine screening. A wide
variety of synthetic, non-naturally occurring nucleotide and
nucleic acid analogues are known which can address this potential
problem. For example, peptide nucleic acids (PNAs) containing
non-ionic backbones, such as N-(2-aminoethyl) glycine units can be
used. Antisense oligonucleotides having phosphorothioate linkages
can also be used, as described in WO 97/03211; WO 96/39154; Mata
(1997) Toxicol Appl Pharmacol 144:189-197; Antisense Therapeutics,
ed. Agrawal (Humana Press, Totowa, N.J., 1996). Provided herein are
antisense oligonucleotides having synthetic DNA backbone analogues,
which also can include phosphoro-dithioate, methylphosphonate,
phosphoramidate, alkyl phosphotriester, sulfamate, 3'-thioacetal,
methylene(methylimino), 3'-N-carbamate, and morpholino carbamate
nucleic acids, as described above.
[0286] Combinatorial chemistry methodology can be used to create
vast numbers of oligonucleotides that can be rapidly screened for
specific oligonucleotides that have appropriate binding affinities
and specificities toward any target, such as the sense and
antisense hydrolase sequences as provided herein (see, e.g., Gold
(1995) J. of Biol. Chem. 270:13581-13584).
Inhibitory Ribozymes
[0287] In certain embodiments, provided herein are ribozymes
capable of binding hydrolase message that can inhibit hydrolase
activity by targeting mRNA. Strategies for designing ribozymes and
selecting the hydrolase-specific antisense sequence for targeting
are well described in the scientific and patent literature, and the
skilled artisan can design such ribozymes using the novel reagents
as provided herein. Ribozymes act by binding to a target RNA
through the target RNA binding portion of a ribozyme which is held
in close proximity to an enzymatic portion of the RNA that cleaves
the target RNA. Thus, the ribozyme recognizes and binds a target
RNA through complementary basepairing, and once bound to the
correct site, acts enzymatically to cleave and inactivate the
target RNA. Cleavage of a target RNA in such a manner will destroy
its ability to direct synthesis of an encoded protein if the
cleavage occurs in the coding sequence. After a ribozyme has bound
and cleaved its RNA target, it is typically released from that RNA
and so can bind and cleave new targets repeatedly.
[0288] In some circumstances, the enzymatic nature of a ribozyme
can be advantageous over other technologies, such as antisense
technology (where a nucleic acid molecule simply binds to a nucleic
acid target to block its transcription, translation or association
with another molecule) as the effective concentration of ribozyme
necessary to effect a therapeutic treatment can be lower than that
of an antisense oligonucleotide. This potential advantage reflects
the ability of the ribozyme to act enzymatically. Thus, a single
ribozyme molecule is able to cleave many molecules of target RNA.
In addition, a ribozyme is typically a highly specific inhibitor,
with the specificity of inhibition depending not only on the base
pairing mechanism of binding, but also on the mechanism by which
the molecule inhibits the expression of the RNA to which it binds.
That is, the inhibition is caused by cleavage of the RNA target and
so specificity is defined as the ratio of the rate of cleavage of
the targeted RNA over the rate of cleavage of non-targeted RNA.
This cleavage mechanism is dependent upon factors additional to
those involved in base pairing. Thus, the specificity of action of
a ribozyme can be greater than that of antisense oligonucleotide
binding the same RNA site.
[0289] The enzymatic ribozyme RNA molecule can be formed in a
hammerhead motif, but may also be formed in the motif of a hairpin,
hepatitis delta virus, group I intron or RNase P-like RNA (in
association with an RNA guide sequence). Examples of such
hammerhead motifs are described by Rossi (1992) Aids Research and
Human Retroviruses 8:183; hairpin motifs by Hampel (1989)
Biochemistry 28:4929, and Hampel (1990) Nuc. Acids Res. 18:299; the
hepatitis delta virus motif by Perrotta (1992) Biochemistry 31:16;
the RNaseP motif by Guerrier-Takada (1983) Cell 35:849; and the
group I intron by Cech (U.S. Pat. No. 4,987,071). The recitation of
these specific motifs is not intended to be limiting; those skilled
in the art will recognize that an enzymatic RNA molecule as
provided herein can have a specific substrate binding site
complementary to one or more of the target gene RNA regions, and
has nucleotide sequence within or surrounding that substrate
binding site which imparts an RNA cleaving activity to the
molecule.
[0290] RNA Interference (RNAi)
[0291] In certain embodiments, provided herein are RNA inhibitory
molecules, so-called "RNAi" molecules, comprising a hydrolase
sequence as provided herein. The RNAi molecule can comprise a
double-stranded RNA (dsRNA) molecule, e.g., siRNA and/or miRNA. The
RNAi can inhibit expression of a hydrolase (e.g., lipase, saturase,
palmitase and/or stearatase) gene or transcript. In one aspect, the
RNAi molecule, e.g., siRNA and/or miRNA, is about 10, 11, 12, 13,
14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or
30 or more duplex nucleotides in length. While the invention is not
limited by any particular mechanism of action, the RNAi can enter a
cell and cause the degradation of a single-stranded RNA (ssRNA) of
similar or identical sequences, including endogenous mRNAs. When a
cell is exposed to double-stranded RNA (dsRNA), mRNA from the
homologous gene is selectively degraded by a process called RNA
interference (RNAi). A possible basic mechanism behind RNAi is the
breaking of a double-stranded RNA (dsRNA) matching a specific gene
sequence into short pieces called short interfering RNA, which
trigger the degradation of mRNA that matches its sequence.
[0292] In one aspect, the RNAi's as provided herein are used in
gene-silencing therapeutics, see, e.g., Shuey (2002) Drug Discov.
Today 7:1040-1046. In certain embodiments, provided herein are
methods to selectively degrade RNA using the RNAi's. The process
may be practiced in vitro, ex vivo or in vivo. In one aspect, the
RNAi molecules as provided herein can be used to generate a
loss-of-function mutation in a cell, an organ or an animal. Methods
for making and using RNAi molecules for selectively degrade RNA are
well known in the art, see, e.g., U.S. Pat. Nos. 6,506,559;
6,511,824; 6,515,109; 6,489,127.
Modification of Nucleic Acids
[0293] In certain embodiments, provided herein are methods of
generating variants of the nucleic acids, e.g., those encoding a
hydrolase or an antibody as provided herein. These methods can be
repeated or used in various combinations to generate hydrolases or
antibodies having an altered or different activity or an altered or
different stability from that of a hydrolase or antibody encoded by
the template nucleic acid. These methods also can be repeated or
used in various combinations, e.g., to generate variations in
gene/message expression, message translation or message stability.
In another aspect, the genetic composition of a cell is altered by,
e.g., modification of a homologous gene ex vivo, followed by its
reinsertion into the cell.
[0294] The term "variant" can include polynucleotides or
polypeptides as provided herein modified at one or more base pairs,
codons, introns, exons, or amino acid residues (respectively) yet
still retain the biological activity of a hydrolase as provided
herein. Variants can be produced by any number of means included
methods such as, for example, error-prone PCR, shuffling,
oligonucleotide-directed mutagenesis, assembly PCR, sexual PCR
mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive
ensemble mutagenesis, exponential ensemble mutagenesis,
site-specific mutagenesis, GeneReassembly, GSSM.sup.SM and any
combination thereof. Techniques for producing variant hydrolases
having activity at a pH or temperature, for example, that is
different from a wild-type hydrolase, are included herein.
[0295] A nucleic acid as provided herein can be altered by any
means. For example, random or stochastic methods, or,
non-stochastic, or "directed evolution," methods, see, e.g., U.S.
Pat. No. 6,361,974. Methods for random mutation of genes are well
known in the art, see, e.g., U.S. Pat. No. 5,830,696. For example,
mutagens can be used to randomly mutate a gene. Mutagens include,
e.g., ultraviolet light or gamma irradiation, or a chemical
mutagen, e.g., mitomycin, nitrous acid, photoactivated psoralens,
alone or in combination, to induce DNA breaks amenable to repair by
recombination. Other chemical mutagens include, for example, sodium
bisulfate, nitrous acid, hydroxylamine, hydrazine or formic acid.
Other mutagens are analogues of nucleotide precursors, e.g.,
nitrosoguanidine, 5-bromouracil, 2-aminopurine, or acridine. These
agents can be added to a PCR reaction in place of the nucleotide
precursor thereby mutating the sequence. Intercalating agents such
as proflavine, acriflavine, quinacrine and the like can also be
used.
[0296] Any technique in molecular biology can be used, e.g., random
PCR mutagenesis, see, e.g., Rice (1992) Proc. Natl. Acad. Sci. USA
89:5467-5471; or, combinatorial multiple cassette mutagenesis, see,
e.g., Crameri (1995) Biotechniques 18:194-196. Alternatively,
nucleic acids, e.g., genes, can be reassembled after random, or
"stochastic," fragmentation, see, e.g., U.S. Pat. Nos. 6,291,242;
6,287,862; 6,287,861; 5,955,358; 5,830,721; 5,824,514; 5,811,238;
5,605,793. In alternative aspects, modifications, additions or
deletions are introduced by error-prone PCR, shuffling,
oligonucleotide-directed mutagenesis, assembly PCR, sexual PCR
mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive
ensemble mutagenesis, exponential ensemble mutagenesis,
site-specific mutagenesis, Gene Site Saturation Mutagenesis.sup.SM
(GSSM.sup.SM), synthetic ligation reassembly (SLR or
GeneReassembly), recombination, recursive sequence recombination,
phosphothioate-modified DNA mutagenesis, uracil-containing template
mutagenesis, gapped duplex mutagenesis, point mismatch repair
mutagenesis, repair-deficient host strain mutagenesis, chemical
mutagenesis, radiogenic mutagenesis, deletion mutagenesis,
restriction-selection mutagenesis, restriction-purification
mutagenesis, artificial gene synthesis, ensemble mutagenesis,
chimeric nucleic acid multimer creation, and/or a combination of
these and other methods.
[0297] The following publications describe a variety of recursive
recombination procedures and/or methods which can be incorporated
into the methods as provided herein: Stemmer (1999) "Molecular
breeding of viruses for targeting and other clinical properties"
Tumor Targeting 4:1-4; Ness (1999) Nature Biotechnology 17:893-896;
Chang (1999) "Evolution of a cytokine using DNA family shuffling"
Nature Biotechnology 17:793-797; Minshull (1999) "Protein evolution
by molecular breeding" Current Opinion in Chemical Biology
3:284-290; Christians (1999) "Directed evolution of thymidine
kinase for AZT phosphorylation using DNA family shuffling" Nature
Biotechnology 17:259-264; Crameri (1998) "DNA shuffling of a family
of genes from diverse species accelerates directed evolution"
Nature 391:288-291; Crameri (1997) "Molecular evolution of an
arsenate detoxification pathway by DNA shuffling," Nature
Biotechnology 15:436-438; Zhang (1997) "Directed evolution of an
effective fucosidase from a galactosidase by DNA shuffling and
screening" Proc. Natl. Acad. Sci. USA 94:4504-4509; Patten et al.
(1997) "Applications of DNA Shuffling to Pharmaceuticals and
Vaccines" Current Opinion in Biotechnology 8:724-733; Crameri et
al. (1996) "Construction and evolution of antibody-phage libraries
by DNA shuffling" Nature Medicine 2:100-103; Gates et al. (1996)
"Affinity selective isolation of ligands from peptide libraries
through display on a lac repressor `headpiece dime`" Journal of
Molecular Biology 255:373-386; Stemmer (1996) "Sexual PCR and
Assembly PCR" In: The Encyclopedia of Molecular Biology. VCH
Publishers, New York. pp.447-457; Crameri and Stemmer (1995)
"Combinatorial multiple cassette mutagenesis creates all the
permutations of mutant and wildtype cassettes" BioTechniques
18:194-195; Stemmer et al. (1995) "Single-step assembly of a gene
and entire plasmid form large numbers of oligodeoxyribonucleotides"
Gene, 164:49-53; Stemmer (1995) "The Evolution of Molecular
Computation" Science 270: 1510; Stemmer (1995) "Searching Sequence
Space" Bio/Technology 13:549-553; Stemmer (1994) "Rapid evolution
of a protein in vitro by DNA shuffling" Nature 370:389-391; and
Stemmer (1994) "DNA shuffling by random fragmentation and
reassembly: In vitro recombination for molecular evolution." Proc.
Natl. Acad. Sci. USA 91:10747-10751.
[0298] Mutational methods of generating diversity include, for
example, site-directed mutagenesis (Ling et al. (1997) "Approaches
to DNA mutagenesis: an overview" Anal Biochem. 254(2): 157-178;
Dale et al. (1996) "Oligonucleotide-directed random mutagenesis
using the phosphorothioate method" Methods Mol. Biol. 57:369-374;
Smith (1985) "In vitro mutagenesis" Ann. Rev. Genet. 19:423-462;
Botstein & Shortle (1985) "Strategies and applications of in
vitro mutagenesis" Science 229:1193-1201; Carter (1986)
"Site-directed mutagenesis" Biochem. J. 237:1-7; and Kunkel (1987)
"The efficiency of oligonucleotide directed mutagenesis" in Nucleic
Acids & Molecular Biology (Eckstein, F. and Lilley, D. M. J.
eds., Springer Verlag, Berlin)); mutagenesis using uracil
containing templates (Kunkel (1985) "Rapid and efficient
site-specific mutagenesis without phenotypic selection" Proc. Natl.
Acad. Sci. USA 82:488-492; Kunkel et al. (1987) "Rapid and
efficient site-specific mutagenesis without phenotypic selection"
Methods in Enzymol. 154, 367-382; and Bass et al. (1988) "Mutant
Trp repressors with new DNA-binding specificities" Science
242:240-245); oligonucleotide-directed mutagenesis (Methods in
Enzymol. 100: 468-500 (1983); Methods in Enzymol. 154: 329-350
(1987); Zoller & Smith (1982) "Oligonucleotide-directed
mutagenesis using M13-derived vectors: an efficient and general
procedure for the production of point mutations in any DNA
fragment" Nucleic Acids Res. 10:6487-6500; Zoller & Smith
(1983) "Oligonucleotide-directed mutagenesis of DNA fragments
cloned into M13 vectors" Methods in Enzymol. 100:468-500; and
Zoller & Smith (1987) Oligonucleotide-directed mutagenesis: a
simple method using two oligonucleotide primers and a
single-stranded DNA template" Methods in Enzymol. 154:329-350);
phosphorothioate-modified DNA mutagenesis (Taylor et al. (1985)
"The use of phosphorothioate-modified DNA in restriction enzyme
reactions to prepare nicked DNA" Nucl. Acids Res. 13: 8749-8764;
Taylor et al. (1985) "The rapid generation of
oligonucleotide-directed mutations at high frequency using
phosphorothioate-modified DNA" Nucl. Acids Res. 13: 8765-8787
(1985); Nakamaye (1986) "Inhibition of restriction endonuclease Nci
I cleavage by phosphorothioate groups and its application to
oligonucleotide-directed mutagenesis" Nucl. Acids Res. 14:
9679-9698; Sayers et al. (1988) "Y-T Exonucleases in
phosphorothioate-based oligonucleotide-directed mutagenesis" Nucl.
Acids Res. 16:791-802; and Sayers et al. (1988) "Strand specific
cleavage of phosphorothioate-containing DNA by reaction with
restriction endonucleases in the presence of ethidium bromide"
Nucl. Acids Res. 16: 803-814); mutagenesis using gapped duplex DNA
(Kramer et al. (1984) "The gapped duplex DNA approach to
oligonucleotide-directed mutation construction" Nucl. Acids Res.
12: 9441-9456; Kramer & Fritz (1987) Methods in Enzymol.
"Oligonucleotide-directed construction of mutations via gapped
duplex DNA" 154:350-367; Kramer et al. (1988) "Improved enzymatic
in vitro reactions in the gapped duplex DNA approach to
oligonucleotide-directed construction of mutations" Nucl. Acids
Res. 16: 7207; and Fritz et al. (1988) "Oligonucleotide-directed
construction of mutations: a gapped duplex DNA procedure without
enzymatic reactions in vitro" Nucl. Acids Res. 16: 6987-6999).
[0299] Additional protocols used in the methods as provided herein
include point mismatch repair (Kramer (1984) "Point Mismatch
Repair" Cell 38:879-887), mutagenesis using repair-deficient host
strains (Carter et al. (1985) "Improved oligonucleotide
site-directed mutagenesis using M13 vectors" Nucl. Acids Res. 13:
4431-4443; and Carter (1987) "Improved oligonucleotide-directed
mutagenesis using M13 vectors" Methods in Enzymol. 154: 382-403),
deletion mutagenesis (Eghtedarzadeh (1986) "Use of oligonucleotides
to generate large deletions" Nucl. Acids Res. 14: 5115),
restriction-selection and restriction-selection and
restriction-purification (Wells et al. (1986) "Importance of
hydrogen-bond formation in stabilizing the transition state of
subtilisin" Phil. Trans. R. Soc. Lond. A 317: 415-423), mutagenesis
by total gene synthesis (Nambiar et al. (1984) "Total synthesis and
cloning of a gene coding for the ribonuclease S protein" Science
223: 1299-1301; Sakamar and Khorana (1988) "Total synthesis and
expression of a gene for the a-subunit of bovine rod outer segment
guanine nucleotide-binding protein (transducin)" Nucl. Acids Res.
14: 6361-6372; Wells et al. (1985) "Cassette mutagenesis: an
efficient method for generation of multiple mutations at defined
sites" Gene 34:315-323; and Grundstrom et al. (1985)
"Oligonucleotide-directed mutagenesis by microscale `shot-gun` gene
synthesis" Nucl. Acids Res. 13: 3305-3316), double-strand break
repair (Mandecki (1986); Arnold (1993) "Protein engineering for
unusual environments" Current Opinion in Biotechnology 4:450-455.
"Oligonucleotide-directed double-strand break repair in plasmids of
Escherichia coli: a method for site-specific mutagenesis" Proc.
Natl. Acad. Sci. USA, 83:7177-7181). Additional details on many of
the above methods can be found in Methods in Enzymology Volume 154,
which also describes useful controls for trouble-shooting problems
with various mutagenesis methods.
[0300] Additional protocols used in the methods as provided herein
include those discussed in U.S. Pat. Nos. 5,605,793 to Stemmer
(Feb. 25, 1997), "Methods for In Vitro Recombination;" U.S. Pat.
No. 5,811,238 to Stemmer et al. (Sep. 22, 1998) "Methods for
Generating Polynucleotides having Desired Characteristics by
Iterative Selection and Recombination;" U.S. Pat. No. 5,830,721 to
Stemmer et al. (Nov. 3, 1998), "DNA Mutagenesis by Random
Fragmentation and Reassembly;" U.S. Pat. No. 5,834,252 to Stemmer,
et al. (Nov. 10, 1998) "End-Complementary Polymerase Reaction;"
U.S. Pat. No. 5,837,458 to Minshull, et al. (Nov. 17, 1998),
"Methods and Compositions for Cellular and Metabolic Engineering;"
WO 95/22625, Stemmer and Crameri, "Mutagenesis by Random
Fragmentation and Reassembly;" WO 96/33207 by Stemmer and Lipschutz
"End Complementary Polymerase Chain Reaction;" WO 97/20078 by
Stemmer and Crameri "Methods for Generating Polynucleotides having
Desired Characteristics by Iterative Selection and Recombination;"
WO 97/35966 by Minshull and Stemmer, "Methods and Compositions for
Cellular and Metabolic Engineering;" WO 99/41402 by Punnonen et al.
"Targeting of Genetic Vaccine Vectors;" WO 99/41383 by Punnonen et
al. "Antigen Library Immunization;" WO 99/41369 by Punnonen et al.
"Genetic Vaccine Vector Engineering;" WO 99/41368 by Punnonen et
al. "Optimization of Immunomodulatory Properties of Genetic
Vaccines;" EP 752008 by Stemmer and Crameri, "DNA Mutagenesis by
Random Fragmentation and Reassembly;" EP 0932670 by Stemmer
"Evolving Cellular DNA Uptake by Recursive Sequence Recombination;"
WO 99/23107 by Stemmer et al., "Modification of Virus Tropism and
Host Range by Viral Genome Shuffling;" WO 99/21979 by Apt et al.,
"Human Papillomavirus Vectors;" WO 98/31837 by del Cardayre et al.
"Evolution of Whole Cells and Organisms by Recursive Sequence
Recombination;" WO 98/27230 by Patten and Stemmer, "Methods and
Compositions for Polypeptide Engineering;" WO 98/27230 by Stemmer
et al., "Methods for Optimization of Gene Therapy by Recursive
Sequence Shuffling and Selection," WO 00/00632, "Methods for
Generating Highly Diverse Libraries," WO 00/09679, "Methods for
Obtaining in Vitro Recombined Polynucleotide Sequence Banks and
Resulting Sequences," WO 98/42832 by Arnold et al., "Recombination
of Polynucleotide Sequences Using Random or Defined Primers," WO
99/29902 by Arnold et al., "Method for Creating Polynucleotide and
Polypeptide Sequences," WO 98/41653 by Vind, "An in Vitro Method
for Construction of a DNA Library," WO 98/41622 by Borchert et al.,
"Method for Constructing a Library Using DNA Shuffling," and WO
98/42727 by Pati and Zarling, "Sequence Alterations using
Homologous Recombination."
[0301] Protocols that can be used (providing details regarding
various diversity generating methods) are described, e.g., in U.S.
Ser. No.09/407,800, "SHUFFLING OF CODON ALTERED GENES" by Patten et
al. filed Sep. 28, 1999; "EVOLUTION OF WHOLE CELLS AND ORGANISMS BY
RECURSIVE SEQUENCE RECOMBINATION" by del Cardayre et al., U.S. Pat.
No. 6,379,964; "OLIGONUCLEOTIDE MEDIATED NUCLEIC ACID
RECOMBINATION" by Crameri et al., U.S. Pat. Nos. 6,319,714;
6,368,861; 6,376,246; 6,423,542; 6,426,224 and PCT/US00/01203; "USE
OF CODON-VARIED OLIGONUCLEOTIDE SYNTHESIS FOR SYNTHETIC SHUFFLING"
by Welch et al., U.S. Pat. No. 6,436,675; "METHODS FOR MAKING
CHARACTER STRINGS, POLYNUCLEOTIDES & POLYPEPTIDES HAVING
DESIRED CHARACTERISTICS" by Selifonov et al., filed Jan. 18, 2000,
(PCT/US00/01202) and, e.g. "METHODS FOR MAKING CHARACTER STRINGS,
POLYNUCLEOTIDES & POLYPEPTIDES HAVING DESIRED CHARACTERISTICS"
by Selifonov et al., filed Jul. 18, 2000 (U.S. Ser. No.
09/618,579); "METHODS OF POPULATING DATA STRUCTURES FOR USE IN
EVOLUTIONARY SIMULATIONS" by Selifonov and Stemmer, filed Jan. 18,
2000 (PCT/US00/01138); and "SINGLE-STRANDED NUCLEIC ACID
TEMPLATE-MEDIATED RECOMBINATION AND NUCLEIC ACID FRAGMENT
ISOLATION" by Affholter, filed Sep. 6, 2000 (U.S. Ser. No.
09/656,549); and U.S. Pat. Nos. 6,177,263; 6,153,410.
[0302] Non-stochastic, or "directed evolution," methods include,
e.g., gene site saturation mutagenesis.sup.SM (GSSM.sup.SM),
synthetic ligation reassembly (SLR or GeneReassembly), or a
combination thereof are used to modify the nucleic acids as
provided herein to generate hydrolases with new or altered
properties (e.g., activity under highly acidic or alkaline
conditions, high temperatures, and the like). Polypeptides encoded
by the modified nucleic acids can be screened for an activity
before testing for proteolytic or other activity. Any testing
modality or protocol can be used, e.g., using a capillary array
platform. See, e.g., U.S. Pat. Nos. 6,361,974; 6,280,926;
5,939,250.
Saturation Mutagenesis, or, GSSM.sup.SM Technology
[0303] In one aspect as provided herein, non-stochastic gene
modification, a "directed evolution process," is used to generate
hydrolases and antibodies with new or altered properties.
Variations of this method have been termed "Gene Site Saturation
Mutagenesis," "site-saturation mutagenesis," "saturation
mutagenesis" or simply "GSSM.sup.SM." It can be used in combination
with other mutagenization processes. In one aspect, provided herein
are methods for making enzymes and antibodies using GSSM.sup.SM
technology, e.g., as described herein and also in U.S. Pat. Nos.
6,171,820; 6,579,258; 6,238,884.
[0304] In one aspect, GSSM.sup.SM technology comprises providing a
template polynucleotide and a plurality of oligonucleotides,
wherein each oligonucleotide comprises a sequence homologous to the
template polynucleotide, thereby targeting a specific sequence of
the template polynucleotide, and a sequence that is a variant of
the homologous gene; generating progeny polynucleotides comprising
non-stochastic sequence variations by replicating the template
polynucleotide with the oligonucleotides, thereby generating
polynucleotides comprising homologous gene sequence variations.
[0305] In one aspect, codon primers containing a degenerate N,N,G/T
sequence are used to introduce point mutations into a
polynucleotide, so as to generate a set of progeny polypeptides in
which a full range of single amino acid substitutions is
represented at each amino acid position, e.g., an amino acid
residue in an enzyme active site or ligand binding site targeted to
be modified. These oligonucleotides can comprise a contiguous first
homologous sequence, a degenerate N,N,G/T sequence, and,
optionally, a second homologous sequence. The downstream progeny
translational products from the use of such oligonucleotides
include all possible amino acid changes at each amino acid site
along the polypeptide, because the degeneracy of the N,N,G/T
sequence includes codons for all 20 amino acids. In one aspect, one
such degenerate oligonucleotide (comprised of, e.g., one degenerate
N,N,G/T cassette) is used for subjecting each original codon in a
parental polynucleotide template to a full range of codon
substitutions. In another aspect, at least two degenerate cassettes
are used--either in the same oligonucleotide or not, for subjecting
at least two original codons in a parental polynucleotide template
to a full range of codon substitutions. For example, more than one
N,N,G/T sequence can be contained in one oligonucleotide to
introduce amino acid mutations at more than one site. This
plurality of N,N,G/T sequences can be directly contiguous, or
separated by one or more additional nucleotide sequence(s). In
another aspect, oligonucleotides serviceable for introducing
additions and deletions can be used either alone or in combination
with the codons containing an N,N,G/T sequence, to introduce any
combination or permutation of amino acid additions, deletions,
and/or substitutions.
[0306] In one aspect, simultaneous mutagenesis of two or more
contiguous amino acid positions is done using an oligonucleotide
that contains contiguous N,N,G/T triplets, i.e. a degenerate
(N,N,G/T)n sequence. In another aspect, degenerate cassettes having
less degeneracy than the N,N,G/T sequence are used. For example, it
may be desirable in some instances to use (e.g. in an
oligonucleotide) a degenerate triplet sequence comprised of only
one N, where said N can be in the first second or third position of
the triplet. Any other bases including any combinations and
permutations thereof can be used in the remaining two positions of
the triplet. Alternatively, it may be desirable in some instances
to use (e.g. in an oligo) a degenerate N,N,N triplet sequence.
[0307] In one aspect, use of degenerate triplets (e.g., N,N,G/T
triplets) allows for systematic and easy generation of a full range
of possible natural amino acids (for a total of 20 amino acids)
into each and every amino acid position in a polypeptide (in
alternative aspects, the methods also include generation of less
than all possible substitutions per amino acid residue, or codon,
position). For example, for a 100 amino acid polypeptide, 2000
distinct species (i.e. 20 possible amino acids per
position.times.100 amino acid positions) can be generated. Through
the use of an oligonucleotide or set of oligonucleotides containing
a degenerate N,N,G/T triplet, 32 individual sequences can code for
all 20 possible natural amino acids. Thus, in a reaction vessel in
which a parental polynucleotide sequence is subjected to saturation
mutagenesis using at least one such oligonucleotide, there are
generated 32 distinct progeny polynucleotides encoding 20 distinct
polypeptides. In contrast, the use of a non-degenerate
oligonucleotide in site-directed mutagenesis leads to only one
progeny polypeptide product per reaction vessel. Nondegenerate
oligonucleotides can optionally be used in combination with
degenerate primers disclosed; for example, nondegenerate
oligonucleotides can be used to generate specific point mutations
in a working polynucleotide. This provides one means to generate
specific silent point mutations, point mutations leading to
corresponding amino acid changes, and point mutations that cause
the generation of stop codons and the corresponding expression of
polypeptide fragments.
[0308] In one aspect, each saturation mutagenesis reaction vessel
contains polynucleotides encoding at least 20 progeny polypeptide
(e.g., hydrolase, e.g., lipase, saturase, palmitase and/or
stearatase) molecules such that all 20 natural amino acids are
represented at the one specific amino acid position corresponding
to the codon position mutagenized in the parental polynucleotide
(other aspects use less than all 20 natural combinations). The
32-fold degenerate progeny polypeptides generated from each
saturation mutagenesis reaction vessel can be subjected to clonal
amplification (e.g. cloned into a suitable host, e.g., E. coli
host, using, e.g., an expression vector) and subjected to
expression screening. When an individual progeny polypeptide is
identified by screening to display a favorable change in property
(when compared to the parental polypeptide, such as increased
selectivity for hydrolysis of palmitate esters versus hydrolysis of
oleate esters), it can be sequenced to identify the correspondingly
favorable amino acid substitution contained therein.
[0309] In one aspect, upon mutagenizing each and every amino acid
position in a parental polypeptide using saturation mutagenesis as
disclosed herein, favorable amino acid changes may be identified at
more than one amino acid position. One or more new progeny
molecules can be generated that contain a combination of all or
part of these favorable amino acid substitutions. For example, if 2
specific favorable amino acid changes are identified in each of 3
amino acid positions in a polypeptide, the permutations include 3
possibilities at each position (no change from the original amino
acid, and each of two favorable changes) and 3 positions. Thus,
there are 3.times.3.times.3 or 27 total possibilities, including 7
that were previously examined--6 single point mutations (i.e. 2 at
each of three positions) and no change at any position.
[0310] In another aspect, site-saturation mutagenesis can be used
together with another stochastic or non-stochastic means to vary
sequence, e.g., synthetic ligation reassembly (see below),
shuffling, chimerization, recombination and other mutagenizing
processes and mutagenizing agents. Provided herein are mutagenizing
process(es), including saturation mutagenesis, used in an iterative
manner.
Synthetic Ligation Reassembly (SLR)
[0311] In one aspect provided herein are non-stochastic gene
modification systems termed "synthetic ligation reassembly," or
simply "SLR,", also known as "GeneReassembly" technology, a
"directed evolution process," to generate polypeptides, e.g.,
enzymes (such as hydrolases, e.g., lipases, saturases, palmitases
and/or stearatases) or antibodies as provided herein, with new or
altered properties. SLR is a method of ligating oligonucleotide
fragments together non-stochastically. This method differs from
stochastic oligonucleotide shuffling in that the nucleic acid
building blocks are not shuffled, concatenated or chimerized
randomly, but rather are assembled non-stochastically. See, e.g.,
U.S. Pat. Nos. 6,773,900; 6,740,506; 6,713,282; 6,635,449;
6,605,449; 6,537,776.
[0312] In one aspect, SLR comprises the following steps: (a)
providing a template polynucleotide, wherein the template
polynucleotide comprises sequence encoding a homologous gene; (b)
providing a plurality of building block polynucleotides, wherein
the building block polynucleotides are designed to cross-over
reassemble with the template polynucleotide at a predetermined
sequence, and a building block polynucleotide comprises a sequence
that is a variant of the homologous gene and a sequence homologous
to the template polynucleotide flanking the variant sequence; (c)
combining a building block polynucleotide with a template
polynucleotide such that the building block polynucleotide
cross-over reassembles with the template polynucleotide to generate
polynucleotides comprising homologous gene sequence variations.
[0313] SLR does not depend on the presence of high levels of
homology between polynucleotides to be rearranged. Thus, this
method can be used to non-stochastically generate libraries (or
sets) of progeny molecules comprised of over 10.sup.100 different
chimeras. SLR can be used to generate libraries comprised of over
10.sup.1000 different progeny chimeras. In one aspect provided
herein are non-stochastic methods of producing a set of finalized
chimeric nucleic acid molecules having an overall assembly order
that is chosen by design. This method includes the steps of
generating by design a plurality of specific nucleic acid building
blocks having serviceable mutually compatible ligatable ends, and
assembling these nucleic acid building blocks, such that a designed
overall assembly order is achieved.
[0314] The mutually compatible ligatable ends of the nucleic acid
building blocks to be assembled are considered to be "serviceable"
for this type of ordered assembly if they enable the building
blocks to be coupled in predetermined orders. Thus, the overall
assembly order in which the nucleic acid building blocks can be
coupled is specified by the design of the ligatable ends. If more
than one assembly step is to be used, then the overall assembly
order in which the nucleic acid building blocks can be coupled is
also specified by the sequential order of the assembly step(s). In
one aspect, the annealed building pieces are treated with an
enzyme, such as a ligase (e.g. T4 DNA ligase), to achieve covalent
bonding of the building pieces.
[0315] In one aspect, the design of the oligonucleotide building
blocks is obtained by analyzing a set of progenitor nucleic acid
sequence templates that serve as a basis for producing a progeny
set of finalized chimeric polynucleotides. These parental
oligonucleotide templates thus serve as a source of sequence
information that aids in the design of the nucleic acid building
blocks that are to be mutagenized, e.g., chimerized or shuffled. In
one aspect of this method, the sequences of a plurality of parental
nucleic acid templates are aligned in order to select one or more
demarcation points. The demarcation points can be located at an
area of homology, and are comprised of one or more nucleotides.
These demarcation points are alternatively shared by at least two
of the progenitor templates. The demarcation points can thereby be
used to delineate the boundaries of oligonucleotide building blocks
to be generated in order to rearrange the parental polynucleotides.
The demarcation points identified and selected in the progenitor
molecules serve as potential chimerization points in the assembly
of the final chimeric progeny molecules. A demarcation point can be
an area of homology (comprised of at least one homologous
nucleotide base) shared by at least two parental polynucleotide
sequences. Alternatively, a demarcation point can be an area of
homology that is shared by at least half of the parental
polynucleotide sequences, or, it can be an area of homology that is
shared by at least two thirds of the parental polynucleotide
sequences. In alternative embodiments, a serviceable demarcation
point is an area of homology that is shared by at least three
fourths of the parental polynucleotide sequences, or, it can be
shared by at almost all of the parental polynucleotide sequences.
In one aspect, a demarcation point is an area of homology that is
shared by all of the parental polynucleotide sequences.
[0316] In one aspect, a ligation reassembly process is performed
exhaustively in order to generate an exhaustive library of progeny
chimeric polynucleotides. In other words, all possible ordered
combinations of the nucleic acid building blocks are represented in
the set of finalized chimeric nucleic acid molecules. At the same
time, in another aspect, the assembly order (i.e. the order of
assembly of each building block in the 5' to 3 sequence of each
finalized chimeric nucleic acid) in each combination is by design
(or non-stochastic) as described above. Provided herein are
non-stochastic methods that reduce the possibility of unwanted side
products.
[0317] In another aspect, the ligation reassembly method is
performed systematically. For example, the method is performed in
order to generate a systematically compartmentalized library of
progeny molecules, with compartments that can be screened
systematically, e.g. one by one. Provided herein are methods
comprising selective and judicious use of specific nucleic acid
building blocks, coupled with the selective and judicious use of
sequentially stepped assembly reactions, a design can be achieved
where specific sets of progeny products are made in each of several
reaction vessels. This allows a systematic examination and
screening procedure to be performed. Thus, these methods allow a
potentially very large number of progeny molecules to be examined
systematically in smaller groups. Because of its ability to perform
chimerizations in a manner that is highly flexible yet exhaustive
and systematic as well, particularly when there is a low level of
homology among the progenitor molecules, these methods provide for
the generation of a library (or set) comprised of a large number of
progeny molecules. Because of the non-stochastic nature of the
instant ligation reassembly methods, the progeny molecules
generated can comprise a library of finalized chimeric nucleic acid
molecules having an overall assembly order that is chosen by
design. The saturation mutagenesis and optimized directed evolution
methods also can be used to generate different progeny molecular
species.
[0318] In one aspect, the methods herein provide freedom of choice
and control regarding the selection of demarcation points, the size
and number of the nucleic acid building blocks, and the size and
design of the couplings. The requirement for intermolecular
homology can be highly relaxed. In fact, demarcation points can
even be chosen in areas of little or no intermolecular homology.
For example, because of codon wobble, i.e. the degeneracy of
codons, nucleotide substitutions can be introduced into nucleic
acid building blocks without altering the amino acid originally
encoded in the corresponding progenitor template. Alternatively, a
codon can be altered such that the coding for an original amino
acid is altered. In one aspect, substitutions can be introduced
into the nucleic acid building block in order to increase the
incidence of intermolecular homologous demarcation points and thus
to allow an increased number of couplings to be achieved among the
building blocks, which in turn allows a greater number of progeny
chimeric molecules to be generated.
[0319] In another aspect, the synthetic nature of the step in which
the building blocks are generated allows the design and
introduction of nucleotides (e.g., one or more nucleotides, which
may be, for example, codons or introns or regulatory sequences)
that can later be optionally removed in an in vitro process (e.g.
by mutagenesis) or in an in vivo process (e.g. by utilizing the
gene splicing ability of a host organism). It is appreciated that
in many instances the introduction of these nucleotides may also be
desirable for many other reasons in addition to the potential
benefit of creating a serviceable demarcation point.
[0320] In one aspect, a nucleic acid building block is used to
introduce an intron. Thus, functional introns are introduced into a
man-made gene manufactured according to the methods described
herein. The artificially introduced intron(s) can be functional in
a host cells for gene splicing much in the way that
naturally-occurring introns serve functionally in gene
splicing.
Optimized Directed Evolution System
[0321] In certain embodiments, provided herein are non-stochastic
gene modification systems termed "optimized directed evolution
system" to generate hydrolases and antibodies with new or altered
properties. Optimized directed evolution is directed to the use of
repeated cycles of reductive reassortment, recombination and
selection that allow for the directed molecular evolution of
nucleic acids through recombination. Optimized directed evolution
allows generation of a large population of evolved chimeric
sequences, wherein the generated population is significantly
enriched for sequences that have a predetermined number of
crossover events.
[0322] A crossover event is a point in a chimeric sequence where a
shift in sequence occurs from one parental variant to another
parental variant. Such a point is normally at the juncture of where
oligonucleotides from two parents are ligated together to form a
single sequence. This method allows calculation of the correct
concentrations of oligonucleotide sequences so that the final
chimeric population of sequences is enriched for the chosen number
of crossover events. This provides more control over choosing
chimeric variants having a predetermined number of crossover
events.
[0323] In addition, this method provides a convenient means for
exploring a tremendous amount of the possible protein variant space
in comparison to other systems. Previously, if one generated, for
example, 10.sup.13 chimeric molecules during a reaction, it would
be extremely difficult to test such a high number of chimeric
variants for a particular activity. Moreover, a significant portion
of the progeny population would have a very high number of
crossover events which resulted in proteins that were less likely
to have increased levels of a particular activity. By using these
methods, the population of chimerics molecules can be enriched for
those variants that have a particular number of crossover events.
Thus, although one can still generate 10.sup.13 chimeric molecules
during a reaction, each of the molecules chosen for further
analysis most likely has, for example, only three crossover events.
Because the resulting progeny population can be skewed to have a
predetermined number of crossover events, the boundaries on the
functional variety between the chimeric molecules is reduced. This
provides a more manageable number of variables when calculating
which oligonucleotide from the original parental polynucleotides
might be responsible for affecting a particular trait.
[0324] One method for creating a chimeric progeny polynucleotide
sequence is to create oligonucleotides corresponding to fragments
or portions of each parental sequence. In alternative embodiments,
each oligonucleotide includes a unique region of overlap so that
mixing the oligonucleotides together results in a new variant that
has each oligonucleotide fragment assembled in the correct order.
Alternatively protocols for practicing these methods as provided
herein can be found in U.S. Pat. Nos. 6,773,900; 6,740,506;
6,713,282; 6,635,449; 6,605,449; 6,537,776; 6,361,974.
[0325] The number of oligonucleotides generated for each parental
variant bears a relationship to the total number of resulting
crossovers in the chimeric molecule that is ultimately created. For
example, three parental nucleotide sequence variants might be
provided to undergo a ligation reaction in order to find a chimeric
variant having, for example, greater activity at high temperature.
As one example, a set of 50 oligonucleotide sequences can be
generated corresponding to each portions of each parental variant.
Accordingly, during the ligation reassembly process there could be
up to 50 crossover events within each of the chimeric sequences.
The probability that each of the generated chimeric polynucleotides
will contain oligonucleotides from each parental variant in
alternating order is very low. If each oligonucleotide fragment is
present in the ligation reaction in the same molar quantity it is
likely that in some positions oligonucleotides from the same
parental polynucleotide will ligate next to one another and thus
not result in a crossover event. If the concentration of each
oligonucleotide from each parent is kept constant during any
ligation step in this example, there is a 1/3 chance (assuming 3
parents) that an oligonucleotide from the same parental variant
will ligate within the chimeric sequence and produce no
crossover.
[0326] Accordingly, a probability density function (PDF) can be
determined to predict the population of crossover events that are
likely to occur during each step in a ligation reaction given a set
number of parental variants, a number of oligonucleotides
corresponding to each variant, and the concentrations of each
variant during each step in the ligation reaction. The statistics
and mathematics behind determining the PDF is described below. By
utilizing these methods, one can calculate such a probability
density function, and thus enrich the chimeric progeny population
for a predetermined number of crossover events resulting from a
particular ligation reaction. Moreover, a target number of
crossover events can be predetermined, and the system then
programmed to calculate the starting quantities of each parental
oligonucleotide during each step in the ligation reaction to result
in a probability density function that centers on the predetermined
number of crossover events. These methods are directed to the use
of repeated cycles of reductive reassortment, recombination and
selection that allow for the directed molecular evolution of a
nucleic acid encoding a polypeptide through recombination. This
system allows generation of a large population of evolved chimeric
sequences, wherein the generated population is significantly
enriched for sequences that have a predetermined number of
crossover events. A crossover event is a point in a chimeric
sequence where a shift in sequence occurs from one parental variant
to another parental variant. Such a point is normally at the
juncture of where oligonucleotides from two parents are ligated
together to form a single sequence. The method allows calculation
of the correct concentrations of oligonucleotide sequences so that
the final chimeric population of sequences is enriched for the
chosen number of crossover events. This provides more control over
choosing chimeric variants having a predetermined number of
crossover events.
Determining Crossover Events
[0327] Aspects as provided herein include a system and software
that receive a desired crossover probability density function
(PDF), the number of parent genes to be reassembled, and the number
of fragments in the reassembly as inputs. The output of this
program is a "fragment PDF" that can be used to determine a recipe
for producing reassembled genes, and the estimated crossover PDF of
those genes. The processing described herein is alternatively
performed in MATLAB.TM. (The Mathworks, Natick, Mass.) a
programming language and development environment for technical
computing.
Iterative Processes
[0328] In certain embodiments, provided herein are processes that
can be iteratively repeated. For example a nucleic acid (or, the
nucleic acid) responsible for an altered hydrolase or antibody
phenotype is identified, re-isolated, again modified, re-tested for
activity. This process can be iteratively repeated until a desired
phenotype is engineered. For example, an entire biochemical
anabolic or catabolic pathway can be engineered into a cell,
including proteolytic activity.
[0329] Similarly, if it is determined that a particular
oligonucleotide has no affect at all on the desired trait (e.g., a
new hydrolase phenotype), it can be removed as a variable by
synthesizing larger parental oligonucleotides that include the
sequence to be removed. Since incorporating the sequence within a
larger sequence prevents any crossover events, there will no longer
be any variation of this sequence in the progeny polynucleotides.
This iterative practice of determining which oligonucleotides are
most related to the desired trait, and which are unrelated, allows
more efficient exploration all of the possible protein variants
that might be provide a particular trait or activity.
In Vivo Shuffling
[0330] In vivo shuffling of molecules is used in methods as
provided herein that provide variants of polypeptides as provided
herein, e.g., antibodies, hydrolases, and the like. In vivo
shuffling can be performed utilizing the natural property of cells
to recombine multimers. While recombination in vivo has provided
the major natural route to molecular diversity, genetic
recombination remains a relatively complex process that involves 1)
the recognition of homologies; 2) strand cleavage, strand invasion,
and metabolic steps leading to the production of recombinant
chiasma; and finally 3) the resolution of chiasma into discrete
recombined molecules. The formation of the chiasma requires the
recognition of homologous sequences.
[0331] In certain embodiments, provided herein are methods for
producing a hybrid polynucleotide from at least a first
polynucleotide and a second polynucleotide. In other embodiments,
provided herein are methods used to produce a hybrid polynucleotide
by introducing at least a first polynucleotide and a second
polynucleotide which share at least one region of partial sequence
homology into a suitable host cell. The regions of partial sequence
homology promote processes which result in sequence reorganization
producing a hybrid polynucleotide. In one aspect, the term "hybrid
polynucleotide" encompasses any nucleotide sequence which results
from a method as provided herein, and in one embodiment contains
sequence from at least two original polynucleotide sequences. Such
hybrid polynucleotides can result from intermolecular recombination
events which promote sequence integration between DNA molecules. In
addition, such hybrid polynucleotides can result from
intramolecular reductive reassortment processes which utilize
repeated sequences to alter a nucleotide sequence within a DNA
molecule.
Producing Sequence Variants
[0332] In certain embodiments, provided herein are methods of
making sequence variants of the nucleic acid and hydrolase and
antibody sequences as provided herein or isolating hydrolases using
the nucleic acids and polypeptides as provided herein. In certain
embodiments, provided herein are variants of a hydrolase gene as
provided herein, which can be altered by any means, including,
e.g., random or stochastic methods, or, non-stochastic, or
"directed evolution," methods, as described above.
[0333] Provided herein are methods of generating a variant of a
nucleic acid encoding a polypeptide having hydrolase activity, e.g.
lipase, saturase, palmitase and/or stearatase activity, comprising
the steps of: (a) providing a template nucleic acid comprising a
nucleic acid as provided herein; and (b) modifying, deleting or
adding one or more nucleotides in the template sequence, or a
combination thereof, to generate a variant of the template nucleic
acid. In one aspect, the method can further comprise expressing the
variant nucleic acid to generate a variant hydrolase, e.g. a
lipase, saturase, palmitase and/or stearatase polypeptide. The
modifications, additions or deletions can be introduced by a method
comprising error-prone PCR, shuffling, oligonucleotide-directed
mutagenesis, assembly PCR, sexual PCR mutagenesis, in vivo
mutagenesis, cassette mutagenesis, recursive ensemble mutagenesis,
exponential ensemble mutagenesis, site-specific mutagenesis, Gene
Site Saturation Mutagenesi.sup.SM (GSSM.sup.SM), synthetic ligation
reassembly (SLR or GeneReassembly) or a combination thereof. In
another aspect, the modifications, additions or deletions are
introduced by a method comprising recombination, recursive sequence
recombination, phosphothioate-modified DNA mutagenesis,
uracil-containing template mutagenesis, gapped duplex mutagenesis,
point mismatch repair mutagenesis, repair-deficient host strain
mutagenesis, chemical mutagenesis, radiogenic mutagenesis, deletion
mutagenesis, restriction-selection mutagenesis,
restriction-purification mutagenesis, artificial gene synthesis,
ensemble mutagenesis, chimeric nucleic acid multimer creation and a
combination thereof.
[0334] In one aspect, the method can be iteratively repeated until
a hydrolase, e.g. a lipase, a saturase, a palmitase and/or a
stearatase having an altered or different activity or an altered or
different stability from that of a polypeptide encoded by the
template nucleic acid is produced. In one aspect, the variant
hydrolase, e.g. lipase, saturase, palmitase and/or stearatase
polypeptide is thermotolerant, and retains some activity after
being exposed to an elevated temperature. In another aspect, the
variant hydrolase, e.g. lipase, saturase, palmitase and/or
stearatase polypeptide has increased glycosylation as compared to
the hydrolase, e.g. lipase, saturase, palmitase and/or stearatase
encoded by a template nucleic acid. Alternatively, the variant
hydrolase, e.g. lipase, saturase, palmitase and/or stearatase
polypeptide has hydrolase, e.g. lipase, saturase, palmitase and/or
stearatase activity under a high temperature, wherein the
hydrolase, e.g. lipase, saturase, palmitase and/or stearatase
encoded by the template nucleic acid is not active under the high
temperature. In one aspect, the method can be iteratively repeated
until a hydrolase, e.g. a lipase, a saturase, a palmitase and/or a
stearatase coding sequence having an altered codon usage from that
of the template nucleic acid is produced. In another aspect, the
method can be iteratively repeated until a hydrolase gene, e.g. a
lipase, a saturase, a palmitase and/or a stearatase gene, having
higher or lower levels of message expression or stability from that
of the template nucleic acid is produced. In another aspect,
formulation of the final hydrolase product, e.g. lipase, saturase,
palmitase and/or stearatase product, enables an increase or
modulation of the performance of the hydrolase, e.g. lipase,
saturase, palmitase and/or stearatase in the product.
[0335] The isolated variants may be naturally occurring. Variants
can also be created in vitro. Variants may be created using genetic
engineering techniques such as site directed mutagenesis, random
chemical mutagenesis, Exonuclease III deletion procedures, and
standard cloning techniques. Alternatively, such variants,
fragments, analogs, or derivatives may be created using chemical
synthesis or modification procedures. Other methods of making
variants are also familiar to those skilled in the art. These
include procedures in which nucleic acid sequences obtained from
natural isolates are modified to generate nucleic acids which
encode polypeptides having characteristics which enhance their
value in industrial or laboratory applications. In such procedures,
a large number of variant sequences having one or more nucleotide
differences with respect to the sequence obtained from the natural
isolate are generated and characterized. These nucleotide
differences can result in amino acid changes with respect to the
polypeptides encoded by the nucleic acids from the natural
isolates.
[0336] For example, variants may be created using error prone PCR.
In error prone PCR, PCR is performed under conditions where the
copying fidelity of the DNA polymerase is low, such that a high
rate of point mutations is obtained along the entire length of the
PCR product. Error prone PCR is described, e.g., in Leung, D. W.,
et al., Technique, 1:11-15, 1989) and Caldwell, R. C. & Joyce
G. F., PCR Methods Applic., 2:28-33, 1992. Briefly, in such
procedures, nucleic acids to be mutagenized are mixed with PCR
primers, reaction buffer, MgCl.sub.2, MnCl.sub.2, Taq polymerase
and an appropriate concentration of dNTPs for achieving a high rate
of point mutation along the entire length of the PCR product. For
example, the reaction may be performed using 20 fmoles of nucleic
acid to be mutagenized, 30 pmole of each PCR primer, a reaction
buffer comprising 50 mM KCl, 10 mM Tris HCl (pH 8.3) and 0.01%
gelatin, 7 mM MgCl.sub.2, 0.5 mM MnCl.sub.2, 5 units of Taq
polymerase, 0.2 mM dGTP, 0.2 mM dATP, 1 mM dCTP, and 1 mM dTTP. PCR
may be performed for 30 cycles of 94.degree. C. for 1 min,
45.degree. C. for 1 min, and 72.degree. C. for 1 min. However, it
will be appreciated that these parameters may be varied as
appropriate. The mutagenized nucleic acids are cloned into an
appropriate vector and the activities of the polypeptides encoded
by the mutagenized nucleic acids are evaluated.
[0337] Variants may also be created using oligonucleotide directed
mutagenesis to generate site-specific mutations in any cloned DNA
of interest. Oligonucleotide mutagenesis is described, e.g., in
Reidhaar-Olson (1988) Science 241:53-57. Briefly, in such
procedures a plurality of double stranded oligonucleotides bearing
one or more mutations to be introduced into the cloned DNA are
synthesized and inserted into the cloned DNA to be mutagenized.
Clones containing the mutagenized DNA are recovered and the
activities of the polypeptides they encode are assessed.
[0338] Another method for generating variants is assembly PCR.
Assembly PCR involves the assembly of a PCR product from a mixture
of small DNA fragments. A large number of different PCR reactions
occur in parallel in the same vial, with the products of one
reaction priming the products of another reaction. Assembly PCR is
described in, e.g., U.S. Pat. No. 5,965,408.
[0339] Still another method of generating variants is sexual PCR
mutagenesis. In sexual PCR mutagenesis, forced homologous
recombination occurs between DNA molecules of different but highly
related DNA sequence in vitro, as a result of random fragmentation
of the DNA molecule based on sequence homology, followed by
fixation of the crossover by primer extension in a PCR reaction.
Sexual PCR mutagenesis is described, e.g., in Stemmer (1994) Proc.
Natl. Acad. Sci. USA 91:10747-10751. Briefly, in such procedures a
plurality of nucleic acids to be recombined are digested with DNase
to generate fragments having an average size of 50-200 nucleotides.
Fragments of the desired average size are purified and resuspended
in a PCR mixture. PCR is conducted under conditions which
facilitate recombination between the nucleic acid fragments. For
example, PCR may be performed by resuspending the purified
fragments at a concentration of 10-30 ng/l in a solution of 0.2 mM
of each dNTP, 2.2 mM MgCl.sub.2, 50 mM KCL, 10 mM Tris HCl, pH 9.0,
and 0.1% Triton X-100. 2.5 units of Taq polymerase per 100:1 of
reaction mixture is added and PCR is performed using the following
regime: 94.degree. C. for 60 seconds, 94.degree. C. for 30 seconds,
50-55.degree. C. for 30 seconds, 72.degree. C. for 30 seconds
(30-45 times) and 72.degree. C. for 5 minutes. However, it will be
appreciated that these parameters may be varied as appropriate. In
some aspects, oligonucleotides may be included in the PCR
reactions. In other aspects, the Klenow fragment of DNA polymerase
I may be used in a first set of PCR reactions and Taq polymerase
may be used in a subsequent set of PCR reactions. Recombinant
sequences are isolated and the activities of the polypeptides they
encode are assessed.
[0340] Variants may also be created by in vivo mutagenesis. In some
aspects, random mutations in a sequence of interest are generated
by propagating the sequence of interest in a bacterial strain, such
as an E. coli strain, which carries mutations in one or more of the
DNA repair pathways. Such "mutator" strains have a higher random
mutation rate than that of a wild-type parent. Propagating the DNA
in one of these strains will eventually generate random mutations
within the DNA. Mutator strains suitable for use for in vivo
mutagenesis are described, e.g., in PCT Publication No. WO
91/16427.
[0341] Variants may also be generated using cassette mutagenesis.
In cassette mutagenesis a small region of a double stranded DNA
molecule is replaced with a synthetic oligonucleotide "cassette"
that differs from the native sequence. The oligonucleotide often
contains completely and/or partially randomized native
sequence.
[0342] Recursive ensemble mutagenesis may also be used to generate
variants. Recursive ensemble mutagenesis is an algorithm for
protein engineering (protein mutagenesis) developed to produce
diverse populations of phenotypically related mutants whose members
differ in amino acid sequence. This method uses a feedback
mechanism to control successive rounds of combinatorial cassette
mutagenesis. Recursive ensemble mutagenesis is described, e.g., in
Arkin (1992) Proc. Natl. Acad. Sci. USA 89:7811-7815.
[0343] In some aspects, variants are created using exponential
ensemble mutagenesis. Exponential ensemble mutagenesis is a process
for generating combinatorial libraries with a high percentage of
unique and functional mutants, wherein small groups of residues are
randomized in parallel to identify, at each altered position, amino
acids which lead to functional proteins. Exponential ensemble
mutagenesis is described, e.g., in Delegrave (1993) Biotechnology
Res. 11:1548-1552. Random and site-directed mutagenesis are
described, e.g., in Arnold (1993) Current Opinion in Biotechnology
4:450-455.
[0344] In some aspects, the variants are created using shuffling
procedures wherein portions of a plurality of nucleic acids which
encode distinct polypeptides are fused together to create chimeric
nucleic acid sequences which encode chimeric polypeptides as
described in, e.g., U.S. Pat. Nos. 5,965,408; 5,939,250.
[0345] Provided herein are variants of polypeptides comprising
sequences in which one or more of the amino acid residues (e.g., of
an exemplary polypeptide, e.g., SEQ ID NO:2, SEQ ID NO:4, SEQ ID
NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID
NO:16, SEQ ID NO:18, or SEQ ID NO:20 or SEQ ID NO:2 having one,
two, three, four, five, six, seven, eight or more (several) or all
the amino acid variations described in Table 3 or Table 4, or the
equivalent thereof) are substituted with a conserved or
non-conserved amino acid residue (e.g., a conserved amino acid
residue) and such substituted amino acid residue may or may not be
one encoded by the genetic code. Conservative substitutions are
those that substitute a given amino acid in a polypeptide by
another amino acid of like characteristics. Thus, polypeptides
herein include those with conservative substitutions of sequences,
e.g., the exemplary sequences as provided herein (e.g., SEQ ID
NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID
NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, or SEQ ID NO:20 or
SEQ ID NO:2 having one, two, three, four, five, six, seven, eight
or more (several) or all the amino acid variations described in
Table 3 or Table 4, or the equivalent thereof), including but not
limited to the following replacements: replacements of an aliphatic
amino acid such as alanine, valine, leucine and isoleucine with
another aliphatic amino acid; replacement of a serine with a
threonine or vice versa; replacement of an acidic residue such as
aspartic acid and glutamic acid with another acidic residue;
replacement of a residue bearing an amide group, such as asparagine
and glutamine, with another residue bearing an amide group;
exchange of a basic residue such as lysine and arginine with
another basic residue; and replacement of an aromatic residue such
as phenylalanine, tyrosine, or tryptophan with another aromatic
residue. Other variants are those in which one or more of the amino
acid residues of the polypeptides as provided herein includes a
substituent group.
[0346] Other variants within the scope as provided herein are those
in which the polypeptide is associated with another compound, such
as a compound to increase the half-life of the polypeptide, for
example, polyethylene glycol. Additional variants within the scope
as provided herein are those in which additional amino acids are
fused to the polypeptide, such as a leader sequence, a secretory
sequence, a proprotein sequence or a sequence which facilitates
purification, enrichment, or stabilization of the polypeptide. In
some aspects, the variants, fragments, derivatives and analogs of
the polypeptides as provided herein retain the same biological
function or activity as the exemplary polypeptides, e.g., a
proteolytic activity, as described herein. In other aspects, the
variant, fragment, derivative, or analog includes a proprotein,
such that the variant, fragment, derivative, or analog can be
activated by cleavage of the proprotein portion to produce an
active polypeptide.
Optimizing Codons to Achieve High Levels of Protein Expression in
Host Cells
[0347] In certain embodiments, provided herein are methods for
modifying hydrolase-encoding nucleic acids to modify codon usage.
In one embodiment, provided herein are methods for modifying codons
in a nucleic acid encoding a hydrolase to increase or decrease its
expression in a host cell, e.g., a bacterial, insect, mammalian,
yeast or plant cell. Further provided herein are nucleic acids
encoding a hydrolase modified to increase its expression in a host
cell, hydrolase so modified, and methods of making the modified
hydrolases. The method comprises identifying a "non-preferred" or a
"less preferred" codon in hydrolase-encoding nucleic acid and
replacing one or more of these non-preferred or less preferred
codons with a "preferred codon" encoding the same amino acid as the
replaced codon and at least one non-preferred or less preferred
codon in the nucleic acid has been replaced by a preferred codon
encoding the same amino acid. A preferred codon is a codon
over-represented in coding sequences in genes in the host cell and
a non-preferred or less preferred codon is a codon
under-represented in coding sequences in genes in the host
cell.
[0348] Host cells for expressing the nucleic acids, expression
cassettes and vectors as provided herein include bacteria, yeast,
fungi, plant cells, insect cells and mammalian cells. In certain
embodiments, provided herein are methods for optimizing codon usage
in all of these cells, codon-altered nucleic acids and polypeptides
made by the codon-altered nucleic acids. Exemplary host cells
include gram negative bacteria, such as Escherichia coli and
Pseudomonas fluorescens; gram positive bacteria, such as
Lactobacillus gasseri, Lactococcus lactis, Lactococcus cremoris,
Bacillus subtilis. Exemplary host cells also include eukaryotic
organisms, e.g., various yeast, such as Saccharomyces sp.,
including Saccharomyces cerevisiae, Schizosaccharomyces pombe,
Pichia pastoris, and Kluyveromyces lactis, Hansenula polymorpha,
Aspergillus niger, and mammalian cells and cell lines and insect
cells and cell lines. Other exemplary host cells include bacterial
cells, such as E. coli, Streptomyces, Bacillus subtilis, Bacillus
cereus, Salmonella typhimurium and various species within the
genera Pseudomonas, Streptomyces and Staphylococcus, fungal cells,
such as Aspergillus, yeast such as any species of Pichia,
Saccharomyces, Schizosaccharomyces, Schwanniomyces, including
Pichia pastoris, Saccharomyces cerevisiae, or Schizosaccharomyces
pombe, insect cells such as Drosophila S2 and Spodoptera Sf9,
animal cells such as CHO, COS or Bowes melanoma and adenoviruses.
The selection of an appropriate host is within the abilities of
those skilled in the art. In certain embodiments, provided herein
are nucleic acids and polypeptides optimized for expression in
these organisms and species.
[0349] For example, the codons of a nucleic acid encoding a
hydrolase isolated from a bacterial cell are modified such that the
nucleic acid is optimally expressed in a bacterial cell different
from the bacteria from which the hydrolase was derived, a yeast, a
fungi, a plant cell, an insect cell or a mammalian cell. Methods
for optimizing codons are well known in the art, see, e.g., U.S.
Pat. No. 5,795,737; Baca (2000) Int. J. Parasitol. 30:113-118; Hale
(1998) Protein Expr. Purif. 12:185-188; Narum (2001) Infect. Immun.
69:7250-7253. See also Narum (2001) Infect. Immun. 69:7250-7253,
describing optimizing codons in mouse systems; Outchkourov (2002)
Protein Expr. Purif. 24:18-24, describing optimizing codons in
yeast; Feng (2000) Biochemistry 39:15399-15409, describing
optimizing codons in E. coli; Humphreys (2000) Protein Expr. Purif.
20:252-264, describing optimizing codon usage that affects
secretion in E. coli.
Transgenic Non-Human Animals
[0350] In certain embodiments, provided herein are transgenic
non-human animals comprising a nucleic acid, a polypeptide (e.g., a
hydrolase or an antibody as provided herein), an expression
cassette, a vector, a transfected or a transformed cell as provided
herein. The transgenic non-human animals can be, e.g., goats,
rabbits, sheep, pigs, cows, rats and mice, comprising the nucleic
acids as provided herein. These animals can be used, e.g., as in
vivo models to study hydrolase activity, or, as models to screen
for agents that change the hydrolase activity in vivo. The coding
sequences for the polypeptides to be expressed in the transgenic
non-human animals can be designed to be constitutive, or, under the
control of tissue-specific, developmental-specific or inducible
transcriptional regulatory factors. Transgenic non-human animals
can be designed and generated using any method known in the art;
see, e.g., U.S. Pat. Nos. 6,211,428; 6,187,992; 6,156,952;
6,118,044; 6,111,166; 6,107,541; 5,959,171; 5,922,854; 5,892,070;
5,880,327; 5,891,698; 5,639,940; 5,573,933; 5,387,742; 5,087,571,
describing making and using transformed cells and eggs and
transgenic mice, rats, rabbits, sheep, pigs and cows. See also,
e.g., Pollock (1999) J. Immunol. Methods 231:147-157, describing
the production of recombinant proteins in the milk of transgenic
dairy animals; Baguisi (1999) Nat. Biotechnol. 17:456-461,
demonstrating the production of transgenic goats. U.S. Pat. No.
6,211,428, describes making and using transgenic non-human mammals
which express in their brains a nucleic acid construct comprising a
DNA sequence. U.S. Pat. No. 5,387,742, describes injecting cloned
recombinant or synthetic DNA sequences into fertilized mouse eggs,
implanting the injected eggs in pseudo-pregnant females, and
growing to term transgenic mice whose cells express proteins
related to the pathology of Alzheimer's disease. U.S. Pat. No.
6,187,992, describes making and using a transgenic mouse whose
genome comprises a disruption of the gene encoding amyloid
precursor protein (APP).
[0351] "Knockout animals" can also be used to practice the methods
as provided herein. For example, in one aspect, the transgenic or
modified animals as provided herein comprise a "knockout animal,"
e.g., a "knockout mouse," engineered not to express an endogenous
gene, which is replaced with a gene expressing a hydrolase, or, a
fusion protein comprising a hydrolase as provided herein. As noted
above, functional knockouts can also be generated using antisense
sequences as provided herein, e.g., double-stranded RNAi
molecules.
Transgenic Plants and Seeds
[0352] In certain embodiments, provided herein are transgenic
plants and seeds comprising a nucleic acid, a polypeptide (e.g., a
hydrolase or an antibody as provided herein), an expression
cassette or vector or a transfected or transformed cell as provided
herein. The transgenic plant can be dicotyledonous (a dicot) or
monocotyledonous (a monocot). In one embodiment, provided herein
are methods of making and using these transgenic plants and seeds.
The transgenic plant or plant cell expressing a polypeptide as
provided herein may be constructed in accordance with any method
known in the art. See, for example, U.S. Pat. No. 6,309,872.
[0353] Nucleic acids and expression constructs as provided herein
can be introduced into a plant cell by any means. For example,
nucleic acids or expression constructs can be introduced into the
genome of a desired plant host, or, the nucleic acids or expression
constructs can be episomes. Introduction into the genome of a
desired plant can be such that the host's hydrolase production is
regulated by endogenous transcriptional or translational control
elements. In one aspect, provided herein are "knockout plants"
where insertion of gene sequence by, e.g., homologous
recombination, has disrupted the expression of the endogenous gene.
Means to generate "knockout" plants are well-known in the art, see,
e.g., Strepp (1998) Proc Natl. Acad. Sci. USA 95:4368-4373; Miao
(1995) Plant J 7:359-365. See discussion on transgenic plants,
below.
[0354] The nucleic acids as provided herein can be used to confer
desired traits on essentially any plant, e.g., on oilseed producing
plants, including rice bran, rapeseed (canola), sunflower, olive,
palm or soy, and the like, or on glucose or starch-producing
plants, such as corn, potato, wheat, rice, barley, and the like.
Nucleic acids as provided herein can be used to manipulate
metabolic pathways of a plant in order to optimize or alter host's
expression of a hydrolase or a substrate or product of a hydrolase,
e.g., an oil, a lipid, such as a mono-, di- or tri-acylglyceride
and the like. The can change the ratios of lipids, lipid conversion
and turnover in a plant. This can facilitate industrial processing
of a plant. Alternatively, hydrolases as provided herein can be
used in production of a transgenic plant to produce a compound not
naturally produced by that plant. This can lower production costs
or create a novel product.
[0355] In one aspect, the first step in production of a transgenic
plant involves making an expression construct for expression in a
plant cell. These techniques are well known in the art. They can
include selecting and cloning a promoter, a coding sequence for
facilitating efficient binding of ribosomes to mRNA and selecting
the appropriate gene terminator sequences. One exemplary
constitutive promoter is CaMV35S, from the cauliflower mosaic
virus, which generally results in a high degree of expression in
plants. Other promoters are more specific and respond to cues in
the plant's internal or external environment. An exemplary
light-inducible promoter is the promoter from the cab gene,
encoding the major chlorophyll a/b binding protein.
[0356] In one aspect, the nucleic acid is modified to achieve
greater expression in a plant cell. For example, a sequence as
provided herein is likely to have a higher percentage of A-T
nucleotide pairs compared to that seen in a plant, some of which
prefer G-C nucleotide pairs. Therefore, A-T nucleotides in the
coding sequence can be substituted with G-C nucleotides without
significantly changing the amino acid sequence to enhance
production of the gene product in plant cells.
[0357] Selectable marker gene can be added to the gene construct in
order to identify plant cells or tissues that have successfully
integrated the transgene. This may be necessary because achieving
incorporation and expression of genes in plant cells is a rare
event, occurring in just a few percent of the targeted tissues or
cells. Selectable marker genes encode proteins that provide
resistance to agents that are normally toxic to plants, such as
antibiotics or herbicides. Only plant cells that have integrated
the selectable marker gene will survive when grown on a medium
containing the appropriate antibiotic or herbicide. As for other
inserted genes, marker genes also require promoter and termination
sequences for proper function.
[0358] In one aspect, making transgenic plants or seeds comprises
incorporating sequences as provided herein and, optionally, marker
genes into a target expression construct (e.g., a plasmid, a
phage), along with positioning of the promoter and the terminator
sequences. This can involve transferring the modified gene into the
plant through a suitable method. For example, a construct may be
introduced directly into the genomic DNA of the plant cell using
techniques such as electroporation and microinjection of plant cell
protoplasts, or the constructs can be introduced directly to plant
tissue using ballistic methods, such as DNA particle bombardment.
For example, see, e.g., Christou (1997) Plant Mol. Biol.
35:197-203; Pawlowski (1996) Mol. Biotechnol. 6:17-30; Klein (1987)
Nature 327:70-73; Takumi (1997) Genes Genet. Syst. 72:63-69,
discussing use of particle bombardment to introduce transgenes into
wheat; and Adam (1997) supra, for use of particle bombardment to
introduce YACs into plant cells. For example, Rinehart (1997)
supra, used particle bombardment to generate transgenic cotton
plants. Apparatus for accelerating particles is described U.S. Pat.
No. 5,015,580; and, the commercially available BioRad (Biolistics)
PDS-2000 particle acceleration instrument; see also, John, U.S.
Pat. No. 5,608,148; and Ellis, U.S. Pat. No. 5,681,730, describing
particle-mediated transformation of gymnosperms.
[0359] In one aspect, protoplasts can be immobilized and injected
with a nucleic acids, e.g., an expression construct. Although plant
regeneration from protoplasts is not easy with cereals, plant
regeneration is possible in legumes using somatic embryogenesis
from protoplast derived callus. Organized tissues can be
transformed with naked DNA using gene gun technique, where DNA is
coated on tungsten microprojectiles, shot 1/100th the size of
cells, which carry the DNA deep into cells and organelles.
Transformed tissue is then induced to regenerate, usually by
somatic embryogenesis. This technique has been successful in
several cereal species including maize and rice.
[0360] Nucleic acids, e.g., expression constructs, can also be
introduced in to plant cells using recombinant viruses. Plant cells
can be transformed using viral vectors, such as, e.g., tobacco
mosaic virus derived vectors (Rouwendal (1997) Plant Mol. Biol.
33:989-999), see Porta (1996) "Use of viral replicons for the
expression of genes in plants," Mol. Biotechnol. 5:209-221.
[0361] Alternatively, nucleic acids, e.g., an expression construct,
can be combined with suitable T-DNA flanking regions and introduced
into a conventional Agrobacterium tumefaciens host vector. The
virulence functions of the Agrobacterium tumefaciens host will
direct the insertion of the construct and adjacent marker into the
plant cell DNA when the cell is infected by the bacteria.
Agrobacterium tumefaciens-mediated transformation techniques,
including disarming and use of binary vectors, are well described
in the scientific literature. See, e.g., Horsch (1984) Science
233:496-498; Fraley (1983) Proc. Natl. Acad. Sci. USA 80:4803
(1983); Gene Transfer to Plants, Potrykus, ed. (Springer-Verlag,
Berlin 1995). The DNA in an A. tumefaciens cell is contained in the
bacterial chromosome as well as in another structure known as a Ti
(tumor-inducing) plasmid. The Ti plasmid contains a stretch of DNA
termed T-DNA (-20 kb long) that is transferred to the plant cell in
the infection process and a series of vir (virulence) genes that
direct the infection process. A. tumefaciens can only infect a
plant through wounds: when a plant root or stem is wounded it gives
off certain chemical signals, in response to which, the vir genes
of A. tumefaciens become activated and direct a series of events
necessary for the transfer of the T-DNA from the Ti plasmid to the
plant's chromosome. The T-DNA then enters the plant cell through
the wound. One speculation is that the T-DNA waits until the plant
DNA is being replicated or transcribed, then inserts itself into
the exposed plant DNA. In order to use A. tumefaciens as a
transgene vector, the tumor-inducing section of T-DNA have to be
removed, while retaining the T-DNA border regions and the vir
genes. The transgene is then inserted between the T-DNA border
regions, where it is transferred to the plant cell and becomes
integrated into the plant's chromosomes.
[0362] In certain embodiments, provided herein are methods for the
transformation of monocotyledonous plants using the nucleic acids
as provided herein, including important cereals, see Hiei (1997)
Plant Mol. Biol. 35:205-218. See also, e.g., Horsch, Science (1984)
233:496; Fraley (1983) Proc. Natl. Acad. Sci USA 80:4803; Thykjaer
(1997) supra; Park (1996) Plant Mol. Biol. 32:1135-1148, discussing
T-DNA integration into genomic DNA. See also D'Halluin, U.S. Pat.
No. 5,712,135, describing a process for the stable integration of a
DNA comprising a gene that is functional in a cell of a cereal, or
other monocotyledonous plant.
[0363] In one aspect, the third step can involve selection and
regeneration of whole plants capable of transmitting the
incorporated target gene to the next generation. Such regeneration
techniques rely on manipulation of certain phytohormones in a
tissue culture growth medium, typically relying on a biocide and/or
herbicide marker that has been introduced together with the desired
nucleotide sequences. Plant regeneration from cultured protoplasts
is described in Evans et al., Protoplasts Isolation and Culture,
Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing
Company, New York, 1983; and Binding, Regeneration of Plants, Plant
Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration
can also be obtained from plant callus, explants, organs, or parts
thereof. Such regeneration techniques are described generally in
Klee (1987) Ann. Rev. of Plant Phys. 38:467-486. To obtain whole
plants from transgenic tissues such as immature embryos, they can
be grown under controlled environmental conditions in a series of
media containing nutrients and hormones, a process known as tissue
culture. Once whole plants are generated and produce seed,
evaluation of the progeny begins.
[0364] After the expression cassette is stably incorporated in
transgenic plants, it can be introduced into other plants by sexual
crossing. Any of a number of standard breeding techniques can be
used, depending upon the species to be crossed. Since transgenic
expression of the nucleic acids as provided herein leads to
phenotypic changes, plants comprising the recombinant nucleic acids
as provided herein can be sexually crossed with a second plant to
obtain a final product. Thus, the seed as provided herein can be
derived from a cross between two transgenic plants as provided
herein, or a cross between a plant as provided herein and another
plant. The desired effects (e.g., expression of the polypeptides as
provided herein to produce a plant with altered, increased and/or
decreased lipid or oil content) can be enhanced when both parental
plants express the polypeptides as provided herein. The desired
effects can be passed to future plant generations by standard
propagation means.
[0365] The nucleic acids and polypeptides as provided herein are
expressed in or inserted in any plant or seed. Transgenic plants as
provided herein can be dicotyledonous or monocotyledonous. Examples
of monocot transgenic plants as provided herein are grasses, such
as meadow grass (blue grass, Poa), forage grass such as festuca,
lolium, temperate grass, such as Agrostis, and cereals, e.g.,
wheat, oats, rye, barley, rice, sorghum, and maize (corn). Examples
of dicot transgenic plants as provided herein are tobacco, legumes,
such as lupins, potato, sugar beet, pea, bean and soybean, and
cruciferous plants (family Brassicaceae), such as cauliflower, rape
seed, and the closely related model organism Arabidopsis thaliana.
Thus, the transgenic plants and seeds as provided herein include a
broad range of plants, including, but not limited to, species from
the genera Anacardium, Arachis, Asparagus, Atropa, Avena, Brassica,
Citrus, Citrullus, Capsicum, Carthamus, Cocos, Coffea, Cucumis,
Cucurbita, Daucus, Elaeis, Fragaria, Glycine, Gossypium,
Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum,
Lolium, Lupinus, Lycopersicon, Malus, Manihot, Majorana, Medicago,
Nicotiana, Olea, Oryza, Panieum, Pannisetum, Persea, Phaseolus,
Pistachia, Pisum, Pyrus, Prunus, Raphanus, Ricinus, Secale,
Senecio, Sinapis, Solanum, Sorghum, Theobromus, Trigonella,
Triticum, Vicia, Vitis, Vigna, and Zea.
[0366] In alternative embodiments, the nucleic acids as provided
herein are expressed in plants which contain fiber cells,
including, e.g., cotton, silk cotton tree (Kapok, Ceiba pentandra),
desert willow, creosote bush, winterfat, balsa, ramie, kenaf, hemp,
roselle, jute, sisal abaca and flax. In alternative embodiments,
the transgenic plants as provided herein can be members of the
genus Gossypium, including members of any Gossypium species, such
as G. arboreum;. G. herbaceum, G. barbadense, and G. hirsutum.
[0367] In certain embodiments, the transgenic plants herein can be
used for producing large amounts of the polypeptides (e.g.,
antibodies, hydrolases) as provided herein. For example, see
Palmgren (1997) Trends Genet. 13:348; Chong (1997) Transgenic Res.
6:289-296 (producing human milk protein beta-casein in transgenic
potato plants using an auxin-inducible, bidirectional mannopine
synthase (mas1',2') promoter with Agrobacterium
tumefaciens-mediated leaf disc transformation methods).
[0368] Using known procedures, one of skill can screen for plants
as provided herein by detecting the increase or decrease of
transgene mRNA or protein in transgenic plants. Means for detecting
and quantitation of mRNAs or proteins are well known in the
art.
[0369] Provided herein are fatty acids or fatty acid derivatives
from transgenic plants as provided herein, e.g., transgenic
oleaginous plants. In one aspect, transgenic oleaginous plants
comprising at least one hydrolase as provided herein are produced.
In one aspect, the transgenic plant comprises a hydrolase gene
operably linked to a promoter, permitting an expression of the gene
either in cellular, extracellular or tissue compartments other than
those in which the plant lipids accumulate, or permitting exogenous
induction of the hydrolase. In one aspect, seeds and/or fruits
containing the lipids of the plants are collected, the seeds and/or
fruits are crushed (if necessary after hydrolase (e.g., lipase,
saturase, palmitase and/or stearatase) gene-induction treatment) so
as to bring into contact the lipids and hydrolase as provided
herein contained in the seeds and/or fruits. The mixture can be
allowed to incubate to allow enzymatic hydrolysis of the lipids of
the ground material by catalytic action of the lipase as provided
herein contained in the crushed material. In one aspect, the fatty
acids formed by the hydrolysis are extracted and/or are converted
in order to obtain the desired fatty acid derivatives.
[0370] This enzymatic hydrolysis process as provided herein uses
mild operating conditions and can be small-scale and use
inexpensive installations. In this aspect the plant as provided
herein is induced to produce the hydrolase for transformation of
plant lipids. Using this strategy, the enzyme is prevented from
coming into contact with stored plant lipids so as to avoid any
risk of premature hydrolysis ("self-degradation of the plant")
before harvesting. The crushing and incubating units can be light
and small-scale; many are known in the agricultural industry and
can be carried out at the sites where the plants are harvested.
[0371] In one aspect, transgenic plants as provided herein are
produced by transformation of natural oleaginous plants. The
genetically transformed plants as provided herein are then
reproduced sexually so as to produce transgenic seeds as provided
herein. These seeds can be used to obtain transgenic plant
progeny.
[0372] In one aspect, the hydrolase gene is operably linked to an
inducible promoter to prevent any premature contact of hydrolase
and plant lipid. This promoter can direct the expression of the
gene in compartments other than those where the lipids accumulate
or the promoter can initiate the expression of the hydrolase at a
desired time by an exogenous induction.
Polypeptides and Peptides
[0373] In certain embodiments, provided herein are isolated,
synthetic or recombinant polypeptides having a sequence identity
(e.g., at least 50% sequence identity) to SEQ ID NO:2, SEQ ID NO:4,
SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14,
SEQ ID NO:16, SEQ ID NO:18, or SEQ ID NO:20 or SEQ ID NO:2 having
one, two, three, four, five, six, seven, eight or more (several) or
all the amino acid variations described in Table 3 or Table 4, or
the equivalent thereof. In certain embodiments, provided herein are
nucleic acids encoding polypeptides having a sequence as set forth
in SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID
NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, or
SEQ ID NO:20 or SEQ ID NO:2 having one, two, three, four, five,
six, seven, eight or more (several) or all the amino acid
variations described in Table 3 or Table 4, or the equivalent
thereof.
[0374] The sequence identity can be over the full length of the
polypeptide, or, the identity can be over a region of at least
about 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450,
500, 550, 600, 650, 700 or more residues. Polypeptides as provided
herein can also be shorter than the full length of exemplary
polypeptides. In one aspect provided herein are polypeptides
comprising only a subsequence of a sequence as provided herein,
exemplary subsequences can be about 5, 10, 15, 20, 25, 30, 35, 40,
45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 125, 150, 175, 200,
250, 300, 350, 400, 450, 500, 550, 600, 650, 700, or more residues.
In alternative aspects, polypeptides (peptides, fragments) can
range in size between about 5 and the full length of a polypeptide,
e.g., an enzyme as provided herein; exemplary sizes being of about
5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85,
90, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550,
600, 650, 700, or more residues, e.g., contiguous residues of an
exemplary hydrolase as provided herein. Peptides as provided herein
can be useful as, e.g., labeling probes, antigens, toleragens,
motifs, hydrolase active sites.
[0375] Polypeptides as provided herein also include antibodies
capable of binding to a hydrolase as provided herein.
[0376] Polypeptides as provided herein also include amino acid
sequences that are "substantially identical" to sequences as
provided herein, including sequences that differ from a reference
sequence by one or more conservative or non-conservative amino acid
substitutions, deletions, or insertions, particularly when such a
substitution occurs at a site that is not the active site of the
molecule, and provided that the polypeptide essentially retains its
functional properties. A conservative amino acid substitution, for
example, substitutes one amino acid for another of the same class
(e.g., substitution of one hydrophobic amino acid, such as
isoleucine, valine, leucine, or methionine, for another, or
substitution of one polar amino acid for another, such as
substitution of arginine for lysine, glutamic acid for aspartic
acid or glutamine for asparagine). One or more amino acids can be
deleted, for example, from a hydrolase, resulting in modification
of the structure of the polypeptide, without significantly altering
its biological activity. For example, amino- or carboxyl-terminal
amino acids that are not required for hydrolase activity can be
removed.
[0377] "Amino acid" or "amino acid sequence" can include an
oligopeptide, peptide, polypeptide, or protein sequence, or to a
fragment, portion, or subunit of any of these, and to naturally
occurring or synthetic molecules.
[0378] The terms "polypeptide" and "protein" can include amino
acids joined to each other by peptide bonds or modified peptide
bonds, i.e., peptide isosteres, and may contain modified amino
acids other than the 20 gene-encoded amino acids. The term
"polypeptide" also includes peptides and polypeptide fragments,
motifs and the like. The term also includes glycosylated
polypeptides. The peptides and polypeptides as provided herein also
include all "mimetic" and "peptidomimetic" forms, as described in
further detail, below.
[0379] The polypeptides as provided herein include hydrolases in an
active or inactive form. For example, the polypeptides as provided
herein include proproteins before "maturation" or processing of
prepro sequences, e.g., by a proprotein-processing enzyme, such as
a proprotein convertase to generate an "active" mature protein. The
polypeptides as provided herein include hydrolases inactive for
other reasons, e.g., before "activation" by a post-translational
processing event, e.g., an endo- or exo-peptidase or proteinase
action, a phosphorylation event, an amidation, a glycosylation or a
sulfation, a dimerization event, and the like. Methods for
identifying "prepro" domain sequences and signal sequences are well
known in the art, see, e.g., Van de Ven (1993) Crit. Rev. Oncog.
4(2):115-136. For example, to identify a prepro sequence, the
protein is purified from the extracellular space and the N-terminal
protein sequence is determined and compared to the unprocessed
form.
[0380] The polypeptides as provided herein include all active
forms, including active subsequences, e.g., catalytic domains or
active sites, of an enzyme as provided herein. In certain
embodiments, provided herein are catalytic domains or active sites
as set forth below. In other embodiments, provided herein are
peptides or polypeptides comprising or consisting of an active site
domain as predicted through use of a database such as Pfam (which
is a large collection of multiple sequence alignments and hidden
Markov models covering many common protein families, The Pfam
protein families database, A. Bateman, E. Birney, L. Cerruti, R.
Durbin, L. Etwiller, S. R. Eddy, S. Griffiths-Jones, K. L. Howe, M.
Marshall, and E. L. L. Sonnhammer, Nucleic Acids Research,
30(1):276-280, 2002) or equivalent.
[0381] In certain embodiments, provided herein are polypeptides
with or without a signal sequence and/or a prepro sequence. In one
embodiment, provided herein are polypeptides with heterologous
signal sequences and/or prepro sequences. The prepro sequence
(including a sequence as provided herein used as a heterologous
prepro domain) can be located on the amino terminal or the carboxy
terminal end of the protein. In another embodiment, provided herein
are isolated, synthetic or recombinant signal sequences, prepro
sequences and catalytic domains (e.g., "active sites") comprising
or consisting of sequences as provided herein. The signal sequence,
prepro domains and/or catalytic domain as provided herein can be
part of a fusion protein, e.g., as a heterologous domain in a
chimeric protein. In certain embodiments, provided herein are
nucleic acids encoding these catalytic domains (CDs), prepro
domains and signal sequences (SPs, e.g., a peptide having a
sequence comprising/consisting of amino terminal residues of a
polypeptide as provided herein). In certain embodiments, provided
herein are signal sequences comprising a peptide
comprising/consisting of a sequence as set forth in residues 1 to
12, 1 to 13, 1 to 14, 1 to 15, 1 to 16, 1 to 17, 1 to 18, 1 to 19,
1 to 20, 1 to 21, 1 to 22, 1 to 23, 1 to 24, 1 to 25, 1 to 26, 1 to
27, 1 to 28, 1 to 28, 1 to 30, 1 to 31, 1 to 32, 1 to 33, 1 to 34,
1 to 35, 1 to 36, 1 to 37, 1 to 38, 1 to 39, 1 to 40, 1 to 41, 1 to
42, 1 to 43, 1 to 44, 1 to 45, 1 to 46, 1 to 47, 1 to 48, 1 to 49
or 1 to 50, of a polypeptide as provided herein.
[0382] Polypeptides and peptides as provided herein can be isolated
from natural sources, be synthetic, or be recombinantly generated
polypeptides. Peptides and proteins can be recombinantly expressed
in vitro or in vivo. The peptides and polypeptides as provided
herein can be made and isolated using any method known in the art.
Polypeptide and peptides as provided herein can also be
synthesized, whole or in part, using chemical methods well known in
the art. See e.g., Caruthers (1980) Nucleic Acids Res. Symp. Ser.
215-223; Horn (1980) Nucleic Acids Res. Symp. Ser. 225-232; Banga,
A. K., Therapeutic Peptides and Proteins, Formulation, Processing
and Delivery Systems (1995) Technomic Publishing Co., Lancaster,
Pa. For example, peptide synthesis can be performed using various
solid-phase techniques (see e.g., Roberge (1995) Science 269:202;
Merrifield (1997) Methods Enzymol. 289:3-13) and automated
synthesis may be achieved, e.g., using the ABI 431A Peptide
Synthesizer (Perkin Elmer) in accordance with the instructions
provided by the manufacturer.
[0383] The peptides and polypeptides as provided herein can also be
glycosylated. The glycosylation can be added post-translationally
either chemically or by cellular biosynthetic mechanisms, wherein
the later incorporates the use of known glycosylation motifs, which
can be native to the sequence or can be added as a peptide or added
in the nucleic acid coding sequence. The glycosylation can be
O-linked or N-linked.
[0384] "Recombinant" polypeptides or proteins refer to polypeptides
or proteins produced by recombinant DNA techniques; i.e., produced
from cells transformed by an exogenous DNA construct encoding the
desired polypeptide or protein. "Synthetic" nucleic acids
(including oligonucleotides), polypeptides or proteins as provided
herein include those prepared by any chemical synthesis, e.g., as
described, below.
[0385] "Fragments" as used herein are a portion of a naturally
occurring protein which can exist in at least two different
conformations. Fragments can have the same or substantially the
same amino acid sequence as the naturally occurring protein.
"Enzymatically active fragments" as used herein are a portion of an
amino acid sequence (encoding a protein) which retains at least one
functional activity of the protein to which it is related.
"Substantially the same" means that an amino acid sequence is
largely, but not entirely, the same, but retains at least one
functional activity of the sequence to which it is related. In
general two amino acid sequences are "substantially the same" or
"substantially homologous" if they are at least about 85%
identical. Fragments which have different three dimensional
structures as the naturally occurring protein are also included. An
example of this, is a "pro-form" molecule, such as a low activity
proprotein that can be modified by cleavage to produce a mature
enzyme with significantly higher activity.
[0386] The peptides and polypeptides as provided herein, as defined
above, include all "mimetic" and "peptidomimetic" forms. The terms
"mimetic" and "peptidomimetic" refer to a synthetic chemical
compound which has substantially the same structural and/or
functional characteristics of the polypeptides as provided herein.
The mimetic can be either entirely composed of synthetic,
non-natural analogues of amino acids, or, is a chimeric molecule of
partly natural peptide amino acids and partly non-natural analogs
of amino acids. The mimetic can also incorporate any amount of
natural amino acid conservative substitutions, as long as such
substitutions also do not substantially alter the mimetic's
structure and/or activity. As with polypeptides as provided herein
which are conservative variants, routine experimentation will
determine whether a mimetic is within the scope as provided herein,
i.e., that its structure and/or function is not substantially
altered. Thus, in one aspect, a mimetic composition is within the
scope as provided herein if it has a hydrolase activity.
[0387] Polypeptide mimetic compositions as provided herein can
contain any combination of non-natural structural components. In
alternative aspect, mimetic compositions as provided herein include
one or all of the following three structural groups: a) residue
linkage groups other than the natural amide bond ("peptide bond")
linkages; b) non-natural residues in place of naturally occurring
amino acid residues; or c) residues which induce secondary
structural mimicry, i.e., to induce or stabilize a secondary
structure, e.g., a beta turn, gamma turn, beta sheet, alpha helix
conformation, and the like. For example, a polypeptide as provided
herein can be characterized as a mimetic when all or some of its
residues are joined by chemical means other than natural peptide
bonds. Individual peptidomimetic residues can be joined by peptide
bonds, other chemical bonds or coupling means, such as, e.g.,
glutaraldehyde, N-hydroxysuccinimide esters, bifunctional
maleimides, N,N'-dicyclohexylcarbodiimide (DCC) or
N,N'-diisopropylcarbodiimide (DIC). Linking groups that can be an
alternative to the traditional amide bond ("peptide bond") linkages
include, e.g., ketomethylene (e.g., --C(.dbd.O)--CH.sub.2-- for
--C(.dbd.O)--NH--), aminomethylene (CH.sub.2--NH), ethylene, olefin
(CH.dbd.CH), ether (CH.sub.2--O), thioether (CH.sub.2--S),
tetrazole (CN.sub.4--), thiazole, retroamide, thioamide, or ester
(see, e.g., Spatola (1983) in Chemistry and Biochemistry of Amino
Acids, Peptides and Proteins, Vol. 7, pp 267-357, "Peptide Backbone
Modifications," Marcell Dekker, NY).
[0388] A polypeptide as provided herein can also be characterized
as a mimetic by containing all or some non-natural residues in
place of naturally occurring amino acid residues. Non-natural
residues are well described in the scientific and patent
literature; a few exemplary non-natural compositions useful as
mimetics of natural amino acid residues and guidelines are
described below. Mimetics of aromatic amino acids can be generated
by replacing by, e.g., D- or L-naphylalanine; D- or
L-phenylglycine; D- or L-2 thieneylalanine; D- or L-1, -2, 3-, or
4-pyreneylalanine; D- or L-3 thieneylalanine; D- or
L-(2-pyridinyl)-alanine; D- or L-(3-pyridinyl)-alanine; D- or
L-(2-pyrazinyl)-alanine; D- or L-(4-isopropyl)-phenylglycine;
D-(trifluoromethyl)-phenylglycine;
D-(trifluoromethyl)-phenylalanine; D-p-fluoro-phenylalanine; D- or
L-p-biphenylphenylalanine; D- or L-p-methoxy-biphenylphenylalanine;
D- or L-2-indole(alkyl)alanines; and, D- or L-alkylainines, where
alkyl can be substituted or unsubstituted methyl, ethyl, propyl,
hexyl, butyl, pentyl, isopropyl, iso-butyl, sec-isotyl, iso-pentyl,
or a non-acidic amino acids. Aromatic rings of a non-natural amino
acid include, e.g., thiazolyl, thiophenyl, pyrazolyl,
benzimidazolyl, naphthyl, furanyl, pyrrolyl, and pyridyl aromatic
rings.
[0389] Mimetics of acidic amino acids can be generated by
substitution by, e.g., non-carboxylate amino acids while
maintaining a negative charge; (phosphono)alanine; sulfated
threonine. Carboxyl side groups (e.g., aspartyl or glutamyl) can
also be selectively modified by reaction with carbodiimides
(R'-N-C-N-R') such as, e.g., 1-cyclohexyl-3(2-morpholinyl-(4-ethyl)
carbodiimide or 1-ethyl-3(4-azonia-4,4-dimetholpentyl)
carbodiimide. Aspartyl or glutamyl can also be converted to
asparaginyl and glutaminyl residues by reaction with ammonium ions.
Mimetics of basic amino acids can be generated by substitution
with, e.g., (in addition to lysine and arginine) the amino acids
ornithine, citrulline, or (guanidino)-acetic acid, or
(guanidino)alkyl-acetic acid, where alkyl is defined above. Nitrile
derivative (e.g., containing the CN-moiety in place of COOH) can be
substituted for asparagine or glutamine. Asparaginyl and glutaminyl
residues can be deaminated to the corresponding aspartyl or
glutamyl residues. Arginine residue mimetics can be generated by
reacting arginyl with, e.g., one or more conventional reagents,
including, e.g., phenylglyoxal, 2,3-butanedione,
1,2-cyclo-hexanedione, or ninhydrin, alternatively under alkaline
conditions. Tyrosine residue mimetics can be generated by reacting
tyrosyl with, e.g., aromatic diazonium compounds or
tetranitromethane. N-acetylimidizol and tetranitromethane can be
used to form O-acetyl tyrosyl species and 3-nitro derivatives,
respectively. Cysteine residue mimetics can be generated by
reacting cysteinyl residues with, e.g., alpha-haloacetates such as
2-chloroacetic acid or chloroacetamide and corresponding amines; to
give carboxymethyl or carboxyamidomethyl derivatives. Cysteine
residue mimetics can also be generated by reacting cysteinyl
residues with, e.g., bromo-trifluoroacetone,
alpha-bromo-beta-(5-imidozoyl) propionic acid; chloroacetyl
phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide; methyl
2-pyridyl disulfide; p-chloromercuribenzoate; 2-chloromercuri-4
nitrophenol; or, chloro-7-nitrobenzo-oxa-1,3-diazole. Lysine
mimetics can be generated (and amino terminal residues can be
altered) by reacting lysinyl with, e.g., succinic or other
carboxylic acid anhydrides. Lysine and other alpha-amino-containing
residue mimetics can also be generated by reaction with
imidoesters, such as methyl picolinimidate, pyridoxal phosphate,
pyridoxal, chloroborohydride, trinitro-benzenesulfonic acid,
O-methylisourea, 2,4, pentanedione, and transamidase-catalyzed
reactions with glyoxylate. Mimetics of methionine can be generated
by reaction with, e.g., methionine sulfoxide. Mimetics of proline
include, e.g., pipecolic acid, thiazolidine carboxylic acid, 3- or
4-hydroxy proline, dehydroproline, 3- or 4-methylproline, or
3,3,-dimethylproline. Histidine residue mimetics can be generated
by reacting histidyl with, e.g., diethylprocarbonate or
para-bromophenacyl bromide. Other mimetics include, e.g., those
generated by hydroxylation of proline and lysine; phosphorylation
of the hydroxyl groups of seryl or threonyl residues; methylation
of the alpha-amino groups of lysine, arginine and histidine;
acetylation of the N-terminal amine; methylation of main chain
amide residues or substitution with N-methyl amino acids; or
amidation of C-terminal carboxyl groups.
[0390] A residue, e.g., an amino acid, of a polypeptide as provided
herein can also be replaced by an amino acid (or peptidomimetic
residue) of the opposite chirality. Thus, any amino acid naturally
occurring in the L-configuration (which can also be referred to as
the R or S, depending upon the structure of the chemical entity)
can be replaced with the amino acid of the same chemical structural
type or a peptidomimetic, but of the opposite chirality, referred
to as the D-amino acid, but also can be referred to as the R- or
S-form.
[0391] In certain embodiments, provided herein are methods for
modifying the polypeptides as provided herein by either natural
processes, such as post-translational processing (e.g.,
phosphorylation, acylation, etc), or by chemical modification
techniques, and the resulting modified polypeptides. Modifications
can occur anywhere in the polypeptide, including the peptide
backbone, the amino acid side-chains and the amino or carboxyl
termini. It will be appreciated that the same type of modification
may be present in the same or varying degrees at several sites in a
given polypeptide. Also a given polypeptide may have many types of
modifications. Modifications include acetylation, acylation,
ADP-ribosylation, amidation, covalent attachment of flavin,
covalent attachment of a heme moiety, covalent attachment of a
nucleotide or nucleotide derivative, covalent attachment of a lipid
or lipid derivative, covalent attachment of a phosphatidylinositol,
cross-linking cyclization, disulfide bond formation, demethylation,
formation of covalent cross-links, formation of cysteine, formation
of pyroglutamate, formylation, gamma-carboxylation, glycosylation,
GPI anchor formation, hydroxylation, iodination, methylation,
myristolyation, oxidation, pegylation, proteolytic processing,
phosphorylation, prenylation, racemization, selenoylation,
sulfation, and transfer-RNA mediated addition of amino acids to
protein such as arginylation. See, e.g., Creighton, T. E.,
Proteins--Structure and Molecular Properties 2nd Ed., W. H. Freeman
and Company, New York (1993); Posttranslational Covalent
Modification of Proteins, B. C. Johnson, Ed., Academic Press, New
York, pp. 1-12 (1983).
[0392] Solid-phase chemical peptide synthesis methods can also be
used to synthesize the polypeptides, or fragments thereof, as
provided herein. Such method have been known in the art since the
early 1960's (Merrifield, R. B., J. Am. Chem. Soc., 85:2149-2154,
1963) (See also Stewart, J. M. and Young, J. D., Solid Phase
Peptide Synthesis, 2nd Ed., Pierce Chemical Co., Rockford, Ill.,
pp. 11-12)) and have recently been employed in commercially
available laboratory peptide design and synthesis kits (Cambridge
Research Biochemicals). Such commercially available laboratory kits
have generally utilized the teachings of H. M. Geysen et al, Proc.
Natl. Acad. Sci., USA, 81:3998 (1984) and provide for synthesizing
peptides upon the tips of a multitude of "rods" or "pins" all of
which are connected to a single plate. When such a system is
utilized, a plate of rods or pins is inverted and inserted into a
second plate of corresponding wells or reservoirs, which contain
solutions for attaching or anchoring an appropriate amino acid to
the pin's or rod's tips. By repeating such a process step, i.e.,
inverting and inserting the rod's and pin's tips into appropriate
solutions, amino acids are built into desired peptides. In
addition, a number of available FMOC peptide synthesis systems are
available. For example, assembly of a polypeptide or fragment can
be carried out on a solid support using an Applied Biosystems, Inc.
Model 431A.TM. automated peptide synthesizer. Such equipment
provides ready access to the peptides as provided herein, either by
direct synthesis or by synthesis of a series of fragments that can
be coupled using other known techniques.
Enzymes
[0393] In certain embodiments, provided herein are hydrolases, e.g.
lipases, saturases-palmitases and/or stearatases, e.g., proteins
comprising at least about 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%,
58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%,
71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%,
84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, or more, or complete (100%) sequence identity, to an
exemplary polypeptide as provided herein (e.g., SEQ ID NO:2, SEQ ID
NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID
NO:14, SEQ ID NO:16, SEQ ID NO:18, or SEQ ID NO:20 or SEQ ID NO:2
having one, two, three, four, five, six, seven, eight or more
(several) or all the amino acid variations described in Table 3 or
Table 4, or the equivalent thereof, antibodies that bind them, and
methods for making and using them. The polypeptides as provided
herein can have any hydrolase activity, e.g., lipase, saturase,
palmitase and/or stearatase activity. In alternative aspects, an
activity of an enzyme as provided herein comprises hydrolysis or
synthesis of lipids or oils. The hydrolases as provided herein can
modify oils by hydrolysis, acidolysis, alcoholysis, glycerolysis,
esterification, transesterification and/or interesterification,
including "forced migration" reactions.
[0394] In alternative aspects, the hydrolases as provided herein
can have modified or new activities as compared to the exemplary
hydrolases or the activities described herein. Provided herein are
hydrolases with and without signal sequences and the signal
sequences themselves. Provided herein are immobilized hydrolases,
anti-hydrolase antibodies and fragments thereof. Provided herein
are proteins for inhibiting hydrolase activity, e.g., antibodies
that bind to the hydrolase active site. Provided herein are
homodimers and heterocomplexes, e.g., fusion proteins,
heterodimers, etc., comprising the hydrolases as provided herein.
Provided herein are hydrolases having activity over a broad range
of high and low temperatures and pH's (e.g., acidic and basic
aqueous conditions).
[0395] In one aspect, one or more hydrolases (e.g., lipases,
saturases, palmitases and/or stearatases) as provided herein is
used for the biocatalytic synthesis of structured lipids, i.e.,
lipids that contain a defined set of fatty acids distributed in a
defined manner on the glycerol backbone, including cocoa butter
alternatives, poly-unsaturated fatty acids (PUFAs), 1,3-diacyl
glycerides (DAGs), 2-monoacylglycerides (MAGs) and
triacylglycerides (TAGs).
[0396] Provided herein are methods of generating enzymes having
altered (higher or lower) K.sub.cat/K.sub.m. In one aspect,
site-directed mutagenesis is used to create additional hydrolase
enzymes with alternative substrate specificities. This can be done,
for example, by redesigning the substrate binding region or the
active site of the enzyme. In one aspect, hydrolases as provided
herein are more stable at high temperatures, such as 80.degree. C.
to 85.degree. C. to 90.degree. C. to 95.degree. C., as compared to
hydrolases from conventional or moderate organisms.
[0397] Various proteins as provided herein have a hydrolase
activity, e.g., lipase, saturase, palmitase and/or stearatase
activity, under various conditions. Provided herein are methods of
making hydrolases with different catalytic efficiency and
stabilities towards temperature, oxidizing agents and pH
conditions. These methods can use, e.g., the techniques of
site-directed mutagenesis and/or random mutagenesis. In one aspect,
directed evolution can be used to produce hydrolases with
alternative specificities and stability.
[0398] The proteins as provided herein are used in methods that can
identify hydrolase modulators, e.g., activators or inhibitors.
Briefly, test samples (e.g., compounds, such as members of peptide
or combinatorial libraries, broths, extracts, and the like) are
added to hydrolase assays to determine their ability to modulate,
e.g., inhibit or activate, substrate cleavage. These inhibitors can
be used in industry and research to reduce or prevent undesired
isomerization. Modulators found using the methods as provided
herein can be used to alter (e.g., decrease or increase) the
spectrum of activity of a hydrolase.
[0399] In one aspect, provided herein are methods of discovering
hydrolases using the nucleic acids, polypeptides and antibodies as
provided herein. In one aspect, lambda phage libraries are screened
for expression-based discovery of hydrolases. Provided herein are
lambda phage libraries for use in screening to allow detection of
toxic clones; improved access to substrate; reduced need for
engineering a host, by-passing the potential for any bias resulting
from mass excision of the library; and, faster growth at low clone
densities. Screening of lambda phage libraries can be in liquid
phase or in solid phase. Provided herein are methods for screening
in liquid phase. This can give a greater flexibility in assay
conditions; additional substrate flexibility; higher sensitivity
for weak clones; and ease of automation over solid phase
screening.
[0400] In other embodiments, provided herein are screening methods
using the proteins and nucleic acids as provided herein involving
robotic automation. This enables the execution of many thousands of
biocatalytic reactions and screening assays in a short period of
time, e.g., per day, as well as ensuring a high level of accuracy
and reproducibility (see discussion of arrays, below). As a result,
a library of derivative compounds can be produced in a matter of
weeks.
[0401] In certain embodiments, provided herein are hydrolase
enzymes which are non-naturally occurring hydrolases having a
different hydrolase activity, stability, substrate specificity, pH
profile and/or performance characteristic as compared to the
non-naturally occurring hydrolase. These hydrolases have an amino
acid sequence not found in nature. They can be derived by
substitution of a plurality of amino acid residues of a precursor
hydrolase with different amino acids. The precursor hydrolase may
be a naturally-occurring hydrolase or a recombinant hydrolase. In
one aspect, the hydrolase variants encompass the substitution of
any of the naturally occurring L-amino acids at the designated
amino acid residue positions.
Hydrolase Signal Sequences, Prepro and Catalytic Domains
[0402] In certain embodiments, provided herein are signal sequences
(e.g., signal peptides (SPs)), prepro domains and catalytic domains
(CDs). The SPs, prepro domains and/or CDs as provided herein can be
isolated, synthetic or recombinant peptides or can be part of a
fusion protein, e.g., as a heterologous domain in a chimeric
protein. In certain embodiments, provided herein are nucleic acids
encoding these catalytic domains (CDs), prepro domains and signal
sequences (SPs, e.g., a peptide having a sequence
comprising/consisting of amino terminal residues of a polypeptide
as provided herein). In certain embodiments, provided herein are
signal sequences comprising a peptide comprising/consisting of a
sequence as set forth in residues 1 to 12, 1 to 13, 1 to 14, 1 to
15, 1 to 16, 1 to 17, 1 to 18, 1 to 19, 1 to 20, 1 to 21, 1 to 22,
1 to 23, 1 to 24, 1 to 25, 1 to 26, 1 to 27, 1 to 28, 1 to 28, 1 to
30, 1 to 31, 1 to 32, 1 to 33, 1 to 34, 1 to 35, 1 to 36, 1 to 37,
1 to 38, 1 to 39, 1 to 40, 1 to 41, 1 to 42, 1 to 43, 1 to 44 (or a
longer peptide) of a polypeptide as provided herein. In one
embodiment, provided herein are isolated, synthetic or recombinant
signal sequences comprising/consisting of a signal sequence as
provided herein derived from another enzyme as provided herein, or
another type of enzyme or polypeptide.
[0403] The hydrolase signal sequences (SPs), CDs, and/or prepro
sequences as provided herein can be isolated peptides, or,
sequences joined to another hydrolase or a non-hydrolase
polypeptide, e.g., as a fusion (chimeric) protein. In certain
embodiments, provided herein are polypeptides comprising hydrolase
signal sequences as provided herein. In one aspect, polypeptides
comprising hydrolase signal sequences SPs, CDs, and/or prepro as
provided herein comprise sequences heterologous to hydrolases as
provided herein (e.g., a fusion protein comprising an SP, CD,
and/or prepro as provided herein and sequences from another
hydrolase or a non-hydrolase protein). Provided herein are
hydrolases as provided herein with heterologous SPs, CDs, and/or
prepro sequences, e.g., sequences with a yeast signal sequence. A
hydrolase as provided herein can comprise a heterologous SP and/or
prepro in a vector, e.g., a pPIC series vector (Invitrogen,
Carlsbad, Calif.).
[0404] In one aspect, SPs, CDs, and/or prepro sequences as provided
herein are identified following identification of novel hydrolase
polypeptides. The pathways by which proteins are sorted and
transported to their proper cellular location are often referred to
as protein targeting pathways. One of the most important elements
in all of these targeting systems is a short amino acid sequence at
the amino terminus of a newly synthesized polypeptide called the
signal sequence. This signal sequence directs a protein to its
appropriate location in the cell and is removed during transport or
when the protein reaches its final destination. Most lysosomal,
membrane, or secreted proteins have an amino-terminal signal
sequence that marks them for translocation into the lumen of the
endoplasmic reticulum. The signal sequences can vary in length from
13 to 45 or more amino acid residues. Various methods of
recognition of signal sequences are known to those of skill in the
art. For example, in one aspect, novel hydrolase signal peptides
are identified by a method referred to as SignalP. SignalP uses a
combined neural network which recognizes both signal peptides and
their cleavage sites. (Nielsen, et al., "Identification of
prokaryotic and eukaryotic signal peptides and prediction of their
cleavage sites." Protein Engineering, vol. 10, no. 1, p. 1-6
(1997).
[0405] It should be understood that in some aspects hydrolases as
provided herein may not have SPs and/or prepro sequences, and/or
catalytic domains (CDs). In one aspect, provided herein are
polypeptides (e.g., hydrolases) lacking all or part of an SP, a CD
and/or a prepro domain. In another aspect, provided herein are
nucleic acids encoding a signal sequence (SP), a CD, and/or prepro
from one hydrolase operably linked to a nucleic acid sequence of a
different hydrolase or, optionally, a signal sequence (SPs) and/or
prepro domain from a non-hydrolase protein may be desired.
[0406] In certain embodiments, provided herein are isolated,
synthetic or recombinant polypeptides comprising signal sequences
(SPs), prepro domain and/or catalytic domains (CDs) as provided
herein and heterologous sequences. The heterologous sequences are
sequences not naturally associated (e.g., to a hydrolase) with an
SP, prepro domain and/or CD. The sequence to which the SP, prepro
domain and/or CD are not naturally associated can be on the SP's,
prepro domain and/or CD's amino terminal end, carboxy terminal end,
and/or on both ends of the SP and/or CD. In certain embodiments,
provided herein are isolated, synthetic or recombinant polypeptides
comprising (or consisting of) a polypeptide comprising a signal
sequence (SP), prepro domain and/or catalytic domain (CD) as
provided herein with the proviso that it is not associated with any
sequence to which it is naturally associated (e.g., hydrolase
sequence). Provided herein are isolated or recombinant nucleic
acids encoding these polypeptides. Thus, in one aspect, the
isolated, synthetic or recombinant nucleic acid as provided herein
comprises coding sequence for a signal sequence (SP), prepro domain
and/or catalytic domain (CD) as provided herein and a heterologous
sequence (i.e., a sequence not naturally associated with the a
signal sequence (SP), prepro domain and/or catalytic domain (CD) as
provided herein). The heterologous sequence can be on the 3'
terminal end, 5' terminal end, and/or on both ends of the SP,
prepro domain and/or CD coding sequence.
[0407] In certain embodiments, provided herein are fusion of
N-terminal or C-terminal subsequences of enzymes as provided herein
(e.g., signal sequences, prepro sequences) with other polypeptides,
active proteins or protein fragments. The production of an enzyme
as provided herein (e.g., a hydrolase, e.g., a lipase, saturase,
palmitase and/or stearatase) may also be accomplished by expressing
the enzyme as an inactive fusion protein that is later activated by
a proteolytic cleavage event (using either an endogenous or
exogenous protease activity, e.g. trypsin) that results in the
separation of the fusion protein partner and the mature enzyme,
e.g., hydrolase as provided herein. In one aspect, the fusion
protein as provided herein is expressed from a hybrid nucleotide
construct that encodes a single open reading frame containing the
following elements: the nucleotide sequence for the fusion protein,
a linker sequence (defined as a nucleotide sequence that encodes a
flexible amino acid sequence that joins two less flexible protein
domains), protease cleavage recognition site, and the mature enzyme
(e.g., any enzyme as provided herein, e.g., a hydrolase) sequence.
In alternative aspects, the fusion protein can comprise a pectate
lyase sequence, a xylanase sequence, a phosphatidic acid
phosphatase sequence, or another sequence, e.g., a sequence that
has previously been shown to be over-expressed in a host system of
interest. Any host system can be used (see discussion, above), for
example, E. coli or Pichia pastoris. The arrangement of the
nucleotide sequences in the chimeric nucleotide construction can be
determined based on the protein expression levels achieved with
each fusion construct. Proceeding from the 5' end of the nucleotide
construct to the 3' prime end of the construct, in one aspect, the
nucleotide sequences is assembled as follows: Signal
sequence/fusion protein/linker sequence/protease cleavage
recognition site/mature enzyme (e.g., any enzyme as provided
herein, e.g., a hydrolase) or Signal sequence/pro sequence/mature
enzyme/linker sequence/fusion protein. The expression of enzyme
(e.g., any enzyme as provided herein, e.g., a hydrolase) as an
inactive fusion protein may improve the overall expression of the
enzyme's sequence, may reduce any potential toxicity associated
with the overproduction of active enzyme and/or may increase the
shelf life of enzyme prior to use because enzyme would be inactive
until the fusion protein e.g. pectate lyase is separated from the
enzyme, e.g., hydrolase as provided herein.
[0408] In one embodiment, provided herein are specific formulations
for the activation of a hydrolase as provided herein expressed as a
fusion protein. In one aspect, the activation of the hydrolase
activity initially expressed as an inactive fusion protein is
accomplished using a proteolytic activity or potentially a
proteolytic activity in combination with an amino-terminal or
carboxyl-terminal peptidase (the peptidase can be an enzyme as
provided herein, or, another enzyme). This activation event may be
accomplished in a variety of ways and at a variety of points in the
manufacturing/storage process prior to application in oil
degumming. Exemplary processes as provided herein include: cleavage
by an endogenous activity expressed by the manufacturing host upon
secretion of the fusion construct into the fermentation media;
cleavage by an endogenous protease activity that is activated or
comes in contact with intracellularly expressed fusion construct
upon rupture of the host cells; passage of the crude or purified
fusion construct over a column of immobilized protease activity to
accomplish cleavage and enzyme (e.g., hydrolase as provided herein,
e.g., e.g., a lipase, saturase, palmitase and/or stearatase)
activation prior to enzyme formulation; treatment of the crude or
purified fusion construct with a soluble source of proteolytic
activity; activation of a hydrolase (e.g., a hydrolase as provided
herein) at the oil refinery using either a soluble or insoluble
source of proteolytic activity immediately prior to use in the
process; and/or, activation of the hydrolase (e.g., a lipase,
saturase, palmitase and/or stearatase as provided herein) activity
by continuously circulating the fusion construct formulation
through a column of immobilized protease activity at reduced
temperature (for example, any between about 4.degree. C. and
20.degree. C.). This activation event may be accomplished prior to
delivery to the site of use or it may occur on-site at the oil
refinery.
Glycosylation
[0409] The peptides and polypeptides as provided herein (e.g.,
hydrolases, antibodies) can also be glycosylated, for example, in
one aspect, comprising at least one glycosylation site, e.g., an
N-linked or O-linked glycosylation. In one aspect, the polypeptide
can be glycosylated after being expressed in a P. pastoris or a S.
pombe. The glycosylation can be added post-translationally either
chemically or by cellular biosynthetic mechanisms, wherein the
later incorporates the use of known glycosylation motifs, which can
be native to the sequence or can be added as a peptide or added in
the nucleic acid coding sequence.
Hybrid Hydrolases and Peptide Libraries
[0410] In certain embodiments, provided herein are hybrid
hydrolases (e.g., synthetic proteins) and fusion proteins,
including peptide libraries, comprising sequences as provided
herein. The peptide libraries as provided herein can be used to
isolate peptide modulators (e.g., activators or inhibitors) of
targets. The peptide libraries as provided herein can be used to
identify formal binding partners of targets, such as ligands, e.g.,
cytokines, hormones and the like.
[0411] In one aspect, the fusion proteins as provided herein (e.g.,
the peptide moiety) are conformationally stabilized (relative to
linear peptides) to allow a higher binding affinity for targets. In
another aspect, provided herein are fusions of hydrolases as
provided herein and other peptides, including known and random
peptides. They can be fused in such a manner that the structure of
the enzyme or antibody (e.g., hydrolase) is not significantly
perturbed and the peptide is metabolically or structurally
conformationally stabilized. This allows the creation of a peptide
library that is easily monitored both for its presence within cells
and its quantity.
[0412] Amino acid sequence variants as provided herein can be
characterized by a predetermined nature of the variation, a feature
that sets them apart from a naturally occurring form, e.g., an
allelic or interspecies variation of a hydrolase sequence. In one
aspect, the variants as provided herein exhibit the same
qualitative biological activity as the naturally occurring
analogue. Alternatively, the variants can be selected for having
modified characteristics. In one aspect, while the site or region
for introducing an amino acid sequence variation is predetermined,
the mutation per se need not be predetermined. For example, in
order to optimize the performance of a mutation at a given site,
random mutagenesis may be conducted at the target codon or region
and the expressed hydrolase variants screened for the optimal
combination of desired activity. Techniques for making substitution
mutations at predetermined sites in DNA having a known sequence are
well known, as discussed herein for example, M13 primer mutagenesis
and PCR mutagenesis. Screening of the mutants can be done using
assays of proteolytic activities. In alternative aspects, amino
acid substitutions can be single residues; insertions can be on the
order of from about 1 to 20 amino acids, although considerably
larger insertions can be done. Deletions can range from about 1 to
about 20, 30, 40, 50, 60, 70 residues or more. To obtain a final
derivative with the optimal properties, substitutions, deletions,
insertions or any combination thereof may be used. Generally, these
changes are done on a few amino acids to minimize the alteration of
the molecule. However, larger changes may be tolerated in certain
circumstances.
[0413] In certain embodiments, provided herein are hydrolases where
the structure of the polypeptide backbone, the secondary or the
tertiary structure, e.g., an alpha-helical or beta-sheet structure,
has been modified. In one aspect, the charge or hydrophobicity has
been modified. In one aspect, the bulk of a side chain has been
modified. Substantial changes in function or immunological identity
are made by selecting substitutions that are less conservative. For
example, substitutions can be made which more significantly affect:
the structure of the polypeptide backbone in the area of the
alteration, for example an alpha-helical or a beta-sheet structure;
a charge or a hydrophobic site of the molecule, which can be at an
active site; or a side chain. In other embodiments, provided herein
are proteins comprising sequence substitutions as provided herein,
e.g., where (a) a hydrophilic residues, e.g. seryl or threonyl, are
substituted for (or by) a hydrophobic residue, e.g. leucyl,
isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline
is substituted for (or by) any other residue; (c) a residue having
an electropositive side chain, e.g. lysyl, arginyl, or histidyl, is
substituted for (or by) an electronegative residue, e.g. glutamyl
or aspartyl; or (d) a residue having a bulky side chain, e.g.
phenylalanine, is substituted for (or by) one not having a side
chain, e.g. glycine. The variants can exhibit the same qualitative
biological activity (i.e. hydrolase activity) although variants can
be selected to modify the characteristics of the hydrolases as
needed.
[0414] In one aspect, hydrolases as provided herein comprise
epitopes or purification tags, signal sequences or other fusion
sequences, etc. In one aspect, the hydrolases as provided herein
can be fused to a random peptide to form a fusion polypeptide. By
"fused" or "operably linked" herein it is meant that the random
peptide and the hydrolase are linked together, in such a manner as
to minimize the disruption to the stability of the hydrolase
structure, e.g., it retains hydrolase activity. The fusion
polypeptide (or fusion polynucleotide encoding the fusion
polypeptide) can comprise further components as well, including
multiple peptides at multiple loops.
[0415] In one aspect, the peptides (e.g., hydrolase subsequences)
and nucleic acids encoding them are randomized, either fully
randomized or they are biased in their randomization, e.g. in
nucleotide/residue frequency generally or per position.
"Randomized" means that each nucleic acid and peptide consists of
essentially random nucleotides and amino acids, respectively. In
one aspect, the nucleic acids which give rise to the peptides can
be chemically synthesized, and thus may incorporate any nucleotide
at any position. Thus, when the nucleic acids are expressed to form
peptides, any amino acid residue may be incorporated at any
position. The synthetic process can be designed to generate
randomized nucleic acids, to allow the formation of all or most of
the possible combinations over the length of the nucleic acid, thus
forming a library of randomized nucleic acids. The library can
provide a sufficiently structurally diverse population of
randomized expression products to affect a probabilistically
sufficient range of cellular responses to provide one or more cells
exhibiting a desired response. Provided herein are interaction
libraries large enough so that at least one of its members will
have a structure that gives it affinity for some molecule, protein,
or other factor.
Screening Methodologies and "On-line" Monitoring Devices
[0416] In practicing the methods as provided herein, a variety of
apparatus and methodologies can be used to in conjunction with the
polypeptides and nucleic acids as provided herein, e.g., to screen
polypeptides for hydrolase activity, to screen compounds as
potential activators or inhibitors of a hydrolase activity (e.g.,
for potential drug screening), for antibodies that bind to a
polypeptide as provided herein, for nucleic acids that hybridize to
a nucleic acid as provided herein, to screen for cells expressing a
polypeptide as provided herein and the like. See, e.g., U.S. Pat.
No. 6,337,187.
[0417] Capillary Arrays
[0418] Capillary arrays, such as the GIGAMATRIX.TM., Diversa
Corporation, San Diego, Calif., can be used to in the methods as
provided herein. Nucleic acids or polypeptides as provided herein
can be immobilized to or applied to an array, including capillary
arrays. Arrays can be used to screen for or monitor libraries of
compositions (e.g., small molecules, antibodies, nucleic acids,
etc.) for their ability to bind to or modulate the activity of a
nucleic acid or a polypeptide as provided herein. Capillary arrays
provide another system for holding and screening samples. For
example, a sample screening apparatus can include a plurality of
capillaries formed into an array of adjacent capillaries, wherein
each capillary comprises at least one wall defining a lumen for
retaining a sample. The apparatus can further include interstitial
material disposed between adjacent capillaries in the array, and
one or more reference indicia formed within of the interstitial
material. A capillary for screening a sample, wherein the capillary
is adapted for being bound in an array of capillaries, can include
a first wall defining a lumen for retaining the sample, and a
second wall formed of a filtering material, for filtering
excitation energy provided to the lumen to excite the sample.
[0419] A polypeptide or nucleic acid, e.g., a ligand or a
substrate, can be introduced into a first component into at least a
portion of a capillary of a capillary array. Each capillary of the
capillary array can comprise at least one wall defining a lumen for
retaining the first component. An air bubble can be introduced into
the capillary behind the first component. A second component can be
introduced into the capillary, wherein the second component is
separated from the first component by the air bubble. A sample of
interest can be introduced as a first liquid labeled with a
detectable particle into a capillary of a capillary array, wherein
each capillary of the capillary array comprises at least one wall
defining a lumen for retaining the first liquid and the detectable
particle, and wherein the at least one wall is coated with a
binding material for binding the detectable particle to the at
least one wall. The method can further include removing the first
liquid from the capillary tube, wherein the bound detectable
particle is maintained within the capillary, and introducing a
second liquid into the capillary tube.
[0420] The capillary array can include a plurality of individual
capillaries comprising at least one outer wall defining a lumen.
The outer wall of the capillary can be one or more walls fused
together. Similarly, the wall can define a lumen that is
cylindrical, square, hexagonal or any other geometric shape so long
as the walls form a lumen for retention of a liquid or sample. The
capillaries of the capillary array can be held together in close
proximity to form a planar structure. The capillaries can be bound
together, by being fused (e.g., where the capillaries are made of
glass), glued, bonded, or clamped side-by-side. The capillary array
can be formed of any number of individual capillaries, for example,
a range from 100 to 4,000,000 capillaries. A capillary array can
form a micro titer plate having about 100,000 or more individual
capillaries bound together.
[0421] Arrays, or "Biochips"
[0422] Nucleic acids or polypeptides as provided herein can be
immobilized to or applied to an array. Arrays can be used to screen
for or monitor libraries of compositions (e.g., small molecules,
antibodies, nucleic acids, etc.) for their ability to bind to or
modulate the activity of a nucleic acid or a polypeptide as
provided herein. For example, in one aspect as provided herein, a
monitored parameter is transcript expression of a hydrolase gene.
One or more, or, all the transcripts of a cell can be measured by
hybridization of a sample comprising transcripts of the cell, or,
nucleic acids representative of or complementary to transcripts of
a cell, by hybridization to immobilized nucleic acids on an array,
or "biochip." By using an "array" of nucleic acids on a microchip,
some or all of the transcripts of a cell can be simultaneously
quantified. Alternatively, arrays comprising genomic nucleic acid
can also be used to determine the genotype of a newly engineered
strain made by the methods as provided herein. Polypeptide arrays"
can also be used to simultaneously quantify a plurality of
proteins. The present invention can be practiced with any known
"array," also referred to as a "microarray" or "nucleic acid array"
or "polypeptide array" or "antibody array" or "biochip," or
variation thereof. Arrays are generically a plurality of "spots" or
"target elements," each target element comprising a defined amount
of one or more biological molecules, e.g., oligonucleotides,
immobilized onto a defined area of a substrate surface for specific
binding to a sample molecule, e.g., mRNA transcripts.
[0423] The "arrays" or "microarrays" or "biochips" or "chips" as
provided herein can comprise a plurality of target elements, each
target element comprising a defined amount of one or more
polypeptides (including antibodies) or nucleic acids immobilized
onto a defined area of a substrate surface.
[0424] In one aspect, the hydrolases are used as immobilized forms.
Any immobilization method can be used, e.g., immobilization upon an
inert support such as diethylaminoethyl-cellulose, porous glass,
chitin or cells. Cells that express hydrolases as provided herein
can be immobilized by cross-linking, e.g. with glutaraldehyde to a
substrate surface.
[0425] In practicing the methods as provided herein, any known
array and/or method of making and using arrays can be incorporated
in whole or in part, or variations thereof, as described, for
example, in U.S. Pat. Nos. 6,277,628; 6,277,489; 6,261,776;
6,258,606;
[0426] 6,054,270; 6,048,695; 6,045,996; 6,022,963; 6,013,440;
5,965,452; 5,959,098; 5,856,174; 5,830,645; 5,770,456; 5,632,957;
5,556,752; 5,143,854; 5,807,522; 5,800,992; 5,744,305; 5,700,637;
5,556,752; 5,434,049; see also, e.g., WO 99/51773; WO 99/09217; WO
97/46313; WO 96/17958; see also, e.g., Johnston (1998) Curr. Biol.
8:R171-R174; Schummer (1997) Biotechniques 23:1087-1092; Kern
(1997) Biotechniques 23:120-124; Solinas-Toldo (1997) Genes,
Chromosomes & Cancer 20:399-407; Bowtell (1999) Nature Genetics
Supp. 21:25-32. See also published U.S. patent applications Nos.
20010018642; 20010019827; 20010016322; 20010014449; 20010014448;
20010012537; 20010008765.
Antibodies and Antibody-Based Screening Methods
[0427] In certain embodiments, provided herein are isolated,
synthetic or recombinant antibodies that specifically bind to a
hydrolase as provided herein. These antibodies can be used to
isolate, identify or quantify the hydrolase as provided herein or
related polypeptides. These antibodies can be used to isolate other
polypeptides as provided herein or other related hydrolases.
[0428] "Antibodies" as provided herein can comprise peptide(s) or
polypeptide(s) derived from, modeled after or substantially encoded
by an immunoglobulin gene or immunoglobulin genes, or fragments
thereof, capable of specifically binding an antigen or epitope,
see, e.g. Fundamental Immunology, Third Edition, W. E. Paul, ed.,
Raven Press, N.Y. (1993); Wilson (1994) J. Immunol. Methods
175:267-273; Yarmush (1992) J. Biochem. Biophys. Methods 25:85-97.
The term antibody includes antigen-binding portions, i.e., "antigen
binding sites," (e.g., fragments, subsequences, complementarity
determining regions (CDRs)) that retain capacity to bind antigen,
including (i) a Fab fragment, a monovalent fragment consisting of
the VL, VH, CL and CH.sub.1 domains; (ii) a F(ab')2 fragment, a
bivalent fragment comprising two Fab fragments linked by a
disulfide bridge at the hinge region; (iii) a Fd fragment
consisting of the VH and CH.sub.1 domains; (iv) a Fv fragment
consisting of the VL and VH domains of a single arm of an antibody,
(v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which
consists of a VH domain; and (vi) an isolated complementarity
determining region (CDR). Single chain antibodies are also included
by reference in the term "antibody." Provided herein are
antibodies, including antigen binding sites and single chain
antibodies that specifically bind to a hydrolase as provided
herein. In practicing the methods as provided herein, polypeptides
having a hydrolase activity can also be used.
[0429] The antibodies can be used in immunoprecipitation, staining,
immunoaffinity columns, and the like. If desired, nucleic acid
sequences encoding for specific antigens can be generated by
immunization followed by isolation of polypeptide or nucleic acid,
amplification or cloning and immobilization of polypeptide onto an
array as provided herein. Alternatively, the methods as provided
herein can be used to modify the structure of an antibody produced
by a cell to be modified, e.g., an antibody's affinity can be
increased or decreased. Furthermore, the ability to make or modify
antibodies can be a phenotype engineered into a cell by the methods
as provided herein.
[0430] Methods of immunization, producing and isolating antibodies
(polyclonal and monoclonal) are known to those of skill in the art
and described in the scientific and patent literature, see, e.g.,
Coligan, CURRENT PROTOCOLS IN IMMUNOLOGY, Wiley/Greene, NY (1991);
Stites (eds.) BASIC AND CLINICAL IMMUNOLOGY (7th ed.) Lange Medical
Publications, Los Altos, Calif. ("Stites"); Goding, MONOCLONAL
ANTIBODIES: PRINCIPLES AND PRACTICE (2d ed.) Academic Press, New
York, N.Y. (1986); Kohler (1975) Nature 256:495; Harlow (1988)
ANTIBODIES, A LABORATORY MANUAL, Cold Spring Harbor Publications,
New York. Antibodies also can be generated in vitro, e.g., using
recombinant antibody binding site expressing phage display
libraries, in addition to the traditional in vivo methods using
animals. See, e.g., Hoogenboom (1997) Trends Biotechnol. 15:62-70;
Katz (1997) Annu. Rev. Biophys. Biomol. Struct. 26:27-45.
[0431] Polypeptides or peptides can be used to generate antibodies,
which bind specifically to the polypeptides as provided herein. The
resulting antibodies may be used in immunoaffinity chromatography
procedures to isolate or purify the polypeptide or to determine
whether the polypeptide is present in a biological sample. In such
procedures, a protein preparation, such as an extract, or a
biological sample is contacted with an antibody capable of
specifically binding to one of the polypeptides as provided
herein.
[0432] In immunoaffinity procedures, the antibody is attached to a
solid support, such as a bead or other column matrix. The protein
preparation is placed in contact with the antibody under conditions
in which the antibody specifically binds to one of the polypeptides
as provided herein. After a wash to remove non-specifically bound
proteins, the specifically bound polypeptides are eluted.
[0433] The ability of proteins in a biological sample to bind to
the antibody may be determined using any of a variety of procedures
familiar to those skilled in the art. For example, binding may be
determined by labeling the antibody with a detectable label such as
a fluorescent agent, an enzymatic label, or a radioisotope.
Alternatively, binding of the antibody to the sample may be
detected using a secondary antibody having such a detectable label
thereon. Particular assays include ELISA assays, sandwich assays,
radioimmunoassays, and Western Blots.
[0434] Polyclonal antibodies generated against the polypeptides as
provided herein can be obtained by direct injection of the
polypeptides into an animal or by administering the polypeptides to
a non-human animal. The antibody so obtained will then bind the
polypeptide itself. In this manner, even a sequence encoding only a
fragment of the polypeptide can be used to generate antibodies
which may bind to the whole native polypeptide. Such antibodies can
then be used to isolate the polypeptide from cells expressing that
polypeptide.
[0435] For preparation of monoclonal antibodies, any technique
which provides antibodies produced by continuous cell line cultures
can be used. Examples include the hybridoma technique, the trioma
technique, the human B-cell hybridoma technique, and the
EBV-hybridoma technique (see, e.g., Cole (1985) in Monoclonal
Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96).
[0436] Techniques described for the production of single chain
antibodies (see, e.g., U.S. Pat. No. 4,946,778) can be adapted to
produce single chain antibodies to the polypeptides as provided
herein. Alternatively, transgenic mice may be used to express
humanized antibodies to these polypeptides or fragments
thereof.
[0437] Antibodies generated against the polypeptides as provided
herein (including anti-idiotype antibodies) may be used in
screening for similar polypeptides from other organisms and
samples. In such techniques, polypeptides from the organism are
contacted with the antibody and those polypeptides which
specifically bind the antibody are detected. Any of the procedures
described above may be used to detect antibody binding.
Immobilized Hydrolases
[0438] In one aspect, the hydrolase as provided herein, e.g.,
lipases, saturases, palmitases and/or stearatases, are used as
immobilized forms, e.g., to process lipids, in the structured
synthesis of lipids, to digest proteins and the like. The
immobilized lipases as provided herein can be used, e.g., for
hydrolysis of triacylglycerides, diacylglycerides or esters or for
the esterification or transesterification of fatty acids,
diacylglycerides or triacylglycerides, or in the
interesterification of fats. In one aspect, the lipase is specific
for esterification of fatty acids with alcohol, 1,3-specific or
specific for the hydrolysis of partial glycerides, esters or
triacylglycerides. Immobilized lipases as provided herein can be
used in a packed bed for continuous transesterification of solvent
free fats. See, e.g., U.S. Pat. No. 4,818,695; 5,569,594.
[0439] Any immobilization method or form of support can be used,
e.g., arrays, beads, capillary supports and the like, as described
above. In one aspect, hydrolase immobilization can occur upon an
inert support such as diethylaminoethyl-cellulose, porous glass,
chitin or cells. Cells that express hydrolases as provided herein
can be immobilized by cross-linking, e.g. with glutaraldehyde to a
substrate surface. Immobilized hydrolases as provided herein can be
prepared containing hydrolase bound to a dry, porous particulate
hydrophobic support, with a surfactant, such as a polyoxyethylene
sorbitan fatty acid ester or a polyglycerol fatty acid ester. The
support can be an aliphatic olefinic polymer, such as a
polyethylene or a polypropylene, a homo- or copolymer of styrene or
a blend thereof or a pre-treated inorganic support. These supports
can be selected from aliphatic olefinic polymers, oxidation
polymers, blends of these polymers or pre-treated inorganic
supports in order to make these supports hydrophobic. This
pre-treatment can comprise silanization with an organic silicon
compound. The inorganic material can be a silica, an alumina, a
glass or a ceramic. Supports can be made from polystyrene,
copolymers of styrene, polyethylene, polypropylene or from
co-polymers derived from (meth)acrylates. See, e.g., U.S. Pat. No.
5,773,266.
[0440] The hydrolase enzymes, fragments thereof and nucleic acids
that encode the enzymes and fragments can be affixed to a solid
support. This is often economical and efficient in the use of the
hydrolases in industrial processes. For example, a consortium or
cocktail of hydrolase enzymes (or active fragments thereof), which
are used in a specific chemical reaction, can be attached to a
solid support and dunked into a process vat. The enzymatic reaction
can occur. Then, the solid support can be taken out of the vat,
along with the enzymes affixed thereto, for repeated use. In one
embodiment as provided herein, an isolated nucleic acid as provided
herein is affixed to a solid support. In another embodiment as
provided herein, the solid support is selected from the group of a
gel, a resin, a polymer, a ceramic, a glass, a microelectrode and
any combination thereof.
[0441] For example, solid supports provided herein include gels.
Some examples of gels include SEPHAROSE.TM. (GE Healthcare,
Piscataway, N.J.), gelatin, glutaraldehyde, chitosan-treated
glutaraldehyde, albumin-glutaraldehyde, chitosan-xanthan, toyopearl
gel (polymer gel), alginate, alginate-polylysine, carrageenan,
agarose, glyoxyl agarose, magnetic agarose, dextran-agarose,
poly(carbamoyl sulfonate) hydrogel, BSA-PEG hydrogel,
phosphorylated polyvinyl alcohol (PVA), monoaminoethyl-N-aminoethyl
(MANA), amino, or any combination thereof.
[0442] Other solid supports provided herein comprise resins or
polymers. Some examples of resins or polymers include cellulose,
acrylamide, nylon, rayon, polyester, anion-exchange resin,
AMBERLITE.TM. XAD-7, AMBERLITE.TM. XAD-8, AMBERLITE.TM. IRA-94,
AMBERLITE.TM. IRC-50 (Rohm and Haas, Philadelphia, Pa.), polyvinyl,
polyacrylic, polymethacrylate, or any combination thereof.
[0443] Another type of solid support provided herein comprises
ceramic. Some examples include non-porous ceramic, porous ceramic,
SiO.sub.2, Al.sub.2O.sub.3. Another type of solid support useful in
the present invention is glass. Some examples include non-porous
glass, porous glass, aminopropyl glass or any combination thereof.
Another type of solid support that can be used is a microelectrode.
An example is a polyethyleneimine-coated magnetite. Graphitic
particles can be used as a solid support.
[0444] Another type of solid support provided herein comprises
diatomaceous earth products and silicates. Some examples include
CELITE.RTM., KENITE.RTM., DIACTIV.RTM., PRIMISIL.RTM., DIAFIL.RTM.
diatomites and MICRO-CEL.RTM., CALFLO.RTM., SILASORB.TM., and
CELKATE.RTM. (World Minerals Inc., Santa Barbara, Calif.) synthetic
calcium and magnesium silicates. Another example of a solid support
is or comprises a cell, such as a red blood cell.
Kits
[0445] In certain embodiments, provided herein are kits comprising
the compositions, e.g., nucleic acids, expression cassettes,
vectors, cells, transgenic seeds or plants or plant parts,
polypeptides (e.g., hydrolases) and/or antibodies as provided
herein. The kits also can contain instructional material teaching
the methodologies and industrial uses as provided herein, as
described herein.
Industrial and Medical Applications
[0446] The hydrolases (e.g., lipases, saturases, palmitases and/or
stearatases) provided herein have many industrial uses and medical
applications, and a few exemplary uses and compositions are
described below. The processes as provided herein comprise
converting a non-hydratable phospholipid to a hydratable form, oil
degumming, food processing, processing of oils (e.g., making a low
saturate oil) from plants, fish, algae and the like, to name just a
few applications.
[0447] Processing Foods and Feeds
[0448] In certain embodiments, provided herein are cheese-making
processes using hydrolases (e.g., lipases, saturases, palmitases
and/or stearatases) as provided herein. In other embodiments,
provided herein are cheeses comprising hydrolases. In one aspect,
the enzymes as provided herein (e.g., lipases, saturases,
palmitases and/or stearatases or a combination thereof) are used to
process cheeses for flavor enhancement, to increase yield and/or
for "stabilizing" cheeses, e.g., by reducing the tendency for
"oil-off" or, in one aspect, the enzymes as provided herein are
used to produce cheese from cheese milk. These processes as
provided herein can incorporate any method or protocol, e.g., as
described, e.g., in U.S. Pat. Nos. 6,551,635, and 6,399,121, WO
03/070013, WO 00/054601. For example, in one aspect, hydrolases
(e.g., lipases, saturases, palmitases and/or stearatases) as
provided herein are used to stabilize fat emulsion in milk or
milk-comprising compositions, e.g. cream, and are used to stabilize
milk compositions, e.g. for the manufacturing of creams or cream
liquors. In one embodiment, provided herein are processes for
enhancing the flavor of a cheese using at least one enzyme as
provided herein, the process comprising incubating a protein, a fat
and a protease and a lipase (e.g., as provided herein) in an
aqueous medium under conditions that produce an enhanced cheese
flavor (e.g., reduced bitterness), e.g., as described in WO
99/66805. In one aspect, lipases as provided herein are used to
enhance flavor in a cheese (e.g., a curd) by mixing with water, a
protease, and a phospholipase at an elevated temperature, e.g.,
between about 75.degree. C. to 95.degree. C., as described, e.g.,
in U.S. Pat. No. 4,752,483. In one aspect, lipases as provided
herein are used to accelerate cheese aging by adding an enzyme as
provided herein to a cheese (e.g., a cheese milk) before adding a
coagulant to the milk, or, adding an enzyme (e.g., a lipase) as
provided herein to a curd with salt before pressing, e.g., as
described, e.g., in U.S. Pat. No. 4,707,364. In one aspect, a
lipase as provided herein is used to degrade a triacylglyceride in
milk fat to liberate free fatty acids, resulting in flavor
enhancement. An enzyme as provided herein also can be used in any
of these processes as provided herein, see, e.g., Brindisi (2001)
J. of Food Sci. 66:1100-1107.
[0449] Structured Synthesis and Processing of Oils
[0450] In certain embodiments, provided herein are methods for the
structured synthesis of oils, lipids and the like using hydrolases
(e.g., lipases, saturases, palmitases and/or stearatases) as
provided herein. The methods as provided herein comprise a
biocatalytic synthesis of structured lipids, i.e., lipids that
contain a defined set of fatty acids distributed in a defined
manner on a backbone, e.g., a glycerol backbone. Products generated
using the hydrolases and practicing the methods as provided herein
include low saturate oils, e.g., oils from vegetables (e.g., soy,
canola), animals, plants, fish, algae, which oils have been
processed or treated with a polypeptide as provided herein; and
foods, feeds, supplements, pharmaceuticals and the like comprising
low saturate oils made by practicing the methods and/or
compositions (e.g., enzymes) as provided herein. Products generated
using the hydrolases and practicing the methods as provided herein
also include cocoa butter alternatives, lipids containing
poly-unsaturated fatty acids (PUFAs), lipids containing essential
fatty acids, lipids containing monounsaturated fatty acids, lipids
containing phospho-choline and phospho-serine, lipids containing
phytosterols, 1,3-diacyl glycerides (DAGs), 2-monoacylglycerides
(MAGs) and triacylglycerides (TAGs).
[0451] The methods as provided herein enable synthesis of lipids or
fatty acids with defined regioselectivities and
stereoselectivities. Provided herein are oils, lipids and the like,
and oils that can be used in foods and feeds and cooking materials
(e.g., cooking oils, frying oils, baking oils, sauces, marinades,
condiments, spray oils, margarines, mayonnaise, spoonable and
pourable dressings, cocoa butter alternatives, and the like) that
have been processed or treated with polypeptides or peptides (e.g.,
hydrolases, such as lipases, saturases, palmitases and/or
stearatases) as provided herein. In certain embodiments, provided
herein are pharmaceuticals, nutraceuticals and cosmetics comprising
polypeptides (e.g., hydrolases, such as lipases, saturases,
palmitases and/or stearatases; or peptides or antibodies) as
provided herein.
[0452] In certain embodiments, provided herein are methods for
processing (modifying) oils, lipids and the like using hydrolases
as provided herein. The methods can be used to process oils from
plants, animals, microorganisms. The methods as provided herein can
be used in the structured synthesis of oils similar to those found
in plants, animals, and microorganisms. Lipids and oils can be
processed to have a desired characteristic. Lipids and oils that
can be processed by the methods as provided herein (using the
hydrolases as provided herein) include cocoa butter alternatives,
lipids containing poly-unsaturated fatty acids (PUFAs), lipids
containing essential fatty acids, lipids containing monounsaturated
fatty acids, lipids containing phospho-choline and phospho-serine,
lipids containing phytosterols, 1,3-diacyl glycerides (DAGs),
2-monoacylglycerides (MAGs) and triacylglycerides (TAGs). In one
aspect, the processed and synthetic oils and fats as provided
herein (e.g., cocoa butters alternatives and vegetable oils) can be
used in a variety of applications, e.g., in the production of foods
(e.g., confectionaries, pastries) and in the formulation of
pharmaceuticals, nutraceuticals and cosmetics. Provided herein are
methods of processing fats and oils, e.g., oilseeds, from plants,
including, e.g., canola, castor, coconut, coriander, corn,
cottonseed, hazelnut, hempseed, linseed, meadowfoam, olive, palm
oil, palm kernel, peanut, rapeseed, rice bran, safflower, sasanqua,
soybean, sunflower, tall, tsubaki, varieties of "natural" oils
having altered fatty acid compositions via Genetically Modified
Organisms (GMO) or traditional breeding such as high oleic, low
linolenic, or low saturate oils (high oleic canola, low linolenic
soybean, or high stearic sunflower) or blends of any of the above
using a hydrolase as provided herein.
[0453] In certain embodiments, provided herein are methods of
processing oils from animals, e.g., fish (candlefish, codliver,
orange roughy, sardine, herring, menhaden, and the like), mammals
(pork, beef, and the like) and fowl (chicken, and the like), using
the hydrolases as provided herein. In certain embodiments, provided
herein are methods for the structured synthesis of oils similar to
those found in animals, e.g., fish, fowl, and mammals and
microorganisms, using the hydrolases as provided herein. In one
aspect, these synthetic or processed oils are used as feed
additives, foods, as ingredients in pharmaceutical formulations,
nutraceuticals or in cosmetics. For example, in one aspect the
hydrolases as provided herein are used to hydrolyze fatty acids
away from fish oils so that the fatty acids can be recovered and
used as a feed additive. In one aspect, the hydrolases as provided
herein can be used to process oil from restaurant waste and
rendered animal fats.
[0454] In other embodiments, provided herein are methods of
processing fats and oils, e.g., from algal oils, including, e.g.,
Neochloris oleoabundans oil, Scenedesmus dimorphus oil, Euglena
gracilis oil, Phaeodactylum tricornutum oil, Pleurochrysis carterae
oil, Prymnesium parvum oil, Tetraselmis chui oil, Tetraselmis
suecica oil, Isochrysis galbana oil, Nannochloropsis sauna oil,
Botryococcus braunii oil, Dunaliella tertiolecta oil, Nannochloris
species oil, Spirulina species oil, Chlorophycease (green algae)
oil, and Bacilliarophy oil or blends of any of said fats and
oils.
[0455] In one aspect, the hydrolases as provided herein are
versatile biocatalysts in organic synthesis, e.g., in the
structured synthesis of oils, lipids and the like. Enzymes as
provided herein (including hydrolases, e.g., lipases, saturases,
palmitases and/or stearatases) can accept a broad range of
substrates, including secondary and tertiary alcohols, e.g., from a
natural product such as alpha-terpineol, linalool and the like. In
some aspects, the hydrolases as provided herein have good to
excellent enantiospecificity (e.g., stereospecificity).
[0456] In certain embodiments, provided herein is an oil (e.g.,
vegetable oils, cocoa butters, and the like) conversion process
comprising at least one enzyme (e.g., a lipase, saturase, palmitase
and/or stearatase) as provided herein. In one aspect, an oil
conversion process comprises a controlled hydrolysis and acylation,
e.g., a glycerol acylation, which can result in high purity for a
broad range of products. In one aspect, hydrolases (e.g., a lipase,
saturase, palmitase and/or stearatase) as provided herein are used
to produce diacylglycerol oils and structured nutritional oils. In
certain embodiments, provided herein are processes for the
esterification of propylene glycol using an enzyme as provided
herein, e.g., a regio- and/or chemo-selective lipase for
mono-substituted esterification at the Sn-1 position. Provided
herein are processes for the structured synthesis of oils with
targeted saturated or unsaturated fatty acid profiles using an
enzyme as provided herein, e.g., a regio- and/or chemo-selective
lipase for the removal of a saturated fatty acid, or, for the
targeted addition of a fatty acid to a glycerol backbone.
[0457] In one aspect, the methods as provided herein further
comprise processes for the selective removal of fatty acids (e.g.,
undesirable fatty acids) from oils, e.g., separating saturated
and/or unsaturated fatty acids from oils, using a hydrolase (e.g.,
a lipase, saturase, palmitase and/or stearatase) as provided
herein. The process as provided herein can separate saturated
and/or unsaturated fatty acids from any oil, e.g., a soy oil. The
enzyme can be chemoselective and/or enantioselective. In one
aspect, these processes generate high stability fats and oils,
e.g., "healthy" frying oils. This exemplary process as provided
herein can be used to generate oils with less sulfur, e.g., using a
process comprising sulfur removal from crude oil. The enzymes as
provided herein can also be used in interesterification processes
for these and other purposes.
[0458] In one aspect, an enzyme as provided herein is used to
generate a "no-trans" fat oil. In one aspect, a "no-trans" oil is
generated from a partially hydrogenated oil to produce a cis-only
oil. The enzyme can be chemoselective and/or enantioselective.
[0459] In another embodiments, provided herein are processes for
modifying cocoa butters using an enzyme as provided herein. About
80% of cocoa butters comprise POP, SOS and POS triacylglycerides (P
is palmitic fatty acid, O is oleic fatty acid, S is stearic fatty
acid). The saturated-unsaturated-saturated fatty acid structure of
cocoa butters imparts their characteristic melting profiles, e.g.,
in chocolates. In one aspect, the structured and direct synthetic
processes as provided herein are used on cocoa butters to reduce
cocoa butter variations or to produce synthetic cocoa butters
("cocoa butter alternatives"). In one aspect, a chemoselective
and/or enantioselective (e.g., a regio-selective) hydrolase (e.g.,
lipase or esterase) as provided herein is used to make a cocoa
butter alternative, e.g., a cocoa butter substitute, a cocoa butter
replacer and/or a cocoa butter equivalent. Provided herein are
cocoa butter alternatives, including cocoa butter substitutes,
cocoa butter replacers and cocoa butter equivalents and their
manufacturing intermediates comprising an enzyme as provided
herein. A process as provided herein (using an enzyme as provided
herein) for making cocoa butter alternatives can comprise blending
a vegetable oil, e.g., a palm oil, with shea or equivalent, illipe
or equivalent and Sal sterins or equivalent, and treating the
blended oils with the polypeptides as provided herein. In one
aspect, the process as provided herein comprises use of
interesterification. The process as provided herein can generate
compositional or crystalline forms that mimic "natural" cocoa
butter.
[0460] In certain embodiments, provided herein are processes (using
an enzyme as provided herein) for producing a diacylglycerol (DAG),
e.g., 1, 3 diacylglycerol, using a vegetable oil, e.g., a low cost
oil. The enzyme can be chemoselective and/or enantioselective. The
process as provided herein can result in a DAG-comprising
composition having good stability, long shelf life and high
temperature performance.
[0461] The enzymes (hydrolases, e.g., lipases, saturases palmitases
and/or stearatases) as provided herein and methods as provided
herein can also be used in the enzymatic treatment of edible oils,
as described, e.g., in U.S. Pat. No. 6,025,171. In this exemplary
method, enzymes as provided herein are immobilized by preparing an
emulsion containing a continuous hydrophobic phase, such as a
triacylglyceride oil, and a dispersed aqueous phase containing an
amphiphilic enzyme, such as lipase as provided herein, and carrier
material that is partly dissolved and partly undissolved in the
aqueous phase, and removing water from the aqueous phase until the
phase turns into solid enzyme coated carrier particles. The
undissolved part of the carrier material may be a material that is
insoluble in water and oil, or a water soluble material in
undissolved form because the aqueous phase is already saturated
with the water soluble material. The aqueous phase may be formed
with a crude lipase fermentation liquid containing fermentation
residues and biomass that can serve as carrier materials.
Immobilized lipase is useful for ester re-arrangement and
de-acidification in oils. After a reaction, the immobilized enzyme
can be regenerated for a subsequent reaction by adding water to
obtain partial dissolution of the carrier, and with the resultant
enzyme and carrier-containing aqueous phase dispersed in a
hydrophobic phase evaporating water to again form enzyme coated
carrier particles.
[0462] The enzymes (e.g., lipases, saturases, palmitases and/or
stearatases) as provided herein and methods as provided herein can
also be used for preparing transesterified oils, as described,
e.g., in U.S. Pat. No. 5,288,619. Provided herein are methods for
enzymatic transesterification for preparing a margarine oil having
both low trans-acid and low intermediate chain fatty acid content.
The method includes the steps of providing a transesterification
reaction mixture containing a stearic acid source material and an
edible liquid vegetable oil, transesterifying the stearic acid
source material and the vegetable oil using a 1-, 3-positionally
specific lipase, and then finally hydrogenating the fatty acid
mixture to provide a recycled stearic acid source material for a
recyclic reaction with the vegetable oil. Provided herein are
counter-current method for preparing a transesterified oil. The
method includes the steps of providing a transesterification
reaction zone containing a 1-, 3-positionally specific lipase,
introducing a vegetable oil into the transesterification zone,
introducing a stearic acid source material, conducting a
supercritical gas or subcritical liquefied gas counter-current
fluid, carrying out a transesterification reaction of the
triacylglyceride stream with the stearic acid or stearic acid
monoester stream in the reaction zone, withdrawing a
transesterified triacylglyceride margarine oil stream, withdrawing
a counter-current fluid phase, hydrogenating the transesterified
stearic acid or stearic acid monoester to provide a hydrogenated
recycle stearic acid source material, and introducing the
hydrogenated recycle stearic acid source material into the reaction
zone.
[0463] In one aspect, to allow the enzyme as provided herein to
act, both phases, the oil phase and the aqueous phase that contain
the enzyme, must be intimately mixed. It may not be sufficient to
merely stir them. Good dispersion of the enzyme in the oil is aided
if it is dissolved in a small amount of water, e.g., 0.5-5 weight-%
(relative to the oil), and emulsified in the oil in this form, to
form droplets of less than 10 micrometers in diameter (weight
average). The droplets can be smaller than 1 micrometer. Turbulent
stirring can be done with radial velocities above 100 cm/sec. The
oil also can be circulated in the reactor using an external rotary
pump. The aqueous phase containing the enzyme can also be finely
dispersed by means of ultrasound action. A dispersion apparatus can
be used.
[0464] In one aspect, an enzymatic reaction as provided herein
takes place at the border surface between the oil phase and the
aqueous phase. It is the goal of all these measures for mixing to
create the greatest possible surface for the aqueous phase which
contains the enzyme. The addition of surfactants increases the
microdispersion of the aqueous phase. In some cases, therefore,
surfactants with HLB values above 9, such as Na-dodecyl sulfate,
are added to the enzyme solution, as described, e.g., in EP-A 0 513
709. A similar effective method for improving emulsification is the
addition of lysolecithin. The amounts added can lie in the range of
0.001% to 1%, with reference to the oil. The temperature during
enzyme treatment is not critical. Temperatures between 20.degree.
C. and 80.degree. C. can be used, but the latter can only be
applied for a short time. In this aspect, a lipase as provided
herein having a good temperature and/or low pH tolerance is used.
Application temperatures of between 30.degree. C. and 50.degree. C.
are optimal. The treatment period depends on the temperature and
can be kept shorter with an increasing temperature. Times of 0.1 to
10 hours, or, 1 to 5 hours are generally sufficient. The reaction
takes place in a reactor, which can be divided into stages.
Therefore continuous operation is possible, along with batch
operation. The reaction can be carried out in different temperature
stages. For example, incubation can take place for 3 hours at
40.degree. C., then for 1 hour at 60.degree. C. If the reaction
proceeds in stages, this also opens up the possibility of adjusting
different pH values in the individual stages. For example, in the
first stage the pH of the solution can be adjusted to 7, for
example, and in a second stage to 2.5, by adding citric acid or
other suitable acids. In at least one stage, however, the pH of the
enzyme solution must be below 4, or, below 3. If the pH was
subsequently adjusted below this level, a deterioration of effect
may be found. Therefore the citric acid can be added to the enzyme
solution before the latter is mixed into the oil.
[0465] The enzymes (hydrolases, e.g., lipases, saturases,
palmitases and/or stearatases) as provided herein and methods as
provided herein can also be used for preparing oils, as described,
e.g., in U.S. patent application Ser. No. 11/567,318, incorporated
herein by reference in its entirety. Provided herein are continuous
processes for enzymatic treatment of lipids. The method relates to
a process and apparatus for the continuous enzymatic
interesterification of lipid-containing compositions using a
plurality of fixed bed reactors, wherein the flow of the
lipid-containing composition through the apparatus can remain
substantially constant even as the enzymatic activity of a fixed
bed decreases over time, and even when a fixed bed is taken
off-line such as for repair, replacement, or replenishment.
[0466] Nutraceuticals
[0467] In one aspect, the compositions and methods as provided
herein can be used to make nutraceuticals by processing or
synthesizing lipids and oils using the enzymes as provided herein,
e.g., hydrolases, e.g., lipases, saturases, palmitases and/or
stearatases as provided herein. In one aspect, the processed or
synthesized lipids or oils include poly-unsaturated fatty acids
(PUFAs), diacylglycerides, e.g., 1,3-diacyl glycerides (DAGs),
monoacylglycerides, e.g., 2-monoacylglycerides (MAGs) and
triacylglycerides (TAGs). In one aspect, the nutraceuticals are
made by processing diacylglycerides, e.g., 1,3-diacyl glycerides
(DAGs), monoacylglycerides, e.g., 2-monoacylglycerides (MAGs)
and/or triacylglycerides (TAGs) from plant (e.g., oilseed) sources
or from animal (e.g., fish oil) sources. In certain embodiments,
provided herein are nutraceuticals (e.g., dietary compositions)
comprising polypeptides (e.g., enzymes, peptides, antibodies) as
provided herein.
[0468] In one aspect, the compositions and methods as provided
herein can be used to fortify dietary compositions, especially
cow's milk based products, e.g., cow's milk-based infant formulas,
with bile salt-activated hydrolases. The compositions made by the
methods and compositions as provided herein can be used to feed
newborn and premature infants, including administration of a bile
salt-activated hydrolase as provided herein to increase fat
digestion and therefore growth rate. In certain embodiments,
provided herein are compositions and methods for treating subjects
for inadequate pancreatic enzyme production by administration of
bile salt-activated hydrolase in conjunction with ingestion of
fats; see also discussion, below.
[0469] In certain embodiments, provided herein are dietary
compositions comprising a hydrolase, e.g., bile salt-activated
hydrolase as provided herein. In certain embodiments, provided
herein are dietary compositions comprising a nutritional base
comprising a fat and an effective amount of bile salt-activated
hydrolase as provided herein. In one embodiment, provided herein
are cow's milk-based infant formulas comprising a hydrolase, e.g.,
bile salt-activated hydrolase as provided herein. In one aspect,
the hydrolase as provided herein is active in the digestion of long
chain fatty acids, e.g., C.sub.12 to C.sub.22, which make up a very
high percentage of most milks, e.g., 99% of human breast milk. See,
e.g., U.S. Pat. No. 5,000,975.
[0470] In certain embodiments, provided herein are dietary
compositions comprising a vegetable oil fat and a hydrolase as
provided herein. In other embodiments, provided herein are methods
of processing milk based products and/or vegetable oil-comprising
compositions to make dietary compositions. In one aspect, the
processed compositions comprise a lauric acid oil, an oleic acid
oil, a palmitic acid oil and/or a linoleic acid oil. In one aspect,
a rice bran oil, sunflower oleic oil and/or canola oil may be used
as oleic acids oils. In one aspect, fats and oils, e.g., oilseeds,
from plants, including, e.g., canola, castor, coconut, coriander,
corn, cottonseed, hazelnut, hempseed, linseed, meadowfoam, olive,
palm oil, palm kernel, peanut, rapeseed, rice bran, safflower,
sasanqua, soybean, sunflower, tall, tsubaki, varieties of "natural"
oils having altered fatty acid compositions via Genetically
Modified Organisms (GMO) or traditional "breeding such as high
oleic, low linolenic, or low saturated oils (high oleic canola, low
linolenic soybean, or high stearic sunflower), blends of any of the
above for use in the nutraceuticals and dietary compositions are
processed or made using a hydrolase as provided herein. See, e.g.,
U.S. Pat. No. 4,944,944.
[0471] In one aspect, the enzymes as provided herein are provided
in a form that is stable to storage in the formula and/or the
stomach, but active when the formulation reaches the portion of the
gastrointestinal tract where the formula would normally be
digested. Formulations (e.g., microcapsules) for release in the
intestine are well known in the art, e.g., biodegradable polymers
such as polylactide and polyglycolide, as described, e.g., in U.S.
Pat. Nos. 4,767,628; 4,897,268; 4,925,673; 5,902,617.
[0472] Confectionaries, Cocao (Cocoa) Butter and Foods
[0473] In one aspect, the compositions and methods as provided
herein can be used to make and process hard butters, such as cocoa
butter (cocao butter). In another aspect, provided herein are
confectionaries, cocao butter and foods comprising polypeptides
(e.g., enzymes, peptides, antibodies) as provided herein.
[0474] The compositions and methods as provided herein can be used
to make cocoa butter alternatives by "structured" synthetic
techniques using the enzymes, e.g., hydrolases, e.g., lipases,
saturases, palmitases and/or stearatases as provided herein. For
example, in one aspect, the methods as provided herein process or
synthesize triacylglycerides, diacylglycerides and/or
monoacylglycerides for use as, e.g., cocoa butter alternatives. In
one aspect, the methods as provided herein generate a hard butter
with a defined "plastic region" to maintain sufficient hardness
below or at room temperature. In one aspect, the processed or
synthesized lipid is designed to have a very narrow "plastic
region," e.g., in one aspect, where it rapidly melts at about body
temperature. Natural cocoa butter begins to soften at approximately
30.degree. C. to 32.degree. C., and completely melts at
approximately 36.degree. C. Natural cocoa butter can contain 70 wt
% or more of three 1,3-disaturated-2-oleoyl glycerols, which are
1,3-dipalmitoyl-2-oleoyl glycerol (POP),
1-palmitoyl-2-oleoyl-3-stearoyl glycerol (POSt) and
1,3-distearoyl-2-oleoyl glycerol (StOSt). These three glycerols
show a similar melting behavior to each other and are responsible
for melting properties of the cocoa butter, exhibiting a very
narrow plastic region. In certain embodiments, provided herein are
synthetic cocoa butters or processed cocoa butters (synthesized or
processed using a hydrolase as provided herein, all possible
compositions are referred to as cocoa-butter alternatives) with
varying percentages of 1,3-dipalmitoyl-2-oleoyl glycerol (POP),
1-palmitoyl-2-oleoyl glycerol (POSt) and 1,3-distearoyl-2-oleoyl
glycerol (StOSt), depending on the desired properties of the
synthetic cocoa butter, and, synthetic cocoa butters with more or
less than 70 wt % of the three 1,3-disaturated-2-oleoyl glycerols.
The synthetic cocoa butters as provided herein can partially or
completely replace natural or unprocessed cocoa butters and can
maintain or improve essential hard butter properties.
[0475] In certain embodiments, provided herein are synthetic cocoa
butters or processed cocoa butters (synthesized or processed using
a hydrolase as provided herein) with desired properties for use in
confectionary, bakery and pharmaceutical products. In other
embodiments, provided herein are confectionaries, bakery and
pharmaceutical products, and the like, comprising a hydrolase as
provided herein. In one aspect, the methods as provided herein make
or process a lipid (a fat) from a confection (e.g., a chocolate) or
to be used in a confection. In one aspect, a lipid is made or
processed such that the chocolate shows less finger-imprinting than
chocolate made from natural cocoa butter, while still having sharp
melting characteristics in the mouth. In one aspect, a lipid is
made or processed such that a confection (e.g., chocolate) can be
made at a comparatively high ambient temperature, or, be made using
a cooling water at a comparatively high temperature. In one aspect,
the lipid is made or processed such that a confection (e.g.,
chocolate) can be stored under relatively warmer conditions, e.g.,
tropical or semi-tropical conditions or in centrally heated
buildings. In one aspect, the lipids are made or processed such
that a confection (e.g., chocolate) will have a lipid (fat) content
of consistent composition and quality. The enzymes as provided
herein can be used to provide a substitute composition for cocoa
butter which can significantly improve its thermal stability and
replace it in a wide range of applications.
[0476] Margarine and Shortening Production
[0477] In certain embodiments, provided herein are synthetic or
processed fats, e.g., margarine and shortening, synthesized or
processed using a hydrolase as provided herein. In other
embodiments, provided herein are synthetic or processed fats, e.g.,
margarine and shortening, comprising polypeptides (e.g., enzymes,
peptides, antibodies) as provided herein.
[0478] In one embodiment, provided herein are processed fats
comprising a vegetable oil, such as canola, castor, coconut,
coriander, corn, cottonseed, hazelnut, hempseed, linseed,
meadowfoam, olive, palm oil, palm kernel, peanut, rapeseed, rice
bran, safflower, sasanqua,sesame, soybean, sunflower, tall,
tsubaki, varieties of "natural" oils having altered fatty acid
compositions via Genetically Modified Organisms (GMO) or
traditional "breeding" such as high oleic, low linolenic, or low
saturated oils (high oleic canola, low linolenic soybean, or high
stearic sunflower) type oils synthesized or processed using a
hydrolase as provided herein. The synthetic or processed fats,
e.g., margarine and shortening, are designed to have a desired
"plasticity." Many of the plastic fat products, such as margarine
and shortening, are produced from hard stocks and liquid oils as
raw materials. For example, liquid oils such as canola, castor,
coconut, coriander, corn, cottonseed, hazelnut, hempseed, linseed,
meadowfoam, olive, palm oil, palm kernel, peanut, rapeseed, rice
bran, safflower, sasanqua, sesame, soybean, sunflower, tall,
tsubaki, varieties of "natural" oils having altered fatty acid
compositions via Genetically Modified Organisms (GMO) or
traditional "breeding" such as high oleic, low linolenic, or low
saturated oils (high oleic canola, low linolenic soybean, or high
stearic sunflower), are blended with their hardened oils (hard
stocks), and the blend is adjusted to have an appropriate
consistency (plasticity). The plastic fat products such as
margarine and shortening so produced tend to cause the formation of
relatively coarse crystallines because fats and oils used as the
raw materials are composed of fatty acids having almost the same
carbon chain length. In other words, they have a highly-unified
composition of fatty acids. For this reason, the plasticity of
these products can be maintained at an appropriate degree only
within a narrow temperature range, so that the liquid oils
contained therein have a tendency to exude. Provided herein are
methods of making or processing fats designed such that they have a
varied (and defined) composition of fatty acids. The resultant oil,
e.g., margarine or shortening, can have a broader range of
plasticity.
[0479] In one aspect, the methods and compositions as provided
herein are used to make or process vegetable oils, such as canola,
castor, coconut, coriander, corn, cottonseed, hazelnut, hempseed,
linseed, meadowfoam, olive, palm oil, palm kernel, peanut,
rapeseed, rice bran, safflower, sasanqua, sesame, soybean,
sunflower, tall, tsubaki, varieties of "natural" oils having
altered fatty acid compositions via Genetically Modified Organisms
(GMO) or traditional "breeding" such as high oleic, low linolenic,
or low saturated oils (high oleic canola, low linolenic soybean, or
high stearic sunflower) type oils using the hydrolases as provided
herein, including inter-esterification and enzymatic
transesterification, see e.g., U.S. Pat. No. 5,288,619 and U.S.
patent application Ser. No. 11/567,318. The methods and
compositions as provided herein can be used in place of random
inter-esterification as described in, e.g., U.S. Pat. No.
3,949,105. In one aspect, the methods and compositions as provided
herein are used in enzymatic transesterification for preparing an
oil, e.g., a margarine oil, having both low trans-acid and low
intermediate chain fatty acid content.
[0480] In one aspect, the symmetric structure of an oil, e.g., a
palm or lauric type oils is modified, e.g., into a random
structure. Thus, the methods as provided herein can be used to
modify the properties of plastic fat products. In one aspect, the
modification of oils by the methods as provided herein can be
designed to prevent or slow gradually hardening of the oil with
time, particularly when the products are being stored.
[0481] In one aspect, the methods and compositions as provided
herein in a trans-esterification reaction mixture comprising a
stearic acid source material and an edible liquid vegetable oil,
trans-esterifying the stearic acid source material and the
vegetable oil using a 1-, 3-positionally specific lipase as
provided herein, and then hydrogenating the fatty acid mixture to
provide a recycle stearic acid source material for a recyclic
reaction with the vegetable oil. See e.g., U.S. Pat. No.
5,288,619.
[0482] In one aspect, an inter-esterification reaction is conducted
with a lipase as provided herein. In one aspect, the lipase as
provided herein has selectivity for the 1- and 3-positions of
triacylglyceride to slow or inhibit an increase in the amount of
tri-saturated triacylglycerides in the oil. In this reaction as
provided herein, deficiencies of conventional random
inter-esterification and the difficulty of inter-esterification
with a non-specific lipase can be overcome because the
inter-esterification is conducted by an enzyme as provided herein
having specificity for the 1- and 3-positions of triacylglycerides.
In one aspect, the exudation of liquid oils contained in the
products is slowed or prevented with a temperature increase in the
reaction to inhibit a rise in the melting point caused by an
increase in the amount of tri-saturated triacylglycerides. This
addresses the problem of hardening of products during long-term
storage.
[0483] Pharmaceutical Compositions and Treating Hydrolase
Deficiencies
[0484] In certain embodiments, provided herein are methods and
compositions (enzymes as provided herein, e.g., esterases,
acylases, lipases, phospholipases or proteases as provided herein)
that can be used in the treatment of a hydrolase deficiency in an
animal, e.g., a mammal, such as a human. For example, in one
aspect, the methods and compositions as provided herein are used to
treat patients suffering from a deficiency of a pancreatic lipase.
In one aspect, the lipase is administered orally. An enzyme as
provided herein can be delivered in place of or with a preparation
of pig pancreas enzyme.
[0485] In certain embodiments, provided herein are pharmaceutical
compositions comprising polypeptides (e.g., enzymes, peptides,
antibodies) as provided herein. These pharmaceutical compositions
can be in the form of tablets, pills, gels, capsules, hydrogels,
sprays, powders, aerosols, implants, liposomes, creams, ointments,
liquids, a microsphere, a multiparticulate core particle, an
emulsion, a suspension, nanostructures and the like. The
pharmaceutical compositions comprising polypeptides (e.g., enzymes,
peptides, antibodies) as provided herein can be administered in any
form, e.g., orally, intradermally, intraperitoneally, by I.V.,
topically and the like. In one aspect, the pharmaceutical
compositions as provided herein are formulated for topical,
sublingual, oral, intravenous, subcutaneous, intramuscular,
transdermal, intraarterial, intraarticular, or intradermal
delivery.
[0486] In one aspect, the compositions as provided herein used for
these treatments are active under acidic conditions. In one aspect,
the compositions as provided herein are administered orally in
formulations (e.g., tablets, pills, gels, capsules, hydrogels,
sprays, powders, aerosols) that pass through the acid regions of
the stomach and discharge the enzyme only in the relatively
alkaline environment of the jejunum. In one aspect, a hydrolase as
provided herein is formulated with a carrier such as lactose,
saccharose, sorbitol, mannitol, starch, cellulose derivatives or
gelatine or any other such excipient. A lubricant such as magnesium
stearate, calcium stearate or polyethylene glycol wax also can be
added. A concentrated sugar solution, which may contain additives
such as talc, titanium dioxide, gelatine or gum Arabic, can be
added as a coating. Soft or hard capsules can be used to
encapsulate a hydrolase as a liquid or as a solid preparation. See,
e.g., U.S. Pat. Nos. 5,691,181; 5,858,755.
[0487] Detergents
[0488] In certain embodiments, provided herein are methods and
compositions (enzymes, e.g., lipases, saturases, palmitases and/or
stearatases as provided herein) that can be used in making and
using detergents. A hydrolase as provided herein can be added to,
e.g., be blended with, any known detergent composition, solid or
liquid, with or without changing the composition of the detergent
composition. For examples, a hydrolase as provided herein can be
added to any soap, e.g., aliphatic sulfates such as straight or
branched chain alkyl or alkenyl sulfates, amide sulfates, alkyl or
alkenyl ether sulfates having a straight or branched chain alkyl or
alkenyl group to which one or more of ethylene oxide, propylene
oxide and butylene oxide is added, aliphatic sulfonates such as
alkyl sulfonates, amide sulfonates, dialkyl sulfosuccinates,
sulfonates of alpha-olefins, of vinylidene-type olefins and of
internal olefins, aromatic sulfonates such as straight or branched
chain alkylbenzenesulfonates, alkyl or alkenyl ether carbonates or
amides having a straight or branched chain alkyl or alkenyl group
to which one or more of ethylene oxide, propylene oxide and
butylene oxide is added, or amides, alpha-sulfo-fatty acid salts or
esters, amino acid type surfactants, phosphate surfactants such as
alkyl or alkenyl acidic phosphates, and alkyl or alkenyl
phosphates, sulfonic acid type amphoteric surfactants, betaine type
amphoteric surfactants, alkyl or alkenyl ethers or alcohols having
a straight or branched chain alkyl or alkenyl group to which one or
more of ethylene oxide, propylene oxide and butylene oxide is
added, polyoxy-ethylenealkyl phenyl ethers having a straight or
branched chain alkyl group to which one or more of ethylene oxide,
propylene oxide and butylene oxide is added, higher fatty acid
alkanolamides or alkylene oxide adducts thereof, sucrose fatty acid
esters, fatty acid glycerol monoesters, alkyl- or alkenyl-amine
oxides, tetraalkyl-ammonium salt type cationic surfactants, or a
combination thereof. See, e.g., U.S. Pat. No. 5,827,718.
[0489] In some embodiments, provided herein are detergent
compositions comprising one or more polypeptides (hydrolases) as
provided herein. Surface-active and/or non-surface-active forms can
be used. In one aspect, the amount of total hydrolase,
surface-active and/or non-surface-active, can be from about 0.0001%
to about 1.0%, or from about 0.0002% to about 0.5%, by weight, of
the detergent composition. In one aspect, of the detergent
composition, the surface-active hydrolase is from about 5% to about
67% and the non-surface-active hydrolase is from about 33% to about
95% of the total hydrolase activity in the enzymatic mixture. In
one aspect, the optimum pH of the total enzymatic mixture is
between about 5 to about 10.5.
[0490] In one aspect, the detergent compositions as provided herein
include alkaline hydrolases as provided herein which function at
alkaline pH values, since the pH of a washing solution can be in an
alkaline pH range under ordinary washing conditions. See, e.g.,
U.S. Pat. No. 5,454,971
[0491] The polypeptides as provided herein (enzymes as provided
hereins) can be used in any detergent composition, which are well
known in the art, see, e.g., U.S. Pat. Nos. 5,069,810; 6,322,595;
6,313,081. For example, in one aspect, a laundry detergent
composition is provided. It can comprise 0.8 ppm to 80 ppm of a
lipase as provided herein.
[0492] Any method of making and using detergent compositions can be
used with enzymes as provided herein, see, e.g., U.S. Pat. Nos.
6,413,928; 6,399,561; 6,365,561; 6,380,147. The detergent
compositions can be a one and two part aqueous composition, a
non-aqueous liquid composition, a cast solid, a granular form, a
particulate form, a compressed tablet, a gel form, a powder, a gel,
a hydrogel, a liposome, an aerosol, a paste and/or a slurry form.
The hydrolases as provided herein can also be used as a detergent
additive product in a solid or a liquid form. Such additive
products are intended to supplement or boost the performance of
conventional detergent compositions and can be added at any stage
of the cleaning process.
[0493] In certain embodiments, provided herein are methods capable
of removing gross food soils, films of food residue and other minor
food compositions using these detergent compositions. Hydrolases as
provided herein can facilitate the removal of stains by means of
catalytic hydrolysis of lipids, fats or oils. Hydrolases as
provided herein can be used in dishwashing detergents and in
textile laundering detergents.
[0494] The actual active enzyme content depends upon the method of
manufacture of a detergent composition and is not critical,
assuming the detergent composition has the desired enzymatic
activity. In one aspect, the amount of hydrolases present in the
final composition ranges from about 0.001 mg to 0.5 mg per gram of
the detergent composition. The particular enzyme chosen for use in
the process and products provided herein depends upon the
conditions of final utility, including the physical product form,
use pH, use temperature, and soil types to be degraded or altered.
The enzyme can be chosen to provide optimum activity and stability
for any given set of utility conditions. In one aspect, the
hydrolases provided herein are active in the pH ranges of from
about 4 to about 12 and in the temperature range of from about
20.degree. C. to about 95.degree. C. The detergents as provided
herein can comprise cationic, semi-polar nonionic or zwitterionic
surfactants; or, mixtures thereof.
[0495] In one embodiment, enzymes as provided herein can be
formulated into powdered and liquid detergents having pH between
4.0 and 12.0 at levels of about 0.01 to about 5% (alternatively
0.1% to 0.5%) by weight. These detergent compositions can also
include other enzymes such as proteases, cellulases, lipases or
endoglycosidases, endo-beta.-1,4-glucanases, beta-glucanases,
endo-beta-1,3(4)-glucanases, cutinases, peroxidases, laccases,
amylases, glucoamylases, pectinases, reductases, oxidases,
phenoloxidases, ligninases, pullulanases, arabinanases,
hemicellulases, mannanases, xyloglucanases, xylanases, pectin
acetyl esterases, rhamnogalacturonan acetyl esterases,
polygalacturonases, rhamnogalacturonases, galactanases, pectin
lyases, pectin methylesterases, cellobiohydrolases and/or
transglutaminases. These detergent compositions can also include
builders and stabilizers.
[0496] The addition of hydrolases as provided herein to
conventional cleaning compositions does not create any special use
limitation. In other words, any temperature and pH suitable for the
detergent is also suitable for the compositions as provided herein
as long as the enzyme is active at or tolerant of the pH and/or
temperature of the intended use. In addition, the hydrolases as
provided herein can be used in a cleaning composition without
detergents, again either alone or in combination with builders and
stabilizers.
[0497] In certain embodiments, provided herein are cleaning
compositions including detergent compositions for cleaning hard
surfaces, detergent compositions for cleaning fabrics, dishwashing
compositions, oral cleaning compositions, denture cleaning
compositions, and contact lens cleaning solutions.
[0498] In certain embodiments, provided herein are methods for
washing an object comprising contacting the object with a
polypeptide as provided herein under conditions sufficient for
washing. A hydrolase as provided herein may be included as a
detergent additive. The detergent composition as provided herein
may, for example, be formulated as a hand or machine laundry
detergent composition comprising a polypeptide as provided herein.
A laundry additive suitable for pre-treatment of stained fabrics
can comprise a polypeptide as provided herein. A fabric softener
composition can comprise a hydrolase as provided herein.
Alternatively, a hydrolase as provided herein can be formulated as
a detergent composition for use in general household hard surface
cleaning operations. In alternative aspects, detergent additives
and detergent compositions as provided herein may comprise one or
more other enzymes such as a protease, a lipase, a cutinase,
another protease, a carbohydrase, a cellulase, a pectinase, a
mannanase, an arabinase, a galactanase, a xylanase, an oxidase,
e.g., a lactase, and/or a peroxidase (see also, above). The
properties of the enzyme(s) as provided herein are chosen to be
compatible with the selected detergent (i.e. pH-optimum,
compatibility with other enzymatic and non-enzymatic ingredients,
etc.) and the enzyme(s) is present in effective amounts. In one
aspect, enzymes as provided herein are used to remove malodorous
materials from fabrics. Various detergent compositions and methods
for making them that can be used are described in, e.g., U.S. Pat.
Nos. 6,333,301; 6,329,333; 6,326,341; 6,297,038; 6,309,871;
6,204,232; 6,197,070; 5,856,164.
[0499] When formulated as compositions suitable for use in a
laundry machine washing method, the hydrolases as provided herein
can comprise both a surfactant and a builder compound. They can
additionally comprise one or more detergent components, e.g.,
organic polymeric compounds, bleaching agents, additional enzymes,
suds suppressors, dispersants, lime-soap dispersants, soil
suspension and anti-redeposition agents and corrosion inhibitors.
Laundry compositions as provided herein can also contain softening
agents, as additional detergent components. Compositions containing
hydrolases as provided herein can provide fabric cleaning, stain
removal, whiteness maintenance, softening, color appearance, dye
transfer inhibition and sanitization when formulated as laundry
detergent compositions.
[0500] The density of the laundry detergent compositions as
provided herein can range from about 200 to 1500 g/liter, or, about
400 to 1200 g/liter, or, about 500 to 950 g/liter, or, 600 to 800
g/liter, of composition; this can be measured at about 20.degree.
C.
[0501] The "compact" form of laundry detergent compositions as
provided herein is best reflected by density and, in terms of
composition, by the amount of inorganic filler salt. Inorganic
filler salts are conventional ingredients of detergent compositions
in powder form. In conventional detergent compositions, the filler
salts are present in substantial amounts, typically 17% to 35% by
weight of the total composition. In one aspect of the compact
compositions, the filler salt is present in amounts not exceeding
15% of the total composition, or, not exceeding 10%, or, not
exceeding 5% by weight of the composition. The inorganic filler
salts can be selected from the alkali and alkaline-earth-metal
salts of sulphates and chlorides, e.g., sodium sulphate.
[0502] Liquid detergent compositions as provided herein can also be
in a "concentrated form." In one aspect, the liquid detergent
compositions can contain a lower amount of water, compared to
conventional liquid detergents. In alternative aspects, the water
content of the concentrated liquid detergent is less than 40%, or,
less than 30%, or, less than 20% by weight of the detergent
composition. Detergent compounds as provided herein can comprise
formulations as described in WO 97/01629.
[0503] Hydrolases as provided herein can be useful in formulating
various cleaning compositions. A number of known compounds are
suitable surfactants including nonionic, anionic, cationic, or
zwitterionic detergents, e.g., as disclosed in U.S. Pat. Nos.
4,404,128; 4,261,868; 5,204,015. In addition, enzymes as provided
herein can be used, for example, in bar or liquid soap
applications, dish care formulations, contact lens cleaning
solutions or products, peptide hydrolysis, waste treatment, textile
applications, as fusion-cleavage enzymes in protein production, and
the like. Hydrolases as provided herein may provide enhanced
performance in a detergent composition as compared to another
detergent protease, that is, the enzyme group may increase cleaning
of certain enzyme sensitive stains such as grass or blood, as
determined by usual evaluation after a standard wash cycle.
Hydrolases as provided herein can be formulated into known powdered
and liquid detergents having pH between 6.5 and 12.0 at levels of
about 0.01 to about 5% (for example, about 0.1% to 0.5%) by weight.
These detergent cleaning compositions can also include other
enzymes such as other known esterases, phospholipases, proteases,
amylases, cellulases, lipases or endoglycosidases, as well as
builders and stabilizers.
[0504] Treating Foods and Food Processing
[0505] The hydrolases as provided herein can be used for separation
of components of plant cell materials. For example, hydrolases as
provided herein can be used in the separation of protein-rich
material (e.g., plant cells) into components, e.g., sucrose from
sugar beet or starch or sugars from potato, pulp or hull fractions.
In one aspect, hydrolases as provided herein can be used to
separate protein-rich or oil-rich crops into valuable protein and
oil and hull fractions. The separation process may be performed by
use of methods known in the art.
[0506] The hydrolases as provided herein can be used in the
preparation of fruit or vegetable juices, syrups, extracts and the
like to increase yield. The hydrolases as provided herein can be
used in the enzymatic treatment (e.g., hydrolysis of proteins) of
various plant cell wall-derived materials or waste materials, e.g.
from wine or juice production, or agricultural residues such as
vegetable hulls, bean hulls, sugar beet pulp, olive pulp, potato
pulp, and the like. The hydrolases as provided herein can be used
to modify the consistency and appearance of processed fruit or
vegetables. The hydrolases as provided herein can be used to treat
plant material to facilitate processing of plant material,
including foods, facilitate purification or extraction of plant
components. The hydrolases as provided herein can be used to
improve feed value, decrease the water binding capacity, improve
the degradability in waste water plants and/or improve the
conversion of plant material to ensilage, and the like.
[0507] Animal Feeds and Food or Feed Additives
[0508] In certain embodiments, provided herein are methods for
treating animal feeds and foods and food or feed additives using
hydrolases as provided herein, animals including mammals (e.g.,
humans), birds, fish and the like. In other embodiments, provided
herein are animal feeds, foods, feed and food supplements, and
additives comprising hydrolases as provided herein.
[0509] In certain embodiments, provided herein are hydrolases for
use in the modification of animal feed or a food, e.g., to process
the food or feed either in vitro (by modifying components of the
feed or food) or in vivo. In another aspect, hydrolase as provided
herein can be supplied by expressing the enzymes directly in
transgenic feed crops (as, e.g., transgenic plants, seeds and the
like), such as corn, soy bean, rape seed, lupin and the like. In
one aspect, provided herein are transgenic plants, plant parts and
plant cells comprising a nucleic acid sequence encoding a
polypeptide as provided herein. In one aspect, the nucleic acid is
expressed such that the hydrolase as provided herein is produced in
recoverable quantities. The hydrolase can be recovered from any
plant or plant part. Alternatively, the plant or plant part
containing the recombinant polypeptide can be used as such for
improving the quality of a food or feed, e.g., improving
nutritional value, palatability, and rheological properties, or to
destroy an antinutritive factor.
[0510] Interesterification
[0511] In one aspect, the methods and compositions provided herein
can be used to modify the properties of triacylglyceride mixtures,
and, in one aspect, their consistency. In one aspect, an enzyme as
provided herein can be used in the presence of a catalyst such as
sodium metal or sodium methoxide to promote acyl migration between
glyceride molecules such that the products consist of glyceride
mixtures in which the fatty acyl residues are randomly distributed
among the glyceride molecules.
[0512] In one aspect, the enzymes as provided herein can be used to
produce interesterification products under reaction conditions
inwhich hydrolysis of fat is minimized so that lipase-catalyzed
interesterification becomes the dominant reaction. These conditions
may include, for example, restricting the amount of water in the
system.
[0513] In one aspect, enzymes as provided herein can be used to
catalyze interesterification reactions using mixtures of
triacylglycerides and free fatty acids, as described, e.g., in EP 0
093 602 B2. In these cases, free fatty acid can be exchanged with
the acyl groups of the triacylglycerides to produce new
triacylglycerides enriched in the added fatty acid. In one aspect,
1,3-specific lipases as provided herein can be used to confine the
reaction to the 1- and 3-positions of the glycerides, which allow
to obtain a mixture of triacylglycerides unobtainable by chemical
interesterification or reaction with a non-specific lipase. In one
aspect, non-specific lipases are used to attain results similar to
chemical interesterification.
[0514] The ability to produce novel triacylglyceride mixtures using
positionally specific lipases as provided herein is useful to the
oils and fats industry because some of these mixtures have valuable
properties. One example is the 1,3-specific lipase-catalyzed
interesterification of 1,3-dipalmitoyl-2-monoleine (POP), which is
the major triacylglyceride of the mid-fraction of palm oil, with
either stearic acid or tristearin to give products enriched in the
valuable 1-palmitoyl-3-stearoyl-2-monoleine (POSt) and
1,3-distearoyl-2-monoleine (StOSt). POSt and StOSt are the
important components of cocoa butter. Thus, one aspect as provided
herein provides an interesterification reaction to produce cocoa
butter equivalents from cheap starting materials.
[0515] In one aspect, provided herein are methods of production of
a hard fat replacer using the 1,3-specific lipases as provided
herein. In one aspect, a hard fat replacer comprises a mixture of
palm mid-fraction and StOSt, POSt or StOSt/POSt of at least 85%
purity.
[0516] The invention will be further described with reference to
the following examples; however, it is to be understood that the
invention is not limited to such examples.
EXAMPLES
Example 1
Exemplary Lipase-Saturase Assays
[0517] The following example describes exemplary assays to screen
for a hydrolase e.g., a lipase, a saturase, a palmitase and/or a
stearatase activity. In one aspect, these exemplary assays can be
used as routine screens to determine if a polypeptide is within the
scope as provided herein. Such assays include use of pH indicator
compounds to detect cleavage of fatty acids from triacylglycerides,
spectrophotometric methods, HPLC, GC, MS, TLC and others. Jaeger
(1994) FEMS Microbiol. Rev. 15:29-63; Ader (1997) Methods Enzymol.
286:351-386; Vorderwulbecke (1992) Enzyme Microb. Technol.
14:631-639; Renard (1987) Lipids 22: 539-541.
Screening for Lipase/Esterase Activity
[0518] Colonies are picked with sterile toothpicks and used to
singly inoculate each of the wells of 96-well microtiter plates.
The wells contained 250 .mu.L of LB media with 100 .mu.g/mL
ampicillin, 80 .mu.g/mL methicillin, and 10% v/v glycerol (LB
Amp/Meth, glycerol). The cells were grown overnight at 37.degree.
C. without shaking. Each well thus contained a stock culture of E.
coli cells, each of which contained a pBLUESCRIPT.TM. with a unique
DNA insert.
[0519] The 96-well plates were used to multiply inoculate a single
plate (the "condensed plate") containing in each well 200 .mu.L of
LB Amp/Meth, glycerol. This step was performed using the High
Density Replicating Tool (HDRT) of a BIOMEK.TM. (Beckman Coulter,
Inc., Fullerton, Calif.) with a 1% bleach, water, isopropanol,
air-dry sterilization cycle in between each inoculation. Each well
of the condensed plate thus contained 10 to 12 different
pBLUESCRIPT.TM. clones from each of the source library plates. The
condensed plate was grown for 16 hours at 37.degree. C. and then
used to inoculate two white 96-well microtiter daughter plates
(Polyfiltronics, Inc., Rockland Mass.) containing in each well 250
.mu.L of LB Amp/Meth (no glycerol). The original condensed plate
was put in storage -80.degree. C. The two condensed daughter plates
were incubated at 37.degree. C. for 18 hours.
[0520] The short chain esterase `600 .mu.M substrate stock
solution` was prepared as follows: 25 mg of each of the following
compounds was dissolved in the appropriate volume of DMSO to yield
a 25.2 mM solution. The compounds used were 4-methylumbelliferyl
proprionoate, 4-methylumbelliferyl butyrate, and
4-methylumbelliferyl heptanoate. Two hundred fifty microliters of
each DMSO solution was added to ca 9 mL of 50 mM, pH 7.5 HEPES
buffer which contained 0.6% of Triton X-100 and 0.6 mg per mL of
dodecyl maltoside (Anatrace, Maumee, Ohio). The volume was taken to
10.5 mL with the above HEPES buffer to yield a slightly cloudy
suspension.
[0521] The long chain `600 .mu.M substrate stock solution` was
prepared as follows: 25 mg of each of the following compounds was
dissolved in DMSO to 25.2 mM as above. The compounds used were
4-methylumbelliferyl elaidate, 4-methylumbelliferyl palmitate,
4-methylumbelliferyl oleate, and 4-methylumbelliferyl stearate. All
required brief warming in a 70.degree. C. bath to achieve
dissolution. Two hundred fifty microliters of each DMSO solution
was added to the HEPES buffer and diluted to 10.5 mL as above. All
seven umbelliferyl derivatives were obtained from Sigma Chemical
Co. (St. Louis, Mo.).
[0522] Fifty .mu.L of the long chain esterase or short chain
esterase `600 .mu.M substrate stock solution` was added to each of
the wells of a white condensed plate using the BIOMEK.TM. to yield
a final concentration of substrate of about 100 .mu.M. The
fluorescence values were recorded (excitation=326 nm, emission=450
nm) on a plate-reading fluorometer immediately after addition of
the substrate. The plate was incubated at 70.degree. C. for 60
minutes in the case of the long chain substrates, and 30 minutes at
RT in the case of the short chain substrates. The fluorescence
values were recorded again. The initial and final fluorescence
values were compared to determine if an active clone was
present.
[0523] To isolate the individual clone which carried the activity,
the Source GenBank plates were thawed and the individual wells used
to singly inoculate a new plate containing LB Amp/Meth. As above,
the plate was incubated at 37.degree. C. to grow the cells, 50
.mu.L of 600 .mu.M substrate stock solution was added using the
BIOMEK.TM. and the fluorescence was determined. Once the active
well from the source plate was identified, cells from this active
well were streaked on agar with LB/Amp/Meth and grown overnight at
37.degree. C. to obtain single colonies. Eight single colonies were
picked with a sterile toothpick and used to singly inoculate the
wells of a 96-well microtiter plate. The wells contained 250 .mu.L
of LB Amp/Meth. The cells were grown overnight at 37.degree. C.
without shaking. A 200 .mu.L aliquot was removed from each well and
assayed with the appropriate long or short chain substrates as
above. The most active clone was identified and the remaining 50
.mu.L of culture was used to streak an agar plate with LB/Amp/Meth.
Eight single colonies were picked, grown and assayed as above. The
most active clone was used to inoculate 3 mL cultures of
LB/Amp/Meth, which were grown overnight. The plasmid DNA was
isolated from the cultures and utilized for sequencing.
Example 2
Exemplary Protocols for Determination by LCMS of Released Fatty
Acid Profile Resulting from Enzymatic Hydrolysis of Vegetable
Oil
[0524] The following example describes exemplary methods
(protocols) for conducting enzymatic hydrolysis of vegetable oil,
such as soy oil (used in this example), (including enzyme
preparation) using, for example, enzymes as provided herein. This
example also describes exemplary methods (protocols) for detecting
and quantifying the fatty acids released from the oil. The method
is described using the lipase SEQ ID NO:2, but is applicable to
other enzymes, including the enzymes as provided herein, e.g., the
exemplary enzymes having a sequences as set forth in SEQ ID NO:2
and having one, two, three, four, five, six, seven, eight, nine,
ten, eleven or twelve or more or all the amino acid residue
modifications described in Table 3 or Table 4.
Expression of Protein in 96 Deep Well Plate:
[0525] 1. Grow E. coli lipase clones overnight at 30.degree. C. in
1 mL TB medium containing carbenicillin (100 .mu.g/mL) in deep
96-well plates with. Record location and identity of clones. [0526]
2. Inoculate fresh deep 96-well plates containing TB medium (1 mL;
100 .mu.g/mL carbenicillin) with the liquid cultures (10
.mu.L/well). [0527] 3. Incubate culture overnight at 30.degree. C.
while shaking at 200 rpm. [0528] 4. Induce protein expression by
transfer of 500 .mu.L of each overnight cultures into a fresh 96
well plate containing of TB medium (500 .mu.L/well; 100 .mu.g/mL
carbenicillin) and anhydrous tetracycline (200 ng/mL). [0529] 5.
Incubate at 30.degree. C. for 2 hours with shaking at 200 rpm
[0530] 6. Harvest cells by centrifuging each plate for 10 minutes
at 3000.times.g. Remove supernatant. Cell pellets may be used
immediately for oil assays or stored at -20.degree. C. for later
use.
Enzymatic Oil Hydrolysis Reaction:
[0530] [0531] 1. Add 100 .mu.L of B-PER.TM. (Pierce Chemical,
Rockford, Ill.) to each cell pellet. If pellets are stored at
-20.degree. C., allow to thaw for 10 min at room temperature before
addition of B-PERT.TM.. [0532] 2. Add 400 .mu.L of soy oil to each
well of deep 96-well plate. [0533] 3. Add several beads (glass
710-1180 .mu.m) per well. Seal plates with CAPMATS.TM. (Whatman,
Florham Park, N.J.). [0534] 4. Cells are lysed and an
oil/enzyme/buffer emulsion is generated using a mixer mill (Retsch
Inc., Newtown, Pa.). Put a pair of sealed plates into the Mixer
Mill and shake for 30 seconds at a frequency of 30 cycles/second.
[0535] 5. Replace the CAPMATS.TM. seals with a gas permeable seal.
[0536] 6. Incubate the plates for 2 hours at 37.degree. C. while
shaking at 200 rpm.
Fatty Acid Extraction:
[0536] [0537] 1. Add 1 mL of extraction solvent (CHCl.sub.3:MeOH:4N
HCl (2:1:0.075)) to each well of the deep 96 well plate. [0538] 2.
Pipet mixture up and down several times until it appears
homogeneous. [0539] 3. Cover the plates with an aluminum foil seal.
[0540] 4. Centrifuge for 5 minutes at 3000.times.g. Cut open seal
using razor blade. [0541] 5. Penetrate pipet tip through upper
phase and transfer 5 .mu.L of lower phase to a new deep 96-well
plate containing 995 .mu.L/well of MeOH (i.e. a 1/200 dilution of
the lower phase). Be careful not to contaminate with upper phase.
Store separated extraction mixtures at 4.degree. C. [0542] 6.
Transfer 150 .mu.L the 1/200 dilution of all samples to a
polystyrene 96 well plate. [0543] 7. To prevent evaporation,
heat-seal the plates. Be sure the seal does not contact MeOH as
this will prevent proper adhesion. [0544] 8. Analyze the samples by
LC/MS.
LC/MS Analysis:
[0544] [0545] 1. Samples submitted in 96-well plate format are
injected via an HTCPAL.TM. auto sampler (LEAP Technologies,
Carrboro, N.C.) into an isocratic mixture of H.sub.2O/MeCN (10/90,
v/v) and 0.1% formic acid, delivered by LC-10ADVP.TM. pumps
(Shimadzu, Kyoto, Japan) at 1.2 mL/min. [0546] 2. Separation is
achieved with a SYNERGI MAX-RP.TM. (Phenomenex, Sutter Creek
Calif.) 150.times.2.00 mm column and detection. Quantification is
completed with an API 4000.TM. triple-quad mass spectrometer
(Applied Biosystems, Foster, Calif.) using electrospray ionization
(ESI) and multiple ion monitoring for masses 277, 279, 281, 255,
283 in the negative ion mode. [0547] 3. Instrumentation control and
data generation is accomplished with ANALYST 1.3.TM. software
(Applied Biosystems, Foster, Calif.). [0548] 4. LC/MS calibrated
for each fatty acid in the range of 0.5 to 50 .mu.g using standard
samples (Sigma). This range best fits a quadratic regression
standard curve which is used to calculate the amount of each fatty
acid released in enzyme samples.
Example 3
Exemplary Protocols for HTP Screen of Lipase Evolution Libraries
for Increased Selectivity for Hydrolysis of Palmitate or Stearate
Esters Versus Oleate Esters
[0549] The following example describes exemplary methods
(protocols) for high through-put (HTP) screening of lipase
"evolution libraries" for increased selectivity for hydrolysis of
palmitate or stearate esters versus oleate esters. This exemplary
method (protocol/HTP screen) describes screening lipase evolution
libraries derived from SEQ ID NO:2, but is applicable to other
enzymes, including the enzymes as provided herein, e.g., the
exemplary enzymes having a sequences as set forth in SEQ ID NO:2
and having one, two, three, four, five, six, seven, eight, nine,
ten, eleven or twelve or more or all the amino acid residue
modifications described in Table 3 or Table 4; and this exemplary
method (protocol) is applicable to other library types.
[0550] These exemplary HTP screens are conducted utilizing two
fluorogenic substrates: palmitate or stearate methylumbelliferyl
esters versus oleate methylumbelliferyl ester.
HTP Screen Flow:
[0551] 1. Library clones are arrayed in microtiter plates and
assayed in a primary HTP screen. [0552] 2. Clones identified as
having improved selectivity are designated as primary hits. [0553]
3. Primary hits are re-arrayed in microtiter plates, and assayed in
a secondary HTP screen. [0554] 4. Clones confirmed as having
improved selectivity are designated as secondary hits. [0555] 5.
Secondary hits are sequenced to identify sequence mutations present
and assayed on oil (see separate protocol).
HTP Assay Protocol
[0555] [0556] 1. Barcode label black 384-well assay plates; barcode
label 384-well growth plates and fill 30 .mu.L/well LB medium (100
.mu.g/mL carbenicillin). [0557] 2. Pintool or cherry-pick clones
into growth plates and grow overnight at 30.degree. C. in a
humidified incubator. [0558] 3. Induce lipase expression by
addition of 30 .mu.L/well LB medium (100 .mu.g/mL carbenicillin)
containing 4 .mu.g/ml anhydrous tetracycline and incubate 2 hour at
30.degree. C. [0559] 4. Lyse cells by adding 20 .mu.l/well
B-PER.TM. (Pierce Chemical, Rockford, Ill.); maintain at room
temperature until placed on the robot. [0560] 5. Run lipase
activity assay on robot (see below). [0561] 6. Clones identified as
having increased selectivity for palmitate or stearate MeUMB esters
over oleate MeUMB ester are designated as hits. [0562] 7.
Cherry-pick hit clones into deep 96-well plates containing LB
medium (1 mL/well; 100 .mu.g/mL carbenicillin) and grow overnight
at 30.degree. C. [0563] 8. For primary hits, re-array in 384-well
plates and repeat steps 1-8 in the secondary screen; designate hit
clones as secondary hits. [0564] 9. For secondary hits, after step
8 submit for sequencing.
Automated HTP Screen Example Protocol
[0564] [0565] 1. Apricot: Mix and transfer an aliquot (10 .mu.L) of
lysed cells from "Growth Plate" (see Steps 1-4 above) to each of
two separate assay plates (1 & 2). [0566] 2. MULTIDROP.TM.
(Thermo Electron Corporation, Milford, Mass.): Add 704, of
substrate 1 (UMB-16:0) to assay plate 1; add 704, of substrate 2
(UMB-18:1) to assay plate 2 [0567] 3. Incubate assay plates for 20
minutes at 37.degree. C. [0568] 4. Read on fluorimeter: Excitation
360 nm and Emission 465nm
[0569] Secondary hit clones determined to have unique sequences are
arrayed and grown in 96-well plates and assayed on soy oil (see
below).
Structures of Fluorogenic Substrates used in HTP Screen
##STR00001##
Example 4
Exemplary Evolution for Improved Hydrolysis of Palmitate or
Stearate Esters Using GSSM.sup.SM Technology
[0570] The following example describes and summarizes the results
of exemplary "enzyme evolution" and screening protocols that
identified exemplary enzymes as provided herein, e.g., enzymes
having a sequence as set forth in SEQ ID NO:2 but also having a
residue modification as set forth in Table 3 or Table 4; or enzymes
encoded by a nucleic acid having a sequence as set forth in SEQ ID
NO:1 but also having a residue modification as set forth in Table 3
or Table 4. In one aspect, an exemplary screening assay to identify
these exemplary enzymes as provided herein used soy oil as a
substrate, and the fatty acids released (hydrolyzed) from the soy
oil were characterized, e.g., as linolenic acid, linoleic acid,
oleic acid, palmitic acid or stearic acid.
[0571] Soy oil has the following fatty acid distribution:
Linolenic=8%; Linoleic=53%; Oleic=23%; Palmitic=12%; Stearic=4%.
Thus, if the percent of palmitic acid released (hydrolyzed) from
soy oil by an exemplary enzyme as provided herein is greater than
12%, then that enzyme has a preference for hydrolyzing (releasing)
palmitic acid.
Palmitase Screening: Making a "Palmitase Library"
[0572] A palmitase library of variants of SEQ ID NO:2 was made by
GSSM.sup.SM technology (U.S. Pat. No. 6,171,820). Point mutations
were introduced using degenerate oligonucleotides, one amino acid
position at a time, so that each original codon is substituted with
each of the 20 naturally-encoded amino acids. The mutated variants
were transformed into the Escherichia coli host TOP10 (Invitrogen,
USA) for expression and screening. The library was constructed in
an expression vector pASK-5, which was modified from the vector
pASK-IBA (IBA GmbH, Germany). To make pASK-5, the original cloning
linker was replaced with new cloning sites, specifically, the
sequence from Xbal to Hindlll of pASK-IBA was replaced with
following sequence:
TABLE-US-00004 (SEQ ID NO: 21) RBS ArgSerHisHisHisHisHisHis
TCTAGATAACGAGGGCAAAACCATGGGAGGATCCAGATCTCATCACCATCACCATCACTAAGCTT
XbaI NcoI BamHI BglII HindIII
[0573] The expression of the GSSM.sup.SM variants was induced with
anhydrotetracycline after the optimal host cell densities were
achieved.
[0574] Enzymes having amino acid sequences generated by GSSM.sup.SM
technology were screened by a high-through-put (HTP) screening
protocol, e.g. the protocol described in Example 3, that determined
what fatty acid was preferentially hydrolyzed from a fat--soy oil
in this assay. The goal of the evolution project was to improve
palmitate selectivity of the parental sequence, SEQ ID NO:2, on
oil. The assay comprised contacting the new/sequence modified
enzyme to soy oil, which comprises various fatty acids, including
linolenic acid, linoleic acid, oleic acid, palmitic acid and
stearic acid (see % distribution, listed above) and measuring the
amount of each fatty acid hydrolyzed by each modified enzyme. A
"library" of sequences were identified that enabled an enzyme to
preferentially hydrolyze a palmitic acid (or a stearic acid, see
below), from the soy oil (the so-called "Palmitate Library"):
[0575] Primary and secondary screens were conducted using an HTP
screen e.g the method described in Example 3; [0576] Sequencing of
secondary hits identified amino acid mutations that resulted in the
improved selectivity for palmitate hydrolysis versus oleate in the
HTP screen compared with, for example the parental sequence, SEQ ID
NO:2. [0577] For each codon variant coding for an amino acid
mutation, one clone was cherry-picked and arrayed in 96-well plates
for assay on oil; [0578] From the oil assays selectivity of the
mutant enzymes for palmitate or stearate or other fatty acids was
obtained (Table 3) [0579] The top hit yielded palmitate as 59% of
released fatty acids (FAs) versus (vs) 43% for SEQ ID NO:2 in the
same assay; this corresponds to an increase in selectivity factor
of 3.6 to 4.9; [0580] Several clones also showed increases in
stearate selectivity. Table 1, below, summarizes GSSM.sup.SM
mutations (see above) selected for inclusion in the "palmitate
library" to be combined by GeneReassembly.sup.SM technology (see
Example 5). In one exemplary assay, fourteen (14) single amino acid
mutations were identified as yielding the greatest increases in
palmitate hydrolysis in oil assays (see also Tables 1, 3 and 4,
below). Residues are labeled according to the order that they occur
in the parent SEQ ID NO:2 (see FIG. 7), amongst residues that yield
significant increases in palmitate or stearate hydrolysis in oil
assays. The "original AA" in SEQ ID NO:2 and beneficial mutations
("New Amino Acids"), i.e., exemplary sequences as provided herein,
are given. In one aspect, the single mutations to arginine (R) at
residue positions 163 and 164 can be included alternately such that
this exemplary library will include clones with the sequences
163V-164D (SEQ ID NO:2), 163R-164D, and 163V-164R, but not the
sequence 163R-164R.
TABLE-US-00005 [0580] TABLE 1 Original Amino New Amino Residue Acid
Acids 61 D A, E 72 R E, K 116 E A, Q, R, T, V 133 S A 151 I G, A
163 V R 164 D R
FIG. 6a illustrates the effects of exemplary palmitase GSSM.sup.SM
mutations on palmitate and stearate hydrolysis relative to parental
SEQ ID NO:2. For each of the fourteen (14) single amino acid
mutations selected for inclusion in the palmitase
GeneReassembly.sup.SM library the percentage change in released
palmitate and stearate, relative to parental SEQ ID NO:2, is
graphed. Many of these mutations yielded significant increases in
palmitate hydrolysis, accompanied by small to significant increases
in stearate hydrolysis. However, several mutations cause slight
decreases in stearate hydrolysis. Asterisks denote mutations
identified as conveying increased saturase-type selectivity.
Stearate Screening: Making a "Stearate (Stearatase) Library"
[0581] A stearatase library of variants of SEQ ID NO:2 was made by
GSSM.sup.SM technology (U.S. Pat. No. 6,171,820). Point mutations
were introduced using degenerate oligonucleotides, one amino acid
position at a time, so that each original codon could be
substituted with each of the 20 naturally encoded amino acids. The
mutated variants were transformed into the Escherichia coli host
TOP10 (Invitrogen, USA) for expression and screening. The library
was constructed in expression vector pASK-5 (as described above).
The expression of the GSSM.sup.SM variants was induced with
anhydrotetracycline after the optimal host cell densities were
achieved.
[0582] Enzymes having amino acid sequences generated by GSSM.sup.SM
technology were screened by a high-through-put (HTP) screening
protocol, e.g. the protocol described in Example 3, that determined
what fatty acid was preferentially hydrolyzed from a fat--soy oil
in this assay. The assay comprised contacting the new/sequence
modified enzyme to soy oil, which comprises various fatty acids,
including linolenic acid, linoleic acid, oleic acid, palmitic acid
and stearic acid (see % distribution, listed above) and measuring
the amount of each fatty acid hydrolyzed by each modified enzyme. A
"library" of sequences were identified that enabled an enzyme to
preferentially hydrolyze a stearic acid (or a palmitic acid, see
above), from the soy oil (the so-called "Stearate Library"): [0583]
Primary and secondary screens screens were conducted using an HTP
screen e.g the method described in Example 3; [0584] Sequencing of
secondary hits identified amino acid mutations that resulted in the
improved selectivity for stearate hydrolysis versus oleate in the
HTP screen compared with, for example the parental sequence, SEQ ID
NO:2. [0585] For each codon variant coding for an amino acid
mutation, one clone was cherry-picked and arrayed in 96-well plates
for assay on oil. [0586] Oil assays of sequenced secondary hits
yielded the selectivity of the mutant enzymes for palmitate or
stearate or other fatty acids (Table 3). [0587] The top hit yielded
stearate as 22% of released FAs vs 9% for the SEQ ID NO:2 in the
same assay; this corresponds to an increase in selectivity factor
of 2.3 to 5.5; [0588] Several clones also showed increases in
palmitate selectivity. Table 2, below, summarizes GSSM.sup.SM
mutations (see above) selected for inclusion in the "stearatase
library" to be combined by GeneReassembly.sup.SM technology. In one
exemplary assay, twenty two (22) single amino acid mutations were
identified as yielding the greatest increases in stearate
hydrolysis in oil assays (see also Tables 2, 3 and 4, below).
Residues are labeled according to the order that they occur in the
"parental" SEQ ID NO:2, amongst residues that yield significant
increases in palmitate or stearate hydrolysis in oil assays. The
"Original Amino Acid" in SEQ ID NO:2 and beneficial mutations ("New
Amino Acids"), i.e., exemplary sequences as provided herein, are
given. In one aspect, the single mutation to alanine (A) at residue
position 223 is included as a fixed mutation so that every clone in
this exemplary library contains this mutation.
TABLE-US-00006 [0588] TABLE 2 Original Amino New Amino Residue Acid
Acids 20 I L 62 V S 77 G P 83 V C 88 D H 113 Y G 116 E G, T 140 H K
146 K S 167 I S 180 L E 194 E M 211 A Q 212 S Y 215 G C, V, W 218 A
H, S 223 V A 225 A Q, M
FIG. 6b (see also above) illustrates the effects of twelve (12) of
the twenty two (22) lead stearatase GSSM.sup.SM mutations on
palmitate and stearate hydrolysis relative to parental SEQ ID NO:2.
For each of the twelve (12) single amino acid mutations given in
FIG. 6b and selected for inclusion in the stearatase
GeneReassembly.sup.SM library the percentage change in released
palmitate and stearate, relative to parental SEQ ID NO:2, is
graphed. Most of these mutations yielded significant increases in
stearate hydrolysis, but slight to significant decreases in
palmitate hydrolysis. Asterisks denote mutations identified as
conveying increased saturase-type selectivity i.e. increases in
selectivity for hydrolysis of palmitate and stearate versus
hydrolysis of unsaturated fatty acids in the oil e.g. oleate,
linoleate and linolenate.
[0589] Summary [0590] Screening of the "GSSM.sup.SM library" (see
above where GSSM.sup.SM technology is described in detail) based on
the parent SEQ ID NO:2 yielded single amino acid-mutant clones with
significant improvements in palmitate and in stearate selectivity,
and in saturate selectivity i.e. selectivity for hydrolysis of
palmitate and stearate (e.g., selective hydrolysis of palmitate
and/or stearate from soy oil); [0591] Clones were found with
significant improvements in stearate selectivity (selective
hydrolysis of stearic acid over other fatty acids); [0592]
GSSM.sup.SM mutants with increased palmitate selectivity (selective
hydrolysis of palmitic acid over other fatty acids) relative to the
SEQ ID NO:2 enzyme were discovered.
[0593] Table 3 and Table 4, below, describe (further summarize) the
sequences of the exemplary hydrolase enzymes as provided herein,
e.g., the exemplary enzymes having a sequence as set forth in SEQ
ID NO:2 and having at least one (one, several or all) of the amino
acid residue changes described in the tables. Table 3 and Table 4
also summarize activity data for selected exemplary enzymes; the
data including matching particular exemplary enzymes with their
positive hydrolase activity comprising catalysis of hydrolysis of
(release of) a palmitate or a stearate fatty acid from soy oil, as
identified by a high through-put (HTP) screening protocol, as
described above.
[0594] In Table 3 and Table 4, the term "Original Amino Acid"
indicates the targeted amino acid residue (indicated under "Amino
Acid residue") in the "parent" enzyme SEQ ID NO:2 ("targeted" for
change); and term "New Amino Acids" indicates the newly designed
amino acid residue (which replaced the corresponding "targeted"
residue in the "old sequence") in the exemplary (new) enzyme as
provided herein. Listing the "New Amino Acid" reside under the
"stearate" versus the "palmitate" column indicates which of two
high throughput (HTP) fatty acid screens (i.e., release of palmitic
acid in one screen, and release of stearic acid in the other
screen, see Example 3) was used to detect (identify) a particular
enzyme with the indicated residue variation (new enzyme sequence,
"New Amino Acid" reside).
[0595] For example, in the first row in Table 3, at amino acid
residue 7, the tyrosine (or "Y") from the "parent" enzyme SEQ ID
NO:2 is replaced by an arginine (or "R") amino acid residue, and
this new enzyme (Y7R) has activity that differs from that of the
parent enzyme (see Table 3); for example, the "Oil Data" summarizes
the substrate (fatty acid) preference of the new enzyme (e.g., the
Y7R enzyme) by listing the released (hydrolyzed) fatty acids
generated when the enzyme was exposed to (contacted with) soy oil
(assays described above), noting that the substrate soy oil has
several possible hydrolyzable fatty acid constituent groups,
including linolenic acid, linoleic acid, oleic acid, palmitic acid,
stearic acid.
[0596] For example, in the first row, for the Y7R enzyme, 8.3% of
the released fatty acids (from the reacted soy oil) were linolenic
acid, 22.1% of the released fatty acids were linoleic acid; 19.7%
of the released fatty acids were oleic acid; 41.5% of the released
fatty acids were palmitic acid; 8.4% of the released fatty acids
were stearic acid (these four numbers add up to 100%).
[0597] The P+S column adds up both the P and S data points to
summarize how much of the total fatty acids released were palmitic
acid and stearic acid (41.5% plus 8.4%=49.9% of the fatty acids
hydrolyzed were palmitic acid and stearic acid, or "P+S").
TABLE-US-00007 TABLE 3 HTP Screen Hits Palmitate Stearate Amino
Original New New Acid Amino Amino Amino Residue Acid Acid Acid P +
S 7 Y R 49.9% 8 G E, A218R 12 R F 47.8% K 54.2% L 45.4% M 43.3% 16
D M 43.2% 18 P G 41.8% 20 I L 50.3% V 44.6% 22 T M, G215V 52.1% 27
G Q 57.2% S 43.6% 29 A G 51.5% 32 G E scale D, L180E 44.6% 34 L E
45.8% V scale 36 D A 51.0% G 50.9% 40 V P 32.2% 42 V I 47.2% L
47.8% 43 L V 51.5% 45 G A 44.4% L 52.7% 48 A G 45.4% V 70.1% V
55.7% T 33.60% 54 S H 55.6% 61 D A 60.5% E 55.0% S 49.8% 62 V E E
53.0% A 56.6% G 56.5% M 51.9% N 49.7% Q 52.4% S 55.5% T 50.7% D
52.5% L W 50.2% 66 A N 54.2% R 52.1% 72 R E 58.3% K 61.0% P 27.2% S
55.3% T 55.9% Y 50.1% 74 F I 53.8% L 54.8% P 52.3% R 50.5% 77 G P
38.1% 78 I D 47.1% E 37.1% P 40.9% 80 G P 51.9% 82 L P 37.3% 83 V C
47.7% M 59.3% 84 D V 40.2% 87 V A 49.2% C 46.1% D 43.9% E 46.6% G P
53.3% S 45.2% T 42.8% H 52.9% N 50.3% 88 D E 44.6% F 50.3% H 45.9%
L 49.1% P 59.6% P 48.9% Q 47.1% 89 R S 54.5% 92 A D 47.3% E 59.3% R
42.6% S 48.7% T 52.1% V 57.5% 93 V M 48.2% 96 A C C 51.4% I I scale
S S 46.8% 98 G A 45.0% L scale 101 K A 49.8% 103 I L 36.8% 107 W P
46.20% A 39.5% C 39.4% G 47.5% H 42.0% R 68.0% S 36.8% L 64.8% P,
E217Q 46.2% V 37.8% V, E217Q 44.80% 108 S T, A218T stop 19.0% A
43.0% C 26.0% G 47.5% K 57.8% L 44.0% P 56.9% Q 58.6% R 54.7% V
53.4% E, E217Q 46.50% 109 L M 49.0% 110 G L 54.4% 113 Y E 35.8% G
39.8% F 36.5% 116 E A 66.6% F 54.7% G 53.8% H 57.9% L 58.5% L 55.1%
P 58.0% Q 59.6% Q 60.5% R, H140R 60.6% R 61.8% S 58.6% S 59.7% T
67.6% V 67.8% R, H140R 117 L R, I161L 54.1% R 51.6% 120 K I 46.7% L
L 60.8% F 52.6% M 49.9% S S 53.3% 132 G D, S212A 56.2% 133 S A
53.2% A 55.8% G 45.6% P 56.0% R 51.7% T 54.9% V, L139, H 53.2% 134
P G 7.2% R 135 F K 51.8% 139 L H, S133V 53.2% 140 H R, E116R K
45.5% 141 A R 40.2% T 43.3% 142 N M 46.1% R 53.8% S 43.2% T 64.3%
144 A T, N142K 33.9% 146 K S 50.2% G 49.4% L 51.6% A 52.2% 147 I F
56.5% F 50.5% L 52.2% 150 A L 59.7% L 53.3% 151 I A 48.6% G 53.0% H
60.0% P 33.7% S 52.2% T 49.2% 152 N E 28.0% G 53.0% H 46.7% M 35.7%
R 21.1% 155 T C 51.1% 157 D S 50.4% G 48.7% T 54.7% 158 N A 51.2%
159 L M 51.5% 160 P T 52.8% 161 I L, L117R 54.1% L 51.6% 162 P K
scale R scale 163 V E 55.7% R 63.9% T 49.7% 164 D A 42.1% E scale H
39.8% K 49.4% L scale R 61.3% S 47.9% T 53.0% V 42.3% W scale 166 Q
G 49.9% N 41.3% R scale 167 I R R 53.3% S S 47.3% 170 P Q 45.6% A
52.5% A, S212H 34.7% 171 V K 34.1% 172 R P 51.7% Q 54.9% S 40.2%
178 S K 50.6% 180 L E 54.0% H 44.6% Q scale F, G32D 44.6% 183 V I
scale 193 P 49.4% 194 E A scale M 47.9% Q scale D, P193S 49.4% 197
D K 39.4% 198 E stop 56.1% 200 L V 55.3% 204 V L 45.9% R 45.7% 210
A V 50.2% 211 A E 35.3%
H 48.1% K 39.4% L 45.0% Q 50.3% F 32.6% N 46.1% P 49.2% R 55.2% W
47.8% Y 48.9% T 50.8% S 52.7% S 52.7% I I 49.8% T, E217A 46.2% 212
S C 49.3% R 50.3% A, G132D 53.2% A 36.8% E 36.6% G 44.3% H 46.5% L
53.2% P 12.2% Q 41.8% R 50.2% T 53.7% V 38.7% W 48.4% Y 47.1% H,
P170A 34.7% 213 K I 47.9% G 57.7% T 56.7% T 55.5% stop 214 T C
51.6% G 53.0% V V 52.2% V 54.5% P 51.9% N 56.9% R 55.1% Y 62.7% Y
62.7% 215 G A A 56.6% I 54.1% L 29.9% H 50.2% S 52.1% M 47.9% V
55.6% P 47.3% C 60.4% W 52.8% stop 53.9% V, T22M 52.1% 216 A T T
50.9% R 41.9% Y 34.8% V V 56.9% C 59.7% S S 55.0% L 55.6% 217 E Q
36.6% R 59.4% S 53.5% A 46.2% G 44.8% P 46.2% 218 A M 42.5% H H
49.1% Q Q 47.7% R 53.4% W 51.9% S 51.1% T 50.0% K 52.4% R, G8E R,
228K 223 V A 48.8% M 31.6% R 23.4% T scale 224 A F 49.5% G 58.2% G
48.4% I 41.7% Q 46.4% Y 43.7% 225 A G 49.3% L 54.3% M 49.0% Q 45.8%
T 43.2% 226 R H 48.3% T 41.2% 227 L R 41.4% Fatty Acids Released
from Oil by Enzyme Amino Acid Residue Linolenic Linoleic Oleic
Palmitic Stearic P + S 7 8.3% 22.1% 19.7% 41.5% 8.4% 49.9% 8 12
11.5% 13.0% 27.7% 38.5% 9.3% 47.8% 5.2% 22.1% 18.5% 47.2% 7.1%
54.2% 14.7% 13.9% 26.0% 34.4% 11.0% 45.4% 10.3% 12.8% 33.6% 34.0%
9.4% 43.3% 16 7.2% 25.1% 24.6% 36.1% 7.1% 43.2% 18 12.5% 20.0%
25.7% 36.2% 5.6% 41.8% 20 8.2% 21.2% 20.3% 38.5% 11.7% 50.3% 12.2%
23.2% 20.0% 40.1% 4.5% 44.6% 22 8.0% 19.5% 20.4% 47.1% 5.0% 52.1%
27 7.5% 17.6% 17.6% 47.4% 9.8% 57.2% 9.1% 23.2% 24.0% 35.8% 7.8%
43.6% 29 9.0% 19.9% 19.6% 40.9% 10.7% 51.5% 32 19.8% 29.1% 34.0%
scale 17.1% scale 14.6% 12.1% 28.7% 36.6% 7.9% 44.6% 34 5.6% 31.0%
17.5% 40.9% 4.9% 45.8% 21.1% 35.3% 37.1% scale 6.5% scale 36 7.1%
22.1% 19.9% 43.8% 7.1% 51.0% 8.7% 22.9% 17.6% 48.2% 2.7% 50.9% 40
0.0% 51.4% 16.4% 22.4% 9.7% 32.2% 42 14.8% 12.1% 25.8% 34.6% 12.6%
47.2% 43 7.7% 13.9% 30.7% 34.8% 13.0% 47.8% 8.9% 19.9% 19.7% 44.4%
7.1% 51.5% 45 10.3% 23.8% 21.5% 38.5% 5.9% 44.4% 5.9% 22.3% 19.1%
49.7% 3.0% 52.7% 48 15.0% 18.0% 21.7% 38.1% 7.2% 45.4% 4.3% 11.5%
14.2% 61.0% 9.1% 70.1% 7.6% 17.3% 19.4% 43.8% 12.0% 55.7% 23.6%
13.4% 29.3% 22.5% 11.1% 33.60% 54 8.1% 19.3% 17.0% 48.4% 7.3% 55.6%
61 5.6% 19.8% 14.1% 53.9% 6.6% 60.5% 6.4% 20.1% 18.5% 47.3% 7.7%
55.0% 7.7% 19.9% 22.6% 41.5% 8.3% 49.8% 62 7.6% 18.8% 20.7% 44.6%
8.3% 53.0% 9.2% 17.6% 16.6% 45.6% 11.0% 56.6% 6.7% 20.3% 16.5%
47.6% 8.8% 56.5% 7.7% 20.9% 19.5% 44.9% 6.9% 51.9% 7.9% 21.7% 20.7%
40.7% 9.0% 49.7% 8.5% 20.8% 18.4% 42.6% 9.8% 52.4% 5.4% 26.0% 13.1%
37.0% 18.5% 55.5% 10.0% 21.9% 17.5% 40.2% 10.5% 50.7% 6.1% 23.2%
18.2% 47.1% 5.4% 52.5% 9.9% 21.3% 18.6% 46.7% 3.6% 50.2% 66 7.5%
16.8% 21.5% 48.0% 6.2% 54.2% 11.4% 18.0% 18.5% 47.2% 4.8% 52.1% 72
7.9% 16.5% 17.3% 54.2% 4.1% 58.3% 4.4% 20.7% 13.9% 52.2% 8.7% 61.0%
6.8% 44.6% 21.4% 20.2% 7.0% 27.2% 8.6% 17.3% 18.8% 45.7% 9.6% 55.3%
7.5% 17.4% 19.3% 45.1% 10.7% 55.9% 6.7% 23.1% 20.1% 40.2% 9.9%
50.1% 74 7.4% 19.6% 19.3% 45.4% 8.4% 53.8% 8.0% 19.3% 18.0% 44.8%
10.0% 54.8% 8.7% 20.5% 18.6% 42.2% 10.1% 52.3% 7.1% 21.7% 20.7%
41.1% 9.4% 50.5% 77 10.3% 41.0% 10.6% 17.8% 20.4% 38.1% 78 9.8%
22.5% 20.6% 43.8% 3.4% 47.1% 26.2% 23.0% 13.8% 15.4% 21.7% 37.1%
14.4% 13.2% 31.4% 32.3% 8.6% 40.9% 80 7.4% 21.0% 19.7% 42.9% 9.0%
51.9% 82 13.0% 28.3% 21.4% 33.3% 4.0% 37.3% 83 7.5% 20.0% 24.7%
31.1% 16.6% 47.7% 6.8% 18.6% 15.3% 51.5% 7.8% 59.3% 84 0.0% 32.4%
27.4% 21.0% 19.2% 40.2% 87 12.7% 11.9% 26.2% 39.7% 9.5% 49.2% 14.5%
11.8% 27.6% 33.1% 13.0% 46.1% 9.3% 12.3% 34.5% 32.7% 11.2% 43.9%
12.2% 10.5% 30.8% 33.6% 13.0% 46.6% 10.6% 9.9% 26.2% 40.6% 12.7%
53.3% 14.4% 12.4% 27.9% 36.0% 9.2% 45.2% 6.7% 25.8% 24.7% 39.5%
3.3% 42.8% 4.4% 23.2% 19.4% 48.5% 4.5% 52.9% 11.7% 11.3% 26.7%
31.5% 18.8% 50.3% 88 14.1% 13.4% 27.9% 34.7% 9.9% 44.6% 13.4% 15.2%
21.0% 36.7% 13.6% 50.3% 13.3% 12.5% 28.3% 32.5% 13.4% 45.9% 13.0%
9.2% 28.7% 40.3% 8.8% 49.1% 2.9% 22.5% 15.0% 59.0% 0.7% 59.6% 4.2%
35.5% 11.4% 35.6% 13.3% 48.9% 14.7% 9.7% 28.5% 34.9% 12.2% 47.1% 89
0.0% 35.4% 10.1% 39.0% 15.5% 54.5% 92 13.1% 16.1% 23.5% 36.4% 10.9%
47.3% 12.0% 10.4% 18.2% 48.0% 11.4% 59.3% 13.5% 11.3% 32.6% 34.8%
7.7% 42.6% 8.3% 25.1% 17.9% 46.1% 2.6% 48.7% 13.7% 9.8% 24.4% 39.6%
12.5% 52.1% 4.9% 20.0% 17.5% 51.7% 5.8% 57.5% 93 11.7% 9.3% 30.8%
40.8% 7.4% 48.2% 96 10.3% 12.4% 25.9% 37.8% 13.6% 51.4% 17.5% 35.4%
35.5% scale 11.6% scale 12.5% 12.0% 28.7% 33.3% 13.6% 46.8% 98
13.4% 19.9% 21.7% 39.7% 5.3% 45.0% 18.5% 30.8% 36.8% scale 13.9%
scale 101 9.8% 12.5% 27.9% 39.7% 10.1% 49.8% 103 9.1% 36.6% 17.5%
26.0% 10.8% 36.8% 107 11.9% 10.1% 31.8% 30.5% 15.7% 46.20% 0.0%
20.4% 40.1% 12.1% 27.4% 39.5% 0.0% 29.6% 30.9% 6.8% 32.6% 39.4%
0.0% 29.6% 22.9% 9.5% 38.0% 47.5% 2.2% 12.0% 43.9% 22.0% 19.9%
42.0% 30.4% 12.5% 46.2% 10.9% 57.1% 68.0% 12.0% 20.5% 30.7% 5.2%
31.6% 36.8% 5.0% 16.0% 14.2% 62.2% 2.6% 64.8% 11.9% 10.1% 31.8%
30.5% 15.7% 46.2% 0.0% 15.6% 46.5% 10.2% 27.6% 37.8% 13.2% 21.6%
20.4% 31.3% 13.5% 44.80% 108 9.0% 49.0% 23.0% 12.3% 6.7% 19.0% 0.0%
51.0% 6.1% 33.1% 9.9% 43.0% 11.0% 18.4% 44.6% 4.1% 21.9% 26.0% 0.0%
29.6% 22.9% 9.5% 38.0% 47.5% 0.0% 32.0% 10.2% 53.5% 4.3% 57.8% 0.0%
45.6% 10.4% 38.2% 5.8% 44.0% 0.0% 28.4% 14.7% 51.2% 5.7% 56.9% 5.4%
18.9% 17.2% 52.8% 5.8% 58.6% 0.0% 10.6% 34.7% 5.9% 48.8% 54.7% 0.0%
21.9% 24.7% 32.7% 20.8% 53.4% 12.1% 13.9% 27.6% 33.8% 12.7% 46.50%
109 10.9% 8.8% 31.3% 37.7% 11.3% 49.0% 110 0.4% 21.4% 23.9% 54.4%
0.0% 54.4% 113 5.0% 44.1% 15.1% 21.0% 14.8% 35.8% 13.6% 14.6% 32.0%
15.2% 24.6% 39.8% 13.9% 25.9% 23.7% 36.5% 0.0% 36.5% 116 4.8% 17.4%
11.2% 55.5% 11.1% 66.6% 7.8% 17.7% 19.8% 47.0% 7.7% 54.7% 3.3%
26.7% 16.1% 33.1% 20.7% 53.8% 7.3% 18.3% 16.5% 47.8% 10.1% 57.9%
4.3% 22.9% 14.2% 54.3% 4.2% 58.5% 4.6% 26.8% 13.5% 41.6% 13.5%
55.1% 0.0% 32.4% 9.6% 38.3% 19.8% 58.0% 8.1% 16.1% 16.2% 50.4% 9.3%
59.6% 7.3% 20.5% 11.7% 49.2% 11.2% 60.5% 6.9% 19.6% 12.9% 52.1%
8.5% 60.6% 5.4% 17.4% 15.4% 50.8% 11.0% 61.8% 8.7% 18.7% 13.9%
49.1% 9.5% 58.6% 6.7% 22.8% 10.8% 46.3% 13.4% 59.7% 6.4% 17.2% 8.8%
50.3% 17.2% 67.6% 5.6% 17.6% 9.0% 59.0% 8.8% 67.8% 117 6.2% 21.4%
18.3% 46.0% 8.0% 54.1% 8.9% 21.8% 17.7% 40.6% 11.0% 51.6% 120 15.3%
17.9% 20.1% 44.4% 2.3% 46.7% 7.5% 15.4% 16.3% 51.3% 9.5% 60.8%
17.3% 4.4% 25.7% 44.0% 8.6% 52.6% 4.1% 25.5% 20.5% 36.9% 13.0%
49.9% 15.7% 10.1% 20.9% 36.8% 16.5% 53.3% 132 0.0% 32.8% 10.9%
56.2% 0.0% 56.2% 133 6.6% 20.7% 19.5% 49.9% 3.3% 53.2%
9.3% 18.3% 16.5% 45.1% 10.8% 55.8% 3.3% 30.4% 20.7% 45.6% 0.0%
45.6% 0.0% 34.3% 9.6% 56.0% 0.0% 56.0% 13.2% 12.9% 22.2% 42.7% 9.0%
51.7% 10.1% 11.6% 23.3% 46.5% 8.4% 54.9% 0.0% 35.9% 10.9% 46.9%
6.3% 53.2% 134 0.0% 56.2% 36.6% 7.2% 0.0% 7.2% 135 0.0% 41.1% 7.2%
51.8% 0.0% 51.8% 139 0.0% 35.9% 10.9% 46.9% 6.3% 53.2% 140 9.7%
23.4% 21.4% 32.7% 12.8% 45.5% 141 11.2% 12.1% 36.5% 28.2% 12.1%
40.2% 14.7% 13.9% 28.1% 38.3% 5.0% 43.3% 142 16.3% 18.8% 18.8%
10.3% 35.7% 46.1% 0.0% 34.5% 11.7% 43.4% 10.5% 53.8% 8.6% 15.8%
32.5% 22.8% 20.4% 43.2% 2.4% 9.6% 23.7% 47.7% 16.7% 64.3% 144 0.0%
14.9% 51.2% 13.4% 20.4% 33.9% 146 13.6% 10.3% 26.0% 31.4% 18.7%
50.2% 12.6% 12.4% 25.5% 36.5% 12.9% 49.4% 6.6% 22.4% 19.5% 48.2%
3.4% 51.6% 9.0% 19.7% 19.0% 41.7% 10.5% 52.2% 147 8.0% 17.9% 17.6%
48.8% 7.7% 56.5% 7.2% 24.5% 17.9% 33.0% 17.4% 50.5% 9.5% 20.6%
17.7% 42.2% 9.9% 52.2% 150 7.7% 15.1% 17.5% 50.4% 9.2% 59.7% 7.5%
20.6% 18.6% 41.3% 12.0% 53.3% 151 7.8% 26.1% 17.5% 46.4% 2.2% 48.6%
5.0% 29.6% 12.4% 48.9% 4.1% 53.0% 0.0% 25.5% 14.5% 55.5% 4.5% 60.0%
0.0% 14.2% 52.1% 20.0% 13.7% 33.7% 0.0% 17.3% 30.5% 43.3% 8.9%
52.2% 8.0% 22.7% 20.2% 44.0% 5.1% 49.2% 152 0.0% 56.3% 15.7% 23.6%
4.4% 28.0% 8.0% 12.7% 26.3% 22.5% 30.5% 53.0% 0.0% 27.1% 26.2%
26.2% 20.5% 46.7% 0.0% 20.1% 44.2% 24.8% 10.8% 35.7% 9.5% 31.2%
38.3% 2.2% 18.9% 21.1% 155 18.4% 4.9% 25.6% 41.5% 9.6% 51.1% 157
7.9% 19.5% 22.2% 41.2% 9.2% 50.4% 9.6% 21.7% 20.1% 39.1% 9.6% 48.7%
7.2% 25.2% 13.0% 34.9% 19.8% 54.7% 158 14.0% 1.2% 33.5% 42.8% 8.5%
51.2% 159 6.3% 28.4% 13.8% 36.7% 14.8% 51.5% 160 5.6% 20.8% 20.8%
46.6% 6.2% 52.8% 161 6.2% 21.4% 18.3% 46.0% 8.0% 54.1% 8.9% 21.8%
17.7% 40.6% 11.0% 51.6% 162 10.2% 45.6% 38.4% scale 5.7% scale
22.1% 39.2% 32.7% scale 6.0% scale 163 5.9% 22.9% 15.5% 47.4% 8.3%
55.7% 8.6% 17.1% 10.4% 61.4% 2.5% 63.9% 6.4% 23.5% 20.4% 45.7% 4.0%
49.7% 164 8.4% 26.9% 22.6% 39.2% 2.9% 42.1% 13.0% 38.4% 37.5% scale
11.2% scale 9.6% 29.5% 21.1% 35.1% 4.7% 39.8% 17.8% 12.3% 20.5%
38.7% 10.7% 49.4% 23.3% 23.1% 39.1% scale 14.5% scale 6.5% 15.2%
17.1% 58.0% 3.3% 61.3% 9.1% 23.1% 19.8% 40.1% 7.8% 47.9% 9.2% 20.1%
17.7% 41.2% 11.8% 53.0% 15.6% 17.7% 24.4% 29.9% 12.4% 42.3% 15.9%
37.0% 35.5% scale 11.7% scale 166 5.5% 21.8% 22.8% 44.5% 5.4% 49.9%
14.6% 22.3% 21.8% 33.2% 8.1% 41.3% 22.3% 33.3% 36.8% scale 7.6%
scale 167 7.2% 19.4% 20.1% 44.8% 8.4% 53.3% 10.0% 21.9% 20.7% 36.3%
11.0% 47.3% 170 12.5% 12.4% 29.4% 37.8% 7.8% 45.6% 8.5% 18.2% 20.8%
43.0% 9.5% 52.5% 3.5% 22.0% 39.8% 8.9% 25.9% 34.7% 171 8.0% 22.4%
35.5% 33.4% 0.7% 34.1% 172 8.0% 18.8% 21.4% 43.6% 8.1% 51.7% 7.4%
19.1% 18.6% 45.1% 9.8% 54.9% 22.5% 0.0% 37.3% 40.2% 0.0% 40.2% 178
14.5% 12.9% 22.0% 32.3% 18.3% 50.6% 180 8.6% 19.0% 18.5% 42.1%
11.8% 54.0% 11.8% 14.2% 29.3% 32.1% 12.5% 44.6% 11.5% 40.0% 36.3%
scale 12.2% scale 14.6% 12.1% 28.7% 36.6% 7.9% 44.6% 183 10.6%
35.4% 40.7% scale 13.3% scale 193 3.0% 32.4% 15.2% 49.4% 0.0% 49.4%
194 10.9% 38.7% 42.0% scale 8.4% scale 9.6% 21.8% 20.7% 34.6% 13.2%
47.9% 12.6% 31.0% 37.8% scale 18.6% scale 3.0% 32.4% 15.2% 49.4%
0.0% 49.4% 197 9.8% 0.0% 50.9% 39.4% 0.0% 39.4% 198 7.7% 19.7%
16.6% 46.8% 9.3% 56.1% 200 8.5% 16.8% 19.3% 48.7% 6.7% 55.3% 204
13.7% 12.8% 27.6% 32.2% 13.7% 45.9% 9.9% 14.0% 30.5% 23.2% 22.5%
45.7% 210 7.2% 22.0% 20.7% 39.0% 11.2% 50.2% 211 9.0% 16.2% 39.4%
24.0% 11.2% 35.3% 10.2% 17.0% 24.7% 35.7% 12.4% 48.1% 13.8% 10.4%
36.5% 24.1% 15.3% 39.4% 6.5% 12.2% 36.3% 30.5% 14.5% 45.0% 6.9%
26.6% 16.1% 32.7% 17.7% 50.3% 3.4% 36.2% 27.7% 32.6% 0.0% 32.6%
6.9% 26.5% 20.5% 28.9% 17.3% 46.1% 0.0% 35.1% 15.6% 39.6% 9.7%
49.2% 0.0% 25.3% 19.5% 46.8% 8.4% 55.2% 6.6% 19.7% 25.9% 37.2%
10.6% 47.8% 7.7% 22.8% 20.7% 36.6% 12.3% 48.9% 16.3% 4.6% 28.2%
49.1% 1.7% 50.8% 8.0% 22.1% 17.2% 41.2% 11.5% 52.7% 8.0% 22.1%
17.2% 41.2% 11.5% 52.7% 18.2% 3.2% 28.7% 42.4% 7.5% 49.8% 11.9%
10.1% 31.8% 30.5% 15.7% 46.2% 212 7.5% 25.6% 17.6% 36.5% 12.8%
49.3% 19.1% 0.9% 29.7% 46.8% 3.5% 50.3% 8.8% 28.4% 9.6% 33.7% 19.5%
53.2% 19.4% 24.8% 18.9% 33.5% 3.3% 36.8% 19.1% 26.9% 17.5% 31.6%
4.9% 36.6% 5.5% 42.3% 7.9% 30.8% 13.5% 44.3% 4.6% 23.9% 25.1% 35.5%
11.0% 46.5% 8.8% 28.4% 9.6% 33.7% 19.5% 53.2% 0.0% 65.4% 22.4%
10.5% 1.7% 12.2% 3.3% 14.2% 40.6% 30.7% 11.1% 41.8% 11.2% 13.6%
25.0% 40.3% 9.9% 50.2% 10.6% 16.6% 19.1% 42.7% 11.0% 53.7% 21.1%
22.7% 17.4% 17.5% 21.2% 38.7% 7.6% 24.0% 20.0% 38.9% 9.5% 48.4%
10.3% 20.4% 22.2% 33.7% 13.4% 47.1% 3.5% 22.0% 39.8% 8.9% 25.9%
34.7% 213 7.6% 28.2% 16.3% 30.4% 17.5% 47.9% 5.3% 18.8% 18.1% 41.3%
16.4% 57.7% 7.5% 21.0% 14.8% 48.5% 8.2% 56.7% 8.3% 17.8% 18.5%
44.6% 10.9% 55.5% 214 9.1% 20.2% 19.1% 47.0% 4.5% 51.6% 8.3% 19.8%
18.9% 44.6% 8.4% 53.0% 7.7% 20.5% 19.6% 45.3% 7.0% 52.2% 7.1% 21.5%
16.9% 42.4% 12.1% 54.5% 7.0% 25.9% 15.1% 39.9% 12.0% 51.9% 6.9%
18.0% 18.3% 48.5% 8.4% 56.9% 7.4% 19.2% 18.2% 45.6% 9.5% 55.1% 5.3%
21.1% 10.9% 47.3% 15.4% 62.7% 5.3% 21.1% 10.9% 47.3% 15.4% 62.7%
215 7.8% 19.8% 15.8% 46.4% 10.2% 56.6% 7.9% 20.2% 17.7% 40.6% 13.6%
54.1% 20.0% 24.8% 25.4% 25.7% 4.1% 29.9% 4.4% 26.2% 19.2% 45.1%
5.1% 50.2% 8.1% 19.6% 20.1% 42.7% 9.4% 52.1% 2.3% 30.1% 19.7% 31.8%
16.1% 47.9% 5.9% 23.7% 14.8% 39.3% 16.3% 55.6% 9.6% 26.0% 17.0%
36.5% 10.9% 47.3% 4.7% 20.8% 14.1% 42.2% 18.2% 60.4% 4.2% 31.0%
12.0% 40.7% 12.1% 52.8% 6.7% 21.3% 18.1% 41.7% 12.3% 53.9% 8.0%
19.5% 20.4% 47.1% 5.0% 52.1% 216 8.3% 21.9% 18.9% 40.9% 10.0% 50.9%
0.0% 28.0% 30.1% 22.8% 19.1% 41.9% 34.6% 0.0% 30.6% 33.7% 1.1%
34.8% 7.3% 17.8% 17.9% 47.0% 10.0% 56.9% 6.6% 16.6% 17.2% 50.0%
9.7% 59.7% 7.7% 18.1% 19.2% 44.5% 10.5% 55.0% 7.5% 20.3% 16.5%
45.0% 10.6% 55.6% 217 0.0% 42.3% 21.0% 24.3% 12.3% 36.6% 6.8% 16.7%
17.1% 50.1% 9.3% 59.4% 7.4% 20.5% 18.7% 44.1% 9.4% 53.5% 11.9%
10.1% 31.8% 30.5% 15.7% 46.2% 13.2% 21.6% 20.4% 31.3% 13.5% 44.8%
12.1% 13.9% 27.6% 33.8% 12.7% 46.2% 218 0.7% 39.0% 17.8% 30.3%
12.1% 42.5% 4.7% 26.8% 19.4% 30.5% 18.7% 49.1% 7.1% 22.8% 22.4%
38.3% 9.4% 47.7% 7.2% 19.9% 19.6% 44.1% 9.2% 53.4% 8.5% 19.7% 19.9%
42.2% 9.7% 51.9% 7.2% 25.9% 15.8% 37.6% 13.5% 51.1% 8.0% 21.1%
20.9% 41.9% 8.2% 50.0% 8.7% 19.9% 19.0% 42.9% 9.4% 52.4% 223 4.5%
29.5% 17.2% 15.8% 33.0% 48.8% 0.0% 38.4% 30.1% 31.6% 0.0% 31.6%
20.2% 22.8% 33.6% 17.3% 6.0% 23.4% 19.0% 37.0% 34.9% scale 9.1%
scale 224 8.0% 20.5% 22.1% 41.0% 8.4% 49.5% 6.6% 18.2% 17.1% 51.4%
6.8% 58.2% 7.9% 22.1% 21.6% 37.0% 11.4% 48.4% 14.4% 19.0% 24.9%
33.1% 8.5% 41.7% 3.1% 26.3% 24.2% 40.8% 5.6% 46.4% 10.3% 20.1%
25.8% 38.1% 5.7% 43.7% 225 9.7% 22.2% 18.8% 41.8% 7.5% 49.3% 4.3%
23.5% 17.8% 47.9% 6.4% 54.3% 12.0% 21.9% 17.1% 39.1% 9.9% 49.0%
12.9% 23.8% 17.5% 34.1% 11.7% 45.8% 15.9% 22.6% 18.3% 38.0% 5.2%
43.2% 226 4.9% 24.9% 21.9% 45.8% 2.5% 48.3% 6.5% 29.5% 22.8% 32.4%
8.8% 41.2% 227 13.6% 23.1% 21.9% 38.3% 3.2% 41.4%
[0598] Table 4 is a summary, or further compilation, of data shown
in Table 3 (above). For example, the term "position" indicated the
amino acid residue position in SEQ ID NO:2; the term "Original
Amino Acid.", as in Table 3, indicated the unaltered "parental"
residue, while the term "New Amino Acid." as in Table 3, indicated
the altered (new) amino acid residue in that position. The terms
"WT_P" and "WT_S" indicate the substrate (fatty acid release)
preference of the "parental" enzyme, e.g SEQ ID NO:2 for a
particular substrate (fatty acid) by indicating the amount of fatty
acid released (hydrolyzed) from the soy oil (as in Table 3), where
"P" is palmitic acid, and "S" is stearic acid.
[0599] The "palmitate" and "stearate" columns indicate the amount
of palmitic acid and stearic acid released (by enzymatic
hydrolysis) from the soy oil, which comprises linolenic acid,
linoleic acid, oleic acid, palmitic acid, stearic acid, as
discussed above. "P+S" shows the combined amounts of fatty acids
hydrolyzed that were palmitic acid and stearic acid, or "P+S". The
terms "delta_P" and "delta_S" indicate the change in preference of
an exemplary enzyme as provided herein (e.g., D61A from the first
row) for hydrolyzing palmitic acid and stearic acid, respectively,
as compared to the corresponding activity of SEQ ID NO:2. The term
"delta P+S" indicates the total or summed change in preference of
an exemplary enzyme as provided herein (e.g. D61A from the first
row) for hydrolyzing palmitic acid and stearic acid as compared to
the corresponding activity of SEQ ID NO:2. The section "palmitate
mutations" summarizes the exemplary enzymes as provided herein
having an activity (fatty acid hydrolysis) preference for releasing
palmitic acid versus other fatty acids. The section "stearate
mutations" summarizes the exemplary enzyme as provided herein
having an activity preference for releasing stearic acid versus
other fatty acids (from soy oil, assay described above).
TABLE-US-00008 TABLE 4 Original New Amino Amino Position Acid Acid
WT_P WT_S Palmitate Stearate Exemplary Palmitate Mutations 61 D A
45% 6% 54% 7% 61 D E 45% 6% 47% 8% 72 R E 45% 6% 54% 4% 72 R K 45%
6% 52% 9% 116 E A 45% 6% 56% 11% 116 E Q 45% 6% 50% 9% 116 E R 45%
6% 52% 9% 116 E T 45% 6% 50% 17% 116 E V 45% 6% 59% 9% 133 S A 45%
6% 45% 11% 151 I G 45% 6% 49% 4% 151 I A 45% 6% 46% 2% 163 V R* 45%
6% 61% 2% 164 D R* 45% 6% 58% 3% Stearate Mutations 20 I L 45% 6%
39% 12% 62 V S 45% 6% 37% 18% 77 G P 45% 6% 18% 20% 83 V C 45% 6%
31% 17% 88 D H 45% 6% 33% 13% 113 Y G 45% 6% 15% 25% 116 E T 45% 6%
50% 17% 116 E G 45% 6% 33% 21% 140 H K 45% 6% 33% 13% 146 K S 45%
6% 31% 19% 167 I S 45% 6% 36% 11% 180 L E 45% 6% 42% 12% 194 E M
45% 6% 35% 13% 211 A Q 45% 6% 33% 18% 212 S Y 45% 6% 34% 13% 215 G
C 45% 6% 42% 18% 215 G V 45% 6% 39% 16% 215 G W 45% 6% 41% 12% 218
A H 45% 6% 30% 19% 218 A S 45% 6% 38% 14% 223 V A 45% 6% 16% 33%
225 A M 45% 6% 39% 10% Q 45% 6% 34% 12% Original New Amino Amino
Position Acid Acid P + S delta_P delta_S delta_P + S Palmitate
Mutations 61 D A 60% 9% 1% 9% 61 D E 55% 2% 2% 4% 72 R E 58% 9% -2%
7% 72 R K 61% 7% 3% 10% 116 E A 67% 11% 5% 16% 116 E Q 60% 5% 3% 9%
116 E R 61% 7% 3% 10% 116 E T 68% 5% 11% 17% 116 E V 68% 14% 3% 17%
133 S A 56% 0% 5% 5% 151 I G 53% 4% -2% 2% 151 I A 49% 1% -4% -2%
163 V R* 64% 16% -4% 13% 164 D R* 61% 13% -3% 10% Stearate
Mutations 20 I L 51% -6% 6% 0% 62 V S 55% -8% 12% 4% 77 G P 38%
-27% 14% -13% 83 V C 48% -14% 11% -3% 88 D H 46% -12% 7% -5% 113 Y
G 40% -30% 19% -11% 116 E T 68% 5% 11% 17% 116 E G 54% -12% 15% 3%
140 H K 46% -12% 7% -5% 146 K S 50% -14% 13% -1% 167 I S 47% -9% 5%
-4% 180 L E 54% -3% 6% 3% 194 E M 48% -10% 7% -3% 211 A Q 50% -12%
12% -1% 212 S Y 47% -11% 7% -4% 215 G C 60% -3% 12% 9% 215 G V 56%
-6% 10% 5% 215 G W 53% -4% 6% 2% 218 A H 49% -15% 13% -2% 218 A S
51% -7% 8% 0% 223 V A 49% -29% 27% -2% 225 A M 49% -6% 4% -2% Q 46%
-11% 6% -5%
Example 5
Exemplary Evolution for Improved Hydrolysis of Palmitate Using
GeneReassembly.sup.SM Technology
[0600] Fourteen (14) single amino acid mutations identified from
the GSSM.sup.SM screening which cover seven (7) amino acid
positions were combined by the GeneReassembly.sup.SM technology
(U.S. Pat. No. 6,605,449). The full length nucleic acid sequences
generated from the GeneReassembly phase were cloned into an
expression vector pASK-5 (see description above) for expression in
Escherichia coli host HMS175 (Novagen, USA). The expression of the
GeneReassembly variants was induced with anhydrotetracycline after
the optimal host cell densities were achieved.
[0601] The 14 mutations that yielded the greatest increases in
palmitate hydrolysis, identified in Table 2, were selected for
inclusion in a Palmitase GeneReassembly library generated by
methods described above. Initial clones were screened on
umbelliferyl palmitate for activity yielding about 145
sequence-unique clones, which were assayed for activity on soy oil,
as described above.
[0602] FIG. 8 shows primary and secondary screen data for soy oil
assays on selected clones from the palmitase library. Clones that
yielded palmitate at greater than 70% of hydrolysed FAs in the
primary assay (under the standard initial rate conditions of the
assay method) were selected to be re-assayed on soy oil. For each
soy oil assay, the extracted FAs were diluted 50-fold and 100-fold
for analysis by LCMS or GC. Where additional, non-targeted
mutations were found, this is also indicated. The FA hydrolysis
ratios detected and the amounts of each FA detected are presented.
In the figure, "high" and "low" indicate values that were outside
the range of the calibration curve. The rows are sorted in order of
percentage palmitate released in the secondary assay, and then by
total palmitate released. Numerous clones showed significantly
increased palmitate selectivity (up to 100%), compared with the
parent SEQ ID NO:2 (61.2%)
[0603] The top 25 palmitase hits selected based on the secondary
assay described above were subcloned into Pseudomonas systems (Dow
Global Technologies Inc., US Patent PUB. APP. NO. 20050130160 and
Dow Global Technologies Inc., US Patent PUB. APP. NO. 20050186666).
The nucleic acid sequence encoding the enzyme or polypeptide was
inserted either in the pMYC vector (Dow Global Technologies Inc.,
US Patent PUB. APP. NO. 20050130160) or in the pDOW1169 vector (Dow
Global Technologies Inc., US Patent PUB. APP. NO. 20080058262) and
then introduced into the Pseudomonas fluorescens host by
electroporation. The transformed cells were selected either by
growth in minimal medium for the pDOW1169 constructs or in rich
media plus tetracycline for the pMYC constructs. The expression of
the enzyme or polypeptide was induced with IPTG after the optimal
host cell densities were achieved.
[0604] Table 5 shows data from assays on soy oil, run in duplicate,
of the top 25 hits expressed in the Pseudomonas systems. The 4 hits
constructed in the pDOW1169 vector are listed in bold underline
typeface, all other hits were constructed in the pMYC vector.
Enzyme was added to 5 g of crude oil resulting in 20% final water
content. The mixture was then homogenized with a 7 mm probe and
incubated for 40 hours at 25.degree. C. with stir bar agitation.
Aliquots were removed and analyzed for FA by converting FA to FAME
and quantifying FAME by GC as described in Example 8. The 25
enzymes were loaded into the 5 g soy oil based upon equal
UMB-palmitate activity units. In these reactions palmitate in oil
was reduced significantly from 11% in untreated oil to 5% or less
in enzyme treated oils indicating an increased preference for
hydrolysis of palmitate compared with the parent enzyme SEQ ID
NO:2.
TABLE-US-00009 TABLE 5 Amino acid position & amino acid present
Enzyme Palmitate Stearate Oleate Linoleate Linolenate 53 61 72 116
126 133 151 160 163 164 1 6.0% 4.3% 24.9% 59.7% 5.1% A E A A R 1
6.4% 4.3% 24.8% 59.3% 5.2% A E A A R 2 6.6% 4.3% 24.8% 59.2% 5.1% A
E V A R 2 6.9% 4.3% 24.7% 59.0% 5.1% A E V A R 3 9.0% 4.3% 24.1%
57.3% 5.2% E E V A R 3 8.4% 4.3% 24.3% 57.8% 5.2% E E V A R 4 3.9%
4.3% 25.1% 61.6% 5.1% A A K A R 4 5.8% 4.4% 25.0% 59.7% 5.2% A A K
A R 5 5.6% 4.3% 25.0% 60.0% 5.1% E V R 5 5.8% 4.3% 25.0% 59.8% 5.1%
E V R 6 4.9% 4.3% 24.9% 60.8% 5.1% E V 6 5.7% 4.3% 24.8% 60.1% 5.1%
E V 7 5.0% 4.3% 24.9% 60.7% 5.1% E E V A A 7 4.9% 4.3% 24.9% 60.8%
5.1% E E V A A 8 5.2% 4.0% 24.7% 61.3% 4.8% E V A R 8 5.2% 4.0%
24.7% 61.3% 4.8% E V A R 9 5.3% 4.1% 24.8% 60.9% 4.9% V A R 9 5.5%
4.2% 24.9% 60.6% 4.9% V A R 5.7% 4.0% 23.3% 56.2% 10.8% E E V A R
5.6% 4.3% 25.0% 60.1% 5.0% E E V A R 11 8.3% 5.7% 23.3% 57.7% 5.0%
T E E A A P R 11 5.9% 3.8% 24.5% 60.6% 5.2% E E A A R 12 7.8% 5.1%
24.8% 57.3% 5.0% E E V R 12 5.7% 4.4% 25.0% 59.7% 5.1% E E V R 13
4.8% 3.3% 24.7% 62.2% 4.9% E K V R 13 5.9% 4.0% 24.5% 60.8% 4.9% E
K V R 14 5.5% 3.8% 25.2% 60.6% 5.0% E K V 14 5.9% 4.5% 24.8% 59.9%
4.9% E K V 15 5.8% 3.6% 25.0% 60.7% 5.0% E E T R 15 5.6% 4.3% 24.9%
60.4% 4.9% E E T R 16 6.1% 4.0% 24.1% 60.9% 4.9% E E V A 16 6.2%
4.0% 24.1% 60.9% 4.8% E E V A 17 5.7% 4.4% 24.9% 59.9% 5.1% E K R
17 5.0% 4.3% 25.0% 60.8% 4.9% E K R 18 8.3% 4.2% 23.5% 55.7% 8.2% E
E V R 18 7.9% 4.2% 23.7% 56.0% 8.2% E E V R 19 6.8% 4.2% 24.0%
56.9% 8.1% K V A R 19 6.8% 4.2% 24.0% 56.9% 8.1% K V A R 20 6.1%
4.2% 24.0% 57.5% 8.2% E R A R 20 5.4% 4.1% 23.9% 58.5% 8.0% E R A R
6.7% 4.0% 23.3% 58.0% 8.0% A E A A 6.5% 3.9% 23.2% 58.5% 7.9% A E A
A 5.4% 4.0% 23.9% 58.6% 8.0% E E A A R 5.3% 4.1% 24.0% 58.7% 8.0% E
E A A R 6.6% 3.9% 23.2% 58.4% 7.9% E V A 6.4% 3.9% 23.1% 58.8% 7.8%
E V A 24 6.0% 4.3% 24.3% 57.3% 8.1% A E V 24 5.7% 4.3% 24.3% 57.6%
8.1% A E V 25 ND ND ND ND ND A E V R 25 6.0% 4.0% 24.0% 58.1% 8.0%
A E V R 26 4.8% 4.2% 24.2% 58.9% 7.9% E K R ND (Not Determined)
[0605] Table 6 below shows data for the thermostability of the top
25 palmitase hits selected based on the secondary assay described
above. These data were obtained using the hits expressed in the E.
coli HMS174 host. Clones were arrayed in 96-well plates and
incubated for 10 minutes at room temperature (RT), 45, 50 or
55.degree. C. then assayed at RT on MeUMB-palmitate. The percentage
of residual activity is determined by dividing the activity after
incubation at each temperature by the activity after incubation at
RT. Also shown for each palmitases are the mutations present, and
examples of palmitate selectivity and activity on soy oil. SEQ ID
NO:2 retained approx. 15% of activity after incubation for 10 min.
at 50.degree. C., but had no activity after incubation at
55.degree. C.
TABLE-US-00010 TABLE 6 % Stability Amino acid position & amino
acid present Enzyme 55C 50C 45C 61 72 116 133 151 163 164 Other 27
23.0% 62.7% E K V 28 22.8% 62.1% E K V R 29 55.9% E K R 30 24.1%
68.8% 75.6% E E V A 31 22.0% 68.1% 82.5% E E V A R 32 27.1% 58.4% E
E V R 33 26.1% 56.6% E E V A R 34 24.7% 54.0% E E V A R 35 8.1%
64.1% 67.6% E E T R 36 10.3% 53.8% 75.7% E E A A R 37 9.2% 54.8%
61.5% E E A R 38 45.4% 68.4% E E A A A 39 22.9% 61.9% E E A A R 40
35.3% 77.1% E V A R 41 30.6% 70.2% E V A 42 20.3% 71.8% 79.3% E A A
G R 43 64.2% E A A 44 63.2% A K V 45 56.0% A K V A A R 46 80.7% A K
A R 47 22.2% 71.8% 88.1% A E V A R 48 60.6% 83.2% A E V A R 49
50.7% 68.0% A E V 50 50.2% 77.2% A E V R 51 21.1% 53.6% A E V A R
52 56.5% A E Q A A R 53 73.6% 118.3% A E A A 54 69.2% 110.7% A E A
A R 55 82.2% A V 56 51.4% A A A 57 82.8% K V A G 58 60.1% K V R 59
58.3% K V A P162S 60 57.9% K V A R V62F 61 56.3% K V A R 62 51.9% K
Q A R 63 74.8% K A 64 58.8% K A A 65 49.6% 72.0% E V R 66 46.3%
66.0% E V 67 55.1% E V A R 68 51.7% E V A A 69 23.6% 54.6% E A 70
76.2% E A R 71 59.2% V A 72 51.8% V A R
Example 6
Laboratory Protocol for Evaluation of Candidate Palmitase,
Stearatase or Saturase Enzymes
[0606] Exemplary enzymes and polypeptides as provided herein were
expressed in the Pseudomonas system (Dow Global Technologies Inc.,
US Patent PUB. APP. NO. 20050130160). The nucleic acid encoding the
enzyme or polypeptide is inserted into the pMYC vector (Dow Global
Technologies Inc., US Patent PUB. APP. NO. 20050130160) and was
then introduced into the auxotrophic Pseudomonas fluorescens host
by electroporation. The transformed cells were selected by growth
in minimal medium. The expression of the enzyme or polypeptide was
induced with IPTG after the optimal host cell densities
achieved.
[0607] The following procedure is to be used to evaluate the
ability of an enzyme or other polypeptide as provided herein to
hydrolyze an oil sample. Palmitase enzyme is added to 1 kg of crude
oil resulting in 20% final water content. The mixture is then
homogenized with an overhead mixer and incubated at room
temperature with constant mixing using a paddle mixer. Aliquots
(0.5 mL) were removed at 0 h, 21 h, 43 h, 65 h, and 72 h and
treated for FAME conversion & GC analysis as described in
Example 8.
[0608] The above procedure was used with SEQ ID NO:2, the oil
sample was a crude soybean oil. After 72 h samples of both the
untreated oil and enzyme-treated oil yielded the results shown in
Table 7.
TABLE-US-00011 TABLE 7 Fatty Acid Composition Untreated Oil (%)
Enzyme Treated Oil (%) C16:0 11.1 3.7 C18:0 4.1 4.2 C18:1 22.1 24.3
C18:2 54.5 59.5 C18.3 8.2 8.3
The results show a significant decrease in the amount of palmitic
acid (C16:0), such a decrease being considered desirable
Example 7
Evaluation of Lipases, Saturase or Palmitases with sequence
homology to the exemplary polypeptide SEQ ID NO:2
[0609] Several homologous lipase sequences were subcloned into the
pMAL-c2x vector (New England Biolabs, USA) by the xi-cloning method
(Genlantis, USA). The constructs containing SEQ ID NO:2, SEQ ID
NO:6, SEQ ID NO:14, or SEQ ID NO:16 were transformed into the
Escherichia coli host ArcticExpress RP (Stratagene, USA) for
expression. The expression of the lipases is under the control of a
promoter which is induced with IPTG after the optimal host cell
densities achieved. The recombinant enzymes were tested on soy oil
for FA selectivity (Table 8). The lipases comprising SEQ ID NO:2,
SEQ ID NO:6, SEQ ID NO:14, or SEQ ID NO:16 were expressed and
cleaved from the MBP fusion tag using standard conditions. A single
colony was inoculated into LB medium containing 20 .mu.g/m1
gentamycin and shaken at 200 rpm overnight at 30.degree. C. This
overnight culture was inoculated into fresh LB medium containing 20
.mu.g/m1 gentamycin to an OD600 reading of 0.05. This culture was
shaken at 200 rpm and 30.degree. C. until an OD600 reading of 0.5
was obtained. Cultures were transferred to 12.degree. C. shaking at
200 rpm and allowed to equilibrate to the lower temperature before
induction of lipase expression by addition of 0.5 mM IPTG, followed
by further growth for 24 hours. Cells were collected by
centrifugation, suspended in Tris buffer pH8, containing NaCl,
CaCl.sub.2, DNasel, and lysozyme, and then lysed by sonication.
Cell lysates were clarified by centrifugation. Enzymes were cleaved
from the MBP by incubation of the lipase-MBP fusion with FactorXa
for 6 hours at room temperature, followed by an additional 18 hours
at 12.degree. C. The clarified lysates with intact, active
recombinant enzymes all showed strong and similar preferences for
hydrolysis of palmitate over other FA when assayed on soy oil
(Table 8).
TABLE-US-00012 TABLE 8 Similarity to SEQ ID NO: 2 Fatty Acids (%)
Hydrolyzed Enzyme Identity Similarity Palmitate Stearate Oleate
Linoleate Linolenate Soy Oil NA NA 11.0% 4.3% 24.9% 59.7% 5.1% SEQ
ID NO: 2 100% 100 50.9% 5.1% 16.9% 18.1% 9.0% SEQ ID NO: 14 27% 42%
45.8% 2.0 14.2% 37.9% 0.0% SEQ ID NO: 12 47% 62% 50.4% 4.1% 16.1%
23.4% 6.0% SEQ ID NO: 6 41% 56% 37.0% 6.2% 28.5% 20.7% 7.6%
Example 8
Method for Conversion of Free Fatty Acids or Triglycerides to Fatty
Acid Methyl Esters (FAME) and Quantitation of FAME by Gas
Chromatography
[0610] Fatty acids released from lipids, triglycerides, fats or
oils by the action of lipases, e.g. saturaes, palmitases and/or
stearatases can be quantified directly by LCMS using the method
described in Example 2. Alternatively these hydrolyzed fatty acids
can be converted to Fatty Acid Methyl Esters (FAME) using acid
catalyzed methanolysis, and then quantified by Gas Chromatography
(GC). In this example: [0611] The oil after reaction with lipases,
e.g. saturaes, palmitases and/or stearatases is treated by addition
of 1 mL of extraction solvent (CHCl.sub.3:MeOH:4N HCl (2:1:0.075))
per 0.5 mL reaction volume. [0612] A 45 .mu.L aliquot of extracted
oil is transferred into a 4mL screw top vial. To each vial a small
stir bar is added, followed by 2 mL hexane and 400 .mu.L 20% (v/v)
MeOH in HCl. [0613] The vials are then sealed and heated with
stirring for 15 minutes. The vials are then removed from heat and
allowed to cool before adding 800 .mu.L H.sub.2O. [0614] The
mixture is then vortexed and a sample (500 .mu.L) of the top hexane
layer containing FAMES is transferred into an auto sampler vial for
the GC. To each sample 500 .mu.L of 0.5 mg/mL C15:0 FAME is added
as an internal standard.
[0615] The FAME synthesized using this method are then analyzed by
Gas Chromatography using the following operational parameters:
[0616] The equipment is a Hewlett Packard 6890 Series GC with
autosampler [0617] The column used is a Supelco SP-2380 Fused
Silica Capillary Column 30 m.times.0.25 mm and 0.2 .mu.m film
thickness [0618] The injector and detector are set at 260.degree.
C.; Helium carrier gas flow is set at 0.6 mL/min; the oven is set
at an initial temperature of 150.degree. C. [0619] Samples (1 mL)
are injected with a 10:1 injection split. The GC method used has:
[0620] Ramp 1: 4 C/min for 10 min=190.degree. C. [0621] Ramp 2: 15
C/min for 4 min=250.degree. C. [0622] Hold: 250.degree. C. for 2
min
[0623] Triglyceride FA can also be analyzed by conversion to FAME,
even in the presence of hydrolyzed fatty acids. Using the above
method and the method below in combination can this be used to
determine the fatty acid selectivity of a lipase, e.g. saturase,
palmitase, and/or stearatase, and the effect of the enzyme on the
oil. The method for analysis of FA bound to glycerol (or other
alcohols) utilizes base catalyzed methanolysis: [0624] The oil
after reaction with lipases, e.g. saturaes, palmitases and/or
stearatases is treated by addition of 1 mL of extraction solvent
(CHCl.sub.3:MeOH:4N HCl (2:1:0.075)) per 0.5 mL reaction volume.
[0625] A 45 .mu.L aliquot of extracted oil is transferred into a
microfuge tube. The 500 .mu.L of heptane is added followed by 50
.mu.L of 2 N methanolic KOH. [0626] The mixture is vortexed
vigorously for 30 seconds then centrifuged. [0627] An aliquot (50
.mu.L) of the top heptane layer containing FAME is transferred to
an auto sampler vial and combine it with 450 .mu.L of hexane
containing the C15:0 internal standard. [0628] Analysis of FAME by
GC is as outlined above.
[0629] A number of embodiments as provided herein have been
described. Nevertheless, it will be understood that various
modifications may be made without departing from the spirit and
scope as provided herein. Accordingly, other embodiments are within
the scope of the following claims.
Sequence CWU 1
1
211684DNAUnknownDNA obtained from environmental sample 1atgctgaaac
cgcctcccta cggacgcctg ctgcgcgaac tggccgatat cccggccatc 60gtgacggcac
cgttccgggg cgctgcgaaa atgggcaaac tggcggatgg cgagccggta
120ctggtgctgc ccggcttcct ggccgacgac aacgccacct cggtgctgcg
caagaccttc 180gatgtcgcgg gctttgcctg ttcgggctgg gaacgcggct
tcaacctcgg cattcgtggc 240gacctcgtgg accggctggt cgaccggctg
cgggcggtgt cggaggcggc cggtggtcag 300aaggtgatcg tggtcggctg
gagcctcggc ggcctctatg cgcgcgagct gggccacaag 360gcgcccgaac
tgatccggat ggtcgtcacg ctcggcagtc cgttcgcggg cgacctccac
420gccaaccatg cgtggaagat ctacgaggcg atcaacagcc acacggtcga
caacctgccg 480atcccggtcg atttccagat taagccgccg gtgcgcacca
tcgcggtgtg gtcgccgctc 540gacggggtgg tggcgccgga gacctcggaa
ggctcgcccg agcagtcgga cgagcggcta 600gagctggcgg tgacccacat
gggctttgcc gcatcgaaga ccggggccga ggctgtggtc 660cggctggtcg
cggcgcggct ctag 6842227PRTUnknownProtein obtained from
environmental sampleSITE(51)..(54)N-glycosylation site. Prosite id
= PS00001SITE(103)..(112)Lipases, serine active site. Prosite id =
PS00120 2Met Leu Lys Pro Pro Pro Tyr Gly Arg Leu Leu Arg Glu Leu
Ala Asp 1 5 10 15 Ile Pro Ala Ile Val Thr Ala Pro Phe Arg Gly Ala
Ala Lys Met Gly 20 25 30 Lys Leu Ala Asp Gly Glu Pro Val Leu Val
Leu Pro Gly Phe Leu Ala 35 40 45 Asp Asp Asn Ala Thr Ser Val Leu
Arg Lys Thr Phe Asp Val Ala Gly 50 55 60 Phe Ala Cys Ser Gly Trp
Glu Arg Gly Phe Asn Leu Gly Ile Arg Gly 65 70 75 80 Asp Leu Val Asp
Arg Leu Val Asp Arg Leu Arg Ala Val Ser Glu Ala 85 90 95 Ala Gly
Gly Gln Lys Val Ile Val Val Gly Trp Ser Leu Gly Gly Leu 100 105 110
Tyr Ala Arg Glu Leu Gly His Lys Ala Pro Glu Leu Ile Arg Met Val 115
120 125 Val Thr Leu Gly Ser Pro Phe Ala Gly Asp Leu His Ala Asn His
Ala 130 135 140 Trp Lys Ile Tyr Glu Ala Ile Asn Ser His Thr Val Asp
Asn Leu Pro 145 150 155 160 Ile Pro Val Asp Phe Gln Ile Lys Pro Pro
Val Arg Thr Ile Ala Val 165 170 175 Trp Ser Pro Leu Asp Gly Val Val
Ala Pro Glu Thr Ser Glu Gly Ser 180 185 190 Pro Glu Gln Ser Asp Glu
Arg Leu Glu Leu Ala Val Thr His Met Gly 195 200 205 Phe Ala Ala Ser
Lys Thr Gly Ala Glu Ala Val Val Arg Leu Val Ala 210 215 220 Ala Arg
Leu 225 3633DNAUnknownDNA obtained from environmental sample
3atggccggcc accagggcgc gcggggcccc aaagacggtc cgccggcgat ggtgatcccg
60ggcttcctcg cccacgacag gcacacgaca cgattgcgcc gggaactcgc cgaggcgggg
120ttcagggttc acccctggcg gcagggctgg aacatgggag cgcgtgccga
cacgctcgag 180aaattgaagc gggcagtgga ccagtgcggt catgacgagc
cgatcctgct ggtcggctgg 240agtctgggcg ggctctacgc gagggaggtc
gcgcgcgccg agccggatca ggtgcgggcg 300gtggtcactc ttggttcccc
ggtgtcgggc gaccggcgcc gctacaccaa cgtgtggaag 360ctgtacgaat
gggtggcggg tcacccggtg gacgacccgc cgatccccga caaggaggaa
420aagccgccgg tgccgaccct ggctttgtgg tcggcggatg acgggatcgt
cggcgccccg 480tcggcgcgcg ggactcagtt atctcacgac aaggcggtcg
agatgcgaac gagccacatg 540ggctttgcca tgtcggcgaa gagcgcacgc
tttgttgtcg ccgagatcgt gaagttcctg 600aagaaaaccg aaggttccga
gtcgcacgat tga 6334210PRTUnknownProtein obtained from environmental
sampleSITE(76)..(85)Lipases, serine active site. Prosite id =
PS00120 4Met Ala Gly His Gln Gly Ala Arg Gly Pro Lys Asp Gly Pro
Pro Ala 1 5 10 15 Met Val Ile Pro Gly Phe Leu Ala His Asp Arg His
Thr Thr Arg Leu 20 25 30 Arg Arg Glu Leu Ala Glu Ala Gly Phe Arg
Val His Pro Trp Arg Gln 35 40 45 Gly Trp Asn Met Gly Ala Arg Ala
Asp Thr Leu Glu Lys Leu Lys Arg 50 55 60 Ala Val Asp Gln Cys Gly
His Asp Glu Pro Ile Leu Leu Val Gly Trp 65 70 75 80 Ser Leu Gly Gly
Leu Tyr Ala Arg Glu Val Ala Arg Ala Glu Pro Asp 85 90 95 Gln Val
Arg Ala Val Val Thr Leu Gly Ser Pro Val Ser Gly Asp Arg 100 105 110
Arg Arg Tyr Thr Asn Val Trp Lys Leu Tyr Glu Trp Val Ala Gly His 115
120 125 Pro Val Asp Asp Pro Pro Ile Pro Asp Lys Glu Glu Lys Pro Pro
Val 130 135 140 Pro Thr Leu Ala Leu Trp Ser Ala Asp Asp Gly Ile Val
Gly Ala Pro 145 150 155 160 Ser Ala Arg Gly Thr Gln Leu Ser His Asp
Lys Ala Val Glu Met Arg 165 170 175 Thr Ser His Met Gly Phe Ala Met
Ser Ala Lys Ser Ala Arg Phe Val 180 185 190 Val Ala Glu Ile Val Lys
Phe Leu Lys Lys Thr Glu Gly Ser Glu Ser 195 200 205 His Asp 210
5711DNAUnknownDNA obtained from environmental sample 5gtgagcgaga
aaggcgcacc caagggaagg cagcggctga aggagatcgg cgcgcttctg 60ttccacgcgc
ctcgcagctt gggccatctg ggcgcgcgcg gccccaagga cggtcctccg
120gtgatggtca tcccgggatt cctcgcgcac gacttgcata cgacgcagtt
gcgccgggcg 180ctcgcgaagg caggcttccg agtgcatccg tggcggcagg
ggatgaacct tggagcgcgc 240gccgatacgc tcgaaattct gaagcgcgcg
gtggattcct gcggctcgag cgagccgatg 300ctgctcgtcg gctggagcct
gggcggtctc tatgcccggg agatcgcgcg tgcggagccg 360gaccgggtgc
gggcggtggt gacgatggga tcgccggtgt ggggcgaccg caggcgctac
420accaacgtgt ggaagctgta cgaacggatt gccggccatc cggtcgacaa
gccgccgatc 480ccggacaaga gccagaagcc gccggtgccg actctggctt
tgtggtcgca gcatgatggc 540atcgtcggcg cgccctcggc gagagggacg
aagaagaccc gcgacaaggc ggtcgccatc 600gacacgactc acatggggtt
tgccatgtcg cccaagacga cgcgcgcggc agtgcgtgag 660atcgtgggct
ttttgaatga agtcgaaggc ggttcgtcac cccgggcgtg a
7116236PRTUnknownProtein obtained from environmental sample 6Met
Ser Glu Lys Gly Ala Pro Lys Gly Arg Gln Arg Leu Lys Glu Ile 1 5 10
15 Gly Ala Leu Leu Phe His Ala Pro Arg Ser Leu Gly His Leu Gly Ala
20 25 30 Arg Gly Pro Lys Asp Gly Pro Pro Val Met Val Ile Pro Gly
Phe Leu 35 40 45 Ala His Asp Leu His Thr Thr Gln Leu Arg Arg Ala
Leu Ala Lys Ala 50 55 60 Gly Phe Arg Val His Pro Trp Arg Gln Gly
Met Asn Leu Gly Ala Arg 65 70 75 80 Ala Asp Thr Leu Glu Ile Leu Lys
Arg Ala Val Asp Ser Cys Gly Ser 85 90 95 Ser Glu Pro Met Leu Leu
Val Gly Trp Ser Leu Gly Gly Leu Tyr Ala 100 105 110 Arg Glu Ile Ala
Arg Ala Glu Pro Asp Arg Val Arg Ala Val Val Thr 115 120 125 Met Gly
Ser Pro Val Trp Gly Asp Arg Arg Arg Tyr Thr Asn Val Trp 130 135 140
Lys Leu Tyr Glu Arg Ile Ala Gly His Pro Val Asp Lys Pro Pro Ile 145
150 155 160 Pro Asp Lys Ser Gln Lys Pro Pro Val Pro Thr Leu Ala Leu
Trp Ser 165 170 175 Gln His Asp Gly Ile Val Gly Ala Pro Ser Ala Arg
Gly Thr Lys Lys 180 185 190 Thr Arg Asp Lys Ala Val Ala Ile Asp Thr
Thr His Met Gly Phe Ala 195 200 205 Met Ser Pro Lys Thr Thr Arg Ala
Ala Val Arg Glu Ile Val Gly Phe 210 215 220 Leu Asn Glu Val Glu Gly
Gly Ser Ser Pro Arg Ala 225 230 235 7669DNAUnknownDNA obtained from
environmental sample 7atgaggctgc gcgagggggg cgcgctcgta tcgcgggcct
atcgcgcctt cgggcgcctc 60ggcgagcgcg gcccggcgga cgggccgccg ctgatggtga
tcccgggctt cctcgccacc 120gatcgcacca ctttggggct gcagcgggcg
ctggccaagg gcggctacaa ggtgaccgga 180tggggcatgg gcctcaacag
cggcgtcacc gaagacatag tcgaccgcat cgccgctcgg 240gtcgaaaggt
ttggagccgg ccgcaaagtg atcctcgtcg gctggagcct cggcggactc
300tacgcgcgcg tggtcgcgca ggagcggccg gatctcgtcg acaaggtggt
cacgctcggc 360tcgccctttt cgggcgacag gcgccgcaac aacaatgtct
ggcggctcta cgagttcgtc 420gccggccatc cggtcaacag cccgccgatc
gacaaggacc ccgaggtgaa gccgccggtg 480ccgacgctcg ctatctggtc
gcggcgcgac ggcatcgtct ctccggcggg cgcgcgcggg 540cgggagggag
agcgcgacgc cgagctcgag ctcgactgca gccacatggg ctttgcggtc
600agcgccaggg cttatcccaa gatcgtggag gcggtgcggg cgtttccgga
aaacatccgt 660tcgcgctga 6698222PRTUnknownProtein obtained from
environmental sampleSITE(91)..(100)Lipases, serine active site.
Prosite id = PS00120 8Met Arg Leu Arg Glu Gly Gly Ala Leu Val Ser
Arg Ala Tyr Arg Ala 1 5 10 15 Phe Gly Arg Leu Gly Glu Arg Gly Pro
Ala Asp Gly Pro Pro Leu Met 20 25 30 Val Ile Pro Gly Phe Leu Ala
Thr Asp Arg Thr Thr Leu Gly Leu Gln 35 40 45 Arg Ala Leu Ala Lys
Gly Gly Tyr Lys Val Thr Gly Trp Gly Met Gly 50 55 60 Leu Asn Ser
Gly Val Thr Glu Asp Ile Val Asp Arg Ile Ala Ala Arg 65 70 75 80 Val
Glu Arg Phe Gly Ala Gly Arg Lys Val Ile Leu Val Gly Trp Ser 85 90
95 Leu Gly Gly Leu Tyr Ala Arg Val Val Ala Gln Glu Arg Pro Asp Leu
100 105 110 Val Asp Lys Val Val Thr Leu Gly Ser Pro Phe Ser Gly Asp
Arg Arg 115 120 125 Arg Asn Asn Asn Val Trp Arg Leu Tyr Glu Phe Val
Ala Gly His Pro 130 135 140 Val Asn Ser Pro Pro Ile Asp Lys Asp Pro
Glu Val Lys Pro Pro Val 145 150 155 160 Pro Thr Leu Ala Ile Trp Ser
Arg Arg Asp Gly Ile Val Ser Pro Ala 165 170 175 Gly Ala Arg Gly Arg
Glu Gly Glu Arg Asp Ala Glu Leu Glu Leu Asp 180 185 190 Cys Ser His
Met Gly Phe Ala Val Ser Ala Arg Ala Tyr Pro Lys Ile 195 200 205 Val
Glu Ala Val Arg Ala Phe Pro Glu Asn Ile Arg Ser Arg 210 215 220
9669DNAUnknownDNA obtained from environmental sample 9atgaagccgc
cgcccggatg gatgaagatc cgggaggcgg gctcgctcct cgcgcgcttc 60taccgcgcgt
tcggcaagct cgagccgcgc gggccggcgg acgggccgaa gctgatggtg
120atcccgggtt tcctcgcggg cgacaggacg acgctcgggc tgcagcgagc
gctggccggc 180ggcggctacc gggtcgccgg ctgggggctg ggggtgaacc
gcggcgtttc ggaggacgtg 240gtcgaccgga tcggccagca agtcgcgcgg
ttcggggcgg gcgagaaggt gatcctggtc 300ggctggagcc ttggcgggct
ttatgcgcgc gtggtggcgc aggagcggcc cgacctcgtc 360gagaaggtgg
tgaccttggg ctcgccgttt tcgggcgacc ggcggcgcaa caacaatgtg
420tggcggctct atgagtgggt ggctgggcat ccggtgaacg atccgccgat
cgacaaggac 480ccggcgaaga agcccccggt gccgacgctc gcgatctggt
cgcggcgtga tgggatcgtg 540gcggtcgaag gcgcgcgggg gcggccggag
gagcgggatg ccgagctgga gatcgattgc 600agccacatgg ggtttggggt
cagcggcaag gcgtttcccc gaatcgtaga ggcggtgaag 660gggttctaa
66910222PRTUnknownProtein obtained from environmental
sampleSITE(98)..(107)Lipases, serine active site. Prosite id =
PS00120 10Met Lys Pro Pro Pro Gly Trp Met Lys Ile Arg Glu Ala Gly
Ser Leu 1 5 10 15 Leu Ala Arg Phe Tyr Arg Ala Phe Gly Lys Leu Glu
Pro Arg Gly Pro 20 25 30 Ala Asp Gly Pro Lys Leu Met Val Ile Pro
Gly Phe Leu Ala Gly Asp 35 40 45 Arg Thr Thr Leu Gly Leu Gln Arg
Ala Leu Ala Gly Gly Gly Tyr Arg 50 55 60 Val Ala Gly Trp Gly Leu
Gly Val Asn Arg Gly Val Ser Glu Asp Val 65 70 75 80 Val Asp Arg Ile
Gly Gln Gln Val Ala Arg Phe Gly Ala Gly Glu Lys 85 90 95 Val Ile
Leu Val Gly Trp Ser Leu Gly Gly Leu Tyr Ala Arg Val Val 100 105 110
Ala Gln Glu Arg Pro Asp Leu Val Glu Lys Val Val Thr Leu Gly Ser 115
120 125 Pro Phe Ser Gly Asp Arg Arg Arg Asn Asn Asn Val Trp Arg Leu
Tyr 130 135 140 Glu Trp Val Ala Gly His Pro Val Asn Asp Pro Pro Ile
Asp Lys Asp 145 150 155 160 Pro Ala Lys Lys Pro Pro Val Pro Thr Leu
Ala Ile Trp Ser Arg Arg 165 170 175 Asp Gly Ile Val Ala Val Glu Gly
Ala Arg Gly Arg Pro Glu Glu Arg 180 185 190 Asp Ala Glu Leu Glu Ile
Asp Cys Ser His Met Gly Phe Gly Val Ser 195 200 205 Gly Lys Ala Phe
Pro Arg Ile Val Glu Ala Val Lys Gly Phe 210 215 220
11570DNAUnknownDNA obtained from environmental sample 11gtgttggtgc
tgccggcgtt cctcgccaac gaccttccca cttcgcttct ccgcaggacg 60ctgaaggcga
acgggtttcg cccgttcggc tgggcgaacg gtttcaactt aggtgcacgg
120ccggacacgc tccagcgcct gagcgcacgg ctcgatgcgg tggttcagga
agcgggcagg 180ccggttgcat tgatcggctg gagccttggc gggctttatg
cccgagagct ggcgaaacgc 240aggtcggctg aggtgtcggc agtgatcacg
ctcggcacgc ccttctcggt tgacctcaga 300cgcaacaacg cctggaagct
gtacgagctc atcaacgatc atcctgtcga tgcccctccc 360ttggatgttc
aggtcgacgc gaagccaccc gtccgaacct tcgctttgtg gtcgcgtcgc
420gacgggatcg tagcgcccgc gagcgcgcac ggcatggagg gcgagttcga
ccaggcgatc 480gagctgcagt gcacgcacaa cgagatggtc agtgatccgg
aggccctctc cacgatcgtt 540accttgctgc gggaaaatgt tggctcctga
57012189PRTUnknownProtein obtained from environmental sample 12Met
Leu Val Leu Pro Ala Phe Leu Ala Asn Asp Leu Pro Thr Ser Leu 1 5 10
15 Leu Arg Arg Thr Leu Lys Ala Asn Gly Phe Arg Pro Phe Gly Trp Ala
20 25 30 Asn Gly Phe Asn Leu Gly Ala Arg Pro Asp Thr Leu Gln Arg
Leu Ser 35 40 45 Ala Arg Leu Asp Ala Val Val Gln Glu Ala Gly Arg
Pro Val Ala Leu 50 55 60 Ile Gly Trp Ser Leu Gly Gly Leu Tyr Ala
Arg Glu Leu Ala Lys Arg 65 70 75 80 Arg Ser Ala Glu Val Ser Ala Val
Ile Thr Leu Gly Thr Pro Phe Ser 85 90 95 Val Asp Leu Arg Arg Asn
Asn Ala Trp Lys Leu Tyr Glu Leu Ile Asn 100 105 110 Asp His Pro Val
Asp Ala Pro Pro Leu Asp Val Gln Val Asp Ala Lys 115 120 125 Pro Pro
Val Arg Thr Phe Ala Leu Trp Ser Arg Arg Asp Gly Ile Val 130 135 140
Ala Pro Ala Ser Ala His Gly Met Glu Gly Glu Phe Asp Gln Ala Ile 145
150 155 160 Glu Leu Gln Cys Thr His Asn Glu Met Val Ser Asp Pro Glu
Ala Leu 165 170 175 Ser Thr Ile Val Thr Leu Leu Arg Glu Asn Val Gly
Ser 180 185 13807DNAUnknownDNA obtained from environmental sample
13gtgaatacag ccgacctatt gaagccacca cccgcaagca tgacagttct cgaggcgaga
60gcgctgctgg acatatgcaa gatgagcgcc ccattggcgc gcttgctatt caaaaagaac
120tcgccctggc gcaaacaacg ggttctcgta atacctggct ttggcgctga
tgatcgctac 180acctggccgt tgcgcaattt cgtccaggca cagggctatg
ccacgactgg ctggggcctg 240ggcaccaaca aggcaggtct caatatgccg
catcaactat ccgacgtcca ccccagatgg 300aagctaaaac ccaagacgcc
gtaccgtggt gaggcgggcg taccttacgt gattgaccgc 360ttgatcgaac
ggtttgacga attggcatcg acggatccgc aacccatcgc acttataggt
420tggagtctgg gtggtttcat ggcccgtgaa gttgcccgag agcgcccaaa
ccaggtgagt 480caggttatta ccctcggttc tcctgtcatc ggaggcccaa
aatacaccct cgctgcatcg 540gctttcatcc ggcgcaaata cgatttggac
tgggtggagc aagtgatcgc ggagcgggaa 600gatcgcccca ttactgttcc
tattacagca atagtcagcc agtctgatgg catcgtcgga 660tattcagcgg
caatcgatca ccacagtccc gctgtgcagc atttacatat ggatgttgcc
720catttgggct ttccttacaa cacgagggtt tggtcagaaa tcgccaatgc
gctcaactct 780ttagaggtgg agaaggagcg tgtttag
80714268PRTUnknownProtein obtained from environmental
sampleSITE(138)..(147)Lipases, serine active site. Prosite id =
PS00120 14Met Asn Thr Ala Asp Leu Leu Lys Pro Pro Pro Ala Ser Met
Thr Val 1 5 10 15 Leu Glu Ala Arg Ala Leu Leu Asp Ile Cys Lys Met
Ser Ala Pro Leu 20 25 30 Ala Arg Leu Leu Phe Lys Lys Asn Ser Pro
Trp Arg Lys Gln Arg Val 35 40 45 Leu Val Ile Pro Gly Phe Gly Ala
Asp Asp Arg Tyr
Thr Trp Pro Leu 50 55 60 Arg Asn Phe Val Gln Ala Gln Gly Tyr Ala
Thr Thr Gly Trp Gly Leu 65 70 75 80 Gly Thr Asn Lys Ala Gly Leu Asn
Met Pro His Gln Leu Ser Asp Val 85 90 95 His Pro Arg Trp Lys Leu
Lys Pro Lys Thr Pro Tyr Arg Gly Glu Ala 100 105 110 Gly Val Pro Tyr
Val Ile Asp Arg Leu Ile Glu Arg Phe Asp Glu Leu 115 120 125 Ala Ser
Thr Asp Pro Gln Pro Ile Ala Leu Ile Gly Trp Ser Leu Gly 130 135 140
Gly Phe Met Ala Arg Glu Val Ala Arg Glu Arg Pro Asn Gln Val Ser 145
150 155 160 Gln Val Ile Thr Leu Gly Ser Pro Val Ile Gly Gly Pro Lys
Tyr Thr 165 170 175 Leu Ala Ala Ser Ala Phe Ile Arg Arg Lys Tyr Asp
Leu Asp Trp Val 180 185 190 Glu Gln Val Ile Ala Glu Arg Glu Asp Arg
Pro Ile Thr Val Pro Ile 195 200 205 Thr Ala Ile Val Ser Gln Ser Asp
Gly Ile Val Gly Tyr Ser Ala Ala 210 215 220 Ile Asp His His Ser Pro
Ala Val Gln His Leu His Met Asp Val Ala 225 230 235 240 His Leu Gly
Phe Pro Tyr Asn Thr Arg Val Trp Ser Glu Ile Ala Asn 245 250 255 Ala
Leu Asn Ser Leu Glu Val Glu Lys Glu Arg Val 260 265
15804DNAUnknownBacterial DNA 15atggagctcg ccaaggtcac cgccctgatg
aaggccaccg ccctcgagat cgcgatcctc 60accggccacc tcgtcctcta cccctccggg
atcgtggccg agcgcctcgc ggccgccccc 120tcttcaccgt cctccccgtc
cgcgggcccg acgggccgac gtccggtcgt cctgctgcac 180ggtttcgtgg
acaaccgctc ggtcttcgtc ctgctgcgcc gtgccctcac ccggagcggc
240cgtgactgcg tcgagtcgct caactactcg ccgctcacct gcgacctgcg
ggccgccgcc 300gaactgctgg ggcgccgggt ggacgagatc cgcgcccgga
ccggacacgc cgaggtcgac 360atcgtcggcc acagcctggg cgggctcatc
gcccgttatt acgtacagcg tctcggcggt 420gacagccggg tgcgcaccct
ggtcatgctc ggcaccccgc actccggcac caccgtggcc 480cggctcgccg
acgcgcatcc gctggtgcgg cagatgcggc cgggttcgga ggtgctgcgg
540gagctcgccg cgccctcgcc cggctgccgt acccggttcg tgagcttctg
gagcgacctc 600gaccaggtga tggtgccggt ggacacggcc tgcctggacc
accccgacct gctggtgcac 660aacgtccggg tcagcgggat cggtcatctc
gcgctgccgg tccatcccac ggtggcggcc 720ggggtccggg aggccctcga
cgcgagcggc gcgggggtcc cgggggtgcg ggaggagggg 780cccggcgccg
gcgccgtggc gtga 80416267PRTUnknownBacterial
proteinSITE(120)..(129)Lipases, serine active site. Prosite id =
PS00120 16Met Glu Leu Ala Lys Val Thr Ala Leu Met Lys Ala Thr Ala
Leu Glu 1 5 10 15 Ile Ala Ile Leu Thr Gly His Leu Val Leu Tyr Pro
Ser Gly Ile Val 20 25 30 Ala Glu Arg Leu Ala Ala Ala Pro Ser Ser
Pro Ser Ser Pro Ser Ala 35 40 45 Gly Pro Thr Gly Arg Arg Pro Val
Val Leu Leu His Gly Phe Val Asp 50 55 60 Asn Arg Ser Val Phe Val
Leu Leu Arg Arg Ala Leu Thr Arg Ser Gly 65 70 75 80 Arg Asp Cys Val
Glu Ser Leu Asn Tyr Ser Pro Leu Thr Cys Asp Leu 85 90 95 Arg Ala
Ala Ala Glu Leu Leu Gly Arg Arg Val Asp Glu Ile Arg Ala 100 105 110
Arg Thr Gly His Ala Glu Val Asp Ile Val Gly His Ser Leu Gly Gly 115
120 125 Leu Ile Ala Arg Tyr Tyr Val Gln Arg Leu Gly Gly Asp Ser Arg
Val 130 135 140 Arg Thr Leu Val Met Leu Gly Thr Pro His Ser Gly Thr
Thr Val Ala 145 150 155 160 Arg Leu Ala Asp Ala His Pro Leu Val Arg
Gln Met Arg Pro Gly Ser 165 170 175 Glu Val Leu Arg Glu Leu Ala Ala
Pro Ser Pro Gly Cys Arg Thr Arg 180 185 190 Phe Val Ser Phe Trp Ser
Asp Leu Asp Gln Val Met Val Pro Val Asp 195 200 205 Thr Ala Cys Leu
Asp His Pro Asp Leu Leu Val His Asn Val Arg Val 210 215 220 Ser Gly
Ile Gly His Leu Ala Leu Pro Val His Pro Thr Val Ala Ala 225 230 235
240 Gly Val Arg Glu Ala Leu Asp Ala Ser Gly Ala Gly Val Pro Gly Val
245 250 255 Arg Glu Glu Gly Pro Gly Ala Gly Ala Val Ala 260 265
17798DNAUnknownDNA obtained from environmental sample 17gtggccgccg
cggacagcgg gacggcggaa gggcaaaggc ttcggccgcc gagcctgttc 60ctgatgctgg
ccgaggcgag gggcttgctc gaactgaact cgagcctgtt gttgtcgccg
120ctgttgttgc gggcgccgaa gggcgacgga catccggtgc tggcgctgcc
gggctttctc 180gccagcgatc tgtcgatggc gccgatgcgg cgctatctga
aagaactcgg ctacgatgcc 240catgcgtgga acatgggccg caatctcggc
ggcgtcgcgt ccaagcgcga agccttgcgc 300gacctgttgc ggcgcattta
cagccagacg ggccgcaagg tcagcctggt cggctggagt 360ctcggcggcg
tctatgcgcg cgatctcgct ttgcaggcgc ccgacatggt gcgttccgtg
420atcacgctcg gcagtccgtt tgccagcgac atcagggcga ccaacgccac
gcggctctac 480gaggcgctgt cgggagaaag ggtcgacgac aatccggagt
taacagcggc gatcgccggc 540gacctgccgg tgccggcgac ctcgatctat
tcccgtaccg acggtatcgt gaactggcac 600accagcctgc tgcgtccttc
cgcaacggct gaaaacatcg aggtttactt cgccagccat 660atcgggctcg
gcgtcaaccc ggcagcgctg tgggcggtgg ccgaccgcct ggcgcagccc
720gagggggaat ttaagcattt tgaccggtcg ggtccctttg ccattgccta
tggcccccct 780gaaaatgcac aatcctga 79818265PRTUnknownProtein
obtained from environmental sampleSITE(33)..(36)N-glycosylation
site. Prosite id = PS00001SITE(115)..(124)Lipases, serine active
site. Prosite id = PS00120SITE(157)..(160)N-glycosylation site.
Prosite id = PS00001 18Met Ala Ala Ala Asp Ser Gly Thr Ala Glu Gly
Gln Arg Leu Arg Pro 1 5 10 15 Pro Ser Leu Phe Leu Met Leu Ala Glu
Ala Arg Gly Leu Leu Glu Leu 20 25 30 Asn Ser Ser Leu Leu Leu Ser
Pro Leu Leu Leu Arg Ala Pro Lys Gly 35 40 45 Asp Gly His Pro Val
Leu Ala Leu Pro Gly Phe Leu Ala Ser Asp Leu 50 55 60 Ser Met Ala
Pro Met Arg Arg Tyr Leu Lys Glu Leu Gly Tyr Asp Ala 65 70 75 80 His
Ala Trp Asn Met Gly Arg Asn Leu Gly Gly Val Ala Ser Lys Arg 85 90
95 Glu Ala Leu Arg Asp Leu Leu Arg Arg Ile Tyr Ser Gln Thr Gly Arg
100 105 110 Lys Val Ser Leu Val Gly Trp Ser Leu Gly Gly Val Tyr Ala
Arg Asp 115 120 125 Leu Ala Leu Gln Ala Pro Asp Met Val Arg Ser Val
Ile Thr Leu Gly 130 135 140 Ser Pro Phe Ala Ser Asp Ile Arg Ala Thr
Asn Ala Thr Arg Leu Tyr 145 150 155 160 Glu Ala Leu Ser Gly Glu Arg
Val Asp Asp Asn Pro Glu Leu Thr Ala 165 170 175 Ala Ile Ala Gly Asp
Leu Pro Val Pro Ala Thr Ser Ile Tyr Ser Arg 180 185 190 Thr Asp Gly
Ile Val Asn Trp His Thr Ser Leu Leu Arg Pro Ser Ala 195 200 205 Thr
Ala Glu Asn Ile Glu Val Tyr Phe Ala Ser His Ile Gly Leu Gly 210 215
220 Val Asn Pro Ala Ala Leu Trp Ala Val Ala Asp Arg Leu Ala Gln Pro
225 230 235 240 Glu Gly Glu Phe Lys His Phe Asp Arg Ser Gly Pro Phe
Ala Ile Ala 245 250 255 Tyr Gly Pro Pro Glu Asn Ala Gln Ser 260 265
19798DNAUnknownDNA obtained from environmental sample 19atgccggagc
gaaacgaagc gcaggccccg ccgcgtcttc gtccgccggg gctcgggctg 60ttcctcgccg
aagcgcgggg cattttcgag ctcaacgcga gcctgttgct gtcgccgctt
120ctgttgcgcg cgccgcgcgg cgacggccat ccggtgctgg cgttgccggg
ctttcttgcc 180agtgatctat cgatggcgcc gttgcgccgc tacctcaccg
agctcggcta cgacacccac 240gcctggcgca tgggccgcaa tgtcggcggc
atcgcgaaga tgcggatcgc gctgctcgag 300cggctcacgc agatccatgc
cgagtgcggc cgcaaggtct cgattgtcgg ctggagtctc 360ggcggcgtct
atgcgcgcga cctcgcgttg caggcgcccg agatggtgcg ctacgtcgtc
420accctcggca gccccttcgc cagcgacgtc cgcgccacca atgcgacgcg
gctctatgag 480gcgatgtcgg gcgaaacggt cggcgacaat gtcgacctcg
tgcaggcgat tgccggcgac 540ctgccggttc ccgtgacctc gatctattcg
aagagcgacg gcatcgtgaa ctggcggacc 600tgcctgctgc gcccgtccgc
gaccgccgag aatatcgagg tctatttcgc gagccatgtc 660ggcatcggcg
tcaatccggc cgcgctgtgg gcgatcgcgg accggctggc ccagcgggaa
720ggcgaattcc gccccttcga ccggtccggt ccttttgcca ttgcctacgc
gcccccggaa 780caggcacaat cgatctga 79820265PRTUnknownProtein
obtained from environmental sampleSITE(32)..(35)N-glycosylation
site. Prosite id = PS00001SITE(114)..(123)Lipases, serine active
site. Prosite id = PS00120SITE(156)..(159)N-glycosylation site.
Prosite id = PS00001 20Met Pro Glu Arg Asn Glu Ala Gln Ala Pro Pro
Arg Leu Arg Pro Pro 1 5 10 15 Gly Leu Gly Leu Phe Leu Ala Glu Ala
Arg Gly Ile Phe Glu Leu Asn 20 25 30 Ala Ser Leu Leu Leu Ser Pro
Leu Leu Leu Arg Ala Pro Arg Gly Asp 35 40 45 Gly His Pro Val Leu
Ala Leu Pro Gly Phe Leu Ala Ser Asp Leu Ser 50 55 60 Met Ala Pro
Leu Arg Arg Tyr Leu Thr Glu Leu Gly Tyr Asp Thr His 65 70 75 80 Ala
Trp Arg Met Gly Arg Asn Val Gly Gly Ile Ala Lys Met Arg Ile 85 90
95 Ala Leu Leu Glu Arg Leu Thr Gln Ile His Ala Glu Cys Gly Arg Lys
100 105 110 Val Ser Ile Val Gly Trp Ser Leu Gly Gly Val Tyr Ala Arg
Asp Leu 115 120 125 Ala Leu Gln Ala Pro Glu Met Val Arg Tyr Val Val
Thr Leu Gly Ser 130 135 140 Pro Phe Ala Ser Asp Val Arg Ala Thr Asn
Ala Thr Arg Leu Tyr Glu 145 150 155 160 Ala Met Ser Gly Glu Thr Val
Gly Asp Asn Val Asp Leu Val Gln Ala 165 170 175 Ile Ala Gly Asp Leu
Pro Val Pro Val Thr Ser Ile Tyr Ser Lys Ser 180 185 190 Asp Gly Ile
Val Asn Trp Arg Thr Cys Leu Leu Arg Pro Ser Ala Thr 195 200 205 Ala
Glu Asn Ile Glu Val Tyr Phe Ala Ser His Val Gly Ile Gly Val 210 215
220 Asn Pro Ala Ala Leu Trp Ala Ile Ala Asp Arg Leu Ala Gln Arg Glu
225 230 235 240 Gly Glu Phe Arg Pro Phe Asp Arg Ser Gly Pro Phe Ala
Ile Ala Tyr 245 250 255 Ala Pro Pro Glu Gln Ala Gln Ser Ile 260 265
2165DNAArtificial sequenceSynthetic
constructmisc_feature(1)..(65)Cloning linker with cloning sites
21tctagataac gagggcaaaa ccatgggagg atccagatct catcaccatc accatcacta
60agctt 65
* * * * *