U.S. patent application number 15/131691 was filed with the patent office on 2018-02-22 for novel vista-ig constructs and the use of vista-ig for treatment of autoimmune, allergic and inflammatory disorders.
The applicant listed for this patent is KING'S COLLEGE LONDON, THE TRUSTEES OF DARTMOUTH COLLEGE. Invention is credited to Sabrina Ceeraz, Isabelle LeMercier, Janet Lines, Randolph J. Noelle, Elizabeth Nowak.
Application Number | 20180051070 15/131691 |
Document ID | / |
Family ID | 49769417 |
Filed Date | 2018-02-22 |
United States Patent
Application |
20180051070 |
Kind Code |
A1 |
Noelle; Randolph J. ; et
al. |
February 22, 2018 |
Novel VISTA-Ig constructs and the use of VISTA-Ig for Treatment of
Autoimmune, Allergic and Inflammatory Disorders
Abstract
The present invention relates to a fusion proteins comprising
regulatory T cell protein, VISTA (V-domain Immunoglobulin
Suppressor of T cell Activation (PD-L3) and an immunoglobulin
protein (Ig), preferably also containing a flexible linker
intervening the VISTA and Ig Fc polypeptide. The invention also
provides the use of VISTA polypeptides, multimeric VISTA
polypeptides, VISTA-conjugates (e.g., VISTA-Ig), and VISTA
antagonists for the treatment of autoimmune disease, allergy, and
inflammatory conditions, especially lupus, multiple sclerosis,
psoriasis, psoriatic arthritis, multiple sclerosis, Crohn's
disease, inflammatory bowel disease and type 1 or type 2
diabetes.
Inventors: |
Noelle; Randolph J.;
(Plainfield, NH) ; Ceeraz; Sabrina; (Lebanon,
NH) ; LeMercier; Isabelle; (Enfield, NH) ;
Nowak; Elizabeth; (West Lebanon, NH) ; Lines;
Janet; (London, GB) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
THE TRUSTEES OF DARTMOUTH COLLEGE
KING'S COLLEGE LONDON |
HANOVER
LONDON |
NH |
US
GB |
|
|
Family ID: |
49769417 |
Appl. No.: |
15/131691 |
Filed: |
April 18, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13925034 |
Jun 24, 2013 |
|
|
|
15131691 |
|
|
|
|
PCT/US13/47009 |
Jun 21, 2013 |
|
|
|
13925034 |
|
|
|
|
61807135 |
Apr 1, 2013 |
|
|
|
61776234 |
Mar 11, 2013 |
|
|
|
61735799 |
Dec 11, 2012 |
|
|
|
61663969 |
Jun 25, 2012 |
|
|
|
61663431 |
Jun 22, 2012 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 37/00 20180101;
A61P 37/06 20180101; A61K 39/3955 20130101; A61P 9/08 20180101;
A61P 11/06 20180101; A61P 21/02 20180101; A61P 25/06 20180101; A61P
27/12 20180101; A61P 31/06 20180101; A61P 33/12 20180101; C07K
14/70503 20130101; A01K 2267/0387 20130101; A61P 3/04 20180101;
A61P 25/08 20180101; A61P 31/04 20180101; A61P 1/14 20180101; A61P
31/12 20180101; A61P 11/16 20180101; A61P 1/16 20180101; A61P 3/10
20180101; A61P 13/10 20180101; A61P 25/04 20180101; A61P 11/00
20180101; A61P 11/02 20180101; A61P 17/04 20180101; C07K 16/18
20130101; C07K 2317/76 20130101; C07K 2319/60 20130101; C12N
2310/14 20130101; A61P 13/08 20180101; A61P 37/08 20180101; A61P
1/00 20180101; A61P 1/18 20180101; A61P 31/20 20180101; A61P 33/10
20180101; A61P 5/14 20180101; A61P 7/04 20180101; A61P 31/18
20180101; C07K 2319/32 20130101; A61P 5/38 20180101; A61P 5/50
20180101; A61P 9/10 20180101; A61P 17/06 20180101; A61P 19/04
20180101; A61P 21/04 20180101; A61K 45/06 20130101; A61P 15/00
20180101; A61P 19/02 20180101; A61P 33/06 20180101; A61P 35/00
20180101; A61P 7/10 20180101; A61P 31/10 20180101; A61P 13/12
20180101; A61P 17/00 20180101; A61P 19/10 20180101; A01K 2267/0368
20130101; A61P 9/00 20180101; A61P 27/04 20180101; A61P 27/16
20180101; A61P 1/02 20180101; A61P 5/36 20180101; A61P 7/00
20180101; A61P 15/06 20180101; A61P 15/08 20180101; A61P 25/16
20180101; A61P 3/00 20180101; A61P 5/08 20180101; A61P 11/08
20180101; A61P 43/00 20180101; A61P 15/02 20180101; A61P 25/28
20180101; A61P 27/02 20180101; A61P 37/02 20180101; C07K 2319/30
20130101; A61P 5/00 20180101; A61P 9/12 20180101; A61P 29/00
20180101; A61K 38/00 20130101; A61P 15/10 20180101; A61P 17/02
20180101; A61P 1/04 20180101; A61P 17/10 20180101; A61P 25/14
20180101; A01K 2227/105 20130101; A61P 25/00 20180101; C12N 15/1138
20130101; A61K 39/39 20130101; A61K 2039/505 20130101; A61P 9/06
20180101; A01K 2267/0325 20130101; A61P 13/02 20180101; A61P 39/02
20180101; C07K 2319/735 20130101; A61P 7/06 20180101; A61P 19/06
20180101; A61P 21/00 20180101; A61P 35/02 20180101; A01K 2217/075
20130101; A61P 17/14 20180101; A61P 31/14 20180101; A01K 67/0276
20130101; A61K 39/395 20130101; C07K 14/70532 20130101; C07K
16/2827 20130101; A61K 39/3955 20130101; A61K 31/00 20130101 |
International
Class: |
C07K 16/18 20060101
C07K016/18; C07K 14/705 20060101 C07K014/705 |
Goverment Interests
GOVERNMENT FUNDING
[0003] This invention was made with government support under
AT005382 and AI098007 awarded by the National Institutes of Health.
The government has certain rights in the invention.
Claims
1-226. (canceled)
227. An isolated VISTA-Ig fusion protein comprising (i) at least
one polypeptide with at least about 80% sequence identity to the
extracellular domain of the VISTA polypeptide sequence in SEQ ID
NO: 2, 4, 5, 16-25, 36, 37, 68, 69, 72 or 73 or 75 or a fragment
thereof which comprises at least 50 amino acids; (ii) at least one
linker which comprises at least 5 amino acids; and (iii) at least
one Ig Fc protein or fragment thereof, wherein said linker
intervenes a VISTA polypeptide and a Ig Fc protein and the
resultant VISTA-Ig fusion protein elicits more potent
immunosuppressive activity in vivo than an otherwise identical
fusion protein lacking the linker.
228. The VISTA-Ig fusion protein of claim 227, wherein said
polypeptide (i) comprises at least one polypeptide having at least
90% or at least 95% sequence identity to the extracellular domain
of human or murine VISTA or a fragment thereof which is at least 50
amino acids.
229. The VISTA-Ig fusion protein of claims 227, comprising a human
IgG1, IgG2, IgG3 or IgG4 Fc region or fragment or variant
thereof.
230. The VISTA-Ig fusion protein of claim 227, containing at least
one Fc region that comprises one or more modifications that
modulate complement binding, FcR binding, glycosylation and/or
effector function.
231. The VISTA-Ig fusion protein of claim 227, containing at least
one linker that comprises about 4 glycine residues to about 15
glycine residues.
232. The VISTA-Ig fusion protein of claim 227, containing at least
one linker that comprises at about 8 to about 50 amino acid
residues.
233. The VISTA-Ig fusion protein of claim 227, comprising at least
2, 3 or 4 polypeptides which each possess at least about 90% or
about 95% sequence identity to the extracellular domain of the
polypeptide sequence of SEQ ID NO: 2, 4, 5, 16-25, 36, or 37 or a
fragment thereof which comprises at least 50, 75, 100, 125, 150,
175, 200, 225, 250, 275 or 300 amino acids.
234. The VISTA-Ig fusion protein of claim 227, comprising at least
one linker wherein about 30% to about 90% of the linker is
comprised of glycine and/or serine residues.
235. The VISTA-Ig fusion protein of claim 227, which comprises at
least one human or murine Fc region.
236. The VISTA-Ig fusion protein of claim 235, which comprises at
least one human IgG1, IgG2, igG3 or IgG4 Fc region or a murine
IgG2a or IgG2b constant region.
237. The VISTA-Ig fusion protein of claim 235, which comprises at
least one human IgG1 or IgG3 Fc region.
238. The VISTA-Ig fusion protein of claim 227, which exhibits about
30% to about 100% more immunosuppressive activity in an assay that
detects T cell proliferation than an otherwise identical VISTA-Ig
fusion protein lacking said at least one linker.
239. The VISTA-Ig fusion protein of claim 227, which exhibits about
1.0 fold to about 10 fold more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
240. The VISTA-Ig protein of claim 227, comprising the
extracellular domain of VISTA comprising amino acid residues 32-190
or amino acid residues 16-194.
241. The VISTA-Ig protein of claim 227, comprising at least two
copies of a VISTA protein or fragment thereof comprising at least
50, 75, 100, 125, 150, 175, 200, 225, 250, 275 or 300 amino acids
and at least two copies of a VISTA protein and IgG1 Fc or
non-FcR-binding IgG1.
242. The VISTA-Ig protein of claim 227, comprising at least two,
three, four, five, six, seven, or eight copies of a VISTA protein
or fragment thereof comprising at least 50, 75, 100, 125, 150, 175,
200, 225, 250, 275 or 300 amino acids of SEQ ID NO: 2, 4, 5, 16-25,
36, 37, 68, 69, 72 or 73 or 75 or a fragment thereof and at least
one IgG1 or IgG2a.
243. The VISTA-Ig protein of claim 227, comprising at least two
copies of a VISTA protein or fragment thereof which each at least
possess about 90, 95, 96, 97, 98 or 99% sequence identity to the
extracellular domain comprising the polypeptide sequence of SEQ ID
NO: 2, 4, or 25 or fragment thereof comprising at least 50, 75,
100, 125, 150, 175, 200, 225, 250, 275 or 300 amino acids.
244. The VISTA-Ig protein of claim 227, comprising at least one
extracellular domain or fragment of VISTA attached to the
N-terminus of an oligomerization domain.
245. The VISTA-Ig protein of claim 244, wherein the oligomerization
domain is GCN4, COMP, SNARE, CMP, MAT, LLR containing 1 NLRC, NOD2
nucleotide-binding NLRC2, LRR containing 1 NLRC, NOD2
nucleotide-binding NLRC2, or PSORAS1.
246. A recombinant cell which expresses a VISTA-Ig fusion protein
according to claim 227.
247. The cell of claim 246, which is a yeast, bacterial, fungal,
insect, avian, Xenopus, or mammalian cell.
248. A pharmaceutically acceptable composition containing a
therapeutically effective amount of a VISTA-Ig fusion protein
according to claim 227.
249. A method of inhibiting T cell, neutrophil, monocyte and/or
leukocyte proliferation in a subject in need thereof, comprising
the administration of a VISTA-Ig fusion protein according to claim
227.
250. The method of claim 249, wherein the T cells include one or
more of rested or activated CD4+ T cells, CD8+ T cells, memory
cells, and/or effector cells.
251. A method of inhibiting T cell activation in a subject in need
thereof, comprising the administration of a VISTA-Ig fusion protein
according to claim 227.
252. A method of inducing the expression of Foxp3 on T cells in a
subject in need thereof and/or inducing tolerance to an autoantigen
or foreign antigen or allergen, comprising the administration of a
VISTA-Ig fusion protein according to claim 227.
253. A method of inhibiting T cell infiltration and/or Th17 cell
proliferation in a subject in need thereof, comprising the
administration of a VISTA-Ig fusion protein according to claim
227.
254. An isolated siRNA molecule that targets VISTA comprising the
nucleic acid sequence of any one of SEQ ID NOs: 38-67, wherein (i)
the isolated siRNA molecule comprising the amino acid sequence of
any one of SEQ ID NO: 38-47 targets either the ORF or UTR region of
VISTA comprising the amino acid sequence of any one of SEQ ID NO:
38-47; (ii) the isolated siRNA molecule comprising the amino acid
sequence of any one of SEQ ID NO: 48-57 targets the UTR region only
of VISTA; and (iii) the isolated siRNA molecule comprising the
amino acid sequence of any one of SEQ ID NO: 58-67 targets the ORF
region only of VISTA.
255. A composition comprising at least one siRNA molecule according
to claim 254.
256. A method for treating an allergic disorder, an inflammatory
disorder, an autoimmune disorder, graft-versus-host disease,
multiple sclerosis, follicular hyperplasia, myelopoiesis and/or an
allergic respiratory disorder comprising administering at least one
siRNA molecule of claim 254 that targets VISTA.
257. A method of treating or preventing lupus and/or one or more of
the symptoms associated with lupus comprising administering a
therapeutically or prophylactically effective amount of the
VISTA-Ig protein of claim 227, wherein the symptom associated with
lupus includes splenomegaly, proteinuria, loss of kidney function,
macrophage infiltration into the kidneys, Ig deposition in
glomeruli, proteinuria, increased pro-inflammatory cytokine
production, weight loss or impaired renal function.
258. The method of claim 257, which further includes: (i) the
administration of another drug for treating lupus, wherein the
lupus drug is a Nonsteroidal anti-inflammatory drug such as
naproxen, ibuprofen, an Antimalarial drugs such as
hydroxychloroquine (Plaquenil), a Corticosteroid such as
Prednisone, an Immune suppressant such as cyclophosphamide
(Cytoxan), azathioprine (Imuran, Azasan), mycophenolate (Cellcept),
leflunomide (Arava), methotrexate (Trexall); and/or (ii) the
administration of another immunosuppressant, or agent that improves
kidney function, wherein said other immunosuppressive agent is
PD-1, PD-L1, PD-L2, CTLA4, or ICOS protein or at least one PD-1,
PD-L1, PD-L2, CTLA4, or ICOS fusion protein comprising the entire
extracellular region or fragment of said extracellular region that
is at least 50, 100, 150, 200, 250 or 300 amino acids or a variant
that possesses at least 80-90 or 95% sequence identity to any of
the extracellular regions of one PD-1, PD-L1, PD-L2, CTLA4, or ICOS
or to a fragment thereof that is at least 50, 100, 150, 200, 250 or
300 amino acids or an antibody s or antibody fragment specific to
any of PD-1, PD-L1, PD-L2, CTLA4, or ICOS.
259. A VISTA-Ig fusion that possesses at least 90%, at least 95%,
at least 98% or 100% sequence identity to the VISTA polypeptide in
SEQ ID NO:68, 69, 72 or 73.
260. A method of specifically targeting T cells, NK cells and/or
myeloid cells in a patient in need thereof by administration of a
VISTA-Ig polypeptide according to claim 227.
261. The VISTA-Ig polypeptide of claim 227, comprising a human IgG1
Fc region that is mutated to introduce at least one mutation
selected from E269R, E233P, D265A, K322A, P331G and P331/K322A.
Description
RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 13/925,034, filed Jun. 24, 2013, which is a
continuation of PCT Application No. PCT/US13/47009 filed on Jun.
21, 2013, entitled "Novel VISTA-Ig constructs and the use of
VISTA-Ig for Treatment of Autoimmune, Allergic and Inflammatory
Disorders", which claims priority to U.S. Provisional Application
No. 61/663,431 filed on Jun. 22, 2012, entitled "VISTA-Ig for
Treatment of Autoimmune and Inflammatory Disorders", U.S.
Provisional Application No. 61/663,969 filed on Jun. 25, 2012,
entitled "VISTA-Ig for Treatment of Autoimmune and Inflammatory
Disorders", U.S. Provisional Application No. 61/735,799 filed on
Dec. 11, 2012, entitled "VISTA-Ig for Treatment of Autoimmune and
Inflammatory Disorders", U.S. Provisional Application No.
61/776,234 filed on Mar. 11, 2013, entitled "VISTA-Ig for Treatment
of Autoimmune and Inflammatory Disorders", and U.S. Provisional
Application No. 61/807,135 filed on Apr. 1, 2013, also entitled
"VISTA-Ig for Treatment of Autoimmune and Inflammatory Disorders",
the contents of all of which PCT, utility and provisional
applications are incorporated by reference in their entireties.
[0002] The sequence listing file named "43260o1004.txt" having a
size of 125,533 bytes and created Apr. 18, 2016, is hereby
incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0004] VISTA [V-region Immunoglobulin-containing Suppressor of T
cell Activation (VISTA) or PD-L3], is a molecule that negatively
regulates immunity. This invention relates to the use of soluble
forms of VISTA (e.g., VISTA-Ig), including optimized forms of
VISTA-Ig, including multimeric versions comprising linker
polypeptides possessing enhanced potency which may be systemically
administered for the treatment and/or prevention of autoimmune,
allergic and inflammatory conditions in subjects in need thereof.
Exemplary conditions include multiple sclerosis, rheumatoid
arthritis, psoriatic arthritis, lupus disorders such as systemic
lupus erythematous (SLE), discoid lupus, drug-induced lupus, and
neonatal lupus, and allergic or inflammatory respiratory disorders
such as asthma, allergic rhinitis, hay fever, urticaria,
vasculitis, and Churg-Strauss syndrome as well as other allergic,
inflammatory and autoimmune conditions such as are disclosed
infra.
BACKGROUND OF THE INVENTION
[0005] The immune system is tightly controlled by co-stimulatory
and co-inhibitory ligands and receptors. These molecules provide
not only a second signal for T cell activation but also a balanced
network of positive and negative signals to maximize immune
responses against infection while limiting immunity to self.
[0006] Induction of an immune response requires T cell expansion,
differentiation, contraction and establishment of T cell memory. T
cells must encounter antigen presenting cells (APCs) and
communicate via T cell receptor (TCR)/major histocompatibility
complex (MHC) interactions on APCs. Once the TCR/MHC interaction is
established, other sets of receptor-ligand contacts between the T
cell and the APC are required, i.e. co-stimulation via CD154/CD40
and CD28/B7.1-B7.2. The synergy between these contacts results in a
productive immune response capable of clearing pathogens and
tumors, and may be capable of inducing autoimmunity.
[0007] Another level of control has been identified, namely
regulatory T cells (T.sub.reg). This specific subset of T cells is
generated in the thymus, delivered into the periphery, and is
capable of constant and inducible control of T cells responses.
Sakaguchi (2000) Cell 101(5):455-8; Shevach (2000) Annu. Rev.
Immunol. 18:423-49; Bluestone and Abbas (2003) Nat. Rev. Immunol.
3(3):253-7. T.sub.reg are represented by a CD4+CD25+ phenotype and
also express high levels of cytotoxic T lymphocyte-associated
antigen-4 (CTLA-4), OX-40, 4-1BB and the glucocorticoid inducible
TNF receptor-associated protein (GITR). McHugh, et al. (2002)
Immunity 16(2):311-23; Shimizu, et al. (2002) Nat. Immun.
3(2):135-42. Elimination of T.sub.reg cells by 5 day neonatal
thymectomy or antibody depletion using anti-CD25, results in the
induction of autoimmune pathology and exacerbation of T cells
responses to foreign and self-antigens, including heightened
anti-tumor responses. Sakaguchi, et al. (1985) J. Exp. Med.
161(1):72-87; Sakaguchi, et al. (1995) J. Immunol. 155(3):1151-64;
Jones, et al. (2002) Cancer Immun. 2:1. In addition, T.sub.reg have
also been involved in the induction and maintenance of
transplantation tolerance, since depletion of T.sub.reg with
anti-CD25 monoclonal antibodies results in ablation of
transplantation tolerance and rapid graft rejection. Jarvinen, et
al. (2003) Transplantation 76:1375-9. Among the receptors expressed
by T.sub.reg GITR seems to be an important component since ligation
of GITR on the surface of Treg with an agonistic monoclonal
antibody results in rapid termination of T.sub.reg activity,
resulting in autoimmune pathology and ablation of transplantation
tolerance.
[0008] Costimulatory and co-inhibitory ligands and receptors not
only provide a "second signal" for T cell activation, but also a
balanced network of positive and negative signal to maximize immune
responses against infection while limiting immunity to self. The
best characterized costimulatory ligands are B7.1 and B7.2, which
are expressed by professional APCs, and whose receptors are CD28
and CTLA-4. Greenwald, et al. (2005) Annu Rev Immunol 23, 515-548;
Sharpe and Freeman (2002) Nat Rev Immunol 2, 116-126. CD28 is
expressed by naive and activated T cells and is critical for
optimal T cell activation. In contrast, CTLA-4 is induced upon T
cell activation and inhibits T cell activation by binding to
B7.1/B7.2, thus impairing CD28-mediated costimulation. CTLA-4 also
transduces negative signaling through its cytoplasmic ITIM motif.
Teft, et al. (2006). Annu Rev Immunol 24, 65-97. B7.1/B7.2 KO mice
are impaired in adaptive immune response (Borriello, et al. (1997)
Immunity 6, 303-313; Freeman, et al. (1993) Science 262, 907-909),
whereas CTLA-4 KO mice can not adequately control inflammation and
develop systemic autoimmune diseases. Chambers, et al. (1997)
Immunity 7, 885-895; Tivol, et al. (1995) Immunity 3, 541-547;
Waterhouse, et al. (1995) Science 270, 985-988. The B7 family
ligands have expanded to include costimulatory B7-H2 (ICOS Ligand)
and B7-H3, as well as co-inhibitory B7-H1 (PD-L1), B7-DC (PD-L2),
B7-H4 (B7S1 or B7x), and B7-H6. See Brandt, et al. (2009) J Exp Med
206, 1495-1503; Greenwald, et al. (2005) Annu Rev Immunol 23:
515-548.
[0009] Inducible costimulatory (ICOS) molecule is expressed on
activated T cells and binds to B7-H2. See Yoshinaga, et al. (1999)
Nature 402, 827-832. ICOS is important for T cell activation,
differentiation and function, as well as essential for
T-helper-cell-induced B cell activation, Ig class switching, and
germinal center (GC) formation. Dong, et al. (2001) Nature 409,
97-101; Tafuri, et al. (2001) Nature 409, 105-109; Yoshinaga, et
al. (1999) Nature 402, 827-832. Programmed Death 1 (PD-1) on the
other hand, negatively regulates T cell responses. PD-1 KO mice
develop lupus-like autoimmune disease, or autoimmune dilated
cardiomyopathy depending upon the genetic background. Nishimura, et
al. (1999) Immunity 11, 141-151. Nishimura, et al. (2001) Science
291: 319-322. The autoimmunity most likely results from the loss of
signaling by both ligands PD-L1 and PD-L2. Recently, CD80 was
identified as a second receptor for PD-L1 that transduces
inhibitory signals into T cells. Butte, et al. (2007) Immunity 27:
111-122. The receptor for B7-H3 and B7-H4 still remain unknown.
[0010] The best characterized co-stimulatory ligands are B7.1 and
B7.2, which belong to the Ig superfamily and are expressed on
professional APCs and whose receptors are CD28 and CTLA-4.
Greenwald, et al. (2005) Annu Rev. Immunol. 23: 515-548. CD28 is
expressed by naive and activated T cells and is critical for
optimal T cell activation. In contrast, CTLA-4 is induced upon T
cell activation and inhibits T cell activation by binding to
B7.1/B7.2, impairing CD28-mediated co-stimulation. B7.1 and B7.2 KO
mice are impaired in adaptive immune response (Borriello, et al.
(1997) Immunity 6: 303-313), whereas CTLA-4 KO mice cannot
adequately control inflammation and develop systemic autoimmune
diseases. Tivol, et al. (1995) Immunity 3: 541-547; Waterhouse, et
al. (1995) Science 270: 985-988; Chambers, et al. (1997) Immunity
7: 885-895.
[0011] The B7 family ligands have expanded to include
co-stimulatory B7-H2 (inducible T cell co-stimulator [ICOS] ligand)
and B7-H3, as well as co-inhibitory B7-H1 (PD-L1), B7-DC (PD-L2),
B7-H4 (B7S1 or B7x), and B7-H6. Greenwald, et al. (2005) Annu Rev.
Immunol. 23: 515-548; Brandt, et al. (2009) J. Exp. Med. 206:
1495-1503. Accordingly, additional CD28 family receptors have been
identified. ICOS is expressed on activated T cells and binds to
B7-H2. ICOS is a positive coregulator, which is important for T
cell activation, differentiation, and function. Yoshinaga, et al.
(1999) Nature 402: 827-832; Dong, et al. (2001) J. Mol. Med. 81:
281-287. In contrast, PD-1 (programmed death 1) negatively
regulates T cell responses. PD-1 KO mice developed lupus-like
autoimmune disease or autoimmune dilated cardiomyopathy. Nishimura,
et al. (1999) Immunity 11: 141-151; Nishimura, et al. (2001)
Science 291: 319-322. The autoimmunity most likely results from the
loss of signaling by both ligands PD-L1 and PD-L2. Recently, CD80
was identified as a second receptor for PD-L1 that transduces
inhibitory signals into T cells. Butte, et al. (2007) Immunity 27:
111-122.
[0012] The two inhibitory B7 family ligands, PD-L1 and PD-L2, have
distinct expression patterns. PD-L2 is inducibly expressed on DCs
and macrophages, whereas PD-L1 is broadly expressed on both
hematopoietic cells and nonhematopoietic cell types. Okazaki &
Honjo (2006) Trends Immunol. 27(4): 195-201; Keir, et al. (2008)
Ann Rev Immunol. 26: 677-704. Consistent with the
immune-suppressive role of PD-1 receptor, a study using
PD-L1.sup.-/- and PD-L2.sup.-/- mice has shown that both ligands
have overlapping roles in inhibiting T cell proliferation and
cytokine production. Keir, et al. (2006) J Immunol. 175(11):
7372-9. PD-L1 deficiency enhances disease progression in both the
non-obese diabetic model of autoimmune diabetes and the mouse model
of multiple sclerosis (experimental autoimmune encephalomyelitis
[EAE]). Ansari, et al. (2003) J. Exp. Med. 198: 63-69; Salama, et
al. (2003) J. Exp. Med. 198: 71-78; Latchman, et al. (2004) Proc.
Natl. Acad. Sci. USA. 101: 10691-10696. PD-L1.sup.-/- T cells
produce elevated levels of the proinflammatory cytokines in both
disease models. In addition, BM chimera experiments have
demonstrated that the tissue expression of PD-L1 (i.e., within
pancreas) uniquely contributes to its capacity of regionally
controlling inflammation. Keir, et al. (2006) J. Exp. Med. 203:
883-895; Keir, et al. (2007) J. Immunol. 179: 5064-5070; Grabie, et
al. (2007) Circulation 116: 2062-2071. PD-L1 is also highly
expressed on placental syncytiotrophoblasts, which critically
control the maternal immune responses to allogeneic fetus. Guleria,
et al. (2005) J. Exp. Med. 202: 231-237.
[0013] Consistent with its immune-suppressive role, PD-L1 potently
suppresses antitumor immune responses and helps tumors evade immune
surveillance. PD-L1 can induce apoptosis of infiltrating cytotoxic
CD8.sup.+ T cells, which express a high level of PD-1. Dong, et al.
(2002) Nat. Med. 8: 793-800; Dong and Chen (2003) J. Mol. Med. 81:
281-287. Blocking the PD-L1-PD-1 signaling pathway, in conjunction
with other immune therapies, prevents tumor progression by
enhancing antitumor CTL activity and cytokine production. Iwai, et
al. (2002) Proc. Natl. Acad. Sci. USA 99: 12293-12297; Blank, et
al. (2004) Cancer Res. 64: 1140-1145; Blank, et al. (2005) Cancer
Immunol. Immunother. 54: 307-314; Geng, et al. (2006) Int. J.
Cancer 118: 2657-2664. PD-L1 expression on DCs promotes the
induction of adaptive Foxp3.sup.+CD4.sup.+ regulatory T cells
(T.sub.reg cells), and PD-L1 is a potent inducer of a T.sub.reg
cells within the tumor microenvironment. Wang, et al. (2008) Proc
Natl. Acad. Sci. USA 105: 9331-9336. Recent advances in targeting
B7 family regulatory molecules show promise in treating
immune-related diseases such as autoimmunity and cancer. Keir, et
al. (2008) Annu. Rev. Immunol. 26: 677-704; Zou and Chen (2008)
Nat. Rev. Immunol. 8: 467-477.
Autoimmune Disease
[0014] An autoimmune disorder is a condition that occurs when the
immune system mistakenly attacks and destroys healthy body tissue.
There are more than 80 different types of autoimmune disorders.
Normally the immune system's white blood cells help protect the
body from harmful substances, called antigens. Examples of antigens
include bacteria, viruses, toxins, cancer cells, and blood or
tissues from another person or species. The immune system produces
antibodies that destroy these harmful substances. However, in
patients with an autoimmune disorder, the immune system can not
distinguish between self and non-self (e.g., healthy tissue and
foreign antigens). The result is an immune response that destroys
normal body tissues. This response is a hypersensitivity reaction
similar to the response in allergic conditions. In allergies, the
immune system reacts to an outside substance that it normally would
ignore. With autoimmune disorders, the immune system reacts to
normal body tissues that it would normally ignore, the cause of
which is unknown.
[0015] An autoimmune disorder may result in the destruction of one
or more types of body tissue, abnormal growth of an organ, and
changes in organ function and may affect one or more organ or
tissue types. Organs and tissues commonly affected by autoimmune
disorders include blood vessels, connective tissues, endocrine
glands (e.g., thyroid or pancreas), joints, muscles, red blood
cells, and skin. A person may have more than one autoimmune
disorder at the same time.
[0016] Symptoms of an autoimmune disease vary based on the disease
and location of the abnormal immune response. Common symptoms that
often occur with autoimmune diseases include fatigue, fever, and a
general ill-feeling (malaise). Tests that may be done to diagnose
an autoimmune disorder may include: antinuclear antibody tests,
autoantibody tests, CBC, C-reactive protein (CRP), and erythrocyte
sedimentation rate (ESR).
[0017] Medicines are often prescribed to control or reduce the
immune system's response. They are often called immunosuppressive
medicines. Such medicines may include corticosteroids (such as
prednisone) and nonsteroid drugs such as azathioprine,
cyclophosphamide, mycophenolate, sirolimus, or tacrolimus.
[0018] Complications are common and depend on the disease. Side
effects of medications used to suppress the immune system can be
severe, such as infections that can be hard to control. "Autoimmune
disorders." MedlinePlus--U.S. National Library of Medicine (Apr.
19, 2012).
Inflammatory Conditions
[0019] Inflammation is part of the complex biological response of
vascular tissues to harmful stimuli, such as pathogens, damaged
cells, or irritants. Inflammation is a protective attempt by the
organism to remove the injurious stimuli and to initiate the
healing process. Without inflammation, wounds and infections would
never heal. Similarly, progressive destruction of the tissue would
compromise the survival of the organism. However, chronic
inflammation can also lead to a host of diseases, such as hay
fever, periodontitis, atherosclerosis, rheumatoid arthritis, and
even cancer (e.g., gallbladder carcinoma).
[0020] Inflammation can be classified as either acute or chronic.
Acute inflammation is the initial response of the body to harmful
stimuli and is achieved by the increased movement of plasma and
leukocytes (especially granulocytes) from the blood into the
injured tissues. A cascade of biochemical events propagates and
matures the inflammatory response, involving the local vascular
system, the immune system, and various cells within the injured
tissue. Prolonged inflammation, known as chronic inflammation,
leads to a progressive shift in the type of cells present at the
site of inflammation and is characterized by simultaneous
destruction and healing of the tissue from the inflammatory
process. Kindt, et al. (2006) Kuby Immunology [6.sup.th Ed.]
[0021] T-cells are involved in the promulgation of inflammation.
Differentiation of naive T cells leads to the generation of T-cell
subsets, each possessing distinct cytokine expression profiles for
serving different immune functions. Through the activation of
separate signaling pathways, this process results in both
differentiated helper T (Th) cells, termed Th1, Th2 and Th17, and
induced regulatory T cells, which suppress Th cells. These
different cells are important for combating infectious diseases and
cancers; however, when aberrant, they can be responsible for
chronic inflammatory diseases. One such disease is inflammatory
bowel disease (IBD), in which each T-cell subset can have a role in
disease. Zenewicz, et al. (2009) Trends in Molecular Medicine
15(5): 199-207. Therefore, T cells are involved in both autoimmune
disorders and inflammatory conditions and there is a need in the
art for a novel molecule that can modulate the activity of T cells
for the treatment of autoimmune disorders and inflammatory
conditions.
SUMMARY OF THE INVENTION
[0022] This invention relates to the use of soluble forms of VISTA
(e.g., VISTA-Ig), including optimized forms of VISTA-Ig, including
multimeric versions comprising linker polypeptides possessing
enhanced potency which may be systemically administered for the
treatment and/or prevention of autoimmune, allergic and
inflammatory conditions in subjects in need thereof. Exemplary
conditions include multiple sclerosis, rheumatoid arthritis,
psoriatic arthritis, lupus disorders such as systemic lupus
erythematous (SLE), discoid lupus, drug-induced lupus, and neonatal
lupus, and allergic or inflammatory respiratory disorders such as
asthma, allergic rhinitis, hay fever, urticaria, vasculitis, and
Churg-Strauss syndrome as well as other allergic, inflammatory and
autoimmune conditions such as are disclosed infra.
[0023] The invention also provides improved VISTA fusion proteins
comprising one or more (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12
or more copies of a polypeptide with at least about 90% sequence
identity to the extracellular domain of the polypeptide sequence of
SEQ ID NO: 2, 4, 5, 16-25, 36, or 37 or a fragment which is at
least 50, 100, 150, 200, 250, 275 or 300 amino acids, and one or
more immunoglobulin (Ig) protein and optionally a linker peptide
that intervenes a VISTA polypeptide in the fusion polypeptide and
another polypeptide, preferably an Ig polypeptide such as an IgG1,
IgG2, IgG3 or IgG4 Fc region or fragment which Ig polypeptide
optionally may be mutagenized to alter (increase, alter or
decrease) complement binding and/or FcR binding.
[0024] In one embodiment, the polypeptide may have at least about
95% sequence identity to the polypeptide sequence of SEQ ID NO: 2,
4, 5, 16-25, 36, or 37 or a fragment which is at least 50, 100,
150, 200, 250, 275 or 300 amino acids.
[0025] In one embodiment, the Ig protein may be IgG, IgG1, IgG2,
IgG2a, IgM, IgE, or IgA optionally may be mutagenized to alter
(increase, alter or decrease) complement binding and/or FcR
binding. In one embodiment, the Ig protein may be the constant and
hinge region of human IgG1 optionally may be mutagenized to alter
(increase, alter or decrease) complement binding and/or FcR
binding.
[0026] In one embodiment, the extracellular domain of VISTA in the
fusion polypeptide comprises a polypeptide at least 90, 95, 96, 97,
98, 99 or 100% identical to amino acid residues 32-190 or to the
extracellular IgV domain of VISTA may comprise amino acids 16-194.
In one embodiment, the fusion protein comprises at least two copies
of a VISTA protein or a fragment which is at least 50, 100, 150,
200, 250, 275 or 300 amino acids and IgG1, or IgG2a. In another
embodiment, the fusion protein comprises at least three or four
copies of a VISTA protein and IgG1, or IgG2a, optionally intervened
by a peptide linker, e.g., a linker comprising serine and/or
glycine residues that enhances the potency of the resultant fusion
polypeptide.
[0027] In one embodiment, the fusion protein comprises at least two
copies of a VISTA protein and IgG1 Fc or non-FcR-binding IgG1. In
one embodiment, the fusion protein comprises at least four, five or
six copies of a VISTA protein and IgG1 or IgG2a. In one embodiment,
the fusion protein comprises at least four copies of a VISTA
protein and IgG1 Fc or non-FcR-binding IgG1.
[0028] In one embodiment, an isolated multimeric VISTA protein may
comprise at least two copies of a polypeptide with at least about
90% sequence identical to the extracellular domain may comprise the
polypeptide sequence of SEQ ID NO: 2, 4, or 25 or a fragment which
is at least 50, 100, 150, 200, 250, 275 or 300 amino acids. In
another embodiment, the polypeptide may have at least about 95%
sequence identity to the polypeptide sequence of SEQ ID NO: 2, 4,
5, 16-25, 36, or 37 or a fragment which is at least 50, 100, 150,
200, 250, 275 or 300 amino acids. In another embodiment, the
polypeptide may have at least about 90% sequence identity to a
fragment of the extracellular domain of said VISTA polypeptide
which may be at least 50 amino acids long or a fragment which is at
least 75, 100, 150, 200, 250, 275 or 300 amino acids.
[0029] In another embodiment, the fragment of the extracellular
domain of said VISTA polypeptide may be at least about 75 amino
acids long. In another embodiment, the fragment of the
extracellular domain of said VISTA polypeptide may be at least
about 100 amino acids long. In another embodiment, the fragment of
the extracellular domain of said VISTA polypeptide may be at least
about 125 amino acids long.
[0030] In another embodiment, the multimeric VISTA protein
comprises at least three copies of said extracellular domain or
fragment thereof. In another embodiment, the multimeric VISTA
protein comprises at least four copies of said extracellular domain
or fragment thereof. In another embodiment, the multimeric VISTA
protein at least five copies of said extracellular domain or
fragment thereof. In another embodiment, the multimeric VISTA
protein at least six copies of said extracellular domain or
fragment thereof.
[0031] In another embodiment, the extracellular domain or fragment
of VISTA may be attached to the N-terminus of an oligomerization
domain. In another embodiment, the oligomerization domain may be
GCN4, COMP, SNARE, CMP, MAT, LLR containing 1 NLRC, NOD2
nucleotide-binding NLRC2, LRR containing 1 NLRC NOD2
nucleotide-binding NLRC2, or PSORAS1.
[0032] In one embodiment, a composition may comprise the VISTA
fusion protein. In one embodiment, a composition may comprise the
multimeric VISTA protein. In another embodiment, the composition
may be a pharmaceutical composition. In another embodiment, the
pharmaceutical composition may comprise a pharmaceutically
acceptable carrier, excipient, adjuvant, or solution. In another
embodiment, the composition may further comprise at least one other
immunosuppressive agent. In another embodiment, the
immunosuppressive agent may be PD-1, PD-L1, PD-L2, CTLA4, ICOS
proteins or a fragment which is at least 50, 100, 150, 200, 250,
275 or 300 amino acids, or antibodies specific to any of the
foregoing.
[0033] In one embodiment, a method of treating or preventing
inflammation in a subject in need thereof may comprise
administering an effective amount of a VISTA fusion protein,
optionally a VISTA-Ig, or a multimeric VISTA protein.
[0034] In one embodiment, a composition for treating or preventing
inflammation may comprise administering an effective amount of a
VISTA fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein.
[0035] In another embodiment, the use of an effective amount of a
VISTA fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein for the manufacture of a medicament for treating
inflammation.
[0036] In another embodiment, the subject may have inflammatory
condition.
[0037] In another embodiment, the inflammatory condition may be
Acid Reflux/Heartburn, Acne, Acne Vulgaris, Allergies and
Sensitivities, Alzheimer's Disease, Asthma, Atherosclerosis and
Vascular Occlusive Disease, optionally Atherosclerosis, Ischaemic
Heart Disease, Myocardial Infarction, Stroke, Peripheral Vascular
Disease, or Vascular Stent Restenosis, Autoimmune Diseases,
Bronchitis, Cancer, Carditis, Cataracts, Celiac Disease, Chronic
Pain, Chronic Prostatitis, Cirrhosis, Colitis, Connective Tissue
Diseases, optionally Systemic Lupus Erythematosus, Systemic
Sclerosis, Polymyositis, Dermatomyositis, or Sjogren's Syndrome,
Corneal Disease, Crohn's Disease, Crystal Arthropathies, optionally
Gout, Pseudogout, Calcium Pyrophosphate Deposition Disease,
Dementia, Dermatitis, Diabetes, Dry Eyes, Eczema, Edema, Emphysema,
Fibromyalgia, Gastroenteritis, Gingivitis, Glomerulonephritis,
Heart Disease, Hepatitis, High Blood Pressure, Hypersensitivities,
Inflammatory Bowel Diseases, Inflammatory Conditions including
Consequences of Trauma or Ischaemia, Insulin Resistance,
Interstitial Cystitis, Iridocyclitis, Iritis, Joint Pain,
Arthritis, Rheumatoid Arthritis, Lyme Disease, Metabolic Syndrome
(Syndrome X), Multiple Sclerosis, Myositis, Nephritis, Obesity,
Ocular Diseases including Uveitis, Osteopenia, Osteoporosis,
Parkinson's Disease, Pelvic Inflammatory Disease, Periodontal
Disease, Polyarteritis, Polychondritis, Polymyalgia Rheumatica,
Psoriasis, Reperfusion Injury, Rheumatic Arthritis, Rheumatic
Diseases, optionally Rheumatoid Arthritis, Osteoarthritis, or
Psoriatic Arthritis, Rheumatoid Arthritis, Sarcoidosis,
Scleroderma, Sinusitis, Sjogren's Syndrome, Spastic Colon,
Spondyloarthropathies, optionally Ankylosing Spondylitis, Reactive
Arthritis, or Reiter's Syndrome, Systemic Candidiasis, Tendonitis,
Transplant Rejection, UTI's, Vaginitis, Vascular Diseases including
Atherosclerotic Vascular Disease, Vasculitides, optionally
Polyarteritis Nodosa, Wegener's Granulomatosis, Churg-Strauss
Syndrome, or vasculitis.
[0038] In one embodiment, a method of treating an autoimmune
disease may comprise administering an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein.
[0039] In one embodiment, a composition for treating an autoimmune
disease may comprise administering an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein.
[0040] In another embodiment, the use of an effective amount of a
VISTA fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein for the manufacture of a medicament of the treatment of an
autoimmune disease.
[0041] In another embodiment, the autoimmune disease may be a cell
mediated autoimmune disease.
[0042] In another embodiment, the cell mediated autoimmune disease
may be multiple sclerosis, diabetes type I, oophoritis, or
thyroiditis.
[0043] In another embodiment, the autoimmune disease may be
acquired immune deficiency syndrome (AIDS), acquired spenic
atrophy, acute anterior uveitis, Acute Disseminated
Encephalomyelitis (ADEM), acute gouty arthritis, acute necrotizing
hemorrhagic leukoencephalitis, acute or chronic sinusitis, acute
purulent meningitis (or other central nervous system inflammatory
disorders), acute serious inflammation, Addison's disease,
adrenalitis, adult onset diabetes mellitus (Type II diabetes),
adult-onset idiopathic hypoparathyroidism (AOIH),
Agammaglobulinemia, agranulocytosis, vasculitides, including
vasculitis, optionally, large vessel vasculitis, optionally,
polymyalgia rheumatica and giant cell (Takayasu's) arthritis,
allergic conditions, allergic contact dermatitis, allergic
dermatitis, allergic granulomatous angiitis, allergic
hypersensitivity disorders, allergic neuritis, allergic reaction,
alopecia areata, alopecia totalis, Alport's syndrome, alveolitis,
optionally allergic alveolitis or fibrosing alveolitis, Alzheimer's
disease, amyloidosis, amylotrophic lateral sclerosis (ALS; Lou
Gehrig's disease), an eosinophil-related disorder, optionally
eosinophilia, anaphylaxis, ankylosing spondylitis, antgiectasis,
antibody-mediated nephritis, Anti-GBM/Anti-TBM nephritis,
antigen-antibody complex-mediated diseases, antiglomerular basement
membrane disease, anti-phospholipid antibody syndrome,
antiphospholipid syndrome (APS), aphthae, aphthous stomatitis,
aplastic anemia, arrhythmia, arteriosclerosis, arteriosclerotic
disorders, arthritis, optionally rheumatoid arthritis such as acute
arthritis, or chronic rheumatoid arthritis, arthritis chronica
progrediente, arthritis deformans, ascariasis, aspergilloma,
granulomas containing eosinophils, aspergillosis, aspermiogenese,
asthma, optionally asthma bronchiale, bronchial asthma, or
auto-immune asthma, ataxia telangiectasia, ataxic sclerosis,
atherosclerosis, autism, autoimmune angioedema, autoimmune aplastic
anemia, autoimmune atrophic gastritis, autoimmune diabetes,
autoimmune disease of the testis and ovary including autoimmune
orchitis and oophoritis, autoimmune disorders associated with
collagen disease, autoimmune dysautonomia, autoimmune ear disease,
optionally autoimmune inner ear disease (AGED), autoimmune
endocrine diseases including thyroiditis such as autoimmune
thyroiditis, autoimmune enteropathy syndrome, autoimmune gonadal
failure, autoimmune hearing loss, autoimmune hemolysis, Autoimmune
hepatitis, autoimmune hepatological disorder, autoimmune
hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear
disease (AIED), autoimmune myocarditis, autoimmune neutropenia,
autoimmune pancreatitis, autoimmune polyendocrinopathies,
autoimmune polyglandular syndrome type I, autoimmune retinopathy,
autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid
disease, autoimmune urticaria, autoimmune-mediated gastrointestinal
diseases, Axonal & neuronal neuropathies, Balo disease,
Behcet's disease, benign familial and ischemia-reperfusion injury,
benign lymphocytic angiitis, Berger's disease (IgA nephropathy),
bird-fancier's lung, blindness, Boeck's disease, bronchiolitis
obliterans (non-transplant) vs NSIP, bronchitis, bronchopneumonic
aspergillosis, Bruton's syndrome, bullous pemphigoid, Caplan's
syndrome, Cardiomyopathy, cardiovascular ischemia, Castleman's
syndrome, Celiac disease, celiac sprue (gluten enteropathy),
cerebellar degeneration, cerebral ischemia, and disease
accompanying vascularization, Chagas disease, channelopathies,
optionally epilepsy, channelopathies of the CNS, chorioretinitis,
choroiditis, an autoimmune hematological disorder, chronic active
hepatitis or autoimmune chronic active hepatitis, chronic contact
dermatitis, chronic eosinophilic pneumonia, chronic fatigue
syndrome, chronic hepatitis, chronic hypersensitivity pneumonitis,
chronic inflammatory arthritis, Chronic inflammatory demyelinating
polyneuropathy (CIDP), chronic intractable inflammation, chronic
mucocutaneous candidiasis, chronic neuropathy, optionally IgM
polyneuropathies or IgM-mediated neuropathy, chronic obstructive
airway disease, chronic pulmonary inflammatory disease, Chronic
recurrent multifocal ostomyelitis (CRMO), chronic thyroiditis
(Hashimoto's thyroiditis) or subacute thyroiditis, Churg-Strauss
syndrome, cicatricial pemphigoid/benign mucosal pemphigoid, CNS
inflammatory disorders, CNS vasculitis, Coeliac disease, Cogans
syndrome, cold agglutinin disease, colitis polyposa, colitis such
as ulcerative colitis, colitis ulcerosa, collagenous colitis,
conditions involving infiltration of T cells and chronic
inflammatory responses, congenital heart block, congenital rubella
infection, Coombs positive anemia, coronary artery disease,
Coxsackie myocarditis, CREST syndrome (calcinosis, Raynaud's
phenomenon), Crohn's disease, cryoglobulinemia, Cushing's syndrome,
cyclitis, optionally chronic cyclitis, heterochronic cyclitis,
iridocyclitis, or Fuch's cyclitis, cystic fibrosis,
cytokine-induced toxicity, deafness, degenerative arthritis,
demyelinating diseases, optionally autoimmune demyelinating
diseases, demyelinating neuropathies, dengue, dermatitis
herpetiformis and atopic dermatitis, dermatitis including contact
dermatitis, dermatomyositis, dermatoses with acute inflammatory
components, Devic's disease (neuromyelitis optica), diabetic
large-artery disorder, diabetic nephropathy, diabetic retinopathy,
Diamond Blackfan anemia, diffuse interstitial pulmonary fibrosis,
dilated cardiomyopathy, discoid lupus, diseases involving leukocyte
diapedesis, Dressler's syndrome, Dupuytren's contracture, echovirus
infection, eczema including allergic or atopic eczema, encephalitis
such as Rasmussen's encephalitis and limbic and/or brainstem
encephalitis, encephalomyelitis, optionally allergic
encephalomyelitis or encephalomyelitis allergica and experimental
allergic encephalomyelitis (EAE), endarterial hyperplasia,
endocarditis, endocrine ophthamopathy, endometriosis,
endomyocardial fibrosis, endophthalmia phacoanaphylactica,
endophthalmitis, enteritis allergica, eosinophilia-myalgia
syndrome, eosinophilic faciitis, epidemic keratoconjunctivitis,
epidermolisis bullosa acquisita (EBA), episclera, episcleritis,
Epstein-Barr virus infection, erythema elevatum et diutinum,
erythema multiforme, erythema nodosum leprosum, erythema nodosum,
erythroblastosis fetalis, esophageal dysmotility, Essential mixed
cryoglobulinemia, ethmoid, Evan's syndrome, Experimental Allergic
Encephalomyelitis (EAE), Factor VIII deficiency, farmer's lung,
febris rheumatica, Felty's syndrome, fibromyalgia, fibrosing
alveolitis, flariasis, focal segmental glomerulosclerosis (FSGS),
food poisoning, frontal, gastric atrophy, giant cell arthritis
(temporal arthritis), giant cell hepatitis, giant cell polymyalgia,
glomerulonephritides, glomerulonephritis (GN) with and without
nephrotic syndrome such as chronic or acute glomerulonephritis
(e.g., primary GN), Goodpasture's syndrome, gouty arthritis,
granulocyte transfusion-associated syndromes, granulomatosis
including lymphomatoid granulomatosis, granulomatosis with
polyangiitis (GPA), granulomatous uveitis, Grave's disease,
Guillain-Barre syndrome, gutatte psoriasis, haemoglobinuria
paroxysmatica, Hamman-Rich's disease, Hashimoto's disease,
Hashimoto's encephalitis, Hashimoto's thyroiditis, hemochromatosis,
hemolytic anemia or immune hemolytic anemia including autoimmune
hemolytic anemia (AIHA), hemolytic anemia, hemophilia A,
Henoch-Schonlein purpura, Herpes gestationis, human
immunodeficiency virus (HIV) infection, hyperalgesia,
hypogammaglobulinemia, hypogonadism, hypoparathyroidism, idiopathic
diabetes insipidus, idiopathic facial paralysis, idiopathic
hypothyroidism, idiopathic IgA nephropathy, idiopathic membranous
GN or idiopathic membranous nephropathy, idiopathic nephritic
syndrome, idiopathic pulmonary fibrosis, idiopathic sprue,
Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy,
IgE-mediated diseases, optionally anaphylaxis and allergic or
atopic rhinitis, IgG4-related sclerosing disease, ileitis
regionalis, immune complex nephritis, immune responses associated
with acute and delayed hypersensitivity mediated by cytokines and
T-lymphocytes, immune-mediated GN, immunoregulatory lipoproteins,
including adult or acute respiratory distress syndrome (ARDS),
Inclusion body myositis, infectious arthritis, infertility due to
antispermatozoan antibodies, inflammation of all or part of the
uvea, inflammatory bowel disease (IBD) inflammatory
hyperproliferative skin diseases, inflammatory myopathy,
insulin-dependent diabetes (type 1), insulitis, Interstitial
cystitis, interstitial lung disease, interstitial lung fibrosis,
iritis, ischemic re-perfusion disorder, joint inflammation,
Juvenile arthritis, juvenile dermatomyositis, juvenile diabetes,
juvenile onset (Type I) diabetes mellitus, including pediatric
insulin-dependent diabetes mellitus (IDDM), juvenile-onset
rheumatoid arthritis, Kawasaki syndrome, keratoconjunctivitis
sicca, kypanosomiasis, Lambert-Eaton syndrome, leishmaniasis,
leprosy, leucopenia, leukocyte adhesion deficiency,
Leukocytoclastic vasculitis, leukopenia, lichen planus, lichen
sclerosus, ligneous conjunctivitis, linear IgA dermatosis, Linear
IgA disease (LAD), Loffler's syndrome, lupoid hepatitis, lupus
(including nephritis, cerebritis, pediatric, non-renal,
extra-renal, discoid, alopecia), Lupus (SLE), lupus erythematosus
disseminatus, Lyme arthritis, Lyme disease, lymphoid interstitial
pneumonitis, malaria, male and female autoimmune infertility,
maxillary, medium vessel vasculitis (including Kawasaki's disease
and polyarteritis nodosa), membrano- or membranous proliferative GN
(MPGN), including Type I and Type II, and rapidly progressive GN,
membranous GN (membranous nephropathy), Meniere's disease,
meningitis, microscopic colitis, microscopic polyangiitis,
migraine, minimal change nephropathy, Mixed connective tissue
disease (MCTD), mononucleosis infectiosa, Mooren's ulcer,
Mucha-Habermann disease, multifocal motor neuropathy, multiple
endocrine failure, multiple organ injury syndrome such as those
secondary to septicemia, trauma or hemorrhage, multiple organ
injury syndrome, multiple sclerosis (MS) such as spino-optical MS,
multiple sclerosis, mumps, muscular disorders, myasthenia gravis
such as thymoma-associated myasthenia gravis, myasthenia gravis,
myocarditis, myositis, narcolepsy, necrotizing enterocolitis, and
transmural colitis, and autoimmune inflammatory bowel disease,
necrotizing, cutaneous, or hypersensitivity vasculitis, neonatal
lupus syndrome (NLE), nephrosis, nephrotic syndrome, neurological
disease, neuromyelitis optica (Devic's), neuromyelitis optica,
neuromyotonia, neutropenia, non-cancerous lymphocytosis,
nongranulomatous uveitis, non-malignant thymoma, ocular and orbital
inflammatory disorders, ocular cicatricial pemphigoid, oophoritis,
ophthalmia symphatica, opsoclonus myoclonus syndrome (OMS),
opsoclonus or opsoclonus myoclonus syndrome (OMS), and sensory
neuropathy, optic neuritis, orchitis granulomatosa, osteoarthritis,
palindromic rheumatism, pancreatitis, pancytopenia, PANDAS
(Pediatric Autoimmune Neuropsychiatric Disorders Associated with
Streptococcus), paraneoplastic cerebellar degeneration,
paraneoplastic syndrome, paraneoplastic syndromes, including
neurologic paraneoplastic syndromes, optionally Lambert-Eaton
myasthenic syndrome or Eaton-Lambert syndrome, parasitic diseases
such as Lesihmania, paroxysmal nocturnal hemoglobinuria (PNH),
Parry Romberg syndrome, pars planitis (peripheral uveitis),
Parsonnage-Turner syndrome, parvovirus infection, pemphigoid such
as pemphigoid bullous and skin pemphigoid, pemphigus (including
pemphigus vulgaris), pemphigus erythematosus, pemphigus foliaceus,
pemphigus mucus-membrane pemphigoid, pemphigus, peptic ulcer,
periodic paralysis, peripheral neuropathy, perivenous
encephalomyelitis, pernicious anemia (anemia perniciosa),
pernicious anemia, phacoantigenic uveitis, pneumonocirrhosis, POEMS
syndrome, polyarteritis nodosa, Type I, II, & III,
polyarthritis chronica primaria, polychondritis (e.g., refractory
or relapsed polychondritis), polyendocrine autoimmune disease,
polyendocrine failure, polyglandular syndromes, optionally
autoimmune polyglandular syndromes (or polyglandular endocrinopathy
syndromes), polymyalgia rheumatica, polymyositis,
polymyositis/dermatomyositis, polyneuropathies, polyradiculitis
acuta, post-cardiotomy syndrome, posterior uveitis, or autoimmune
uveitis, postmyocardial infarction syndrome, postpericardiotomy
syndrome, post-streptococcal nephritis, post-vaccination syndromes,
presenile dementia, primary biliary cirrhosis, primary
hypothyroidism, primary idiopathic myxedema, primary lymphocytosis,
which includes monoclonal B cell lymphocytosis, optionally benign
monoclonal gammopathy and monoclonal gammopathy of undetermined
significance, MGUS, primary myxedema, primary progressive MS
(PPMS), and relapsing remitting MS (RRMS), primary sclerosing
cholangitis, progesterone dermatitis, progressive systemic
sclerosis, proliferative arthritis, psoriasis such as plaque
psoriasis, psoriasis, psoriatic arthritis, pulmonary alveolar
proteinosis, pulmonary infiltration eosinophilia, pure red cell
anemia or aplasia (PRCA), pure red cell aplasia, purulent or
nonpurulent sinusitis, pustular psoriasis and psoriasis of the
nails, pyelitis, pyoderma gangrenosum, Quervain's thyreoiditis,
Raynauds phenomenon, reactive arthritis, recurrent abortion,
reduction in blood pressure response, reflex sympathetic dystrophy,
refractory sprue, Reiter's disease or syndrome, relapsing
polychondritis, reperfusion injury of myocardial or other tissues,
reperfusion injury, respiratory distress syndrome, restless legs
syndrome, retinal autoimmunity, retroperitoneal fibrosis, Reynaud's
syndrome, rheumatic diseases, rheumatic fever, rheumatism,
rheumatoid arthritis, rheumatoid spondylitis, rubella virus
infection, Sampter's syndrome, sarcoidosis, schistosomiasis,
Schmidt syndrome, SCID and Epstein-Barr virus-associated diseases,
sclera, scleritis, sclerodactyl, scleroderma, optionally systemic
scleroderma, sclerosing cholangitis, sclerosis disseminata,
sclerosis such as systemic sclerosis, sensoneural hearing loss,
seronegative spondyloarthritides, Sheehan's syndrome, Shulman's
syndrome, silicosis, Sjogren's syndrome, sperm & testicular
autoimmunity, sphenoid sinusitis, Stevens-Johnson syndrome,
stiff-man (or stiff-person) syndrome, subacute bacterial
endocarditis (SBE), subacute cutaneous lupus erythematosus, sudden
hearing loss, Susac's syndrome, Sydenham's chorea, sympathetic
ophthalmia, systemic lupus erythematosus (SLE) or systemic lupus
erythematodes, cutaneous SLE, systemic necrotizing vasculitis,
ANCA-associated vasculitis, optionally Churg-Strauss vasculitis or
syndrome (CSS), tabes dorsalis, Takayasu's arteritis,
telangiectasia, temporal arteritis/Giant cell arteritis,
thromboangitis ubiterans, thrombocytopenia, including thrombotic
thrombocytopenic purpura (TTP) and autoimmune or immune-mediated
thrombocytopenia such as idiopathic thrombocytopenic purpura (ITP)
including chronic or acute ITP, thrombocytopenic purpura (TTP),
thyrotoxicosis, tissue injury, Tolosa-Hunt syndrome, toxic
epidermal necrolysis, toxic-shock syndrome, transfusion reaction,
transient hypogammaglobulinemia of infancy, transverse myelitis,
traverse myelitis, tropical pulmonary eosinophilia, tuberculosis,
ulcerative colitis, undifferentiated connective tissue disease
(UCTD), urticaria, optionally chronic allergic urticaria and
chronic idiopathic urticaria, including chronic autoimmune
urticaria, uveitis, anterior uveitis, uveoretinitis, valvulitis,
vascular dysfunction, vasculitis, vertebral arthritis,
vesiculobullous dermatosis, vitiligo, Wegener's granulomatosis
(Granulomatosis with Polyangiitis (GPA)), Wiskott-Aldrich syndrome,
or x-linked hyper IgM syndrome.
[0044] In a further embodiment, the method, use, or composition may
further comprise the administration of another immune modulator
and/or an antigen. In another embodiment, the immune modulator may
be a TLR agonist (TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8,
TLR9, TLR10, TLR11 agonist), may be a type 1 interferon, optionally
alpha interferon or beta interferon, or a CD40 agonist. Or an IL-6
antagonist or a TNF antagonist such as an antibody or antibody
fragment specific to any of the foregoing.
[0045] In one embodiment, the method of treating an inflammatory
disorder may comprise administering an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein.
[0046] In one embodiment, the composition for treating an
inflammatory disorder may comprise an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein.
[0047] In one embodiment, the use of an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein for the manufacture of a medicament for the treatment of an
inflammatory disorder.
[0048] In one embodiment, the disorder treated may be selected from
type 1 diabetes, multiple sclerosis, rheumatoid arthritis,
psoriatic arthritis, systemic lupus erythematosis, rheumatic
diseases, allergic disorders, asthma, allergic rhinitis, skin
disorders, Crohn's disease, ulcerative colitis, transplant
rejection, graft-versus-host disease, poststreptococcal and
autoimmune renal failure, septic shock, systemic inflammatory
response syndrome (SIRS), adult respiratory distress syndrome
(ARDS) and envenomation; autoinflammatory diseases, osteoarthritis,
crystal arthritis, capsulitis, arthropathies, tendonitis,
ligamentitis or traumatic joint injury.
[0049] In one embodiment, the disorder treated may be multiple
sclerosis, a lupus condition such as SLE, a respiratory disorder
such as asthma, urticaria, vaculitis, Chrurg-Strauss syndrome,
psoriatic arthritis, or rheumatoid arthritis.
[0050] In one embodiment, the method of treating
graft-versus-host-disease (GVHD) may comprise administration of an
effective amount of an effective amount of a VISTA fusion protein,
optionally a VISTA-Ig, or a multimeric VISTA protein.
[0051] In one embodiment, the composition for treating
graft-versus-host-disease (GVHD) may comprise administration of an
effective amount of an effective amount of a VISTA fusion protein,
optionally a VISTA-Ig, or a multimeric VISTA protein.
[0052] In one embodiment, the use of an effective amount of an
effective amount of a VISTA fusion protein, optionally a VISTA-Ig,
or a multimeric VISTA protein in the manufacture of a medicament
for the treatment of graft-versus-host-disease (GVHD).
[0053] In one embodiment, the graft-versus-host-disease may be
acute graft-versus-host disease, chronic graft-versus-host disease,
acute graft-versus-host disease associated with stem cell
transplant, chronic graft-versus-host disease associated with stem
cell transplant, acute graft-versus-host disease associated with
bone marrow transplant, acute graft-versus-host disease associated
with allogeneic hematopoetic stem cell transplant (HSCT), or
chronic graft-versus-host disease associated with bone marrow
transplant.
[0054] In one embodiment, the patient treated may have at least one
symptom of graft-versus-host disease (GVHD), optionally wherein the
patient exhibits acute GVHD includes but is not limited to
abdominal pain, abdominal cramps, diarrhea, fever, jaundice, skin
rash, vomiting, and weight loss. In one embodiment, the patient
treated may have at least one symptom of chronic graft-versus-host
disease (GVHD) includes but is not limited to dry eyes, dry mouth,
hair loss, hepatitis, lung disorder, gastrointestinal tract
disorders, skin rash, and skin thickening. In one embodiment, the
patient has or is to receive allogeneic stem cell or bone marrow
transplant.
[0055] In one embodiment, the patient may have or is to receive
autologous stem cell or bone marrow transplant.
[0056] In one embodiment, the method of treating an individual with
an allergic, inflammatory or autoimmune disorder may comprise
administering an effective amount of a VISTA fusion protein,
optionally a VISTA-Ig, or a multimeric VISTA protein.
[0057] In one embodiment, the composition for treating an
individual with an allergic, inflammatory or autoimmune disorder
may comprise administering an effective amount of a VISTA fusion
protein, optionally a VISTA-Ig, or a multimeric VISTA protein.
[0058] In one embodiment, the use of an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig, or a multimeric VISTA
protein for the manufacture of a medicament for the treatment of an
allergic, inflammatory or autoimmune disorder.
[0059] In another embodiment, the allergic, inflammatory or
autoimmune disorder may be selected from psoriasis, dermatitis,
atopic dermatitis; systemic scleroderma, sclerosis; Crohn's
disease, ulcerative colitis; respiratory distress syndrome, adult
respiratory distress syndrome; ARDS); dermatitis; meningitis;
encephalitis; uveitis; colitis; glomerulonephritis; eczema, asthma,
atherosclerosis; leukocyte adhesion deficiency; rheumatoid
arthritis; systemic lupus erythematosus (SLE); diabetes mellitus,
optionally Type I diabetes mellitus or insulin dependent diabetes
mellitis; multiple sclerosis; Reynaud's syndrome; autoimmune
thyroiditis; allergic encephalomyelitis; Sjorgen's syndrome;
juvenile onset diabetes; tuberculosis, sarcoidosis, polymyositis,
granulomatosis and vasculitis; pernicious anemia (Addison's
disease); graft rejection disease, GVHD, central nervous system
(CNS) inflammatory disorder; multiple organ injury syndrome;
hemolytic anemia, cryoglobinemia or Coombs positive anemia;
myasthenia gravis; antigen-antibody complex mediated diseases;
anti-glomerular basement membrane disease; antiphospholipid
syndrome; allergic neuritis; Graves' disease; Lambert-Eaton
myasthenic syndrome; pemphigoid bullous; pemphigus; autoimmune
polyendocrinopathies; Reiter's disease; stiff-man syndrome; Behcet
disease; giant cell arteritis; immune complex nephritis; IgA
nephropathy; IgM polyneuropathies; immune thrombocytopenic purpura
(ITP) and autoimmune thrombocytopenia.
[0060] In another embodiment, the disease may be selected from
arthritis, rheumatoid arthritis, acute arthritis, chronic
rheumatoid arthritis, gouty arthritis, acute gouty arthritis,
chronic inflammatory arthritis, degenerative arthritis, infectious
arthritis, Lyme arthritis, proliferative arthritis, psoriatic
arthritis, vertebral arthritis, and juvenile-onset rheumatoid
arthritis, osteoarthritis, arthritis chronica progrediente,
arthritis deformans, polyarthritis chronica primaria, reactive
arthritis, and ankylosing spondylitis), inflammatory
hyperproliferative skin diseases, psoriasis such as plaque
psoriasis, gutatte psoriasis, pustular psoriasis, and psoriasis of
the nails, dermatitis including contact dermatitis, chronic contact
dermatitis, allergic dermatitis, allergic contact dermatitis,
dermatitis herpetiformis, and atopic dermatitis, x-linked hyper IgM
syndrome, urticaria such as chronic allergic urticaria and chronic
idiopathic urticaria, including chronic autoimmune urticaria,
polymyositis/dermatomyositis, juvenile dermatomyositis, toxic
epidermal necrolysis, scleroderma, systemic scleroderma, sclerosis,
systemic sclerosis, multiple sclerosis (MS), spino-optical MS,
primary progressive MS (PPMS), relapsing remitting MS (RRMS),
progressive systemic sclerosis, atherosclerosis, arteriosclerosis,
sclerosis disseminata, and ataxic sclerosis, inflammatory bowel
disease (IBD), Crohn's disease, colitis, ulcerative colitis,
colitis ulcerosa, microscopic colitis, collagenous colitis, colitis
polyposa, necrotizing enterocolitis, transmural colitis, autoimmune
inflammatory bowel disease, pyoderma gangrenosum, erythema nodosum,
primary sclerosing cholangitis, episcleritis, respiratory distress
syndrome, adult or acute respiratory distress syndrome (ARDS),
meningitis, inflammation of all or part of the uvea, iritis,
choroiditis, an autoimmune hematological disorder, rheumatoid
spondylitis, sudden hearing loss, IgE-mediated diseases such as
anaphylaxis and allergic and atopic rhinitis, encephalitis,
Rasmussen's encephalitis, limbic and/or brainstem encephalitis,
uveitis, anterior uveitis, acute anterior uveitis, granulomatous
uveitis, nongranulomatous uveitis, phacoantigenic uveitis,
posterior uveitis, autoimmune uveitis, glomerulonephritis (GN),
idiopathic membranous GN or idiopathic membranous nephropathy,
membrano- or membranous proliferative GN (MPGN), rapidly
progressive GN, allergic conditions, autoimmune myocarditis,
leukocyte adhesion deficiency, systemic lupus erythematosus (SLE)
or systemic lupus erythematodes such as cutaneous SLE, subacute
cutaneous lupus erythematosus, neonatal lupus syndrome (NLE), lupus
erythematosus disseminatus, lupus (including nephritis, cerebritis,
pediatric, non-renal, extra-renal, discoid, alopecia), juvenile
onset (Type I) diabetes mellitus, including pediatric
insulin-dependent diabetes mellitus (IDDM), adult onset diabetes
mellitus (Type II diabetes), autoimmune diabetes, idiopathic
diabetes insipidus, immune responses associated with acute and
delayed hypersensitivity mediated by cytokines and T-lymphocytes,
tuberculosis, sarcoidosis, granulomatosis, lymphomatoid
granulomatosis, Wegener's granulomatosis, agranulocytosis,
vasculitides, including vasculitis, large vessel vasculitis,
polymyalgia rheumatica, giant cell (Takayasu's) arteritis, medium
vessel vasculitis, Kawasaki's disease, polyarteritis nodosa,
microscopic polyarteritis, CNS vasculitis, necrotizing, cutaneous,
hypersensitivity vasculitis, systemic necrotizing vasculitis, and
ANCA-associated vasculitis, such as Churg-Strauss vasculitis or
syndrome (CSS), temporal arteritis, aplastic anemia, autoimmune
aplastic anemia, Coombs positive anemia, Diamond Blackfan anemia,
hemolytic anemia or immune hemolytic anemia including autoimmune
hemolytic anemia (AIHA), pernicious anemia (anemia perniciosa),
Addison's disease, pure red cell anemia or aplasia (PRCA), Factor
VIII deficiency, hemophilia A, autoimmune neutropenia,
pancytopenia, leukopenia, diseases involving leukocyte diapedesis,
CNS inflammatory disorders, multiple organ injury syndrome such as
those secondary to septicemia, trauma or hemorrhage,
antigen-antibody complex-mediated diseases, anti-glomerular
basement membrane disease, anti-phospholipid antibody syndrome,
allergic neuritis, Bechet's or Behcet's disease, Castleman's
syndrome, Goodpasture's syndrome, Reynaud's syndrome, Sjogren's
syndrome, Stevens-Johnson syndrome, pemphigoid such as pemphigoid
bullous and skin pemphigoid, pemphigus, optionally pemphigus
vulgaris, pemphigus foliaceus, pemphigus mucus-membrane pemphigoid,
pemphigus erythematosus, autoimmune polyendocrinopathies, Reiter's
disease or syndrome, immune complex nephritis, antibody-mediated
nephritis, neuromyelitis optica, polyneuropathies, chronic
neuropathy, IgM polyneuropathies, IgM-mediated neuropathy,
thrombocytopenia , thrombotic thrombocytopenic purpura (TTP),
idiopathic thrombocytopenic purpura (ITP), autoimmune orchitis and
oophoritis, primary hypothyroidism, hypoparathyroidism, autoimmune
thyroiditis, Hashimoto's disease, chronic thyroiditis (Hashimoto's
thyroiditis); subacute thyroiditis, autoimmune thyroid disease,
idiopathic hypothyroidism, Grave's disease, polyglandular syndromes
such as autoimmune polyglandular syndromes (or polyglandular
endocrinopathy syndromes), paraneoplastic syndromes, including
neurologic paraneoplastic syndromes such as Lambert-Eaton
myasthenic syndrome or Eaton-Lambert syndrome, stiff-man or
stiff-person syndrome, encephalomyelitis, allergic
encephalomyelitis, experimental allergic encephalomyelitis (EAE),
myasthenia gravis, thymoma-associated myasthenia gravis, cerebellar
degeneration, neuromyotonia, opsoclonus or opsoclonus myoclonus
syndrome (OMS), and sensory neuropathy, multifocal motor
neuropathy, Sheehan's syndrome, autoimmune hepatitis, chronic
hepatitis, lupoid hepatitis, giant cell hepatitis, chronic active
hepatitis or autoimmune chronic active hepatitis, lymphoid
interstitial pneumonitis, bronchiolitis obliterans (non-transplant)
vs NSIP, Guillain-Barre syndrome, Berger's disease (IgA
nephropathy), idiopathic IgA nephropathy, linear IgA dermatosis,
primary biliary cirrhosis, pneumonocirrhosis, autoimmune
enteropathy syndrome, Celiac disease, Coeliac disease, celiac sprue
(gluten enteropathy), refractory sprue, idiopathic sprue,
cryoglobulinemia, amylotrophic lateral sclerosis (ALS; Lou Gehrig's
disease), coronary artery disease, autoimmune ear disease such as
autoimmune inner ear disease (AGED), autoimmune hearing loss,
opsoclonus myoclonus syndrome (OMS), polychondritis such as
refractory or relapsed polychondritis, pulmonary alveolar
proteinosis, amyloidosis, scleritis, a non-cancerous lymphocytosis,
a primary lymphocytosis, which includes monoclonal B cell
lymphocytosis, optionally benign monoclonal gammopathy or
monoclonal gammopathy of undetermined significance, MGUS,
peripheral neuropathy, paraneoplastic syndrome, channelopathies
such as epilepsy, migraine, arrhythmia, muscular disorders,
deafness, blindness, periodic paralysis, and channelopathies of the
CNS, autism, inflammatory myopathy, focal segmental
glomerulosclerosis (FSGS), endocrine opthalmopathy, uveoretinitis,
chorioretinitis, autoimmune hepatological disorder, fibromyalgia,
multiple endocrine failure, Schmidt's syndrome, adrenalitis,
gastric atrophy, presenile dementia, demyelinating diseases such as
autoimmune demyelinating diseases, diabetic nephropathy, Dressler's
syndrome, alopecia greata, CREST syndrome (calcinosis, Raynaud's
phenomenon, esophageal dysmotility, sclerodactyl), and
telangiectasia), male and female autoimmune infertility, mixed
connective tissue disease, Chagas' disease, rheumatic fever,
recurrent abortion, farmer's lung, erythema multiforme,
post-cardiotomy syndrome, Cushing's syndrome, bird-fancier's lung,
allergic granulomatous angiitis, benign lymphocytic angiitis,
Alport's syndrome, alveolitis such as allergic alveolitis and
fibrosing alveolitis, interstitial lung disease, transfusion
reaction, leprosy, malaria, leishmaniasis, kypanosomiasis,
schistosomiasis, ascariasis, aspergillosis, Sampter's syndrome,
Caplan's syndrome, dengue, endocarditis, endomyocardial fibrosis,
diffuse interstitial pulmonary fibrosis, interstitial lung
fibrosis, idiopathic pulmonary fibrosis, cystic fibrosis,
endophthalmitis, erythema elevatum et diutinum, erythroblastosis
fetalis, eosinophilic faciitis, Shulman's syndrome, Felty's
syndrome, flariasis, cyclitis such as chronic cyclitis,
heterochronic cyclitis, iridocyclitis, or Fuch's cyclitis,
Henoch-Schonlein purpura, human immunodeficiency virus (HIV)
infection, echovirus infection, cardiomyopathy, Alzheimer's
disease, parvovirus infection, rubella virus infection,
post-vaccination syndromes, congenital rubella infection,
Epstein-Barr virus infection, mumps, Evan's syndrome, autoimmune
gonadal failure, Sydenham's chorea, post-streptococcal nephritis,
thromboangitis ubiterans, thyrotoxicosis, tabes dorsalis,
chorioiditis, giant cell polymyalgia, endocrine ophthamopathy,
chronic hypersensitivity pneumonitis, keratoconjunctivitis sicca,
epidemic keratoconjunctivitis, idiopathic nephritic syndrome,
minimal change nephropathy, benign familial and
ischemia-reperfusion injury, retinal autoimmunity, joint
inflammation, bronchitis, chronic obstructive airway disease,
silicosis, aphthae, aphthous stomatitis, arteriosclerotic
disorders, aspermiogenese, autoimmune hemolysis, Boeck's disease,
cryoglobulinemia, Dupuytren's contracture, endophthalmia
phacoanaphylactica, enteritis allergica, erythema nodosum leprosum,
idiopathic facial paralysis, chronic fatigue syndrome, febris
rheumatica, Hamman-Rich's disease, sensoneural hearing loss,
haemoglobinuria paroxysmatica, hypogonadism, ileitis regionalis,
leucopenia, mononucleosis infectiosa, traverse myelitis, primary
idiopathic myxedema, nephrosis, ophthalmia symphatica, orchitis
granulomatosa, pancreatitis, polyradiculitis acuta, pyoderma
gangrenosum, Quervain's thyreoiditis, acquired spenic atrophy,
infertility due to antispermatozoan antobodies, non-malignant
thymoma, vitiligo, SCID and Epstein-Barr virus-associated diseases,
acquired immune deficiency syndrome (AIDS), parasitic diseases such
as Lesihmania, toxic-shock syndrome, food poisoning, conditions
involving infiltration of T cells, leukocyte-adhesion deficiency,
immune responses associated with acute and delayed hypersensitivity
mediated by cytokines and T-lymphocytes, diseases involving
leukocyte diapedesis, multiple organ injury syndrome,
antigen-antibody complex-mediated diseases, antiglomerular basement
membrane disease, allergic neuritis, autoimmune
polyendocrinopathies, oophoritis, primary myxedema, autoimmune
atrophic gastritis, sympathetic ophthalmia, rheumatic diseases,
mixed connective tissue disease, nephrotic syndrome, insulitis,
polyendocrine failure, peripheral neuropathy, autoimmune
polyglandular syndrome type I, adult-onset idiopathic
hypoparathyroidism (AOIH), alopecia totalis, dilated
cardiomyopathy, epidermolisis bullosa acquisita (EBA),
hemochromatosis, myocarditis, nephrotic syndrome, primary
sclerosing cholangitis, purulent or nonpurulent sinusitis, acute or
chronic sinusitis, ethmoid, frontal, maxillary, or sphenoid
sinusitis, an eosinophil-related disorder such as eosinophilia,
pulmonary infiltration eosinophilia, eosinophilia-myalgia syndrome,
Loffler's syndrome, chronic eosinophilic pneumonia, tropical
pulmonary eosinophilia, bronchopneumonic aspergillosis,
aspergilloma, or granulomas containing eosinophils, anaphylaxis,
seronegative spondyloarthritides, polyendocrine autoimmune disease,
sclerosing cholangitis, sclera, episclera, chronic mucocutaneous
candidiasis, Bruton's syndrome, transient hypogammaglobulinemia of
infancy, Wiskott-Aldrich syndrome, ataxia telangiectasia,
autoimmune disorders associated with collagen disease, rheumatism,
neurological disease, ischemic re-perfusion disorder, reduction in
blood pressure response, vascular dysfunction, antgiectasis, tissue
injury, cardiovascular ischemia, hyperalgesia, cerebral ischemia,
and disease accompanying vascularization, allergic hypersensitivity
disorders, glomerulonephritides, reperfusion injury, reperfusion
injury of myocardial or other tissues, dermatoses with acute
inflammatory components, acute purulent meningitis or other central
nervous system inflammatory disorders, ocular and orbital
inflammatory disorders, granulocyte transfusion-associated
syndromes, cytokine-induced toxicity, acute serious inflammation,
chronic intractable inflammation, pyelitis, pneumonocirrhosis,
diabetic retinopathy, diabetic large-artery disorder, endarterial
hyperplasia, peptic ulcer, valvulitis, and endometriosis.
[0061] In one embodiment, a method of making antibodies may
comprise immunizing an animal with a VISTA epitope, removing said
animal's spleen and prepare a single cell suspension, fusing a
spleen cell with a myeloma cell, culturing post-fusion cells in
hybridoma selection medium, culturing the resultant hybridomas,
screening for specific antibody production, and selecting
hybridomas which produce the desired antibody.
[0062] In another embodiment, an anti-VISTA or antibody fragment
thereof produced by the method comprising immunizing an animal with
a VISTA epitope, removing said animal's spleen and prepare a single
cell suspension, fusing a spleen cell with a myeloma cell,
culturing post-fusion cells in hybridoma selection medium,
culturing the resultant hybridomas, screening for specific antibody
production, and selecting hybridomas which produce the desired
antibody.
[0063] In another embodiment, the anti-VISTA or antibody fragment
thereof may be a humanized, chimeric, or single chain variant.
[0064] In one embodiment, an isolated VISTA antagonist may be an
antibody or an antibody fragment thereof, a peptide, a glycoalkoid,
an antisense nucleic acid, a ribozyme, a retinoid, an avemir, a
small molecule, or any combination thereof.
[0065] In one embodiment, a method of treating or preventing
inflammation in a subject in need thereof may comprise
administering an effective amount of an isolated VISTA antagonist,
wherein said antagonist may be an antibody or an antibody fragment
thereof, a peptide, a glycoalkoid, an antisense nucleic acid, a
ribozyme, a retinoid, an avemir, a small molecule, or any
combination thereof.
[0066] In one embodiment, a method of treating an autoimmune
disease may comprise administering an effective amount of an
isolated VISTA antagonist, wherein said antagonist may be an
antibody or an antibody fragment thereof, a peptide, a glycoalkoid,
an antisense nucleic acid, a ribozyme, a retinoid, an avemir, a
small molecule, or any combination thereof.
[0067] In one embodiment, a method of treating an inflammatory
disorder may comprise administering an effective amount of an
isolated VISTA agonist or antagonist, wherein said agonist or
antagonist may be an antibody or an antibody fragment thereof, a
peptide, a glycoalkoid, an antisense nucleic acid, a ribozyme, a
retinoid, an avemir, a small molecule, or any combination
thereof.
[0068] In one embodiment, a method of treating
graft-versus-host-disease (GVHD) may comprise administration of an
effective amount of an effective amount of an isolated VISTA
agonist or antagonist, wherein said agonist or antagonist may be an
antibody or an antibody fragment thereof, a peptide, a glycoalkoid,
an antisense nucleic acid, a ribozyme, a retinoid, an avemir, a
small molecule, or any combination thereof.
[0069] In one embodiment, a method of treating an individual with
an allergic, inflammatory or autoimmune disorder may comprise
administering an effective amount of an isolated VISTA agonist or
antagonist, wherein said agonist or antagonist may be an antibody
or an antibody fragment thereof, a peptide, a glycoalkoid, an
antisense nucleic acid, a ribozyme, a retinoid, an avemir, a small
molecule, or any combination thereof.
[0070] In one embodiment, a composition for treating or preventing
inflammation in a subject in need thereof may comprise
administering an effective amount of an isolated VISTA agonist or
antagonist, wherein said agonist or antagonist may be an antibody
or an antibody fragment thereof, a peptide, a glycoalkoid, an
antisense nucleic acid, a ribozyme, a retinoid, an avemir, a small
molecule, or any combination thereof.
[0071] In one embodiment, a composition for treating an autoimmune
disease may comprise administering an effective amount of an
isolated VISTA agonist or antagonist, wherein said antagonist may
be an antibody or an antibody fragment thereof, a peptide, a
glycoalkoid, an antisense nucleic acid, a ribozyme, a retinoid, an
avemir, a small molecule, or any combination thereof.
[0072] In one embodiment, a composition for treating an
inflammatory disorder may comprise administering an effective
amount of an isolated VISTA agonist or antagonist, wherein said
antagonist may be an antibody or an antibody fragment thereof, a
peptide, a glycoalkoid, an antisense nucleic acid, a ribozyme, a
retinoid, an avemir, a small molecule, or any combination
thereof.
[0073] In one embodiment, a composition for treating
graft-versus-host-disease (GVHD) may comprise administration of an
effective amount of an effective amount of an isolated VISTA
agonist or antagonist, wherein said antagonist may be an antibody
or an antibody fragment thereof, a peptide, a glycoalkoid, an
antisense nucleic acid, a ribozyme, a retinoid, an avemir, a small
molecule, or any combination thereof.
[0074] In one embodiment, a composition for treating an individual
with an allergic, inflammatory or autoimmune disorder may comprise
administering an effective amount of an isolated VISTA agonist or
antagonist, wherein said antagonist may be an antibody or an
antibody fragment thereof, a peptide, a glycoalkoid, an antisense
nucleic acid, a ribozyme, a retinoid, an avemir, a small molecule,
or any combination thereof.
[0075] In one embodiment, the use of an effective amount of an
isolated VISTA agonist or antagonist, wherein said antagonist may
be an antibody or an antibody fragment thereof, a peptide, a
glycoalkoid, an antisense nucleic acid, a ribozyme, a retinoid, an
avemir, a small molecule, or any combination thereof, for the
manufacture of a medicament for treating or preventing
inflammation.
[0076] In one embodiment, the use of an effective amount of an
effective amount of an isolated VISTA agonist or antagonist,
wherein said antagonist may be an antibody or an antibody fragment
thereof, a peptide, a glycoalkoid, an antisense nucleic acid, a
ribozyme, a retinoid, an avemir, a small molecule, or any
combination thereof, for the manufacture of a medicament for the
treatment of an autoimmune disease.
[0077] In one embodiment, the use of an effective amount of an
effective amount of an isolated VISTA agonist or antagonist,
wherein said antagonist may be an antibody or an antibody fragment
thereof, a peptide, a glycoalkoid, an antisense nucleic acid, a
ribozyme, a retinoid, an avemir, a small molecule, or any
combination thereof, for the manufacture of a medicament for the
treatment of an inflammatory disorder.
[0078] In one embodiment, the use of an effective amount of an
effective amount of an isolated VISTA agonist or antagonist,
wherein said agonist or antagonist may be an antibody or an
antibody fragment thereof, a peptide, a glycoalkoid, an antisense
nucleic acid, a ribozyme, a retinoid, an avemir, a small molecule,
or any combination thereof, for the manufacture of a medicament for
the treatment of graft-versus-host-disease (GVHD).
[0079] In one embodiment, the use of an effective amount of an
effective amount of an isolated VISTA agonist or antagonist,
wherein said antagonist may be an antibody or an antibody fragment
thereof, a peptide, a glycoalkoid, an antisense nucleic acid, a
ribozyme, a retinoid, an avemir, a small molecule, or any
combination thereof, for the manufacture of a medicament for the
treatment of an allergic, inflammatory or autoimmune disorder.
[0080] In one embodiment, a method for detecting VISTA in a sample
may comprise contacting a sample with an anti-VISTA antibody or
antibody fragment and detecting the anti-VISTA antibody-VISTA
conjugates. In another embodiment, the sample may be a biological
sample. In another embodiment, the anti-VISTA antibody binds the
amino acid sequence of SEQ ID NO: 2, 3, or 5.
[0081] In another embodiment, compositions for therapeutic,
diagnostic or immune modulatory usage may comprise an isolated
soluble VISTA (PD-L3) protein or VISTA fusion protein (e.g., a
soluble VISTA-Ig fusion protein or a multimeric VISTA protein) may
comprise an amino acid sequence that preferably may be at least
70-90% identical to the human or murine VISTA (PD-L3) polypeptide
set forth in SEQ ID NO: 2, 4 or 5 or an ortholog, or fragment
thereof encoded by a gene that specifically hybridizes to SEQ ID
NO:1 or 3 that modulates VISTA in vivo and a pharmaceutically
acceptable carrier. In some embodiments, the soluble or multimeric
VISTA protein may be directly or indirectly linked to a
heterologous (non-VISTA) protein or may be expressed by a viral
vector or a cell containing (e.g., a transfected immune cell such
as a T cell.)
[0082] In an embodiment, isolated or recombinant VISTA (PD-L3)
polypeptides (e.g., proteins, polypeptides, peptides, or fragments
or portions thereof or a fragment which is at least 50, 100, 150,
200, 250, 275 or 300 amino acids or a fragment which is at least
50, 100, 150, 200, 250, 275 or 300 amino acids). In one embodiment,
an isolated VISTA (PD-L3) polypeptide or VISTA (PD-L3) fusion
protein comprises at least one of the following domains: a signal
peptide domain, an IgV domain, an extracellular domain, a
transmembrane domain, or a cytoplasmic domain.
[0083] In an embodiment, a VISTA (PD-L3) polypeptide comprises at
least one of the following domains: a signal peptide domain, an IgV
domain, an extracellular domain, a transmembrane domain, or a
cytoplasmic domain, and comprises an amino acid sequence at least
about 71%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 99% identical to the amino acid sequence of SEQ ID NO: 2, 4,
or 5. In another embodiment, a VISTA (PD-L3) polypeptide comprises
at least one of the following domains: a signal peptide domain, an
IgV domain, an extracellular domain, a transmembrane domain, or a
cytoplasmic domain, and may have a VISTA (PD-L3) activity (as
described herein).
[0084] In one embodiment, an isolated VISTA protein may comprise a
polypeptide with at least about 90% sequence identity to the
extracellular domain of the polypeptide sequence of SEQ ID NO: 2,
4, 5, 16-25, 36, or 37. In a further embodiment, the polypeptide
may have at least about 95% sequence identity to the polypeptide
sequence of SEQ ID NO: 2, 4, 5, 16-25, 36, or 37.
[0085] In another embodiment, a VISTA polypeptide comprises at
least one of the following domains: a signal peptide domain, an IgV
domain, an extracellular domain, a transmembrane domain, or a
cytoplasmic domain, and may be encoded by a nucleic acid molecule
having a nucleotide sequence which hybridizes under stringent
hybridization conditions to a complement of a nucleic acid molecule
may comprise the nucleotide sequence of SEQ ID NO: 1 or 3.
[0086] In another embodiment, fragments or portions of the
polypeptide may comprise the amino acid sequence of SEQ ID NO: 2,
4, or 5, wherein the fragment comprises at least 15 amino acids
(i.e., contiguous amino acids) of the amino acid sequence of SEQ ID
NO: 2 or 4. In another embodiment, a VISTA (PD-L3) polypeptide
comprises or consists of the amino acid sequence of SEQ ID NO: 2, 4
or 5 or a fragment which is at least 50, 100, 150, 200, 250, 275 or
300 amino acids. In another embodiment, a VISTA (PD-L3) polypeptide
may be encoded by a nucleic acid molecule may comprise a nucleotide
sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99% identical to a nucleotide sequence of
SEQ ID NO: 1 or 3, or a complement thereof. A VISTA (PD-L3)
polypeptide which may be encoded by a nucleic acid molecule
consisting of a nucleotide sequence which hybridizes under
stringent hybridization conditions to a complement of a nucleic
acid molecule may comprise the nucleotide sequence of SEQ ID NO: 1
or 3.
[0087] In one embodiment, the VISTA polypeptides may be agonists
wherein they induce suppression, especially of T cell immunity. In
another embodiment, the VISTA polypeptides may be antagonists
wherein they interfere with suppression.
[0088] The polypeptides of the present invention or portions
thereof, e.g., biologically active portions thereof, may be
operatively linked to a non-VISTA (PD-L3) polypeptide (e.g.,
heterologous amino acid sequences) to form fusion polypeptides.
[0089] In one embodiment, expression vectors may comprise an
isolated nucleic acid encoding a VISTA protein that may be at least
about 70-99% identical to the human or murine VISTA amino acid
sequence set forth in SEQ ID NO: 2, 4 or 5 or a fragment or
ortholog thereof or a fragment which is at least 50, 100, 150, 200,
250, 275 or 300 amino acids, which optionally may be fused to a
sequence encoding another protein such as an Ig polypeptide (e.g.,
an Fc region) or a reporter molecule; and host cells containing
said vectors.
[0090] In another embodiment, isolated nucleic acid molecules
encoding VISTA polypeptides, preferably encoding soluble fusion
proteins and multimeric VISTA proteins as well as nucleic acid
fragments suitable as primers or hybridization probes for the
detection of VISTA (PD-L3)-encoding nucleic acids. In one
embodiment, a VISTA (PD-L3) nucleic acid molecule of the invention
may be at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99% identical to the nucleotide sequence (e.g.,
to the entire length of the nucleotide sequence) encoding VISTA
(PD-L3) in SEQ ID NO:1 or 3 or a complement thereof.
[0091] In another embodiment, a VISTA (PD-L3) nucleic acid molecule
comprises a nucleotide sequence encoding a polypeptide having an
amino acid sequence having a specific percent identity to the amino
acid sequence of SEQ ID NO: 2, 4 or 5. In an embodiment, a VISTA
(PD-L3) nucleic acid molecule comprises a nucleotide sequence
encoding a polypeptide having an amino acid sequence at least about
71%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identical to the
entire length of the amino acid sequence of SEQ ID NO: 2, 4 or 5 or
to the extracellular domain thereof.
[0092] In another embodiment, an isolated nucleic acid molecule
encodes the amino acid sequence of human or murine or VISTA or a
conserved region or functional domain therein. In yet another
embodiment, the nucleic acid molecule comprises a nucleotide
sequence encoding a polypeptide may comprise the amino acid
sequence of SEQ ID NO: 2, 4 or 5. In yet another embodiment, the
nucleic acid molecule may be at least about 50, 100, 150, 200, 250,
300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900,
950, 1000, 1050, 1100, 1150 nucleotides in length. In a further
embodiment, the nucleic acid molecule may be at least about 50,
100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700,
750, 800, 850, 900, 950, 1000, 1050, 1100, 1150 nucleotides in
length and encodes a polypeptide having a VISTA (PD-L3) activity or
modulating VISTA (PD-L3) function.
[0093] Another embodiment features nucleic acid molecules,
preferably VISTA (PD-L3) nucleic acid molecules, which specifically
detect VISTA (PD-L3) nucleic acid molecules relative to nucleic
acid molecules encoding non-VISTA (PD-L3) polypeptides. For
example, in one embodiment, a nucleic acid molecule may be at least
about 880, 900, 950, 1000, 1050, 1100, 1150 nucleotides in length
and hybridizes under stringent conditions to a nucleic acid
molecule encoding the polypeptide shown in SEQ ID NO: 2, 4 or 5, or
a complement thereof. In another embodiment, a nucleic acid
molecule may be at least 20, 30, 40, 50, 100, 150, 200, 250, 300
nucleotides in length and hybridizes under stringent conditions to
a nucleic acid molecule encoding a fragment of VISTA (PD-L3), e.g.,
may comprise at least about 20, 30, 40, 50, 100, 150, 200, 250,
300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900,
950 nucleotides in length, comprises at least 15 (i.e., 15
contiguous) nucleotides of the disclosed nucleic acid sequence in
SEQ ID NO:1 and 3 encoding the VISTA (PD-L3) polypeptides in SEQ ID
NO: 2, 4 or 5, or a complement thereof, and hybridizes under
stringent conditions to a nucleic acid molecule may comprise the
nucleotide sequence shown in SEQ ID NO: 1 or 3 or a complement
thereof.
[0094] In one embodiment, the nucleic acid molecule encodes a
naturally occurring allelic variant of a polypeptide may comprise
the amino acid sequence of SEQ ID NO: 2 or 4 or 5, wherein the
nucleic acid molecule hybridizes to a complement of a nucleic acid
molecule may comprise SEQ ID NO: 1 or 3, or a complement thereof,
under stringent conditions.
[0095] Another embodiment of the invention provides an isolated
antisense to a VISTA (PD-L3) nucleic acid molecule (e.g., antisense
to the coding strand of a VISTA (PD-L3) nucleic acid molecule of
SEQ ID NO: 1 or 3.)
[0096] Another aspect of the invention provides a vector may
comprise a VISTA (PD-L3) nucleic acid molecule. In certain
embodiments, the vector may be a recombinant expression vector.
[0097] In another embodiment, a host cell comprises a vector of the
invention. In yet another embodiment, a host cell comprises a
nucleic acid molecule of the invention. The invention also provides
a method for producing a polypeptide, preferably a VISTA (PD-L3)
polypeptide, by culturing in a suitable medium, a host cell, e.g.,
a mammalian host cell such as a non-human mammalian cell, of the
invention containing a recombinant expression vector, such that the
polypeptide may be produced.
[0098] In one embodiment, an siRNA molecule which targets VISTA
mRNA transcribed from a VISTA DNA may comprise the nucleic acid
sequence of SEQ ID NO: 1 or 3. In another embodiment, a siRNA
molecule which targets VISTA mRNA transcribed from a VISTA DNA
encoding the amino acid sequence set forth in SEQ ID NO: 2, 4 or 5.
In a further embodiment, a siRNA molecule that targets VISTA may
comprise the nucleic acid sequence of any one of SEQ ID NOs: 38-67.
In another embodiment, a siRNA molecule that targets either the ORF
or UTR region of VISTA may comprise the amino acid sequence of any
one of SEQ ID NO: 38-47. In another embodiment, a siRNA molecule
that targets the UTR region only of VISTA may comprise the amino
acid sequence of any one of SEQ ID NO: 48-57. In another
embodiment, a siRNA molecule that targets the ORF region only of
VISTA may comprise the amino acid sequence of any one of SEQ ID NO:
58-67. In one embodiment, a siRNA molecule that targets VISTA may
consist of the nucleic acid sequence of any one of SEQ ID NOs:
38-67. In one embodiment, a siRNA molecule that targets either the
ORF or UTR region of VISTA may consist of the amino acid sequence
of any one of SEQ ID NO: 38-47. In one embodiment, a siRNA molecule
that targets the UTR region only of VISTA may consist the amino
acid sequence of any one of SEQ ID NO: 48-57. In one embodiment, a
siRNA molecule that targets the ORF region only of VISTA may
consist the amino acid sequence of any one of SEQ ID NO: 58-67.
[0099] In a further embodiment, a composition may comprise an siRNA
molecule comprising the nucleic acid sequence of any one of SEQ ID
NOs: 38-67. In a further embodiment, a composition may comprise a
siRNA molecule consisting of the nucleic acid sequence of any one
of SEQ ID NOs: 38-67. In a further embodiment, a composition may be
a pharmaceutical composition.
[0100] In one embodiment, a method for treating an autoimmune
disorder may comprise administration of a siRNA molecule that
targets VISTA comprising the nucleic acid sequence of any one of
SEQ ID NOs: 38-67. In one embodiment, a method for treating an
autoimmune disorder may comprise administration of a siRNA molecule
that targets VISTA consisting of the nucleic acid sequence of any
one of SEQ ID NOs: 38-67. In a further embodiment, a composition
for treating an autoimmune disorder may comprise a siRNA molecule
comprising the nucleic acid sequence of any one of SEQ ID NOs:
38-67. In a further embodiment, a composition for treating an
autoimmune disorder may comprise a siRNA molecule consisting of the
nucleic acid sequence of any one of SEQ ID NOs: 38-67. In a further
embodiment, use of a siRNA molecule comprising any one of nucleic
acid sequences of SEQ ID NOs: 38-67 for the manufacture of a
medicament for the treatment of an autoimmune disease. In a further
embodiment, use of a siRNA molecule consisting of any one of
nucleic acid sequences of SEQ ID NOs: 38-67 for the manufacture of
a medicament for the treatment of an autoimmune disease.
[0101] In one embodiment, a method for treating an inflammatory
disorder may comprise administration of a siRNA molecule that
targets VISTA comprising the nucleic acid sequence of any one of
SEQ ID NOs: 38-67. In one embodiment, a method for treating an
inflammatory disorder may comprise administration of a siRNA
molecule that targets VISTA consisting of the nucleic acid sequence
of any one of SEQ ID NOs: 38-67. In a further embodiment, a
composition for treating an inflammatory disorder may comprise a
siRNA molecule comprising the nucleic acid sequence of any one of
SEQ ID NOs: 38-67. In a further embodiment, a composition for
treating an inflammatory disorder a siRNA molecule may comprise a
siRNA molecule consisting of the nucleic acid sequence of any one
of SEQ ID NOs: 38-67. In a further embodiment, use of a siRNA
molecule comprising any one of nucleic acid sequences of SEQ ID
NOs: 38-67 for the manufacture of a medicament for the treatment of
an inflammatory disease. In a further embodiment, use of a siRNA
molecule consisting of any one of nucleic acid sequences of SEQ ID
NOs: 38-67 for the manufacture of a medicament for the treatment of
an inflammatory disease.
[0102] In one embodiment, a method for treating graft-versus-host
disease may comprise administration of a siRNA molecule that
targets VISTA comprising the nucleic acid sequence of any one of
SEQ ID NOs: 38-67. In one embodiment, a method for treating
graft-versus-host disease may comprise administration of a siRNA
molecule that targets VISTA consisting of the nucleic acid sequence
of any one of SEQ ID NOs: 38-67. In a further embodiment, a
composition for treating graft-versus-host disease may comprise a
siRNA molecule comprising the nucleic acid sequence of any one of
SEQ ID NOs: 38-67. In a further embodiment, a composition for
treating graft-versus-host disease a siRNA molecule may comprise a
siRNA molecule consisting of the nucleic acid sequence of any one
of SEQ ID NOs: 38-67. In a further embodiment, use of a siRNA
molecule comprising any one of nucleic acid sequences of SEQ ID
NOs: 38-67 for the manufacture of a medicament for the treatment of
graft-versus-host disease. In a further embodiment, use of a siRNA
molecule consisting of any one of nucleic acid sequences of SEQ ID
NOs: 38-67 for the manufacture of a medicament for the treatment of
graft-versus-host disease.
[0103] In one embodiment, an antagonist may specifically binds to a
VISTA (PD-L3) protein may comprise the amino acid sequence set
forth in SEQ ID NO: 2, 4 or 5 or a variant, fragment, or ortholog
thereof. In an embodiment, the binding agent modulates (agonizes or
antagonizes) VISTA activity in vitro or in vivo.
[0104] In one embodiment, the VISTA antagonist may be a VISTA
ligand. In another embodiment, the VISTA ligand may be a protein.
In another embodiment, the VISTA antagonist may be an antibody or
an antibody fragment thereof, a peptide, a glycoalkoid, an
antisense nucleic acid, a ribozyme, a retinoid, an avemir, a small
molecule, or any combination thereof.
[0105] In one embodiment, the VISTA antagonists may have functional
properties including but not limited to modulating specific effects
of VISTA (PD-L3) on immunity such as the suppressive effect of the
protein on TCR activation, the suppressive effect of the protein on
CD4 T cell proliferative responses to anti-CD3, suppression of
antigen specific proliferative responses of cognate CD4 T cells,
the suppressive effects of VISTA (PD-L3) on the expression of
specific cytokines (e.g., IL-2 and .gamma. interferon).
[0106] In one embodiment, an antagonist, optionally a
proteinanceous antagonist, that specifically binds to a VISTA
polypeptide, multimeric VISTA polypeptide, or VISTA fusion protein.
In another embodiment, the antagonist, optionally a proteinanceous
antagonist, may exhibit antitumor or antimetastatic activity. In
another embodiment, the antagonist, optionally a proteinanceous
antagonist may specifically bind an epitope comprised in residues
1-20, 20-40, 30-50, 60-80, 70-90, 80-100, or 90-110. In another
embodiment, the antagonist, optionally a proteinanceous antagonist
may bind an epitope comprised in the IgV, stalk region, cytoplasmic
region or transmembrane region of said VISTA protein. In another
embodiment, the antagonist, optionally a proteinanceous antagonist
may elicit at least one of the following activities: (a)
upregulates cytokines; (b) induces expansion of T cells, (c)
promotes antigenic specific T cell immunity; or (d) promotes CD4+
and/or CD8+ T cell activation.
[0107] In another embodiment, an isolated binding agent, preferably
an antibody or antibody fragment, may specifically binds to a VISTA
(PD-L3) protein may comprise the amino acid sequence set forth in
SEQ ID NO: 2, 4 or 5 or a variant, fragment or ortholog thereof. In
an embodiment, the binding agent modulates (agonizes or
antagonizes) VISTA activity in vitro or in vivo. In one embodiment,
the binding agent may be an agonistic or antagonistic anti-VISTA
antibody.
[0108] In one embodiment, the anti-VISTA (PD-L3) antibodies may
have functional properties including but not limited to modulating
specific effects of VISTA (PD-L3) on immunity such as the
suppressive effect of the protein on TCR activation, the
suppressive effect of the protein on CD4 T cell proliferative
responses to anti-CD3, suppression of antigen specific
proliferative responses of cognate CD4 T cells, the suppressive
effects of VISTA (PD-L3) on the expression of specific cytokines
(e.g., IL-2 and .gamma. interferon).
[0109] In a further embodiment, antibodies, optionally monoclonal
or polyclonal antibodies, may specifically bind VISTA (PD-L3)
polypeptides including human VISTA polypeptides.
[0110] In one embodiment, an isolated antibody, or antibody
fragment thereof, that specifically binds to a VISTA polypeptide,
multimeric VISTA polypeptide, or VISTA fusion protein. In another
embodiment, the antibody or antibody fragment thereof may exhibit
antitumor or antimetastatic activity. In another embodiment, the
antibody or antibody fragment thereof may specifically bind an
epitope comprised in residues 1-20, 20-40, 30-50, 60-80, 70-90,
80-100, or 90-110. In another embodiment, the antibody or antibody
fragment thereof may specifically bind an epitope comprised in the
IgV, stalk region, cytoplasmic region or transmembrane region of
said VISTA protein. In another embodiment, the antibody or antibody
fragment thereof may elicit at least one of the following
activities: (a) upregulates cytokines; (b) induces expansion of T
cells, (c) promotes antigenic specific T cell immunity; or (d)
promotes CD4+ and/or CD8+ T cell activation. In another embodiment,
the antibody or fragment may be recombinant. In another embodiment,
the antibody or fragment may have anti-tumor activity. In another
embodiment, the antibody fragment may be a Fab, Fab', F(ab')2, Fv,
CDR, paratope, or portion of an antibody that is capable of binding
the antigen. In another embodiment, the antibody may be chimeric,
humanized, anti-idiotypic, single-chain, bifunctional, or
co-specific. In another embodiment, the antibody or fragment may be
directly or indirectly conjugated to a label, cytotoxic agent,
therapeutic agent, or an immunosuppressive agent. In a further
embodiment, the may be a chemiluminescent label, paramagnetic
label, an MRI contrast agent, fluorescent label, bioluminescent
label, or radioactive label.
[0111] In one embodiment, the invention provides anti-VISTA
antibodies and antibody fragments thereof. In one embodiment, the
antibody fragment is a Fab, Fab', F(ab').sub.2, Fv and scFv
fragment. In one embodiment, the antibody or antibody fragment
thereof may comprise a Fab, Fab', F(ab').sub.2, Fv, single-chain
variable fragment (scFv), IgNAR, SMIP, camelbody, or nanobody. In
another embodiment, a recombinant protein may comprise the
hypervariable region of an anti-VISTA antibody and selectively bind
VISTA. In another embodiment, the antibody fragment may selective
bind VISTA may comprise the amino acid sequence of SEQ ID NO:2, 4
or 5.
[0112] In addition, the VISTA (PD-L3) polypeptides (or biologically
active portions thereof) or modulators of the VISTA (PD-L3)
molecules (e.g., anti-VISTA antibodies) may be incorporated into
pharmaceutical compositions, optionally may comprise a
pharmaceutically acceptable carrier.
[0113] In another embodiment, the invention provides a vaccine may
comprise an antigen and an agent that modulates (enhances or
inhibits) VISTA (PD-L3) activity. In an embodiment, the vaccine
inhibits the interaction between VISTA (PD-L3) and its natural
binding partner(s). In another embodiment, a vaccine may comprise
an antigen and an agent that inhibits the interaction between VISTA
(PD-L3) and its natural binding partner(s). In another embodiment,
a vaccine may comprise an antigen and an agent that promotes the
interaction between VISTA (PD-L3) and its natural binding
partner(s). In one embodiment, the vaccine comprises an excipient,
adjuvant, or a carrier.
[0114] In one embodiment, a kit may comprise a VISTA fusion
protein. In another embodiment, a kit may comprise a multimeric
VISTA protein. In a further embodiment, the VISTA fusion protein or
multimeric VISTA protein may be directly or indirectly fixed to a
solid phase support. In a further embodiment, the solid phase
support may be a bead, test tube, sheet, culture dish, or test
strip. In another embodiment the solid phase support may be an
array.
[0115] In another embodiment, immune cells may be activated may
comprise contacting an immune cell with a VISTA polypeptide,
VISTA-Ig fusion protein, or anti-VISTA antibody. In another
embodiment, the immune cell may be a T cell, B cell, or an
antigen-presenting cell. Immune cells activated in accordance with
the method of the instant invention can subsequently be expanded ex
vivo and used in the treatment and prevention of a variety of
diseases; e.g., human T cells which have been cloned and expanded
in vitro maintain their regulatory activity. Prior to expansion, a
source of T cells may be obtained from a subject (e.g., a mammals
such as a human, dog, cat, mouse, rat, or transgenic species
thereof). T cells can be obtained from a number of sources,
including peripheral blood mononuclear cells, bone marrow, lymph
node tissue, cord blood, thymus tissue, and tissue from a site of
infection, spleen tissue, tumors or T cell lines. T cells may be
obtained from a unit of blood collected from a subject using any
number of techniques known to the skilled artisan, such as
FICOLL.RTM. separation.
[0116] In another embodiment, a method for modulating VISTA (PD-L3)
activity, may comprise contacting a cell capable of expressing
VISTA (PD-L3) with an agent that modulates VISTA (PD-L3) activity,
preferably an anti-VISTA (PD-L3) antibody such that VISTA (PD-L3)
activity in the cell may be modulated. In one embodiment, the agent
inhibits VISTA (PD-L3) activity. In another embodiment, the agent
stimulates VISTA (PD-L3) activity. In a further embodiment, the
agent interferes with or enhances the interaction between a VISTA
(PD-L3) polypeptide and its natural binding partner(s). In one
embodiment, the agent may be an antibody that specifically binds to
a VISTA (PD-L3) polypeptide. In another embodiment, the agent may
be a peptide, peptidomimetic, or other small molecule that binds to
a VISTA (PD-L3) polypeptide.
[0117] In another embodiment, the agent modulates expression of
VISTA (PD-L3) by modulating transcription of a VISTA (PD-L3) gene,
translation of a VISTA (PD-L3) mRNA, or post-translational
modification of a VISTA (PD-L3) polypeptide. In another embodiment,
the agent may be a nucleic acid molecule having a nucleotide
sequence that may be antisense to the coding strand of a VISTA
(PD-L3) mRNA or a VISTA (PD-L3) gene. In a further embodiment, the
agent may be a siRNA molecule that targets VISTA (PD-L3) mRNA.
[0118] In one embodiment, methods for treating autoimmune disorder
or inflammatory condition may comprise administering an agent which
may be a VISTA (PD-L3) modulator to the subject. In one embodiment,
the VISTA (PD-L3) modulator may be a VISTA (PD-L3) polypeptide,
preferably a soluble fusion protein or multimeric VISTA protein or
anti-VISTA antibody as described infra. In another embodiment the
VISTA (PD-L3) modulator may be a VISTA (PD-L3) nucleic acid
molecule, e.g., in an adenoviral vector. In another embodiment, the
invention further provides treating the subject with an additional
agent that modulates an immune response.
[0119] In one embodiment, a method for modulating the interaction
of VISTA (PD-L3) with its natural binding partner(s) on an immune
cell may comprise contacting an antigen presenting cell which
expresses VISTA (PD-L3) with an agent selected from the group
consisting of a form of VISTA (PD-L3), or an agent that modulates
the interaction of VISTA (PD-L3) and its natural binding partner(s)
such that the interaction of VISTA (PD-L3) with it natural binding
partner(s) on an immune cell may be modulated and assessing the
interaction of VISTA with its natural binding partner(s). In an
embodiment, an agent that modulates the interaction of VISTA
(PD-L3) and its natural binding partner(s) may be an antibody that
specifically binds to VISTA (PD-L3). In one embodiment, the
interaction of VISTA (PD-L3) with its natural binding partner(s)
may be unregulated. In another embodiment, the interaction of VISTA
(PD-L3) with its natural binding partner(s) may be down regulated.
In one embodiment, the method further comprises contacting the
immune cell or the antigen presenting cell with an additional agent
that modulates an immune response. In one embodiment, the step of
contacting may be performed in vitro. In another embodiment, the
step of contacting may be performed in vivo. In one embodiment, the
immune cell may be selected from the group consisting of a T cell,
a monocyte, a macrophage, a dendritic cell, a B cell, and a myeloid
cell.
[0120] In one embodiment, a method for inhibiting activation in an
immune cell may comprise inhibiting the activity or expression of
VISTA (PD-L3) in a cell such that immune cell activation may be
inhibited. In one embodiment, a method for increasing activation in
an immune cell may comprise increasing the activity or expression
of VISTA (PD-L3) in a cell such that immune cell activation may be
increased.
[0121] In another embodiment, a method for upregulating an immune
response may comprise administering an agent that inhibits the
interaction between VISTA (PD-L3) and its natural binding
partner(s) on immune cells. In one embodiment, the agent comprises
a blocking antibody or a small molecule that binds to VISTA (PD-L3)
and inhibits the interaction between VISTA (PD-L3) and its natural
binding partner(s). In another embodiment, the method further
comprises administering a second agent that upregulates an immune
response to the subject. In another embodiment, a method for
downregulating an immune response may comprise administering an
agent that stimulates the interaction between VISTA (PD-L3) and its
natural binding partner(s) on immune cells.
[0122] In one embodiment, a method for treating a condition
selected from the group consisting of a tumor, a pathogenic
infection, an inflammatory immune response or condition, preferably
less pronounced inflammatory conditions, or an immunosuppressive
disease may comprise administration of an effective amount of a
VISTA polypeptide or VISTA-Ig fusion protein. Specific examples
include multiple sclerosis, thyroiditis, rheumatoid arthritis,
diabetes type II and type I and cancers, both advanced and early
forms, including metastatic cancers (e.g., bladder cancer, ovarian
cancer, melanoma, lung cancer), wherein VISTA suppresses an
effective anti-tumor response. The subject may be administered
cells or a viral vector that express a nucleic acid that encodes an
anti-VISTA antibody or VISTA fusion protein.
[0123] In one embodiment, a method for treating a condition
selected from the group consisting of transplant, an allergy,
infectious disease, cancer, and inflammatory or autoimmune
disorders (e.g., an inflammatory immune disorder) may comprise
administration of an effective amount of a VISTA (PD-L3) proteins,
binding agents or VISTA (PD-L3) antagonists or agonists. In another
embodiment, type 1 diabetes, multiple sclerosis, rheumatoid
arthritis, psoriatic arthritis, systemic lupus erythematosus,
rheumatic diseases, allergic disorders, asthma, allergic rhinitis,
skin disorders, gastrointestinal disorders such as Crohn's disease
and ulcerative colitis, transplant rejection, poststreptococcal and
autoimmune renal failure, septic shock, systemic inflammatory
response syndrome (SIRS), adult respiratory distress syndrome
(ARDS) and envenomation; autoinflammatory diseases as well as
degenerative bone and joint diseases including osteoarthritis,
crystal arthritis and capsulitis and other arthropathies may be
treated may comprise administration of an effective amount of a
VISTA (PD-L3) proteins, binding agents or VISTA (PD-L3) antagonists
or agonists. Further, the methods and compositions may comprise an
effective amount of a VISTA (PD-L3) proteins, binding agents or
VISTA (PD-L3) antagonists or agonists may be used for treating
tendonitis, ligamentitis and traumatic joint injury. In one
embodiment, an agent comprises an antibody or a small molecule that
stimulates the interaction between VISTA (PD-L3) and its natural
binding partner(s). In another embodiment, the method further
comprises administering a second agent that downregulates an immune
response to the subject such as a PD-L1, PD-L2 or CTLA-4 fusion
protein or antibody specific thereto.
[0124] In embodiments the subject VISTA (PD-L3) proteins, nucleic
acids, and ligands specific to VISTA (PD-L3), preferably antibodies
having desired effects on VISTA (PD-L3) functions may be used to
treat conditions including but not limited to cancer, autoimmune
diseases, allergy, inflammatory disorders or infection and more
specifically immune system disorders such as severe combined
immunodeficiency, multiple sclerosis, systemic lupus erythematosus,
type I diabetes mellitus, lymphoproliferative syndrome,
inflammatory bowel disease, allergies, asthma, graft-versus-host
disease, and transplant rejection; immune responses to infectious
pathogens such as bacteria and viruses; and immune system cancers
such as lymphomas and leukemias. In one embodiment, an agent that
modulates the activity of VISTA may relieve T cell exhaustion and
enhance immunity to infectious disease.
[0125] In one embodiment, a method of treating a cancer in a
patient in need thereof may comprise administering an effective
amount of VISTA protein, multimeric VISTA protein, VISTA fusion
protein, optionally a VISTA-Ig fusion protein, wherein said VISTA
protein, multimeric VISTA protein, and/or VISTA fusion protein
enhances antitumor immunity by suppressing the immunosuppressive
activity of VISTA expressed by myeloid dendritic suppressor cells.
In a further embodiment, the patient prior to treatment may be
found to express elevated levels of VISTA protein on immune
cells.
[0126] In one embodiment, a method of enhancing the efficacy of
radiotherapy, chemotherapy or an anti-cancer biologic may comprise
administering an effective amount of VISTA protein, multimeric
VISTA protein, VISTA fusion protein, optionally a VISTA-Ig fusion
protein, in a therapeutic regimen including the administration of
radiotherapy, chemotherapy or an anti-cancer biologic. In a further
embodiment, the patient prior to treatment may have a cancer that
does not respond to said radiotherapy, chemotherapy or an
anti-cancer biologic.
[0127] In one embodiment, a method of treating bladder, ovarian, or
melanoma cancer may comprise administering an effective amount of
VISTA protein, multimeric VISTA protein, VISTA fusion protein,
optionally a VISTA-Ig fusion protein, wherein said cancer is in
early (non-metastatic) or metastatic form and the VISTA-Ig blocks
interaction with its receptor.
[0128] In one embodiment, a method for modulating an immune cell
response may comprise contacting an immune cell with an effective
amount of a VISTA protein, multimeric VISTA protein, VISTA fusion
protein, optionally a VISTA-Ig fusion protein in the presence of a
primary signal so that a response of the immune cell is
modulated.
[0129] In one embodiment, a method of modulating Treg cells in a
subject in need thereof may comprise administering an effective
amount of VISTA protein, multimeric VISTA protein, VISTA fusion
protein, optionally a VISTA-Ig fusion protein.
[0130] In one embodiment, a method of releasing the suppressive
effect of VISTA on immunity may comprise administering an effective
amount of a VISTA protein, multimeric VISTA protein, VISTA fusion
protein, optionally a VISTA-Ig fusion protein. In another
embodiment, the treated patient may be found to express elevated
levels of VISTA prior to treatment. In another embodiment, the
VISTA levels may be monitored after treatment in order to assess
that the immune response may have been enhanced.
[0131] In one embodiment, a method of enhancing cell mediated
immunity in a subject in need thereof may comprise administering an
effective amount of a VISTA protein, multimeric VISTA protein,
VISTA fusion protein, optionally a VISTA-Ig fusion protein.
[0132] In one embodiment, a method for modulating an immune cell
response may comprise contacting an immune cell with may comprise
administering an effective amount of a VISTA fusion protein,
optionally a VISTA-Ig fusion protein, or a multimeric VISTA protein
in the presence of a primary signal so that a response of the
immune cell is modulated. In another embodiment, the contacting may
be performed in vitro, in vivo, or ex vivo.
[0133] In one embodiment, a method of regulating T cell responses
during cognate interactions between T cells and myeloid derived
APCs may comprise administering an effective amount of a VISTA
fusion protein, optionally a VISTA-Ig fusion protein, or a
multimeric VISTA protein.
[0134] In one embodiment, a method of eliciting immunosuppression
in an individual in need thereof may comprise administering an
effective amount of a VISTA fusion protein, optionally a VISTA-Ig
fusion protein, or a multimeric VISTA protein.
[0135] In another embodiment, a method for decreasing immune cell
activation may comprise administering an effective amount of a
VISTA (PD-L3) polypeptide or VISTA-Ig fusion protein to a subject,
wherein said VISTA (PD-L3) polypeptide or VISTA-Ig fusion protein
acts as inhibitory signal for decreasing immune cell activation. In
one embodiment, the immune cell activation is inhibited. In another
embodiment, the immune cell activation is significantly decreased.
In one embodiment, the inhibitory signal binds to an inhibitory
receptor (e.g., CTLA-4 or PD-1) on an immune cell thereby
antagonizing the primary signal which binds to an activating
receptor (e.g., via a TCR, CD3, BCR, or Fc polypeptide). In one
embodiment, the VISTA polypeptide or VISTA-Ig fusion protein
inhibits second messenger generation; inhibits immune cell
proliferation; inhibits effector function in the immune cell (e.g.,
reduced phagocytosis, reduced antibody production, reduced cellular
cytotoxicity, the failure of the immune cell to produce mediators,
(cytokines (e.g., IL-2) and/or mediators of allergic responses); or
the development of anergy.)
[0136] In one embodiment, the primary signal may be a ligand (e.g.,
CD3 or anti-CD3) that binds TCR and initiates a primary stimulation
signal. TCR ligands include but are not limited to anti-CD3
antibody OKT3 and anti-CD3 monoclonal antibody G19-4. In one
embodiment, a primary signal may be delivered to a T cell through
other mechanisms including a protein kinase C activator, such as a
phorbol ester (e.g., phorbol myristate acetate), and a calcium
ionophore (e.g., ionomycin, which raises cytoplasmic calcium
concentrations). The use of such agents bypasses the TCR/CD3
complex but delivers a stimulatory signal to T cells. Other agents
acting as primary signals may include natural and synthetic
ligands. A natural ligand may comprise MHC with or without a
peptide presented. Other ligands may include, but are not limited
to, a peptide, polypeptide, growth factor, cytokine, chemokine,
glycopeptide, soluble receptor, steroid, hormone, mitogen (e.g.,
PHA), or other superantigens, peptide-MHC tetramers and soluble MHC
dimers.
[0137] In another embodiment, a method for detecting the presence
of a VISTA (PD-L3) nucleic acid molecule, protein, or polypeptide
in a biological sample comprises contacting the biological sample
with an agent capable of detecting a VISTA (PD-L3) nucleic acid
molecule, protein, or polypeptide, such that the presence of a
VISTA (PD-L3) nucleic acid molecule, protein or polypeptide may be
detected in the biological sample. This VISTA (PD-L3) expression
may be used to detect certain disease sites such as inflammatory
sites.
[0138] In another embodiment, a method for detecting the presence
of VISTA (PD-L3) activity in a biological sample comprises
contacting the biological sample with an agent capable of detecting
an indicator of VISTA (PD-L3) activity, such that the presence of
VISTA (PD-L3) activity may be detected in the biological sample. In
a further embodiment, a method for detecting soluble VISTA in
biological sample may comprise contacting the biological sample
with an agent capable of detecting an indicator of VISTA (PD-L3)
activity, such that the presence of VISTA (PD-L3) activity may be
detected in the biological sample. In another embodiment, a method
for detecting soluble VISTA in biological sample may comprise
contacting the biological sample with an agent capable of binding
VISTA (PD-L3), optionally an anti-VISTA antibody or antibody
fragment, and detecting the presence of VISTA-antibody complexes.
In a further embodiment, the measurement may be quantitative,
optionally Western blot densitometry, colorimetric, or
flourometic.
[0139] In another embodiment, diagnostic assays for identifying the
presence or absence of a genetic alteration in a VISTA gene
comprises obtaining a sample may comprise a nucleic acid and
analyzing the sample, wherein said genetic alteration is
characterized by at least one of (i) aberrant modification or
mutation of a gene encoding a VISTA (PD-L3) polypeptide; (ii)
misregulation of the gene; and (iii) aberrant post-translational
modification of a VISTA (PD-L3) polypeptide, wherein a wild-type
form of the gene encodes a polypeptide with a VISTA (PD-L3)
activity. In one embodiment, the nucleic acid may be DNA or
mRNA.
[0140] In one embodiment, a method of selecting for anti-VISTA
antibodies for having potential use as a therapeutic or immune
modulatory agent may comprise: (a) immunizing immune cells or a
host with a VISTA protein, immunogenic fragment, or conjugate
thereof; (b) selecting lymphoid cells which express antibodies that
specifically bind to VISTA; (c) selecting anti-VISTA antibodies or
antibody fragments thereof; (d) screening said anti-VISTA
antibodies or antibody fragments thereof for the ability to inhibit
or enhance at least one of the following activities of VISTA
(PD-L3) or VISTA: (i) suppression of T cell activation or
differentiation; (ii) suppression of CD4+ or CD8+ T cell
proliferation, or suppression of cytokine production by T cells;
(iii) wherein an antibody or antibody fragment thereof which has at
least one of the activities in (d) has potential use as a
therapeutic or immune modulatory agents.
[0141] In further embodiment, methods of selecting anti-VISTA
(PD-L3) antibodies having desired functional properties may
comprise screening panels of monoclonal antibodies produced against
this protein or a VISTA (PD-L3)-Ig fusion protein based on desired
functional properties including modulating specific effects of
VISTA (PD-L3) on immunity such as the suppressive effect of the
protein on TCR activation, the suppressive effect of the protein on
CD4 T cell proliferative responses to anti-CD3, suppression of
antigen specific proliferative responses of cognate CD4 T cells,
the suppressive effects of VISTA (PD-L3) on the expression of
specific cytokines (e.g., IL-2 and .gamma. interferon) and
selecting the desired antibody.
[0142] In another embodiment, methods for identifying a compound
that binds to or modulates the activity of a VISTA (PD-L3)
polypeptide may comprise providing an indicator composition may
comprise a VISTA (PD-L3) polypeptide having VISTA (PD-L3) activity,
contacting the indicator composition with a test compound, and
determining the effect of the test compound on VISTA (PD-L3)
activity in the indicator composition to identify a compound that
modulates the activity of a VISTA (PD-L3) polypeptide.
[0143] In another embodiment, a cell-based assay for screening for
compounds which modulate the activity of VISTA (PD-L3) may comprise
contacting a cell expressing a VISTA (PD-L3) target molecule with a
test compound and determining the ability of the test compound to
modulate the activity of the VISTA (PD-L3) target molecule
[0144] In another embodiment, a cell-free assay for screening for
compounds which modulate the binding of VISTA (PD-L3) to a target
molecule may comprise contacting a VISTA (PD-L3) polypeptide or
biologically active portion thereof with a test compound and
determining the ability of the test compound to bind to the VISTA
(PD-L3) polypeptide or biologically active portion thereof.
[0145] In another embodiment, a method of identifying a compound,
e.g. an anti-VISTA (PD-L3) antibody which modulates the effect of
VISTA (PD-L3) on T cell activation or cytokine production at a
first and second antigen concentration may comprise contacting a T
cell expressing a VISTA (PD-L3) target molecule with a test
compound at a first antigen concentration, determining the ability
of the test compound to modulate T cell proliferation or cytokine
production at the first antigen concentration, contacting a T cell
expressing a VISTA (PD-L3) target molecule with the test compound
at a second antigen concentration, and determining the ability of
the test compound to modulate T cell proliferation or cytokine
production at the second antigen concentration, thereby identifying
a compound which modulates T cell activation or cytokine production
at a first and second antigen concentration.
[0146] In other embodiments panels of anti-VISTA (PD-L3) antibodies
and VISTA (PD-L3) proteins may be screened and selected on the
basis of which anti-VISTA antibodies inhibit or promote the effects
of VISTA (PD-L3) on CD4+ and CD8+ T cell differentiation,
proliferation and/or cytokine production. In a further embodiment,
a mouse that has been engineered to express human VISTA may be used
to test the function of anti-human VISTA antibodies in regulating
immunity.
[0147] In another embodiment, a method of treating
graft-versus-host-disease (GVHD) may comprise administration of an
effective amount of a VISTA fusion protein, optionally a VISTA-Ig
fusion protein, or the multimeric VISTA protein. In another
embodiment, a method for treating graft-versus-host disease (GVHD),
acute graft-versus-host disease, chronic graft-versus-host disease,
acute graft-versus-host disease associated with stem cell
transplant, chronic graft-versus-host disease associated with stem
cell transplant, acute graft-versus-host disease associated with
bone marrow transplant, acute graft-versus-host disease associated
with allogeneic hematopoetic stem cell transplant (HSCT), or
chronic graft-versus-host disease associated with bone marrow
transplant may comprise administering of an effective amount of a
VISTA fusion protein, optionally a VISTA-Ig fusion protein, or the
multimeric VISTA protein.
[0148] In another embodiment, the invention provides isolated or
recombinant VISTA-Ig fusion protein or nucleic acids encoding
comprising (i) at least one VISTA polypeptide that comprises at
least 80% sequence identity to the extracellular region of human or
murine VISTA or a fragment thereof which is at least 50 amino
acids, (ii) at least one linker peptide which comprises at least 5
amino acids, and (iii) at least one Ig protein, preferably an Ig Fc
region or fragment or variant thereof, wherein said peptide linker
intervenes a VISTA polypeptide and an Ig protein, and wherein the
resultant VISTA-Ig fusion protein elicits more potent
immunosuppressive activity in vivo than an otherwise identical
fusion protein lacking the linker. In exemplary embodiments, the
isolated VISTA fusion protein may comprise at least one
polypeptides with at least about 80% sequence identity to the
extracellular domain of the polypeptide sequence of SEQ ID NO: 2,
4, 5, 16-25, 36, or 37 or a fragment thereof which comprises at
least 50 amino acids and (ii) at least one linker which comprises
at least 5 amino acids, and (iii) at least one Ig Fc protein or
fragment thereof, wherein said linker intervenes a VISTA
polypeptide and an Ig Fc protein and the resultant VISTA-Ig fusion
protein elicits more potent immunosuppressive activity in vivo than
an otherwise identical fusion protein lacking the linker.
[0149] In another exemplary embodiments the afore-described
VISTA-Ig fusions may comprise at least one polypeptide having at
least 90 or 95% sequence identity to the extracellular domain of
human or murine VISTA or a fragment thereof which is at least 50,
100, 150, 200, 250 or 300 amino acids.
[0150] In another exemplary embodiments the afore-described
VISTA-Ig fusion protein will comprises a human IgG1, IgG2, IgG3 or
IgG4 Fc region or fragment or variant thereof optionally containing
at least one Fc region that comprises one or more modifications
that modulate (increase, alter or decrease) complement binding
and/or FcR binding or effector function.
[0151] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide that comprises at least 4, 5, 6,
7, 8 9, 10, 12, 13, 14, or 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 35, 40, 50 or more glycine amino acid
residues and the fusion may comprise at least 2, 3 or 4
polypeptides which each possess at least about 80% sequence
identity to the extracellular domain of the polypeptide sequence of
SEQ ID NO: 2, 4, 5, 16-25, 36, or 37 or a fragment thereof which
comprises at least 50, 100, 150, 200, 250, or 300 amino acids.
[0152] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein at least 30, 40, 50, 60,
70, 80, 90, 95% or all of the linker residues that comprises. at
least 30, 40, 50, 60, 70, 80, or 90% of the linker is comprised of
glycine and/or serine residues, and preferably comprising at least
one human or murine Fc region, e.g., human IgG1, IgG2, igG3 or IgG4
Fc region or a murine IgG2a or IgG2b constant or Fc region, which
optionally is mutated to modulate (increase or decrease) or alter
glycosylation, FcR binding, complement binding or effector
function.
[0153] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 30% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0154] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 40% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0155] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 50% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0156] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 60% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0157] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 70% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0158] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 30% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0159] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 80% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0160] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 90% more immunosuppressive activity in an
assay that detects T cell proliferation than an otherwise identical
VISTA-Ig fusion protein lacking said at least one linker.
[0161] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 100% more immunosuppressive activity in
an assay that detects T cell proliferation than an otherwise
identical VISTA-Ig fusion protein lacking said at least one
linker.
[0162] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 1.1-2 fold more immunosuppressive
activity in an assay that detects T cell proliferation than an
otherwise identical VISTA-Ig fusion protein lacking said at least
one linker.
[0163] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 2-3 fold more immunosuppressive activity
in an assay that detects T cell proliferation than an otherwise
identical VISTA-Ig fusion protein lacking said at least one
linker.
[0164] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 3-4 fold more immunosuppressive activity
in an assay that detects T cell proliferation than an otherwise
identical VISTA-Ig fusion protein lacking said at least one
linker.
[0165] In other exemplary embodiments the afore-described VISTA-Ig
fusions may comprise at least one one linker intervening a VISTA
polypeptide and an Ig polypeptide wherein the VISTA-Ig fusion
protein exhibits at least 4-5, 6-7, 8-9, 9-10, or at least 10-fold
more immunosuppressive activity in an assay that detects T cell
proliferation than an otherwise identical VISTA-Ig fusion protein
lacking said at least one linker.
[0166] In other exemplary embodiments the afore-described VISTA-Ig
fusions, comprise a least one VISTA polypeptide which has at least
about 90-95% sequence identity to the polypeptide sequence of SEQ
ID NO: 2, 4, 5, 16-25, 36, or 37 or a fragment comprising at least
50, 75, 100, 125, 150, 175, 200, 225, 250, 275 or 300 amino acids,
optionally containing at least one IgG, IgG1, IgG2, IgG2a, IgM,
IgE, or IgA polypeptides, e.g., at least one Ig protein comprising
the constant and hinge region of human IgG1, and optionally
comprising at least one extracellular domain of VISTA that
comprises amino acid residues 32-190 or the extracellular IgV
domain of VISTA comprising amino acids 16-194.
[0167] In other exemplary embodiments the afore-described VISTA-Ig
fusions, comprise at least two copies of a VISTA protein or
fragment thereof comprising at least 50, 75, 100, 125, 150, 175,
200, 225, 250, 275 or 300 amino acids and at least two copies of a
VISTA protein and IgG1 Fc or non-FcR-binding IgG1.
[0168] In other exemplary embodiments the afore-described VISTA-Ig
fusions, comprise at least three, four, five, six, seven, eight or
more copies of a VISTA protein or fragment thereof comprising at
least 50, 75, 100, 125, 150, 175, 200, 225, 250, 275 or 300 amino
acids and at least one IgG1 or IgG2a.
[0169] In other exemplary embodiments the afore-described VISTA-Ig
fusions, comprise at least three, four, five, six, seven, eight or
more copies of a VISTA protein or fragment thereof comprising at
least 50, 75, 100, 125, 150, 175, 200, 225, 250, 275 or 300 amino
acids and at least one IgG1 or IgG2a.
[0170] In other exemplary embodiments the afore-described VISTA-Ig
fusions, comprise at least one extracellular domain or fragment of
VISTA attached to the N-terminus of an oligomerization domain,
e.g., wherein the oligomerization domain is GCN4, COMP, SNARE, CMP,
MAT, LLR containing 1 NLRC, NOD2 nucleotide-binding NLRC2, LRR
containing 1 NLRC, NOD2 nucleotide-binding NLRC2, or PSORAS1.
[0171] In other exemplary embodiments the afore-described VISTA-Ig
fusions are expressed in a recombinant cell such as a yeast,
bacterial, fungal, insect, avian, Xenopus, or mammalian cell.
[0172] In other exemplary embodiments the afore-described VISTA-Ig
fusions are combined or co-administered with a PD-1, PD-L1, PD-2,
PD-L2 protein or fusion protein or an antibody or antibody fragment
that specifically binds any of the foregoing.
[0173] In other exemplary embodiments the afore-described VISTA-Ig
fusions are contained in pharmaceutically acceptable composition
containing a therapeutically effective amount of a VISTA-Ig fusion
protein or cell according to the invention which may be adopted for
parenteral, intravenous, subcutaneous, transdermal, oral,
intramuscular, intravginal, intrabuccal, anal, or nasal
administration.
[0174] In exemplary embodiments, these compositions are used to
treat or prevent different allergic, inflammatory or autoimmune
disorders such as previously identified. Preferred examples include
GVHD, lupus conditions such as SLE, drug-induced lupus, psoriatic
rheumatoid arthritis, and multiple sclerosis, respiratory allergic
and inflammatory conditions such as asthma, rhinitis, vasculitis,
and Churg-Strauss syndrome.
[0175] In one embodiment, the graft-versus-host disease (GVHD) may
be graft-versus-host disease (GVHD), acute graft-versus-host
disease, chronic graft-versus-host disease, acute graft-versus-host
disease associated with stem cell transplant, chronic
graft-versus-host disease associated with stem cell transplant,
acute graft-versus-host disease associated with bone marrow
transplant, acute graft-versus-host disease associated with
allogeneic hematopoetic stem cell transplant (HSCT), or chronic
graft-versus-host disease associated with bone marrow transplant.
In another embodiment, the patient treated has at least one symptom
of graft-versus-host disease (GVHD), optionally wherein the patient
exhibits acute GVHD includes but is not limited to abdominal pain,
abdominal cramps, diarrhea, fever, jaundice, skin rash, vomiting,
and weight loss. In another embodiment, the patient treated has at
least one symptom of chronic graft-versus-host disease (GVHD)
includes but is not limited to dry eyes, dry mouth, hair loss,
hepatisis, lung disorder, gastrointestinal tract disorders, skin
rash, and skin thickening. In another embodiment, the patient has
or is to receive allogeneic stem cell or bone marrow transplant. In
another embodiment, the patient has or is to receive autologous
stem cell or bone marrow transplant.
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0176] FIGS. 1A-1E depict sequence analysis. (FIG. 1A) Full length
amino acid sequence of murine VISTA (PD-L3) (SEQ ID NO: 17). (FIG.
1B) Amino acid sequence alignment of extracellular Ig domains
between murine VISTA (PD-L3) (SEQ ID NO: 25) and selected B7 family
ligands, including B7-H1 (PD-L1) (SEQ ID NO: 26), B7-DC (PD-L2)
(SEQ ID NO: 27), B7-H3 (CD276) (SEQ ID NO: 28), and B7-H4 (B7S1)
(SEQ ID NO: 29). (FIG. 1C) Alignment of VISTA (PD-L3) (SEQ ID NO:
30) Ig domain with B7 family receptors, including PD-1 (SEQ ID NO:
31), CTLA-4 (SEQ ID NO: 32), CD28 (SEQ ID NO: 33), BTLA (SEQ ID NO:
34), and ICOS (SEQ ID NO: 35). Ig-v domain, "."; Ig-c domain,
"______" Alignment was performed using the MUSCLE algorithm
(Multiple Sequence Comparison by Log-Expectation). (FIG. 1D)
Sequence identity (%) of the Ig-V domains between VISTA (PD-L3) and
other B7 family ligands and receptors is calculated using ClustalW2
program. (FIG. 1E) Sequence alignment to show sequence homology
between human (SEQ ID NO: 37) and murine VISTA (PD-L3) (SEQ ID NO:
36). Identical residues are shaded in black. Highly conserved and
semi-conserved residues are shaded in dark and light shade of gray
respectively.
[0177] FIG. 2 depicts a hylogenic analysis of mouse VISTA (PD-L3)
with other Immunoglobulin (Ig) superfamily members. Full-length
sequence of mouse VISTA (PD-L3) and other Ig superfamily members,
including CD28, CTLA-4, ICOS, BTLA, PD-1, B7-H1 (PD-L1), B7-DC
(PD-L2), B7-H2, B7-H3, B7-H4, B7-1, B7-2, BTNL2, BTN3A3, BTN2A2,
and BTN1A1, were analyzed using PhyML algorithm (Phylogenetic
Maximum Likelihood). Branch distances were shown at tree branch
joints.
[0178] FIGS. 3A-3G depict the tissue expression and hematopoietic
cell expression patterns of VISTA (PD-L3) FIG. 3A. RT-PCR of full
length VISTA (PD-L3) from mouse tissues. Lanes: (1) muscle (2)
heart (3) eye (4) thymus (5) spleen (6) small intestine (7) kidney
(8) liver (9) brain (10) mammary gland (11) lung (12) ovary (13)
bone marrow. FIG. 3B. RT-PCR of full-length VISTA (PD-L3) from
purified hematopoietic cell types. Lanes (1) peritoneal macrophages
(2) splenic CD11b+ monocytes (3) splenic CD11c+ DCs (4) splenic
CD4+ T cells (5) splenic CD8+ T cells (6) splenic B cells. FIGS.
3C-E. Flow cytometry analysis of VISTA (PD-L3) expression on
splenic CD4+ and CD8+ T cells from thymus and spleen (FIG. 3C), on
CD11b+ monocytes (FIG. 3D), and on CD11c+ DC subsets from spleen
and peritoneal cavity (FIG. 3E). (FIG. 3F) Splenic B cells, NK
cells and granulocytes are also analyzed. (FIG. 3G) The
differential expression of VISTA (PD-L3) on hematopoietic cells
from different tissue sites, including mesenteric LN, peripheral
LN, spleen, blood and peritoneal cavity. Representative data from
at least 3 independent experiments are shown.
[0179] FIG. 4 depicts a VISTA, novel and structurally-distinct,
Ig-superfamily inhibitory ligand, whose extracellular domain bears
highest homology to the B7 family ligand PD-L1 as displayed on an
Antigen Presenting Cell along with other CDs and B7 family members.
VISTA has a 93 aa cytoplasmic domain with no obvious signal
transducing motifs, except a possible protein kinase C binding
site.
[0180] FIG. 5 depicts the specificity of VISTA (PD-L3) hamster
monoclonal antibodies. Mouse EL4 cell lines over-expressing either
PD-L1 or VISTA (PD-L3) fused to RFP were stained using the
supernatants from hybridoma cultures and analyzed by flow
cytometry. Two representative positive clones are shown, 8D8 and
6E7.
[0181] FIG. 6 depicts a comparison of VISTA (PD-L3) expression with
other B7 family ligands on in vitro cultured spleen cells.
Expression of VISTA (PD-L3) and other B7 family ligands (i.e.,
PD-L1, PD-L2, B7-H3, and B7-H4) on hematopoietic cell types,
including CD4+ T cells, CD11bhi monocytes, and CD11c+ DCs were
compared. Cells were either freshly isolated or in vitro cultured
for 24 hrs, with and without activation. CD4+ T cells were
activated with plate-bound .alpha.CD3 (5 .mu.g/ml), CD11bhi
monocytes and CD11c+ DCs were activated with IFN.alpha. (20 ng/ml)
and LPS (200 ng/ml). Representative results from three independent
experiments are shown.
[0182] FIGS. 7A-7B depict the comparison of in vivo expression
patterns of VISTA (PD-L3) and other B7 family ligands during
immunization. DO11.10 TCR transgenic mice were immunized with
chicken ovalbumin (OVA) emulsified in complete Freund's adjuvant
(CFA) on the flank. Draining and non-draining lymph node cells were
collected 24 hr post immunization, and analyzed by flow cytometry
for the expression of VISTA (PD-L3), PD-L1 and PD-L2. Shown are
representative results from at least four independent experiments.
(FIG. 7A) A population of CD11b+ cells expressing a high level of
VISTA (PD-L3) was induced at 24 hr post immunization with CFA/OVA,
but not with CFA alone within the draining lymph node. These cells
are of mixed phenotype of F4/80+ macrophages and CD11C+ dendritic
cells. (FIG. 7B) Expression of VISTA (PD-L3), PD-L1 and PD-L2 on
CD11bhi monocytes, CD11c+ DCs and CD4+ T cells were analyzed at 24
hr post immunization.
[0183] FIG. 8 depicts the loss of VISTA (PD-L3) expression on
activated CD4+ T cells, CD11b.sup.+ and CD11c.sup.+ cells in
response to immunization. DO11.10 mice were immunized with chicken
ovalbumin (OVA) emulsified in complete Freund's adjuvant (CFA) on
the flank. Draining and non-draining lymph node cells were
collected 48 hr post immunization, and analyzed for VISTA (PD-L3)
expression by flow cytometry. Shown are representative results from
2 independent experiments.
[0184] FIGS. 9A-9D depict that immobilized VISTA (PD-L3)-Ig fusion
protein inhibited CD4+ and CD8+ T cell proliferation. (FIG. 9A)
CFSE labeled CD4+ and CD8+ T cells were stimulated by plate-bound
.alpha.CD3 with or without co-absorbed VISTA (PD-L3)-Ig. The
percentage of CFSE-low cells was quantified and shown in (FIG. 9B).
(FIG. 9C) CD4+ T cells from PD-1 ko mice were also suppressed by
VISTA (PD-L3)-Ig. (FIG. 9D) VISTA (PD-L3)-Ig-mediated suppression
is persistent and can act late. CD4+ T cells were activated in the
presence of VISTA (PD-L3)-Ig or control-Ig for either 72 hrs (i),
or for 24 hrs (ii, iii and iv). 24 hour-preactivated cells were
harvested and re-stimulated under specified conditions for another
48 hours. Cell proliferation was analyzed at the end of the 72 hour
culture. (ii) Pre-activation with VISTA (PD-L3)-Ig and
re-stimulation with antiCD3; (iii) Pre-activation with anti-CD3 and
re-stimulation with VISTA (PD-L3)-Ig. (iv) Pre-activation with
VISTA (PD-L3)-Ig and re-stimulation with VISTA (PD-L3)-Ig.
Duplicated wells were analyzed for all conditions. Shown are
representative results from four experiments.
[0185] FIG. 10 depicts the similar inhibitory effect of PD-L1-Ig
and VISTA (PD-L3)-Ig fusion proteins on CD4+ T cell proliferation.
Bulk purified CD4+ T cells were CFSE labeled and stimulated with
plate-bound .alpha.CD3 together with titrated amount of PD-L1-Ig or
VISTA (PD-L3)-Ig fusion proteins. CFSE dilution was analyzed at 72
hours and the percentage of CFSElow cells was quantified.
Duplicated wells were analyzed for all conditions. Shown are
representative results from 2 independent experiments.
[0186] FIGS. 11A-11B depict the suppressive impact of VISTA
(PD-L3)-Ig on the proliferation of naive and memory CD4+ T cells.
(FIG. 11A) Naive (CD25-CD44lowCD62Lhi) and memory
(CD25-CD44hiCD62Llow) CD4+ T cell subsets were sorted, CFSE
labeled, and stimulated with plate-bound anti-CD3 (2.5 .mu.g/ml)
together with VISTA (PD-L3)-Ig or control-Ig at indicated ratios.
Cell proliferation was analyzed at 72 hours by examining the CFSE
division profile. The percentage of proliferated cells, as
determined by percentage of CFSElow cells, is calculated and shown
in (FIG. 11B). Duplicated wells were analyzed for all conditions.
Shown are representative results from two independent
experiments.
[0187] FIGS. 12A-12B depict VISTA (PD-L3)-Ig fusion protein
suppressed early TCR activation and cell proliferation, but did not
directly induce apoptosis. Bulk purified CD4+ T cells were
stimulated with plate-bound anti-CD3 together with VISTA (PD-L3)-Ig
or control-Ig at 1-2 ratio (2.5 .mu.g/ml and 5 .mu.g/ml
respectively). Cells were analyzed at 24 hr and 48 hrs for the
expression of CD69, CD62L, and CD44 by flow cytometry. Cells were
also stained for early apoptosis marker annexin-V, and cell death
marker 7-Aminoactinomycin D (7-AAD). Shown are representative
results from two independent experiments.
[0188] FIGS. 13A-13E depict VISTA-Ig inhibited cytokine production
by CD4+ and CD8+ T cells. (FIG. 13A) and (FIG. 13B) Bulk purified
CD4+ T cells were stimulated with plate-bound anti-CD3, and
VISTA-Ig or control-Ig at stated ratios. Culture supernatants were
collected after 24 hrs and 48 hrs. Levels of IL-2 and IFN.gamma.
were analyzed by ELISA. (FIGS. 13C-13D) CD4+ T cells were sorted
into naive (CD25-CD44lowCD62Lhi) and memory (CD25-CD44hiCD62Llow)
cell populations. Cells were stimulated with plate-bound .alpha.CD3
and VISTA (PD-L3)-Ig or control-Ig at a ratio of 1:2. Culture
supernatants were collected at 48 hrs and analyzed for the level of
IL-2 and IFN.gamma. by ELISA. (FIG. 13E) Bulk purified CD8+ T cells
were stimulated with plate-bound .alpha.CD3, and VISTA (PD-L3)-Ig
or control-Ig at indicated ratios. IFN.gamma. in the culture
supernatant was analyzed by ELISA. For all conditions, supernatant
for six duplicated wells were pooled for ELISA analysis. Shown are
representative results from three experiments.
[0189] FIGS. 14A-14D depict VISTA-Ig-mediated suppression may
overcome a moderate level of costimulation provided by CD28, but
was completely reversed by a high level of costimulation, as well
as partially rescued by exogenous IL-2 ((FIG. 14A) and (FIG. 14B)).
Mouse CD4+ T cells were activated by plate-bound .alpha.CD3
together with either VISTA (PD-L3)-Ig or control-Ig at 1-1 ratio
and 1-2 ratios. For cytokine rescue, soluble mIL-2, mIL7, mIL15 and
mIL-23 (all at 40 ng/ml) were added to the cell culture (FIG. 14A).
To examine the effects of costimulation, .alpha.CD28 (1 .mu.g/ml)
was immobilized together with .alpha.CD3 and Ig proteins at
indicated ratios (FIG. 14B). Cell proliferation was analyzed at 72
hr by examining CFSE division profiles. FIGS. 14C-14D. To examine
the suppressive activity of VISTA (PD-L3) in the presence of lower
levels of costimulation, titrated amounts of .alpha.CD28 were
coated together with anti-CD3 (2.5 .mu.g/ml) and VISTA-Ig fusion
proteins or control-Ig fusion protein (10 .mu.g/ml) to stimulate
mouse CD4+ T cell proliferation. Cell proliferation was analyzed at
72 hour. Percentages of proliferated CFSElow cells were quantified
and shown in FIG. 14D. Duplicated wells were analyzed for all
conditions. Representative CFSE profiles from three independent
experiments are shown.
[0190] FIGS. 15A-15D depict that VISTA (PD-L3) expressed on antigen
presenting cells suppressed CD4 T cell proliferation ((FIG. 15A),
(FIG. 15B) and (FIG. 15C)). The CHO cell line that stably expresses
MHCII molecule I-Ad and costimulation molecule B7-2 was used as the
parent cell line. Cells were transduced with retrovirus expressing
either VISTA-RFP or RFP control molecules. Transduced cells were
sorted to achieve homogenous level of expression. To test their
ability as antigen presenting cells, CHO-VISTA or CHO-RFP cells
were mitomycin C treated and mixed with OVA-specific transgenic
CD4+ T cells D011.10, in the presence of titrated amount of OVA
peptide. Proliferation of DO11 cells was analyzed at 72 hrs, either
by CFSE division profiles (FIGS. 15A-15B), or by tritium
incorporation (FIG. 15C). (FIG. 15D) bone marrow derived dendritic
cells were transduced with RFP or B7B-H5-RFP retrovirus during
10-day culture period. Transduced CD11c+ RFP+ DCs and
non-transduced CD11c+ RFP- DCs were sorted and used to stimulate
OVA-specific transgenic CD4+ T cells OTII in the presence of
titrated amount of OVA peptide. Cell proliferation was analyzed on
day 3 by examining CFSE division. For all experiments, duplicated
wells were analyzed for all conditions, and representative results
from three independent experiments are shown.
[0191] FIG. 16 depicts the surface expression level of VISTA
(PD-L3) in retrovirally transduced bone marrow derived DCs. Bone
marrow derived DCs (BMDC) were cultured in the presence of GM-CSF
(20 ng/mml) and transduced with either RFP or VISTA-RFP retrovirus
as described herein. On day 10, surface expression level of VISTA
were analyzed on cultured BMDCs, and compared to freshly-isolated
peritoneal macrophages.
[0192] FIGS. 17A-17B show that anti-PDL3 monoclonal antibody
exhibits efficacy in a passive transfer EAE model. In this adoptive
transfer EAE model, donor SJL mice were immunized with CFA and PLP
peptide. On day 10, total lymphocytes from draining LN were
isolated, and cultured in vitro with PLP peptide, IL-23 (20 ng/ml)
and anti-IFNg (10 .mu.g/ml) for 4 days. Expanded CD4 T cells were
then purified and adoptively transferred into naive recipient mice.
Disease progression was monitored and scored with: 0, no disease;
0.5 loss of tail tone; 1: limp tail; 2: limp tail+hind limb
paresis; 2.5: 1 hind limb paralysis; 3: both hind limb paralysis;
3.5: forelimb weakness; 4: hind limb paralysis+unilateral forelimb
paralysis. Mice were sacrificed when disease score reached 4.*,
mice were sacrificed.
[0193] FIG. 18 shows that VISTA expressed on antigen-presenting
cells suppressed CD4+ T cell proliferation.
[0194] FIG. 19 shows that an anti-VISTA antibody inhibited tumor
growth in mice transplanted with MB49 tumor cells.
[0195] FIGS. 20A-20E show the antitumor effect of VISTA monoclonal
antibodies in four different mouse anti-tumor models (FIG. 20A,
FIG. 20B, FIG. 20C and FIG. 20D). FIG. 20E shows the expression of
VISTA on different cells in the ID8 model. Very high expression on
the myeloid dendritic cells in different anatomic locations. As can
be seen, very high levels on myeloid dendritic cells in the ascites
cells, the site where the tumor grows and leukocytes
infiltrate.
[0196] FIG. 21 shows the potentiating effect of VISTA monoclonal
antibodies on the efficacy of a CD40/TLR agonist vaccine
(consisting of using an agonistic .alpha.CD40 mab, TLR agonist and
OVA peptide).
[0197] FIG. 22 shows VISTA expression on CNS cells in mice that are
healthy or in mice that are developing EAE.
[0198] FIGS. 23A-23C depict a sequence and structural analysis of
VISTA. (FIG. 23A) The primary amino acid sequence of mouse VISTA
with the Ig-V domain, the stalk segment, and the transmembrane
region highlighted in bold, italics, and Times New Roman,
respectively. Cysteines in the ectodomain region are indicated by
underlining. A comparative protein structure model of mouse VISTA
using PD-L1 as the template (Protein Data Bank accession no. 3BIS).
The five cysteine residues in the Ig-V domain are illustrated as
sticks. Based on this model, the VISTA Ig-V domain has the
canonical disulfide bond between the B and F strands, as well as
three additional cysteines, some of which can potentially form
inter- and intramolecular disulfide bonds. An additional invariant
cysteine is present in the stalk region following the G strand (not
depicted). The .beta. strands (A-G) are showed as flat arrows. The
C''-D loop is marked by an arrow. (FIG. 23B) Multiple sequence
alignment of the Ig-V domains of several B7 family members and
VISTA. The predicted secondary structure (using arrows, springs,
and "T"s for strands, helices, and .beta.-turns, respectively) is
marked above the alignment and is based on the VISTA structural
model. VISTA (SEQ ID NO: 15), PD1L1 (SEQ ID NO: 11), PD1L2 (SEQ ID
NO: 12), B7H4 (SEQ ID NO: 13), and B7H3 (SEQ ID NO: 14). (FIG. 23C)
Multiple sequence alignment of VISTA orthologues. Invariant
residues are represented by the red background, and
physico-chemically conserved positions are represented by red
letters. Conserved amino acids are marked by blue boxes.
Conservation is calculated on the basis of 36 VISTA orthologous
proteins, but only 9 representatives are shown. The canonical
cysteine pair (B and F strands) that is conserved in almost all Ig
superfamily members is highlighted by red circles, whereas
cysteines that are specific to VISTA are marked by blue circles.
The unique VISTA cysteine pattern is conserved in all orthologues
from mouse (SEQ ID NO: 17), human (SEQ ID NO: 16), kangaroo (SEQ ID
NO: 18), dolphin (SEQ ID NO: 19), chicken (SEQ ID NO: 20), xenopus
(SEQ ID NO: 21), zebra finch (SEQ ID NO: 22), zebrafish, and fugu
(SEQ ID NO: 23).
[0199] FIGS. 24A-24B depict that VISTA over expression on tumor
cells overcomes protective antitumor immunity. MCA105 tumor cells
over expressing VISTA or RFP control protein were generated by
retroviral transduction and sorted to homogeneity. To generate
protective immunity, naive mice were vaccinated with irradiated
MCA105 tumor cells subcutaneously on the left flank. (FIG. 24A)
Vaccinated mice were challenged 14 day later with live MCA105VISTA
or MCA105RFP tumor cells subcutaneously on the right flank. Tumor
growth was monitored every 2 d. Tumor size is shown as mean.+-.SEM.
Shown are representative results from three independent repeats.
(FIG. 24B) Vaccinated mice were either untreated or depleted of
both CD4.sup.+ and CD8.sup.+ T cells by monoclonal antibodies
before live tumor challenge. Tumor size was monitored as in A and
shown as mean.+-.SEM. Shown are representative results from two
independent repeats. For all experiments, ratios indicate the
number of tumor-bearing mice among total number of mice per group.
The statistical differences (p-values) were assessed with an
unpaired Mann-Whitney test.
[0200] FIGS. 25A-25D depicts that VISTA blockade using a specific
monoclonal antibody enhanced CD4.sup.+ T cell response in vitro and
in vivo. (FIG. 25A) A monoclonal antibody clone 13F3 neutralized
VISTA-mediated suppression in vitro. A20-RFP and A20-VISTA cells
were used to stimulate CFSE-labeled DO11.10 CD4.sup.+ T cells in
the presence of cognate OVA peptide. 20 .mu.g/ml VISTA-specific
monoclonal antibody 13F3 or control-Ig was added as indicated. CFSE
dilution was analyzed after 72 h, and percentages of CFSE.sup.low
cells are shown as mean.+-.SEM. Duplicated wells were analyzed for
all conditions. (FIGS. 25B and 25C) Total CD11b.sup.hi myeloid
cells (FIG. 25B) or CD11b-CD11c.sup.- monocytes (FIG. 25C) and
CD11b.sup.hiCD11c.sup.+ myeloid DCs (FIG. 25D) sorted from naive
splenocytes were irradiated and used to stimulate CFSE-labeled
OT-II transgenic CD4.sup.+ T cells in the presence of OVA peptide.
Cell proliferation was measured by incorporation of tritiated
thymidine during the last 8 h of a 72-h culture period and shown as
mean.+-.SEM. Triplicate wells were analyzed in all conditions.
[0201] FIG. 26 depicts VISTA-IgG2a reduces Experimental Autoimmune
Encephalomyelitis (EAE) (a model of multiple sclerosis)
progression. Mice were immunized with 175 .mu.g MOG/CFA and
pertussis toxin (PT) 300 ng (day 0, 2) to induce active EAE. On day
14, 17, and 20, 150 .mu.g VISTA-IgG 2a (n=8) or 150 .mu.g control
IgG2a (n=8) was administered. The data is shown as the
mean.+-.SEM.
[0202] FIG. 27 depicts the therapeutic effect of VISTA-IgG1 and
VISTA-IgG2a on Experimental Autoimmune Encephalomyelitis (EAE)
progression. Mice were immunized with 175 .mu.g MOG/CFA and
pertussis toxin (PT) 300 ng (day 0, 2) to induce active EAE. On day
6, mice were treated with 3 doses per week of 150 .mu.g control
IgG1 (n=3), 150 .mu.g control IgG2a (n=6), 150 .mu.g mVISTA-IgG1
(n=3), or 150 .mu.g mVISTA IgG2a (n=6) (two weeks in total). The
data is shown as the mean.+-.SEM.
[0203] FIG. 28 depicts the therapeutic effect of VISTA-IgG2a fusion
protein on Experimental Autoimmune Encephalomyelitis (EAE)
progression. Mice were immunized with 175 .mu.g MOG/CFA and
pertussis toxin (PT) 300 ng (day 0, 2) to induce active EAE. On day
14, mice were treated with 3 doses per week of PBS (n=6), 100 .mu.g
control IgG2a (n=6), 300 .mu.g control IgG2a (n=6), 100 .mu.g
VISTA-IgG2a (n=6), or 300 .mu.g mVISTA IgG2a (n=6) (two weeks in
total). The data is shown as the mean.+-.SEM.
[0204] FIGS. 29A-29B depicts the expression of VISTA healthy human
tissues was examined by real-time PCR analysis of a cDNA tissue
panel (Origene). (FIG. 29A) VISTA was predominantly expressed in
haematopoietic tissues or in tissues that contain significant
numbers of haematopoietic tissues. This is consistent with
importance of VISTA in immune related functions. (FIG. 29B) The
expression pattern of expression was found to follow a similar
trend to that of VISTA's closest homologue PD-L1.
[0205] FIG. 30 depicts VISTA protein expression in monocytes,
dendritic cells and by approximately 20% of CD4 and CD8 T cells.
VISTA expression was observed within both of the `patrolling`
(CD14.sup.dimCD16.sup.+) and `inflammatory`
(CD14.sup.+CD16.sup.+/-) subsets of blood monocytes, and within
both lymphoid and myeloid subsets of dendritic cell.
[0206] FIGS. 31A-31D depicts the suppression of CFSE dilution of
bulk purified CD4 (FIG. 31A) and CD8 (FIG. 31B) T cells. An Ig
fusion protein was created, consisting of the extracellular domain
of VISTA and the Fc region of human IgG containing mutations for
reduced Fc receptor binding. 10 .mu.g/ml of VISTA-Ig or control Ig
was immobilized on plates along with 2.5 .mu.g/ml of anti-CD3
(OKT3) and then proliferation was measured by CFSE dilution.
[0207] FIGS. 32A-32B depict the titration of human VISTA-Ig and
human VISTA-Ig over different concentrations of OKT3, showing that
higher concentrations of OKT3 can be overcome by higher
concentrations of VISTA
[0208] FIGS. 33A-33D depict the status of cells was examined
following activation in the presence or absence of VISTA-Ig. During
2 days of culture, upregulation by anti-CD3 of the early activation
markers CD25 and CD69 was blocked by VISTA-Ig (FIGS. 33A &
33B). Similarly, after 5 days of culture, the shift from expression
of CD45RA to CD45RO, indicative of antigen-experience was prevented
(FIG. 33C). VISTA had no affect on cell viability. FIG. 34D shows
that VISTA-Ig increased FoxP3 conversion.
[0209] FIGS. 34A-34B depict the suppression induced by VISTA where
cells were cultured on anti-CD3 and VISTA-Ig for two days, and then
moved onto anti-CD3 alone for 3 days. This further stimulation was
unable to rescue suppression (FIGS. 34A and 34B.)
[0210] FIGS. 35A-35B shows that VISTA-Ig significantly reduced
production of IL-10, TNF.alpha. and IFN.gamma. by CD4 (FIG. 35A)
and CD8 (FIG. 35B) T cells, and there was a trend towards a modest
decrease in IL-17 production.
[0211] FIGS. 36A, 36B and 36C show that anti-CD28 agonistic
antibody provides potent costimulation to T cells, and so titred
into the cultures to challenge VISTA suppression.
[0212] FIG. 37 shows the flow gating assay used in Example 32
infra.
[0213] FIG. 38 shows the results of the in vitro T cell
proliferation assay used in Example 32 infra
[0214] FIGS. 39A-39C shows the effect of linker flexibility on
VISTA-Ig activity on CFSE labeled human T cells which were cultured
for 5 days in the presence of 2.5 ug/ml plate-bound anti-CD3 and
either control Ig or VISTA-Ig. (FIG. 39A) huVISTA-Ig from sequence
1. (FIG. 39B) huVISTA-Ig from sequence 2 lacking a flexible linker.
(FIG. 39C) huVISTA-Ig from sequence 3 with a serine/glycine
linker.
[0215] FIGS. 40A, 40B, 40C and 40D contain prophylaxis studies
NZBWF1 female mice were treated from 8 weeks of age with PBS, 150
ug control-IgG2a or mVISTA-IgG2a every other day. Treatment was
initiated at week 24 for therapeutic studies. Disease severity was
monitored weekly by weight loss and proteinuria. Data is shown as
the mean.+-.SEM. Statistical significance was determined between
control-IgG2a vs mVISTA-IgG2a; p=0.0027 (prophylactic) and p=0.0156
(therapeutic) by the unpaired Mann Whitney test.
[0216] FIGS. 41A-41D contain representative H&E-stained high
power sections of kidneys of individual glomeruli from: FIG. 41A.
Historical normal BW glomerulus. FIG. 41B. VISTA-Ig-treated mouse
with moderate glomerular inflammation; FIG. 41C. Control Ig-treated
mice with intense inflammation and congestion; FIG. 41D. Another
control Ig-treated mouse with near-complete obliteration of
glomerulus.
[0217] FIG. 42 contains the results of experiments in an EAE animal
model that show the therapeutic effect of VISTA-IgG2a in active
EAE.
[0218] FIGS. 43A-43B contain the results of experiments in an SLE
animal model that show the prophylactic effect of mVISTA-IgG2a in
preventing SLE onset.
[0219] FIGS. 44A-44B contain the results of experiments in an SLE
animal model that show that prophlactic administration of
mVISTA-IgG2a reduces proteinuria and enhances survival.
[0220] FIG. 45 contains data which show the heightened
susceptibility to EAE in TCR Tg/VISTA-/- mice.
[0221] FIG. 46 contains data which show the heightened IgG
autoantibody in female VISTA KO mice.
[0222] FIG. 47 contains experimental data which show the increased
myelopoiesis in RAG-/- VISTA-/- mice.
[0223] FIG. 48 contains experimental data which show the
inflammatory phenotype of VISTA-/- mice
[0224] FIG. 49 shows tolerance and sensitization to OVA both
increases Foxp3.sup.+ Treg in target tissue and activates Treg in
draining lymph node. Mice were sensitized with OVA/alum adjuvant,
given OVA alone (tolerised) or PBS treated. On days 7, 10,11, and
12 intranasal dosing with 50 .mu.g OVA or PBS was performed. Lung
and draining lymph node cells were stained for intranuclear Foxp3
or surface GARP on day 13, n=5.
[0225] FIG. 50 shows that lung Treg is unresponsive to allergen.
Mice were immunized with OVA/alum adjuvant (sensitized), OVA alone
(tolerised) or PBS treated throughout as in FIG. 49. On day 13 lung
and draining lymph node cells were labeled with CFSE and cultured
in the presence of allergen for 4 days, followed by intranuclear
Foxp3 staining. Similar data were obtained in several independent
experiments.
[0226] FIG. 51 shows Helios expression in Foxp3.sup.+ Treg is
reduced in inflamed tissue but not in draining lymph node. Lung and
lymph node cells as in FIG. 2 were stained for intranuclear Helios
expression.
[0227] FIG. 52 shows that VISTA is highly expressed on alveolar
macrophages during both tolerance induction and allergen
sensitization. Mice were given 4 i.n. doses of allergen alone (OVA,
tolerised) or allergen plus a mucosal adjuvant (OVA+TNF-alpha) to
induce lung inflammation. 24 hours after the final challenge BAL or
lung tissue cells were stained with a monoclonal VISTA Ab and for
markers of macrophage/DC (I-Ab.sup.+CD11c.sup.+) or lymphocytes
(CD3.sup.+/B220.sup.+). Similar data were obtained in 2 independent
experiments.
[0228] FIG. 53 shows that Immobilized VISTA-Ig fusion protein
promotes TGF-.beta.-mediated induction of Foxp3-expressing Treg in
vitro. Sorted Foxp3GFP-CD25-naive CD4+ T cells from Foxp3-reporter
mice were cultured with plate-bound anti-CD3 (5
.mu.g/ml).+-.TGF-.beta. (1 ng/ml) and either control-Ig or VISTA-Ig
(2.5 .mu.g/mL) as indicated. Cells were examined after 72 hrs for
the induction of Foxp3-expressing cells.
[0229] FIG. 54 schematically depicts phosphoblot assays used to
assay effect of VISTA on different signaling pathways.
[0230] FIG. 55 contains phosphoblot of pERK activities at different
timepoints after CD3 stimulation.
[0231] FIG. 56 contains loading control at same timepoints as in
FIG. 55.
[0232] FIG. 57 contains data indicating that VISTA selectively
inhibits ERK1/2 activation.
[0233] FIG. 58 contains data indicating that VISTA does not inhibit
JNK activation.
[0234] FIG. 59A and FIG. 59B contains the results of human and
murine MLR experiments indicating that both human and mouse
VISTA-Ig suppress human and mouse MLR responses.
[0235] FIG. 60A and FIG. 60B contain data indicating that the
administration of VISTA-IgG2a in NZBWF1 mice does not alter
cellular frequencies of inflammatory monocytes and T cells.
[0236] FIG. 61 contains data showing II-17 levels in 20 week NZBWF1
mice treated with VISTA-IgG2a.
[0237] FIG. 62 and FIG. 63 contain the cytokine profile of 24 week
old NZBWF1 mice in SLE therapeutic study.
DETAILED DESCRIPTION OF THE INVENTION
[0238] In order that the invention herein described may be fully
understood, the following detailed description is set forth.
Various embodiments of the invention are described in detail and
may be further illustrated by the provided examples.
Definitions
[0239] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as those commonly understood by
one of ordinary skill in the art to which this invention belongs.
Although methods and materials similar or equivalent to those
described herein may be used in the invention or testing of the
present invention, suitable methods and materials are described
herein. The materials, methods and examples are illustrative only,
and are not intended to be limiting.
[0240] As used in the description herein and throughout the claims
that follow, the meaning of "a," "an," and "the" includes plural
reference unless the context clearly dictates otherwise.
[0241] "Activating receptor," as used herein, refers broadly to
immune cell receptors that bind antigen, complexed antigen (e.g.,
in the context of MHC molecules), Ig-fusion proteins, ligands, or
antibodies. Activating receptors but are not limited to T cell
receptors (TCRs), B cell receptors (BCRs), cytokine receptors, LPS
receptors, complement receptors, and Fc receptors. For example, T
cell receptors are present on T cells and are associated with CD3
molecules. T cell receptors are stimulated by antigen in the
context of MHC molecules (as well as by polyclonal T cell
activating reagents). T cell activation via the TCR results in
numerous changes, e.g., protein phosphorylation, membrane lipid
changes, ion fluxes, cyclic nucleotide alterations, RNA
transcription changes, protein synthesis changes, and cell volume
changes.
[0242] "Antigen presenting cell," as used herein, refers broadly to
professional antigen presenting cells (e.g., B lymphocytes,
monocytes, dendritic cells, and Langerhans cells) as well as other
antigen presenting cells (e.g., keratinocytes, endothelial cells,
astrocytes, fibroblasts, and oligodendrocytes).
[0243] "Amino acid," as used herein refers broadly to naturally
occurring and synthetic amino acids, as well as amino acid analogs
and amino acid mimetics that function in a manner similar to the
naturally occurring amino acids. Naturally occurring amino acids
are those encoded by the genetic code, as well as those amino acids
that are later modified (e.g., hydroxyproline,
.gamma.-carboxyglutamate, and O-phosphoserine.) Amino acid analogs
refers to compounds that have the same basic chemical structure as
a naturally occurring amino acid (i.e., an a carbon that is bound
to a hydrogen, a carboxyl group, an amino group), and an R group
(e.g., homoserine, norleucine, methionine sulfoxide, methionine
methyl sulfonium.) Analogs may have modified R groups (e.g.,
norleucine) or modified peptide backbones, but retain the same
basic chemical structure as a naturally occurring amino acid. Amino
acid mimetics refers to chemical compounds that have a structure
that is different from the general chemical structure of an amino
acid, but that functions in a manner similar to a naturally
occurring amino acid.
[0244] "Anergy" or "tolerance," as used herein, refers broadly to
refractivity to activating receptor-mediated stimulation.
Refractivity is generally antigen-specific and persists after
exposure to the tolerizing antigen has ceased.
[0245] "Antibody", as used herein, refers broadly to an
"antigen-binding portion" of an antibody (also used interchangeably
with "antibody portion," "antigen-binding fragment," "antibody
fragment"), as well as whole antibody molecules. The term
"antigen-binding portion", as used herein, refers to one or more
fragments of an antibody that retain the ability to specifically
bind to an antigen (e.g, VISTA (PD-L3)). The antigen-binding
function of an antibody can be performed by fragments of a
full-length antibody. Examples of antigen-binding fragments
encompassed within the term "antigen-binding portion" of an
antibody include (a) a Fab fragment, a monovalent fragment
consisting of the VL, VH, CL and CH1 domains; (b) a F(ab').sub.2
fragment, a bivalent fragment comprising two Fab fragments linked
by a disulfide bridge at the hinge region; (c) a Fd fragment
consisting of the VH and CH1 domains; (d) a Fv fragment consisting
of the VL and VH domains of a single arm of an antibody; (e) a dAb
fragment (Ward, et al. (1989) Nature 341: 544-546), which consists
of a VH domain; and (f) an isolated complimentarily determining
region (CDR). Furthermore, although the two domains of the Fv
fragment, VL and VH, are coded for by separate genes, they can be
joined, using recombinant methods, by a synthetic linker that
enables them to be made as a single protein chain in which the VL
and VH regions pair to form monovalent molecules (known as single
chain Fv (scFv). See e.g., Bird, et al. (1988) Science 242:
423-426; Huston, et al. (1988) Proc Natl. Acad. Sci. USA 85:
5879-5883; and Osbourn, et al. (1998) Nat. Biotechnol. 16: 778.
Single chain antibodies are also intended to be encompassed within
the term "antigen-binding portion" of an antibody. Any VH and VL
sequences of specific scFv can be linked to human immunoglobulin
constant region cDNA or genomic sequences, in order to generate
expression vectors encoding complete IgG molecules or other
isotypes. VH and Vl can also be used in the generation of Fab, Fv,
or other fragments of immunoglobulins using either protein
chemistry or recombinant DNA technology. Other forms of single
chain antibodies, such as diabodies are also encompassed. Diabodies
are bivalent, bispecific antibodies in which VH and VL domains are
expressed on a single polypeptide chain, but using a linker that is
too short to allow for pairing between the two domains on the same
chain, thereby forcing the domains to pair with complementary
domains of another chain and creating two antigen binding sites.
See e.g., Holliger, et al. (1993) Proc Natl. Acad. Sci. USA 90:
6444-6448; Poljak, et al. (1994) Structure 2: 1121-1123.
[0246] Still further, an antibody or antigen-binding portion
thereof (antigen-binding fragment, antibody fragment, antibody
portion) may be part of a larger immunoadhesion molecules, formed
by covalent or noncovalent association of the antibody or antibody
portion with one or more other proteins or peptides. Examples of
immunoadhesion molecules include use of the streptavidin core
region to make a tetrameric scFv molecule (Kipriyanov, et al.
(1995) Hum. Antibodies Hybridomas 6: 93-101) and use of a cysteine
residue, a marker peptide and a C-terminal polyhistidine tag to
make bivalent and biotinylated scFv molecules. Kipriyanov, et al.
(1994) Mol Immunol. 31: 1047-1058. Antibody portions, such as Fab
and F(ab')2 fragments, can be prepared from whole antibodies using
conventional techniques, such as papain or pepsin digestion,
respectively, of whole antibodies. Moreover, antibodies, antibody
portions and immunoadhesion molecules can be obtained using
standard recombinant DNA techniques, as described herein.
[0247] Antibodies may be polyclonal, monoclonal, xenogeneic,
allogeneic, syngeneic, or modified forms thereof, e.g., humanized,
chimeric. Preferably, antibodies of the invention bind specifically
or substantially specifically to VISTA (PD-L3) molecules. The terms
"monoclonal antibodies" and "monoclonal antibody composition", as
used herein, refer to a population of antibody molecules that
contain only one species of an antigen binding site capable of
immunoreacting with a particular epitope of an antigen, whereas the
term "polyclonal antibodies" and "polyclonal antibody composition"
refer to a population of antibody molecules that contain multiple
species of antigen binding sites capable of interacting with a
particular antigen. A monoclonal antibody composition, typically
displays a single binding affinity for a particular antigen with
which it immunoreacts.
[0248] "Antigen," as used herein, refers broadly to a molecule or a
portion of a molecule capable of being bound by an antibody which
is additionally capable of inducing an animal to produce an
antibody capable of binding to an epitope of that antigen. An
antigen may have one epitope, or have more than one epitope. The
specific reaction referred to herein indicates that the antigen
will react, in a highly selective manner, with its corresponding
antibody and not with the multitude of other antibodies which may
be evoked by other antigens. In the case of a desired enhanced
immune response to particular antigens of interest, antigens
include, but are not limited to, infectious disease antigens for
which a protective immune response may be elicited are
exemplary.
[0249] "Allergic disease," as used herein, refers broadly to a
disease involving allergic reactions. More specifically, an
"allergic disease" is defined as a disease for which an allergen is
identified, where there is a strong correlation between exposure to
that allergen and the onset of pathological change, and where that
pathological change has been proven to have an immunological
mechanism. Herein, an immunological mechanism means that leukocytes
show an immune response to allergen stimulation.
[0250] "Antisense nucleic acid molecule," as used herein, refers
broadly to a nucleotide sequence which is complementary to a
"sense" nucleic acid encoding a protein (e.g., complementary to the
coding strand of a double-stranded cDNA molecule) complementary to
an mRNA sequence or complementary to the coding strand of a gene.
Accordingly, an antisense nucleic acid molecule can hydrogen bond
to a sense nucleic acid molecule.
[0251] "Asthma," as used herein, refers broadly to a disorder of
the respiratory system characterized by inflammation, narrowing of
the airways and increased reactivity of the airways to inhaled
agents. Asthma is frequently, although not exclusively, associated
with atopic or allergic symptoms.
[0252] "Apoptosis," as used herein, refers broadly to programmed
cell death which can be characterized using techniques which are
known in the art. Apoptotic cell death can be characterized by cell
shrinkage, membrane blebbing, and chromatin condensation
culminating in cell fragmentation. Cells undergoing apoptosis also
display a characteristic pattern of internucleosomal DNA
cleavage.
[0253] "Autoimmunity" or "autoimmune disease or condition," as used
herein, refers broadly to a disease or disorder arising from and
directed against an individual's own tissues or a co-segregate or
manifestation thereof or resulting condition therefrom.
[0254] "B cell receptor" (BCR)," as used herein, refers broadly to
the complex between membrane Ig (mIg) and other transmembrane
polypeptides (e.g., Ig .alpha. and Ig .beta.) found on B cells. The
signal transduction function of mIg is triggered by crosslinking of
receptor molecules by oligomeric or multimeric antigens. B cells
can also be activated by anti-immunoglobulin antibodies. Upon BCR
activation, numerous changes occur in B cells, including tyrosine
phosphorylation.
[0255] "Cancer," as used herein, refers broadly to any neoplastic
disease (whether invasive or metastatic) characterized by abnormal
and uncontrolled cell division causing malignant growth or tumor
(e.g., unregulated cell growth.)
[0256] "Chimeric antibody," as used herein, refers broadly to an
antibody molecule in which the constant region, or a portion
thereof, is altered, replaced or exchanged so that the antigen
binding site (variable region) is linked to a constant region of a
different or altered class, effector function and/or species, or an
entirely different molecule which confers new properties to the
chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor,
drug, the variable region or a portion thereof, is altered,
replaced or exchanged with a variable region having a different or
altered antigen specificity.
[0257] "Coding region," as used herein, refers broadly to regions
of a nucleotide sequence comprising codons which are translated
into amino acid residues, whereas the term "noncoding region"
refers to regions of a nucleotide sequence that are not translated
into amino acids (e.g., 5' and 3' untranslated regions).
[0258] "Conservatively modified variants," as used herein, applies
to both amino acid and nucleic acid sequences, and with respect to
particular nucleic acid sequences, refers broadly to conservatively
modified variants refers to those nucleic acids which encode
identical or essentially identical amino acid sequences, or where
the nucleic acid does not encode an amino acid sequence, to
essentially identical sequences. Because of the degeneracy of the
genetic code, a large number of functionally identical nucleic
acids encode any given protein. "Silent variations" are one species
of conservatively modified nucleic acid variations. Every nucleic
acid sequence herein which encodes a polypeptide also describes
every possible silent variation of the nucleic acid. One of skill
will recognize that each codon in a nucleic acid (except AUG, which
is ordinarily the only codon for methionine, and TGG, which is
ordinarily the only codon for tryptophan) may be modified to yield
a functionally identical molecule.
[0259] "Complementarity determining region," "hypervariable
region," or "CDR," as used herein, refers broadly to one or more of
the hyper-variable or complimentarily determining regions (CDRs)
found in the variable regions of light or heavy chains of an
antibody. See Kabat, et al. (1987) "Sequences of Proteins of
Immunological Interest" National Institutes of Health, Bethesda,
Md. These expressions include the hypervariable regions as defined
by Kabat, et al. (1983) "Sequences of Proteins of Immunological
Interest" U.S. Dept. of Health and Human Services or the
hypervariable loops in 3-dimensional structures of antibodies.
Chothia and Lesk (1987) J Mol. Biol. 196: 901-917. The CDRs in each
chain are held in close proximity by framework regions and, with
the CDRs from the other chain, contribute to the formation of the
antigen binding site. Within the CDRs there are select amino acids
that have been described as the selectivity determining regions
(SDRs) which represent the critical contact residues used by the
CDR in the antibody-antigen interaction. Kashmiri (2005) Methods
36: 25-34.
[0260] "Control amount," as used herein, refers broadly to a marker
can be any amount or a range of amounts to be compared against a
test amount of a marker. For example, a control amount of a marker
may be the amount of a marker in a patient with a particular
disease or condition or a person without such a disease or
condition. A control amount can be either in absolute amount (e.g.,
microgram/ml) or a relative amount (e.g., relative intensity of
signals).
[0261] "Costimulatory receptor," as used herein, refers broadly to
receptors which transmit a costimulatory signal to an immune cell,
e.g., CD28 or ICOS. As used herein, the term "inhibitory receptors"
includes receptors which transmit a negative signal to an immune
cell.
[0262] "Costimulate," as used herein, refers broadly to the ability
of a costimulatory molecule to provide a second, non-activating,
receptor-mediated signal (a "costimulatory signal") that induces
proliferation or effector function. For example, a costimulatory
signal can result in cytokine secretion (e.g., in a T cell that has
received a T cell-receptor-mediated signal.) Immune cells that have
received a cell receptor-mediated signal (e.g., via an activating
receptor) may be referred to herein as "activated immune
cells."
[0263] "Cytoplasmic domain," as used herein, refers broadly to the
portion of a protein which extends into the cytoplasm of a
cell.
[0264] "Diagnostic," as used herein, refers broadly to identifying
the presence or nature of a pathologic condition. Diagnostic
methods differ in their sensitivity and specificity. The
"sensitivity" of a diagnostic assay is the percentage of diseased
individuals who test positive (percent of "true positives").
Diseased individuals not detected by the assay are "false
negatives." Subjects who are not diseased and who test negative in
the assay are termed "true negatives." The "specificity" of a
diagnostic assay is 1 minus the false positive rate, where the
"false positive" rate is defined as the proportion of those without
the disease who test positive. While a particular diagnostic method
may not provide a definitive diagnosis of a condition, it suffices
if the method provides a positive indication that aids in
diagnosis.
[0265] "Diagnosing," as used herein refers broadly to classifying a
disease or a symptom, determining a severity of the disease,
monitoring disease progression, forecasting an outcome of a disease
and/or prospects of recovery. The term "detecting" may also
optionally encompass any of the foregoing. Diagnosis of a disease
according to the present invention may, in some embodiments, be
affected by determining a level of a polynucleotide or a
polypeptide of the present invention in a biological sample
obtained from the subject, wherein the level determined can be
correlated with predisposition to, or presence or absence of the
disease. It should be noted that a "biological sample obtained from
the subject" may also optionally comprise a sample that has not
been physically removed from the subject.
[0266] "Effective amount," as used herein, refers broadly to the
amount of a compound, antibody, antigen, or cells that, when
administered to a patient for treating a disease, is sufficient to
effect such treatment for the disease. The effective amount may be
an amount effective for prophylaxis, and/or an amount effective for
prevention. The effective amount may be an amount effective to
reduce, an amount effective to prevent the incidence of
signs/symptoms, to reduce the severity of the incidence of
signs/symptoms, to eliminate the incidence of signs/symptoms, to
slow the development of the incidence of signs/symptoms, to prevent
the development of the incidence of signs/symptoms, and/or effect
prophylaxis of the incidence of signs/symptoms. The "effective
amount" may vary depending on the disease and its severity and the
age, weight, medical history, susceptibility, and pre-existing
conditions, of the patient to be treated. The term "effective
amount" is synonymous with "therapeutically effective amount" for
purposes of this invention.
[0267] "Extracellular domain," as used herein refers broadly to the
portion of a protein that extend from the surface of a cell.
[0268] "Expression vector," as used herein, refers broadly to any
recombinant expression system for the purpose of expressing a
nucleic acid sequence of the invention in vitro or in vivo,
constitutively or inducibly, in any cell, including prokaryotic,
yeast, fungal, plant, insect or mammalian cell. The term includes
linear or circular expression systems. The term includes expression
systems that remain episomal or integrate into the host cell
genome. The expression systems can have the ability to
self-replicate or not, i.e., drive only transient expression in a
cell. The term includes recombinant expression cassettes which
contain only the minimum elements needed for transcription of the
recombinant nucleic acid.
[0269] "Family," as used herein, refers broadly to the polypeptide
and nucleic acid molecules of the invention is intended to mean two
or more polypeptide or nucleic acid molecules having a common
structural domain or motif and having sufficient amino acid or
nucleotide sequence homology as defined herein. Family members can
be naturally or non-naturally occurring and can be from either the
same or different species. For example, a family can contain a
first polypeptide of human origin, as well as other, distinct
polypeptides of human origin or alternatively, can contain
homologues of non-human origin (e.g., monkey polypeptides.) Members
of a family may also have common functional characteristics.
[0270] "Fc receptor" (FcRs) as used herein, refers broadly to cell
surface receptors for the Fc portion of immunoglobulin molecules
(Igs). Fc receptors are found on many cells which participate in
immune responses. Among the human FcRs that have been identified so
far are those which recognize IgG (designated Fc.gamma.R), IgE
(Fc.epsilon.R1), IgA (Fc.alpha.R), and polymerized IgM/A
(Fc.mu..alpha.R). FcRs are found in the following cell types:
Fc.epsilon.RI (mast cells), Fc.epsilon. RII (many leukocytes),
Fc.alpha.R (neutrophils), and Fc.mu..alpha.R (glandular epithelium,
hepatocytes). Hogg (1988) Immunol. Today 9: 185-86. The widely
studied Fc.gamma.Rs are central in cellular immune defenses, and
are responsible for stimulating the release of mediators of
inflammation and hydrolytic enzymes involved in the pathogenesis of
autoimmune disease. Unkeless (1988) Annu. Rev. Immunol. 6: 251-87.
The Fc.gamma.Rs provide a crucial link between effector cells and
the lymphocytes that secrete Ig, since the macrophage/monocyte,
polymorphonuclear leukocyte, and natural killer (NK) cell Fc gamma
Rs confer an element of specific recognition mediated by IgG. Human
leukocytes have at least three different receptors for IgG:
hFc.gamma.RI (found on monocytes/macrophages), hFc.gamma.RII (on
monocytes, neutrophils, eosinophils, platelets, possibly B cells,
and the K562 cell line), and Fc.gamma.III (on NK cells,
neutrophils, eosinophils, and macrophages).
[0271] With respect to T cells, transmission of a costimulatory
signal to a T cell involves a signaling pathway that is not
inhibited by cyclosporin A. In addition, a costimulatory signal can
induce cytokine secretion (e.g., IL-2 and/or IL-10) in a T cell
and/or can prevent the induction of unresponsiveness to antigen,
the induction of anergy, or the induction of cell death in the T
cell.
[0272] "Framework region" or "FR," as used herein, refers broadly
to one or more of the framework regions within the variable regions
of the light and heavy chains of an antibody. See Kabat, et al.
(1987) "Sequences of Proteins of Immunological Interest" National
Institutes of Health, Bethesda, Md. These expressions include those
amino acid sequence regions interposed between the CDRs within the
variable regions of the light and heavy chains of an antibody.
[0273] "Heterologous," as used herein, refers broadly to portions
of a nucleic acid indicates that the nucleic acid comprises two or
more subsequences that are not found in the same relationship to
each other in nature. For instance, the nucleic acid is typically
recombinantly produced, having two or more sequences from unrelated
genes arranged to make a new functional nucleic acid (e.g., a
promoter from one source and a coding region from another source.)
Similarly, a heterologous protein indicates that the protein
comprises two or more subsequences that are not found in the same
relationship to each other in nature (e.g., a fusion protein).
[0274] "High affinity," as used herein, refers broadly to an
antibody having a KD of at least 10.sup.-8 M, more preferably at
least 10.sup.-9 M and even more preferably at least 10.sup.-10 M
for a target antigen. However, "high affinity" binding can vary for
other antibody isotypes. For example, "high affinity" binding for
an IgM isotype refers to an antibody having a KD of at least
10.sup.-7 M, more preferably at least 10.sup.-8 M.
[0275] "Homology," as used herein, refers broadly to a degree of
similarity between a nucleic acid sequence and a reference nucleic
acid sequence or between a polypeptide sequence and a reference
polypeptide sequence. Homology may be partial or complete. Complete
homology indicates that the nucleic acid or amino acid sequences
are identical. A partially homologous nucleic acid or amino acid
sequence is one that is not identical to the reference nucleic acid
or amino acid sequence. The degree of homology can be determined by
sequence comparison. The term "sequence identity" may be used
interchangeably with "homology."
[0276] "Host cell," as used herein, refers broadly to refer to a
cell into which a nucleic acid molecule of the invention, such as a
recombinant expression vector of the invention, has been
introduced. Host cells may be prokaryotic cells (e.g., E. coli), or
eukaryotic cells such as yeast, insect (e.g., SF9), amphibian, or
mammalian cells such as CHO, HeLa, HEK-293, e.g., cultured cells,
explants, and cells in vivo. The terms "host cell" and "recombinant
host cell" are used interchangeably herein. It should be understood
that such terms refer not only to the particular subject cell but
to the progeny or potential progeny of such a cell. Because certain
modifications may occur in succeeding generations due to either
mutation or environmental influences, progeny may not, in fact, be
identical to the parent cell, but are still included within the
scope of the term as used herein.
[0277] "Humanized antibody," as used herein, refers broadly to
include antibodies made by a non-human cell having variable and
constant regions which have been altered to more closely resemble
antibodies that would be made by a human cell. For example, by
altering the non-human antibody amino acid sequence to incorporate
amino acids found in human germline immunoglobulin sequences. The
humanized antibodies of the invention may include amino acid
residues not encoded by human germline immunoglobulin sequences
(e.g., mutations introduced by random or site-specific mutagenesis
in vitro or by somatic mutation in vivo), for example in the CDRs.
The term "humanized antibody", as used herein, also includes
antibodies in which CDR sequences derived from the germline of
another mammalian species, such as a mouse, have been grafted onto
human framework sequences.
[0278] "Hybridization," as used herein, refers broadly to the
physical interaction of complementary (including partially
complementary) polynucleotide strands by the formation of hydrogen
bonds between complementary nucleotides when the strands are
arranged antiparallel to each other.
[0279] "IgV domain" and "IgC domain" as used herein, refer broadly
to Ig superfamily member domains. These domains correspond to
structural units that have distinct folding patterns called Ig
folds. Ig folds are comprised of a sandwich of two beta sheets,
each consisting of antiparallel beta strands of 5-10 amino acids
with a conserved disulfide bond between the two sheets in most, but
not all, domains. IgC domains of Ig, TCR, and MHC molecules share
the same types of sequence patterns and are called the C1 set
within the Ig superfamily. Other IgC domains fall within other
sets. IgV domains also share sequence patterns and are called V set
domains. IgV domains are longer than C-domains and form an
additional pair of beta strands.
[0280] "Immune cell," as used herein, refers broadly to cells that
are of hematopoietic origin and that play a role in the immune
response. Immune cells include lymphocytes, such as B cells and T
cells; natural killer cells; and myeloid cells, such as monocytes,
macrophages, eosinophils, mast cells, basophils, and
granulocytes.
[0281] "Immunoassay," as used herein, refers broadly to an assay
that uses an antibody to specifically bind an antigen. The
immunoassay may be characterized by the use of specific binding
properties of a particular antibody to isolate, target, and/or
quantify the antigen.
[0282] "Immune response," as used herein, refers broadly to T
cell-mediated and/or B cell-mediated immune responses that are
influenced by modulation of T cell costimulation. Exemplary immune
responses include B cell responses (e.g., antibody production) T
cell responses (e.g., cytokine production, and cellular
cytotoxicity) and activation of cytokine responsive cells, e.g.,
macrophages. As used herein, the term "downmodulation" with
reference to the immune response includes a diminution in any one
or more immune responses, while the term "upmodulation" with
reference to the immune response includes an increase in any one or
more immune responses. It are understood that upmodulation of one
type of immune response may lead to a corresponding downmodulation
in another type of immune response. For example, upmodulation of
the production of certain cytokines (e.g., IL-10) can lead to
downmodulation of cellular immune responses.
[0283] "Inflammatory conditions or inflammatory disease," as used
herein, refers broadly to chronic or acute inflammatory
diseases.
[0284] "Inhibitory signal," as used herein, refers broadly to a
signal transmitted via an inhibitory receptor molecule on an immune
cell. A signal antagonizes a signal via an activating receptor
(e.g., via a TCR, CD3, BCR, or Fc molecule) and can result, e.g.,
in inhibition of: second messenger generation; proliferation; or
effector function in the immune cell, e.g., reduced phagocytosis,
antibody production, or cellular cytotoxicity, or the failure of
the immune cell to produce mediators (e.g., cytokines (e.g., IL-2)
and/or mediators of allergic responses); or the development of
anergy.
[0285] "Isolated," as used herein, refers broadly to material
removed from its original environment in which it naturally occurs,
and thus is altered by the hand of man from its natural
environment. Isolated material may be, for example, exogenous
nucleic acid included in a vector system, exogenous nucleic acid
contained within a host cell, or any material which has been
removed from its original environment and thus altered by the hand
of man (e.g., "isolated antibody"). For example, "isolated" or
"purified," as used herein, refers broadly to a protein, DNA,
antibody, RNA, or biologically active portion thereof, that is
substantially free of cellular material or other contaminating
proteins from the cell or tissue source from which the biological
substance is derived, or substantially free from chemical
precursors or other chemicals when chemically synthesized. The
language "substantially free of cellular material" includes
preparations of VISTA (PD-L3) protein in which the protein is
separated from cellular components of the cells from which it is
isolated or recombinantly produced.
[0286] "K-assoc" or "K.sub.a", as used herein, refers broadly to
the association rate of a particular antibody-antigen interaction,
whereas the term "K.sub.diss" or "K.sub.d," as used herein, refers
to the dissociation rate of a particular antibody-antigen
interaction. The term "K.sub.D", as used herein, is intended to
refer to the dissociation constant, which is obtained from the
ratio of K.sub.d to K.sub.a (i.e., K.sub.d/K.sub.a) and is
expressed as a molar concentration (M). K.sub.D values for
antibodies can be determined using methods well established in the
art.
[0287] "Label" or a "detectable moiety" as used herein, refers
broadly to a composition detectable by spectroscopic,
photochemical, biochemical, immunochemical, chemical, or other
physical means.
[0288] "Linker:" herein generally refers to a peptide sequence that
intervenes a VISTA polypeptide and another moiety, typically an Ig
protein, most typically an Ig Fc region, e.g., of human or murines
Igs, preferably it is that of human IgG1, IgG2, IgG3 or IgG4, which
optionally may be modified to reduce or increase FcR binding ad/or
complement binding and/or other effector functions. In an exemplary
embodiment the linker potentiates the immunosuppressive activity of
the VISTA fusion relative to a VISTA fusion wherein the VISTA is
directly linked to an Ig polypeptide. The linker may range in size
from at least about 5 amino acids, more typically at least 10-12,
13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35. 40 or more amino acids.
The linker in exemplary embodiments comprise glycine and serine
residues, and the number of such glycine/serine residues may
comprise at least 30, 40, 50, 60, 70, 80 or 90% of the residues
that constitute the linker. Exemplary linker sequences are
disclosed infra.
[0289] "Low stringency," "medium stringency," "high stringency," or
"very high stringency conditions," as used herein, refers broadly
to conditions for nucleic acid hybridization and washing. Guidance
for performing hybridization reactions can be found in Ausubel, et
al. (2002) Short Protocols in Molecular Biology (5.sup.th Ed.) John
Wiley & Sons, NY. Exemplary specific hybridization conditions
include but are not limited to: (1) low stringency hybridization
conditions in 6.times. sodium chloride/sodium citrate (SSC) at
about 45.degree. C., followed by two washes in 0.2.times.SSC, 0.1%
SDS at least at 50.degree. C. (the temperature of the washes can be
increased to 55.degree. C. for low stringency conditions); (2)
medium stringency hybridization conditions in 6.times.SSC at about
45.degree. C., followed by one or more washes in 0.2.times.SSC,
0.1% SDS at 60.degree. C.; (3) high stringency hybridization
conditions in 6.times.SSC at about 45.degree. C., followed by one
or more washes in 0.2.times.SSC, 0.1% SDS at 65.degree. C.; and (4)
very high stringency hybridization conditions are 0.5M sodium
phosphate, 7% SDS at 65.degree. C., followed by one or more washes
at 0.2.times.SSC, 1% SDS at 65.degree. C.
[0290] "Mammal," as used herein, refers broadly to any and all
warm-blooded vertebrate animals of the class Mammalia, including
humans, characterized by a covering of hair on the skin and, in the
female, milk-producing mammary glands for nourishing the young.
Examples of mammals include but are not limited to alpacas,
armadillos, capybaras, cats, camels, chimpanzees, chinchillas,
cattle, dogs, goats, gorillas, hamsters, horses, humans, lemurs,
llamas, mice, non-human primates, pigs, rats, sheep, shrews,
squirrels, tapirs, and voles. Mammals include but are not limited
to bovine, canine, equine, feline, murine, ovine, porcine, primate,
and rodent species. Mammal also includes any and all those listed
on the Mammal Species of the World maintained by the National
Museum of Natural History, Smithsonian Institution in Washington
D.C.
[0291] "Naturally-occurring nucleic acid molecule," as used herein,
refers broadly to refers to an RNA or DNA molecule having a
nucleotide sequence that occurs in nature (e.g., encodes a natural
protein).
[0292] "Nucleic acid" or "nucleic acid sequence," as used herein,
refers broadly to a deoxy-ribonucleotide or ribonucleotide
oligonucleotide in either single- or double-stranded form. The term
encompasses nucleic acids, i.e., oligonucleotides, containing known
analogs of natural nucleotides. The term also encompasses
nucleic-acid-like structures with synthetic backbones. Unless
otherwise indicated, a particular nucleic acid sequence also
implicitly encompasses conservatively modified variants thereof
(e.g., degenerate codon substitutions) and complementary sequences,
as well as the sequence explicitly indicated. The term nucleic acid
is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and
polynucleotide.
[0293] "Oligomerization domain", as used herein, refers broadly to
a domain that when attached to a VISTA extracellular domain or
fragment thereof, facilitates oligomerization. Said oligomerization
domains comprise self-associating .alpha.-helices, for example,
leucine zippers, that can be further stabilized by additional
disulfide bonds. The domains are designed to be compatible with
vectorial folding across a membrane, a process thought to
facilitate in vivo folding of the polypeptide into a functional
binding protein. Examples thereof are known in the art and include
by way of example coiled GCN4, and COMP.
[0294] The .alpha.-helical coiled coil is probably the most
widespread subunit oligomerization motif found in proteins.
Accordingly, coiled coils fulfill a variety of different functions.
In several families of transcriptional activators, for example,
short leucine zippers play an important role in positioning the
DNA-binding regions on the DNA. Ellenberger, et al. (1992) Cell 71:
1223-1237. Coiled coils are also used to form oligomers of
intermediate filament proteins. Coiled-coil proteins furthermore
appear to play an important role in both vesicle and viral membrane
fusion. Skehel and Wiley (1998) Cell 95: 871-874. In both cases
hydrophobic sequences, embedded in the membranes to be fused, are
located at the same end of the rod-shaped complex composed of a
bundle of long .alpha.-helices. This molecular arrangement is
believed to cause close membrane apposition as the complexes are
assembled for membrane fusion. The coiled coil is often used to
control oligomerization. It is found in many types of proteins,
including transcription factors include, but not limited to GCN4,
viral fusion peptides, SNARE complexes and certain tRNA
synthetases, among others. Very long coiled coils are found in
proteins such as tropomyosin, intermediate filaments and
spindle-pole-body components. Coiled coils involve a number of
.alpha.-helices that are supercoiled around each other in a highly
organized manner that associate in a parallel or an antiparallel
orientation, although dimers and trimers are the most common. The
helices may be from the same or from different proteins. The
coiled-coil is formed by component helices coming together to bury
their hydrophobic seams. As the hydrophobic seams twist around each
helix, so the helices also twist to coil around each other, burying
the hydrophobic seams and forming a supercoil. It is the
characteristic interdigitation of side chains between neighboring
helices, known as knobs-into-holes packing, that defines the
structure as a coiled coil. The helices do not have to run in the
same direction for this type of interaction to occur, although
parallel conformation is more common. Antiparallel conformation is
very rare in trimers and unknown in pentamers, but more common in
intramolecular dimers, where the two helices are often connected by
a short loop. In the extracellular space, the heterotrimeric
coiled-coil protein laminin plays an important role in the
formation of basement membranes. Other examples are the
thrombospondins and cartilage oligomeric matrix protein (COMP) in
which three (thrombospondins 1 and 2) or five (thrombospondins 3, 4
and COMP) chains are connected. The molecules have a flower
bouquet-like appearance, and the reason for their oligomeric
structure is probably the multivalent interaction of the C-terminal
domains with cellular receptors. The yeast transcriptional
activator GCN4 is 1 of over 30 identified eukaryotic proteins
containing the basic region leucine zipper (bZIP) DNA-binding
motif. Ellenberger, et al. (1992) Cell 71: 1223-1237. The bZIP
dimer is a pair of continuous alpha helices that form a parallel
coiled-coil over their carboxy-terminal 34 residues and gradually
diverge toward their amino termini to pass through the major groove
of the DNA binding site. The coiled-coil dimerization interface is
oriented almost perpendicular to the DNA axis, giving the complex
the appearance of the letter T. bZIP contains a 4-3 heptad repeat
of hydrophobic and nonpolar residues that pack together in a
parallel alpha-helical coiled-coil. Ellenberger, et al. (1992) Cell
71: 1223-1237. The stability of the dimer results from the
side-by-side packing of leucines and nonpolar residues in positions
a and d of the heptad repeat, as well as a limited number of intra-
and interhelical salt bridges, shown in a crystal structure of the
GCN4 leucine zipper peptide. Ellenberger, et al. (1992) Cell 71:
1223-1237. Another example is CMP (matrilin-1) isolated from bovine
tracheal cartilage as a homotrimer of subunits of Mr 52,000
(Paulsson & Heinegard (1981) Biochem J. 197: 367-375), where
each subunit consists of a vWFA1 module, a single EGF domain, a
vWFA2 module and a coiled coil domain spanning five heptads. Kiss,
et al. (1989) J. Biol. Chem. 264:8126-8134; Hauser and Paulsson
(1994) J. Biol. Chem. 269: 25747-25753. Electron microscopy of
purified CMP showed a bouquet-like trimer structure in which each
subunit forms an ellipsoid emerging from a common point
corresponding to the coiled coil. Hauser and Paulsson (1994) J.
Biol. Chem. 269: 25747-25753. The coiled coil domain in matrilin-1
has been extensively studied. The trimeric structure is retained
after complete reduction of interchain disulfide bonds under
non-denaturing conditions. Hauser and Paulsson (1994) J. Biol.
Chem. 269: 25747-25753. Yet another example is Cartilage Oligomeric
Matrix Protein (COMP). A non-collagenous glycoprotein, COMP, was
first identified in cartilage. Hedbom, et al. (1992) J. Biol. Chem.
267:6132-6136. The protein is a 524 kDa homopentamer of five
subunits which consists of an N-terminal heptad repeat region (cc)
followed by four epidermal growth factor (EGF)-like domains (EF),
seven calcium-binding domains (T3) and a C-terminal globular domain
(TC). According to this domain organization, COMP belongs to the
family of thrombospondins. Heptad repeats (abcdefg).sub.n with
preferentially hydrophobic residues at positions a and d
form-helical coiled-coil domains. Cohen and Parry (1994) Science
263: 488-489. Recently, the recombinant five-stranded coiled-coil
domain of COMP (COMPcc) was crystallized and its structure was
solved at 0.2 nm resolution. Malashkevich, et al. (1996) Science
274: 761-765.
[0295] "Operatively linked", as used herein, refers broadly to when
two DNA fragments are joined such that the amino acid sequences
encoded by the two DNA fragments remain in-frame.
[0296] "Paratope," as used herein, refers broadly to the part of an
antibody which recognizes an antigen (e.g., the antigen-binding
site of an antibody.) Paratopes may be a small region (e.g., 15-22
amino acids) of the antibody's Fv region and may contain parts of
the antibody's heavy and light chains. See Goldsby, et al. Antigens
(Chapter 3) Immunology (5.sup.th Ed.) New York: W.H. Freeman and
Company, pages 57-75.
[0297] "Patient," or "subject" as used herein, refers broadly to
any animal that is in need of treatment either to alleviate a
disease state or to prevent the occurrence or reoccurrence of a
disease state. Also, "Patient" as used herein, refers broadly to
any animal who has risk factors, a history of disease,
susceptibility, symptoms, signs, was previously diagnosed, is at
risk for, or is a member of a patient population for a disease. The
patient may be a clinical patient such as a human or a veterinary
patient such as a companion, domesticated, livestock, exotic, or
zoo animal. The term "subject" may be used interchangeably with the
term "patient."
[0298] "Polypeptide," "peptide" and "protein," are used
interchangeably and refer broadly to a polymer of amino acid
residues. The terms apply to amino acid polymers in which one or
more amino acid residue is an analog or mimetic of a corresponding
naturally occurring amino acid, as well as to naturally occurring
amino acid polymers. The terms apply to amino acid polymers in
which one or more amino acid residue is an artificial chemical
mimetic of a corresponding naturally occurring amino acid, as well
as to naturally occurring amino acid polymers and non-naturally
occurring amino acid polymer. Polypeptides can be modified, e.g.,
by the addition of carbohydrate residues to form glycoproteins. The
terms "polypeptide," "peptide" and "protein" include glycoproteins,
as well as non-glycoproteins.
[0299] "Promoter," as used herein, refers broadly to an array of
nucleic acid sequences that direct transcription of a nucleic acid.
As used herein, a promoter includes necessary nucleic acid
sequences near the start site of transcription, such as, in the
case of a polymerase II type promoter, a TATA element. A promoter
also optionally includes distal enhancer or repressor elements,
which can be located as much as several thousand base pairs from
the start site of transcription. A "constitutive" promoter is a
promoter that is active under most environmental and developmental
conditions. An "inducible" promoter is a promoter that is active
under environmental or developmental regulation.
[0300] "Prophylactically effective amount," as used herein, refers
broadly to the amount of a compound that, when administered to a
patient for prophylaxis of a disease or prevention of the
reoccurrence of a disease, is sufficient to effect such prophylaxis
for the disease or reoccurrence. The prophylactically effective
amount may be an amount effective to prevent the incidence of signs
and/or symptoms. The "prophylactically effective amount" may vary
depending on the disease and its severity and the age, weight,
medical history, predisposition to conditions, preexisting
conditions, of the patient to be treated.
[0301] "Prophylaxis," as used herein, refers broadly to a course of
therapy where signs and/or symptoms are not present in the patient,
are in remission, or were previously present in a patient.
Prophylaxis includes preventing disease occurring subsequent to
treatment of a disease in a patient. Further, prevention includes
treating patients who may potentially develop the disease,
especially patients who are susceptible to the disease (e.g.,
members of a patent population, those with risk factors, or at risk
for developing the disease).
[0302] "Recombinant" as used herein, refers broadly with reference
to a product, e.g., to a cell, or nucleic acid, protein, or vector,
indicates that the cell, nucleic acid, protein or vector, has been
modified by the introduction of a heterologous nucleic acid or
protein or the alteration of a native nucleic acid or protein, or
that the cell is derived from a cell so modified. Thus, for
example, recombinant cells express genes that are not found within
the native (non-recombinant) form of the cell or express native
genes that are otherwise abnormally expressed, under expressed or
not expressed at all.
[0303] "Signal sequence" or "signal peptide," as used herein,
refers broadly to a peptide containing about 15 or more amino acids
which occurs at the N-terminus of secretory and membrane bound
polypeptides and which contains a large number of hydrophobic amino
acid residues. For example, a signal sequence contains at least
about 10-30 amino acid residues, preferably about 15-25 amino acid
residues, more preferably about 18-20 amino acid residues, and even
more preferably about 19 amino acid residues, and has at least
about 35-65%, preferably about 38-50%, and more preferably about
40-45% hydrophobic amino acid residues (e.g., Valine, Leucine,
Isoleucine or Phenylalanine). A "signal sequence," also referred to
in the art as a "signal peptide," serves to direct a polypeptide
containing such a sequence to a lipid bilayer, and is cleaved in
secreted and membrane bound polypeptides.
[0304] "Specifically (or selectively) binds" to an antibody or
"specifically (or selectively) immunoreactive with," or
"specifically interacts or binds," as used herein, refers broadly
to a protein or peptide (or other epitope), refers, in some
embodiments, to a binding reaction that is determinative of the
presence of the protein in a heterogeneous population of proteins
and other biologics. For example, under designated immunoassay
conditions, the specified antibodies bind to a particular protein
at least two times greater than the background (non-specific
signal) and do not substantially bind in a significant amount to
other proteins present in the sample. Typically a specific or
selective reaction are at least twice background signal or noise
and more typically more than about 10 to 100 times background.
[0305] "Specifically hybridizable" and "complementary" as used
herein, refer broadly to a nucleic acid can form hydrogen bond(s)
with another nucleic acid sequence by either traditional
Watson-Crick or other non-traditional types. The binding free
energy for a nucleic acid molecule with its complementary sequence
is sufficient to allow the relevant function of the nucleic acid to
proceed, e.g., RNAi activity. Determination of binding free
energies for nucleic acid molecules is well known in the art. See,
e.g., Turner, et al. (1987) CSH Symp. Quant. Biol. LII: 123-33;
Frier, et al. (1986) PNAS 83: 9373-77; Turner, et al. (1987) J. Am.
Chem. Soc. 109: 3783-85. A percent complementarity indicates the
percentage of contiguous residues in a nucleic acid molecule that
can form hydrogen bonds (e.g., Watson-Crick base pairing) with a
second nucleic acid sequence (e.g., about at least 5, 6, 7, 8, 9,
10 out of 10 being about at least 50%, 60%, 70%, 80%, 90%, and 100%
complementary, inclusive). "Perfectly complementary" or 100%
complementarity refers broadly all of the contiguous residues of a
nucleic acid sequence hydrogen bonding with the same number of
contiguous residues in a second nucleic acid sequence. "Substantial
complementarity" refers to polynucleotide strands exhibiting about
at least 90% complementarity, excluding regions of the
polynucleotide strands, such as overhangs, that are selected so as
to be noncomplementary. Specific binding requires a sufficient
degree of complementarity to avoid non-specific binding of the
oligomeric compound to non-target sequences under conditions in
which specific binding is desired, i.e., under physiological
conditions in the case of in vivo assays or therapeutic treatment,
or in the case of in vitro assays, under conditions in which the
assays are performed. The non-target sequences typically may differ
by at least 5 nucleotides.
[0306] "Signs" of disease, as used herein, refers broadly to any
abnormality indicative of disease, discoverable on examination of
the patient; an objective indication of disease, in contrast to a
symptom, which is a subjective indication of disease.
[0307] "Solid support," "support," and "substrate," as used herein,
refers broadly to any material that provides a solid or semi-solid
structure with which another material can be attached including but
not limited to smooth supports (e.g., metal, glass, plastic,
silicon, and ceramic surfaces) as well as textured and porous
materials.
[0308] "Subjects" as used herein, refers broadly to anyone suitable
to be treated according to the present invention include, but are
not limited to, avian and mammalian subjects, and are preferably
mammalian. Any mammalian subject in need of being treated according
to the present invention is suitable. Human subjects of both
genders and at any stage of development (i.e., neonate, infant,
juvenile, adolescent, adult) can be treated according to the
present invention. The present invention may also be carried out on
animal subjects, particularly mammalian subjects such as mice,
rats, dogs, cats, cattle, goats, sheep, and horses for veterinary
purposes, and for drug screening and drug development purposes.
"Subjects" is used interchangeably with "patients."
[0309] "Substantially free of chemical precursors or other
chemicals," as used herein, refers broadly to preparations of VISTA
protein in which the protein is separated from chemical precursors
or other chemicals which are involved in the synthesis of the
protein. In one embodiment, the language "substantially free of
chemical precursors or other chemicals" includes preparations of
VISTA protein having less than about 30% (by dry weight) of
chemical precursors or non-VISTA chemicals, more preferably less
than about 20% chemical precursors or non-VISTA chemicals, still
more preferably less than about 10% chemical precursors or
non-VISTA chemicals, and most preferably less than about 5%
chemical precursors or non-VISTA (PD-L3) chemicals.
[0310] "Symptoms" of disease as used herein, refers broadly to any
morbid phenomenon or departure from the normal in structure,
function, or sensation, experienced by the patient and indicative
of disease.
[0311] "T cell," as used herein, refers broadly to CD4+ T cells and
CD8+ T cells. The term T cell also includes both T helper 1 type T
cells and T helper 2 type T cells.
[0312] "Therapy," "therapeutic," "treating," or "treatment", as
used herein, refers broadly to treating a disease, arresting, or
reducing the development of the disease or its clinical symptoms,
and/or relieving the disease, causing regression of the disease or
its clinical symptoms. Therapy encompasses prophylaxis, treatment,
remedy, reduction, alleviation, and/or providing relief from a
disease, signs, and/or symptoms of a disease. Therapy encompasses
an alleviation of signs and/or symptoms in patients with ongoing
disease signs and/or symptoms (e.g., inflammation, pain). Therapy
also encompasses "prophylaxis". The term "reduced", for purpose of
therapy, refers broadly to the clinical significant reduction in
signs and/or symptoms. Therapy includes treating relapses or
recurrent signs and/or symptoms (e.g., inflammation, pain). Therapy
encompasses but is not limited to precluding the appearance of
signs and/or symptoms anytime as well as reducing existing signs
and/or symptoms and eliminating existing signs and/or symptoms.
Therapy includes treating chronic disease ("maintenance") and acute
disease. For example, treatment includes treating or preventing
relapses or the recurrence of signs and/or symptoms (e.g.,
inflammation, pain).
[0313] "Transmembrane domain," as used herein, refers broadly to an
amino acid sequence of about 15 amino acid residues in length which
spans the plasma membrane. More preferably, a transmembrane domain
includes about at least 20, 25, 30, 35, 40, or 45 amino acid
residues and spans the plasma membrane. Transmembrane domains are
rich in hydrophobic residues, and typically have an alpha-helical
structure. In an embodiment, at least 50%, 60%, 70%, 80%, 90%, 95%
or more of the amino acids of a transmembrane domain are
hydrophobic, e.g., leucines, isoleucines, tyrosines, or
tryptophans. Transmembrane domains are described in, for example,
Zagotta, et al. (1996) Annu. Rev. Neurosci. 19:235-263.
[0314] "Transgenic animal," as used herein, refers broadly to a
non-human animal, preferably a mammal, more preferably a mouse, in
which one or more of the cells of the animal includes a
"transgene". The term "transgene" refers to exogenous DNA which is
integrated into the genome of a cell from which a transgenic animal
develops and which remains in the genome of the mature animal, for
example directing the expression of an encoded gene product in one
or more cell types or tissues of the transgenic animal.
[0315] "Tumor," as used herein, refers broadly to at least one cell
or cell mass in the form of a tissue neoformation, in particular in
the form of a spontaneous, autonomous and irreversible excess
growth, which is more or less disinhibited, of endogenous tissue,
which growth is as a rule associated with the more or less
pronounced loss of specific cell and tissue functions. This cell or
cell mass is not effectively inhibited, in regard to its growth, by
itself or by the regulatory mechanisms of the host organism, e.g.,
melanoma or carcinoma. Tumor antigens not only include antigens
present in or on the malignant cells themselves, but also include
antigens present on the stromal supporting tissue of tumors
including endothelial cells and other blood vessel components.
[0316] "Unresponsiveness," as used herein, refers broadly to
refractivity of immune cells to stimulation, e.g., stimulation via
an activating receptor or a cytokine. Unresponsiveness can occur,
e.g., because of exposure to immunosuppressants or high doses of
antigen.
[0317] "Variable region" or "VR," as used herein, refers broadly to
the domains within each pair of light and heavy chains in an
antibody that are involved directly in binding the antibody to the
antigen. Each heavy chain has at one end a variable domain
(V.sub.H) followed by a number of constant domains. Each light
chain has a variable domain (V.sub.L) at one end and a constant
domain at its other end; the constant domain of the light chain is
aligned with the first constant domain of the heavy chain, and the
light chain variable domain is aligned with the variable domain of
the heavy chain.
[0318] "Vector," as used herein, refers broadly to a nucleic acid
molecule capable of transporting another nucleic acid molecule to
which it has been linked. One type of vector is a "plasmid", which
refers to a circular double stranded DNA loop into which additional
DNA segments may be ligated. Another type of vector is a viral
vector, wherein additional DNA segments may be ligated into the
viral genome. Certain vectors are capable of autonomous replication
in a host cell into which they are introduced (e.g., bacterial
vectors having a bacterial origin of replication and episomal
mammalian vectors). Other vectors (e.g., non-episomal mammalian
vectors) are integrated into the genome of a host cell upon
introduction into the host cell, and thereby are replicated along
with the host genome. Moreover, certain vectors are capable of
directing the expression of genes to which they are operatively
linked. Vectors are referred to herein as "recombinant expression
vectors" or simply "expression vectors". In general, expression
vectors of utility in recombinant DNA techniques are often in the
form of plasmids. In the present specification, "plasmid" and
"vector" may be used interchangeably as the plasmid is the most
commonly used form of vector. However, the invention is intended to
include such other forms of expression vectors, such as viral
vectors (e.g., replication defective retroviruses, adenoviruses and
adeno-associated viruses), which serve equivalent functions. The
techniques and procedures are generally performed according to
conventional methods well known in the art and as described in
various general and more specific references that are cited and
discussed throughout the present specification. See, e.g.,
Sambrook, et al. (2001) Molec. Cloning: Lab. Manual [3.sup.rd Ed]
Cold Spring Harbor Laboratory Press. Standard techniques may be
used for recombinant DNA, oligonucleotide synthesis, and tissue
culture, and transformation (e.g., electroporation, lipofection).
Enzymatic reactions and purification techniques may be performed
according to manufacturer's specifications or as commonly
accomplished in the art or as described herein.
[0319] The nomenclatures utilized in connection with, and the
laboratory procedures and techniques of, analytical chemistry,
synthetic organic chemistry, and medicinal and pharmaceutical
chemistry described herein are those well known and commonly used
in the art. Standard techniques may be used for chemical syntheses,
chemical analyses, pharmaceutical preparation, formulation, and
delivery, and treatment of patients.
VISTA or PD-L3
[0320] This application relates to a novel, structurally-distinct,
Ig-superfamily inhibitory ligand designated as V-region
Immunoglobulin-containing Suppressor of T cell Activation (VISTA)
or PD-L3 that is selectively expressed on hematopoietic cells. The
extracellular domain bears homology to the B7 family ligand PD-L1,
and like PD-L1, VISTA has a profound impact on immunity. However,
unlike PD-L1, VISTA is selectively expressed within the
hematopoietic compartment. Expression is most prominent on myeloid
antigen-presenting cells (APCs), although expression on CD4.sup.+ T
cells, CD8.sup.+ T cells and higher expression on a subset of
Foxp3+ regulatory T cells (Treg) is also of significant interest. A
soluble VISTA-Ig fusion protein, or VISTA expression on APCs,
potently inhibits in vitro T cell proliferation, cytokine
production and induces Foxp3 expression in T cells. Conversely, a
newly developed anti-VISTA monoclonal antibody interfered with
VISTA-induced immune suppression of T cell responses by VISTA+ APCs
in vitro. Furthermore, in vivo anti-VISTA intensified the
development of the T cell mediated autoimmune disease experimental
allergic encephalomyelitis (EAE), and facilitated the development
of a protective, tumor-specific immune response with subsequent
tumor remission. Initial studies of VISTA-/- mice are revealing
early indications of spontaneous inflammatory disease, exhibit
inflammatory phenotype characterized e.g., by increased levels of
TNFalpha, IFNgamma, IL-17F, eotaxin, IP-10, MCP-1, and MIG, and
CD4+ and CD8+ T cells, they exhibit a heightened susceptible
susceptibility to autoimmunity such as EAE, increased expression of
IgG autoantibodies, increased myelopoiesis. Also, VISTA knockouts
show an increase of lymphocytic infiltrate in the lung, liver and
pancreas, follicular hyperplasia in the lung and spleen, neutrophil
infiltration in the stomach, with the kidneys, adrenal, esophagus,
small intestine, and colon not showing any perceptible changes.
[0321] Unlike all other PD-Ligand-related molecules (e.g., B7-H3,
H4, H6), VISTA is selectively expressed in hematopoietic cells,
together with its profound suppressive activities and unique
structural features, illustrates that VISTA is a novel,
functionally non-redundant, central negative regulator of immunity,
whose expression is primarily T cell and myeloid-restricted. See WO
2011/120013.
[0322] The best characterized costimulatory ligands are B7.1 and
B7.2 and they belong to the Ig superfamily which consists of many
critical immune regulators, such as the B7 family ligands and
receptors. Ig superfamily members are expressed on professional
antigen-presenting cells (APCs), and their receptors are CD28 and
CTLA-4. CD28 is expressed by naive and activated T cells and is
critical for optimal T-cell activation. In contrast, CTLA-4 is
induced following T-cell activation and inhibits T-cell activation
by binding to B7.1/B7.2, impairing CD28-mediated costimulation.
B7.1 and B7.2 knockout (KO) mice are impaired in adaptive immune
response, whereas CTLA-4 KO mice cannot adequately control
inflammation and develop systemic autoimmune diseases. Over time
the B7 family ligands have expanded to include costimulatory
ligands such as B7-H2 (ICOS Ligand) and B7-H3, and coinhibitory
ligands such as B7-H1 (PD-L1), B7-DC (PD-L2), B7-H4 (B7S1 or B7x),
and B7-H6. Accordingly, additional CD28 family receptors have been
identified. ICOS is expressed on activated T cells and binds to
B7-H2. ICOS is a positive co-regulator, important for T-cell
activation, differentiation and function. On the other hand,
Programmed Death 1 (PD-1) negatively regulates T cell responses.
PD-1 KO mice developed lupus-like autoimmune disease, or T dilated
cardiomyopathy. In contrast to VISTA, the two inhibitory B7 family
ligands, PD-L1 and PD-L2, have distinct expression patterns. PD-L2
is inducibly expressed on DCs and macrophages, whereas PD-L1 is
broadly expressed on both hematopoietic cells and nonhematopoietic
cell types. Consistent with the immune-suppressive role of PD-1
receptor, studies using PD-L1-/- and PD-L2-/- mice have shown that
both ligands have overlapping roles in inhibiting T-cell
proliferation and cytokine production. PD-L1 deficiency enhances
disease progression in both the non-obese diabetic (NOD) model of
autoimmune diabetes and the murine model of multiple sclerosis
(experimental autoimmune encephalomyelitis (EAE). PD-L1-/- T cells
produce elevated levels of the proinflammatory cytokines in both
disease models. In addition, studies in NOD mice have demonstrated
that the tissue expression of PD-L1 (i.e., within pancreas)
uniquely contributes to its capacity of regionally controlling
inflammation. PD-L1 is also highly expressed on placental
syncytiotrophoblasts, which critically control the maternal immune
responses to allogeneic fetus.
[0323] Anti-CTLA-4 antibodies show an enhanced therapeutic benefit
in murine models and clinical trials of melanoma. Mice vaccinated
with B16-GM-CSF (Gvax) promote the rejection of B16 melanomas when
combined with antibody blockade of CTLA-4. Antibodies to PD-1 as
well as PD-L1 also document enhanced anti-tumor immunity and host
survival in a wide range of murine tumor models. Finally, although
CTLA-4 and PD-1 belong to the same family of co-inhibitory
molecules, evidence suggests they use distinct nonredundant
mechanisms to inhibit T-cell activation, and there is synergy in
the ability of anti-CTLA-4 and anti-PD-1/L1 to enhance host
survival in murine melanoma when used in combination.
[0324] The immunoglobulin (Ig) superfamily consists of many
critical immune regulators, including the B7 family ligands and
receptors. VISTA is a novel and structurally distinct Ig
superfamily inhibitory ligand, whose extracellular domain bears
homology to the B7 family ligand PD-L1. This molecule is designated
V-domain Ig suppressor of T cell activation (VISTA). VISTA is
primarily expressed on hematopoietic cells, and VISTA expression is
highly regulated on myeloid antigen-presenting cells (APCs) and T
cells. A soluble VISTA-Ig fusion protein or VISTA expression on
APCs inhibits T cell proliferation and cytokine production in
vitro. A VISTA-specific monoclonal antibody interferes with
VISTA-induced suppression of T cell responses by VISTA-expressing
APCs in vitro. Furthermore, anti-VISTA treatment exacerbates the
development of the T cell-mediated autoimmune disease experimental
autoimmune encephalomyelitis in mice. Finally, VISTA over
expression on tumor cells interferes with protective antitumor
immunity in vivo in mice. These findings show that VISTA, a novel
immunoregulatory molecule, has functional activities that are
nonredundant with other Ig superfamily members and may play a role
in the development of autoimmunity and immune surveillance in
cancer. See Wang, et al. (2011) The Journal of Experimental
Medicine 208(3): 577-92.
[0325] Human VISTA (PD-L3) or VISTA was identified as an
upregulated molecule in a T cell transcriptional profiling screen.
Our characterization of an identical 930 bp gene product recovered
from a murine CD4.sup.+ T-cell cDNA library confirmed the size and
sequence. Silico-sequence and structural analysis predicts a type I
transmembrane protein of 309 amino acids upon maturation. Its
extracellular domain contains a single extracellular Ig-V domain of
136 amino acids, which is linked to a 23-amino acid stalk region, a
21-residue transmembrane segment, and a 97-amino acid cytoplasmic
domain. The cytoplasmic tail of VISTA does not contain any
signaling domains. A BLAST sequence search with the VISTA Ig-V
domain identified PD-L1 of the B7 family as the closest
evolutionarily related protein with a borderline significant
e-value score. A structure based sequence alignment of VISTA with
the B7 family members PD-L1, PD-L2, B7-H3, and B7-H4 highlights
several amino acids that are systematically conserved in all Ig-V
domain proteins.
[0326] The expression of VISTA appears to be selectively expressed
in the hematopoietic compartment and this protein is highly
expressed on mature myeloid cells (CD11b.sup.bright), with lower
levels of expression on CD4.sup.+ T cells, T.sup.reg and CD8.sup.+
T cells. Soluble VISTA proteins, e.g., soluble VISTA-Ig fusion
protein, or VISTA expression on APCs, suppresses in vitro CD4.sup.+
and CD8.sup.+ T cell proliferation and cytokine production. It is
also observed that anti-VISTA antibodies, e.g., an anti-VISTA
monoclonal antibody (13F3) blocked VISTA-induced suppression of T
cell responses by VISTA.sup.+ APCs in vitro. Also, it has been
discovered that an anti-VISTA monoclonal antibody exacerbated EAE
and increased the frequency of encephalitogenic Th17s in vivo.
Still further, the inventors surprisingly discovered that an
anti-VISTA monoclonal antibody induces tumor remission in multiple
murine tumor models. VISTA expression on myeloid derived suppressor
cells (MDSC) in these models is extremely high, suggesting that
VISTA.sup.+ MDSC suppress tumor specific immunity. VISTA exerts
immunosuppressive activities on T cells both in vitro and in vivo,
in mouse and in human (in vitro only) and is an important mediator
in controlling the development of autoimmunity and the immune
responses to cancer. Specifically, the data show that VISTA is a
new member of the Ig superfamily and contains an Ig-V domain with
distant sequence similarity to PD-L1. A VISTA-Ig fusion protein or
when over expressed on artificial APCs VISTA inhibits both mouse
and human CD4+ and CD8+ T cell proliferation and cytokine
production. Further, VISTA expression on myeloid APCs is inhibitory
for T cell responses in vitro.
[0327] VISTA expression on MDSC in the tumor microenvironment is
extremely high. Phenotypic and functional analysis of many cell
surface molecules previously suggested to be involved in
MDSC-mediated suppression of T cells: CD115, CD124, CD80, PD-L1,
and PD-L2 were expressed by MDSC but with no differences in the
levels of their expression or proportion of positive cells were
found between MDSC and cells from tumor-free mice that lack immune
suppressive activity. Therefore, VISTA is the primary B7 negative
regulator on MDSCs.
Antibody-Mediated VISTA Blockade Induces Protective Immunity to an
Autologous Tumor.
[0328] VISTA is a dominant, negative immune regulatory molecule on
MDSCs that interferes with the development of protective anti-tumor
immunity. Therefore, blocking the activity of this molecule with
anti-VISTA antibodies may be used to induce protective anti-tumor
immunity in mammals (e.g., humans).
[0329] Methods of using soluble VISTA proteins, e.g., fusion
proteins and multimeric VISTA proteins comprising multiple copies
of the VISTA extracellular domain or a fragment thereof, and VISTA
binding agents, e.g., small molecules and antibodies or fragments
thereof, which bind or modulate (agonize or antagonize) the
activity of VISTA as immune modulators and for the treatment of
different cancers, e.g., bladder, ovarian and lymphoma, autoimmune
disease, allergy, infection and inflammatory conditions, e.g.
multiple sclerosis and arthritis.
[0330] VISTA is a novel inhibitory ligand, which extracellular Ig-V
domain bears homology to the two known B7 family ligands Programmed
Death Ligand 1 and 2 (PD-L1 and PD-L2) and exhibits unique sequence
features and distinctive expression patterns in vitro and in vivo
on subsets of APCs and T cells,(which distinguishes PD-L3 or VISTA
from other B7 family ligands). VISTA has a functional impact on
CD4.sup.+ and CD8.sup.+ T cell proliferation and differentiation
(suppresses CD4.sup.- and CD8.sup.+ T cell proliferation, as well
as cytokine production). Based on its expression pattern and
inhibitory impact on T cells, PD-L3 or VISTA apparently functions
as a regulatory ligand that negatively regulates T cell responses
during cognate interactions between T cells and myeloid derived
APCs.
[0331] Although VISTA (PD-L3) appears to be a member of the B7
family of ligands, unlike other B7 family ligands, this molecule
contains only an Ig-V domain without an Ig-C domain, and is
phylogenically closer to the B7 family receptor Programmed Death-1
(PD-1). Based thereon, VISTA (PD-L3), and agonists or antagonists
specific thereto can be used to regulate T cell activation and
differentiation, and more broadly to modulate the regulatory
network that controls immune responses. In particular VISTA (PD-L3)
proteins and VISTA (PD-L3) agonists or antagonists, preferably
antibodies specific to VISTA (PD-L3) are useful in modulating
immune responses in autoimmunity, inflammatory responses and
diseases, allergy, cancer, infectious disease and
transplantation.
[0332] Anergy in T cells (as opposed to unresponsiveness) is
characterized by lack of cytokine production, e.g., IL-2. T cell
anergy occurs when T cells are exposed to antigen and receive a
first signal (a T cell receptor or CD-3 mediated signal) in the
absence of a second signal (a costimulatory signal). Under these
conditions, reexposure of the cells to the same antigen (even if
reexposure occurs in the presence of a costimulatory molecule)
results in failure to produce cytokines and, thus, failure to
proliferate. Anergic T cells can, however, mount responses to
unrelated antigens and can proliferate if cultured with cytokines
(e.g., IL-2). For example, T cell anergy can also be observed by
the lack of IL-2 production by T lymphocytes as measured by ELISA
or by a proliferation assay using an indicator cell line.
Alternatively, a reporter gene construct can be used. For example,
anergic T cells fail to initiate IL-2 gene transcription induced by
a heterologous promoter under the control of the 5' IL-2 gene
enhancer or by a multimer of the AP1 sequence that can be found
within the enhancer. Kang, et al. (1992) Science 257: 1134.
[0333] A VISTA (PD-L3) molecule of the present invention is
identified based on the presence of a "extracellular domain" in the
polypeptide or corresponding nucleic acid molecule. In another
embodiment, a VISTA (PD-L3) molecule of the present invention is
identified based on the presence of a "cytoplasmic domain" in the
polypeptide or corresponding nucleic acid molecule.
[0334] "Methods for modulating an immune cell response" herein
means contacting an immune cell in vitro or in vivo with a VISTA
protein, or binding agent specific thereto, in the presence of a
primary signal so that a response of the immune cell is modulated.
(Interaction of VISTA or a modulator thereof transmits a signal to
immune cells, regulating immune responses. VISTA (PD-L3) protein is
expressed at high levels on myeloid antigen presenting cells,
including myeloid dendritic cells (DCs) and macrophages, and at
lower densities on CD4+ and CD8+ T cells. Upon immune activation,
VISTA (PD-L3) expression is upregulated on myeloid APCs, but
downregulated on CD4+ T cells). Therefore, the VISTA (PD-L3)
nucleic acids and polypeptides of the present invention, and
agonists or antagonists thereof are useful, e.g., in modulating the
immune response.
[0335] As used interchangeably herein, "VISTA (PD-L3) activity",
"biological activity of VISTA (PD-L3)" or "functional activity of
VISTA (PD-L3)", refers to an activity exerted by a VISTA (PD-L3)
protein, polypeptide or nucleic acid molecule on a VISTA
(PD-L3)-responsive cell or tissue, or on a VISTA (PD-L3)
polypeptide binding partner, as determined in vivo, or in vitro,
according to standard techniques. These activities include
modulating CD4+ and CD8+ T cell proliferation and cytokine
production. In another embodiment, a VISTA (PD-L3) activity is a
direct activity, such as an association with a VISTA (PD-L3)
binding partner. As used herein, a "target molecule" or "binding
partner" is a molecule with which a VISTA (PD-L3) polypeptide binds
or interacts in nature, i.e., expressed on a T cell, such that
VISTA (PD-L3)-mediated function is achieved. Alternatively, a VISTA
(PD-L3) activity is an indirect activity, such as a cellular
signaling activity mediated by the VISTA (PD-L3) polypeptide. The
biological activities of VISTA (PD-L3) are described herein. For
example, the VISTA (PD-L3) polypeptides and VISTA (PD-L3) agonists
or antagonists of the present invention can have one or more of the
following activities: (1) suppresses or promotes CD4+ and CD8+ T
cell proliferation as well as memory and effector cells, (2)
suppresses or promotes cytokine production, especially suppresses
inflammatory ctytokines such as IL-6, TNF-alpha, gamma interferon,
a,MCP-1, eotaxin, IP-10, MIG, IL-17, and the like (3) functions as
a regulatory ligand that negatively regulates T cell responses
during cognate interactions between T cells and myeloid derived
APCs (4) negatively regulates CD4+ T cell responses by suppressing
early TCR activation and arresting cell division, but with minimum
direct impact on apoptosis, (5) suppresses or promotes
antigen-specific T cell activation during cognate interactions
between APCs and T cells and/or (6) suppresses or promotes T
cell-mediated immune responses; (7) modulate (increase or decrease)
activation of immune cells, e.g., T lymphocytes, (8) modulate
(increase or decrease) the immune response, e.g., inflammatory or
autoimmune or allergic immune response of an organism, e.g., a
mouse or human organism, (9) increase or decrease the expression of
activation markers on T cells such as CD44, (10) increase or
decrease myelopoiesis, and (11) inhibits or increases T cell or
neutrophilinfiltration and Th17s, (11) induce or inhibit Foxp3+
cells, (12) inhibit or increase follicular hyperplasia. By contrast
VISTA agonists such as VISTA-Ig do not affect B cell
proliferation.
[0336] "Isolated VISTA (PD-L3) proteins and polypeptides that
modulate one or more VISTA (PD-L3) activities". These polypeptides
will include VISTA (PD-L3) polypeptides having one or more of the
following domains: a signal peptide domain, an IgV domain, an
extracellular domain, a transmembrane domain, and a cytoplasmic
domain, and, preferably, a VISTA (PD-L3) activity.
[0337] Modulation of a costimulatory signal may result in
modulation of effector function of an immune cell. Thus, the term
"VISTA activity" includes the ability of a VISTA polypeptide to
bind its natural binding partner(s), the ability to modulate immune
cell costimulatory or inhibitory signals, and the ability to
modulate the immune response.
[0338] Modulation of an inhibitory signal in an immune cell results
in modulation of proliferation of and/or cytokine secretion by an
immune cell. For example, the family of VISTA (PD-L3) polypeptides
of the present invention preferably comprises least one "signal
peptide domain". As described infra a signal sequence was
identified in the amino acid sequence of native human VISTA (PD-L3)
and was also identified in the amino acid sequence of native mouse
VISTA (PD-L3).
[0339] Stimulation of VISTA (PD-L3) activity is desirable in
situations in which VISTA (PD-L3) is abnormally downregulated
and/or in which increased VISTA (PD-L3) activity is likely to have
a beneficial effect. Likewise, inhibition of VISTA (PD-L3) activity
is desirable in situations in which VISTA (PD-L3) is abnormally
upregulated and/or in which decreased VISTA (PD-L3) activity is
likely to have a beneficial effect. Exemplary agents for use in
downmodulating VISTA (PD-L3) (i.e., VISTA (PD-L3) antagonists)
include, e.g., antisense nucleic acid molecules, antibodies that
recognize and block VISTA (PD-L3), combinations of antibodies that
recognize and block VISTA (PD-L3) and antibodies that recognize and
block VISTA (PD-L3) counter receptors, and compounds that block the
interaction of VISTA (PD-L3) with its naturally occurring binding
partner(s) on an immune cell (e.g., soluble, monovalent VISTA
(PD-L3) molecules; soluble forms of VISTA (PD-L3) molecules that do
not bind Fc receptors on antigen presenting cells; soluble forms of
VISTA (PD-L3) binding partners; and compounds identified in the
subject screening assays). Exemplary agents for use in upmodulating
VISTA (PD-L3) (i.e., VISTA (PD-L3) agonists) include, e.g., nucleic
acid molecules encoding VISTA (PD-L3) polypeptides, multivalent
forms of VISTA (PD-L3), compounds that increase the expression of
VISTA (PD-L3), compounds that enhance the interaction of VISTA
(PD-L3) with its naturally occurring binding partners and cells
that express VISTA (PD-L3).
[0340] Depending upon the form of the VISTA (PD-L3) molecule that
binds to a receptor, a signal can be either transmitted (e.g., by a
multivalent form of a VISTA (PD-L3) molecule that results in
crosslinking of the receptor or by a soluble form of VISTA (PD-L3)
that binds to Fc receptors on antigen presenting cells) or
inhibited (e.g., by a soluble, monovalent form of a VISTA (PD-L3)
molecule or a soluble form of VISTA (PD-L3) that is altered using
methods known in the art such that it does not bind to Fc receptors
on antigen presenting cells), e.g., by competing with activating
forms of VISTA (PD-L3) molecules for binding to the receptor.
However, there are instances in which a soluble molecule can be
stimulatory. The effects of the various modulatory agents can be
easily demonstrated using routine screening assays as described
herein.
Downregulation of Immune Responses
[0341] Upregulating the inhibitory function of a VISTA (PD-L3)
polypeptide may be used to downregulate immune responses.
Downregulation can be in the form of inhibiting or blocking an
immune response already in progress, or may involve preventing the
induction of an immune response. The functions of activated immune
cells can be inhibited by downregulating immune cell responses or
by inducing specific anergy in immune cells, or both. For example,
VISTA (PD-L3) may bind to an inhibitory receptor, forms of VISTA
(PD-L3) that bind to the inhibitory receptor, e.g., multivalent
VISTA (PD-L3) on a cell surface, can be used to downmodulate the
immune response. An activating antibody may be used to stimulate
VISTA (PD-L3) activity is a bispecific antibody. For example, such
an antibody can comprise a VISTA (PD-L3) binding site and another
binding site which targets a cell surface receptor on an immune
cell, e.g., a T cell, a B cell, or a myeloid cell. Such an
antibody, in addition to comprising a VISTA (PD-L3) binding site,
can further comprise a binding site which binds to a B cell antigen
receptor, a T cell antigen receptor, or an Fc receptor, in order to
target the molecule to a specific cell population. Selection of
this second antigen for the bispecific antibody provides
flexibility in selection of cell population to be targeted for
inhibition. Agents that promote a VISTA (PD-L3) activity or which
enhance the interaction of VISTA (PD-L3) with its natural binding
partners (e.g., VISTA (PD-L3) activating antibodies or VISTA
(PD-L3) activating small molecules) can be identified by their
ability to inhibit immune cell proliferation and/or effector
function, or to induce anergy when added to an in vitro assay. For
example, cells can be cultured in the presence of an agent that
stimulates signal transduction via an activating receptor. A number
of art-recognized readouts of cell activation can be employed to
measure, e.g., cell proliferation or effector function (e.g.,
antibody production, cytokine production, phagocytosis) in the
presence of the activating agent. The ability of a test agent to
block this activation can be readily determined by measuring the
ability of the agent to affect a decrease in proliferation or
effector function being measured. In one embodiment, at low antigen
concentrations, VISTA (PD-L3) immune cell interactions inhibit
strong B7-CD28 signals. In another embodiment, at high antigen
concentrations, VISTA (PD-L3) immune cell interactions may reduce
cytokine production but not inhibit T cell proliferation.
Accordingly, the ability of a test compound to block activation can
be determined by measuring cytokine production and/or proliferation
at different concentrations of antigen.
[0342] Tolerance may be induced against specific antigens by
co-administering an antigen with a VISTA (PD-L3) agonist. For
example, tolerance may be induced to specific polypeptides. Immune
responses to allergens or foreign polypeptides to which an immune
response is undesirable can be inhibited. For example, patients
that receive Factor VIII frequently generate antibodies against
this clotting factor. Co-administration of an agent that stimulates
VISTA (PD-L3) activity or interaction with its natural binding
partner, with recombinant factor VIII (or physically linking VISTA
(PD-L3) to Factor VIII, e.g., by cross-linking) can result in
immune response downmodulation.
[0343] A VISTA (PD-L3) agonist and another agent that can block
activity of costimulatory receptors on an immune cell can be used
to downmodulate immune responses. Exemplary molecules include:
agonists forms of other PD ligands, soluble forms of CTLA-4,
anti-B7-1 antibodies, anti-B7-2 antibodies, or combinations
thereof. Alternatively, two separate peptides (for example, a VISTA
(PD-L3) polypeptide with blocking forms of B7-2 and/or B7-1
polypeptides), or a combination of antibodies (e.g., activating
antibodies against a VISTA (PD-L3) polypeptide with blocking
anti-B7-2 and/or anti-B7-1 monoclonal antibodies) can be combined
as a single composition or administered separately (simultaneously
or sequentially) to downregulate immune cell mediated immune
responses in a subject. Furthermore, a therapeutically active
amount of one or more peptides having a VISTA (PD-L3) polypeptide
activity, along with one or more polypeptides having B7-1 and/or
B7-1 activity can be used in conjunction with other downmodulating
reagents to influence immune responses. Examples of other
immunomodulating reagents include antibodies that block a
costimulatory signal (e.g., against CD28 or ICOS), antibodies that
activate an inhibitory signal via CTLA4, and/or antibodies against
other immune cell markers (e.g., against CD40, CD40 ligand, or
cytokines), fusion proteins (e.g., CTLA4-Fc or PD-1-Fc), and
immunosuppressive drugs (e.g., rapamycin, cyclosporine A, or
FK506). The VISTA (PD-L3) polypeptides may also be useful in the
construction of therapeutic agents which block immune cell function
by destruction of cells. For example, portions of a VISTA (PD-L3)
polypeptide can be linked to a toxin to make a cytotoxic agent
capable of triggering the destruction of cells to which it
binds.
[0344] Infusion of one or a combination of such cytotoxic agents
(e.g., VISTA (PD-L3) ricin (alone or in combination with
PD-L1-ricin), into a patient may result in the death of immune
cells, particularly in light of the fact that activated immune
cells that express higher amounts of VISTA (PD-L3) binding
partners. For example, because PD-1 is induced on the surface of
activated lymphocytes, a VISTA (PD-L3) polypeptide can be used to
target the depletion of these specific cells by Fc-R dependent
mechanisms or by ablation by conjugating a cytotoxic drug (e.g.,
ricin, saporin, or calicheamicin) to the VISTA (PD-L3) polypeptide
to kill cells that express a receptor for VISTA. A toxin can be
conjugated to an anti-VISTA (PD-L3) antibody in order to target for
death VISTA (PD-L3)-expressing antigen-presenting cell. In a
further embodiment, the VISTA (PD-L3)-antibody-toxin can be a
bispecific antibody. Such bispecific antibodies are useful for
targeting a specific cell population, e.g., using a marker found
only on a certain type of cell, e.g., B lymphocytes, monocytes,
dendritic cells, or Langerhans cells. Downregulating immune
responses by activating VISTA (PD-L3) activity or the VISTA
(PD-L3)- immune cell interaction (and thus stimulating the negative
signaling function of VISTA (PD-L3)) is useful in downmodulating
the immune response, e.g., in situations of tissue, skin and organ
transplantation, in graft-versus-host disease (GVHD), or allergies,
or in autoimmune diseases such as systemic lupus erythematosus and
multiple sclerosis. For example, blockage of immune cell function
results in reduced tissue destruction in tissue transplantation.
Typically, in tissue transplants, rejection of the transplant is
initiated through its recognition as foreign by immune cells,
followed by an immune reaction that destroys the transplant. The
administration of a molecule which promotes the activity of VISTA
(PD-L3) or the interaction of VISTA (PD-L3) with its natural
binding partner(s), on immune cells (such as a soluble, multimeric
form of a VISTA (PD-L3) polypeptide) alone or in conjunction with
another downmodulatory agent prior to or at the time of
transplantation can inhibit the generation of a costimulatory
signal. Moreover, promotion of VISTA (PD-L3) activity may also be
sufficient to anergize the immune cells, thereby inducing tolerance
in a subject.
[0345] To achieve sufficient immunosuppression or tolerance in a
subject, it may also be desirable to block the costimulatory
function of other molecules. For example, it may be desirable to
block the function of B7-1 and B7-2 by administering a soluble form
of a combination of peptides having an activity of each of these
antigens or blocking antibodies against these antigens (separately
or together in a single composition) prior to or at the time of
transplantation. Alternatively, it may be desirable to promote
inhibitory activity of VISTA (PD-L3) and inhibit a costimulatory
activity of B7-1 and/or B7-2. Other downmodulatory agents that can
be used in connection with the downmodulatory methods of the
invention include, for example, agents that transmit an inhibitory
signal via CTLA4, soluble forms of CTLA4, antibodies that activate
an inhibitory signal via CTLA4, blocking antibodies against other
immune cell markers, or soluble forms of other receptor ligand
pairs (e.g., agents that disrupt the interaction between CD40 and
CD40 ligand (e.g., anti CD40 ligand antibodies)), antibodies
against cytokines, or immunosuppressive drugs. For example,
activating VISTA (PD-L3) activity or the interaction of VISTA
(PD-L3) with its natural binding partner(s), is useful in treating
autoimmune disease. Many autoimmune disorders are the result of
inappropriate activation of immune cells that are reactive against
self tissue and which promote the production of cytokines and
autoantibodies involved in the pathology of the diseases.
Preventing the activation of autoreactive immune cells may reduce
or eliminate disease symptoms. Administration of agents that
promote activity of VISTA (PD-L3) (PD-L3) or VISTA interaction with
its natural binding partner(s), may induce antigen-specific
tolerance of autoreactive immune cells which could lead to
long-term relief from the disease. Additionally, co-administration
of agents which block costimulation of immune cells by disrupting
receptor-ligand interactions of B7 molecules with costimulatory
receptors may be useful in inhibiting immune cell activation to
prevent production of autoantibodies or cytokines which may be
involved in the disease process. The efficacy of reagents in
preventing or alleviating autoimmune disorders can be determined
using a number of well-characterized animal models of human
autoimmune diseases. Examples include murine experimental
autoimmune encephalitis, systemic lupus erythematosus in
MRL/lpr/lpr mice or NZB hybrid mice, murine autoimmune collagen
arthritis, diabetes mellitus in NOD mice and BB rats, and murine
experimental myasthenia gravis. See Paul ed., Fundamental
Immunology, Raven Press, New York, 1989, pages 840-856.
[0346] Inhibition of immune cell activation is useful
therapeutically in the treatment of allergies and allergic
reactions, e.g., by inhibiting IgE production. An agent that
promotes VISTA (PD-L3) activity or VISTA (PD-L3) interaction with
its natural binding partner(s) can be administered to an allergic
subject to inhibit immune cell-mediated allergic responses in the
subject. Stimulation VISTA (PD-L3) activity or interaction with its
natural binding partner(s), can be accompanied by exposure to
allergen in conjunction with appropriate MHC molecules. Allergic
reactions can be systemic or local in nature, depending on the
route of entry of the allergen and the pattern of deposition of IgE
on mast cells or basophils. Thus, immune cell-mediated allergic
responses can be inhibited locally or systemically by
administration of an agent that promotes VISTA (PD-L3) activity or
VISTA (PD-L3)- immune cell interactions.
[0347] Downregulation of an immune response via stimulation of
VISTA (PD-L3) activity or VISTA (PD-L3) interaction with its
natural binding partner(s), may also be useful in treating an
autoimmune attack of autologous tissues. Thus, conditions that are
caused or exacerbated by autoimmune attack (e.g., heart disease,
myocardial infarction or atherosclerosis) may be ameliorated or
improved by increasing VISTA (PD-L3) activity or VISTA (PD-L3)
biding to its natural binding partner. It is therefore within the
scope of the invention to modulate conditions exacerbated by
autoimmune attack, such as autoimmune disorders (as well as
conditions such as heart disease, myocardial infarction, and
atherosclerosis) by stimulating VISTA (PD-L3) activity or VISTA
(PD-L3) interaction with its counter receptor.
Upregulation of Immune Responses
[0348] Inhibition of VISTA (PD-L3) activity or VISTA (PD-L3)
interaction with its natural binding partner(s), as a means of
upregulating immune responses is also useful in therapy.
Upregulation of immune responses can be in the form of enhancing an
existing immune response or eliciting an initial immune response.
For example, enhancing an immune response through inhibition of
VISTA (PD-L3) activity is useful in cases of infections with
microbes, e.g., bacteria, viruses, or parasites, or in cases of
immunosuppression. For example, an agent that inhibits VISTA
(PD-L3) activity, e.g., a non-activating antibody (i.e., a blocking
antibody) against VISTA (PD-L3), or a soluble form of VISTA
(PD-L3), is therapeutically useful in situations where upregulation
of antibody and cell-mediated responses, resulting in more rapid or
thorough clearance of a virus, bacterium, or parasite, would be
beneficial. These conditions include viral skin diseases such as
Herpes or shingles, in which case such an agent can be delivered
topically to the skin. In addition, systemic viral diseases such as
influenza, the common cold, and encephalitis might be alleviated by
the administration of such agents systemically. In certain
instances, it may be desirable to further administer other agents
that upregulate immune responses, for example, forms of B7 family
members that transduce signals via costimulatory receptors, in
order further augment the immune response.
[0349] Immune responses may be enhanced in an infected patient by
removing immune cells from the patient, contacting immune cells in
vitro with an agent that inhibits the VISTA (PD-L3) activity or
VISTA (PD-L3) interaction with its natural binding partner(s), and
reintroducing the in vitro-stimulated immune cells into the
patient. In another embodiment, a method of enhancing immune
responses involves isolating infected cells from a patient, e.g.,
virally infected cells, transfecting them with a nucleic acid
molecule encoding a form of VISTA (PD-L3) that cannot bind its
natural binding partner(s), such that the cells express all or a
portion of the VISTA (PD-L3) molecule on their surface, and
reintroducing the transfected cells into the patient. The
transfected cells may be capable of preventing an inhibitory signal
to, and thereby activating, immune cells in vivo.
[0350] An agent that inhibits VISTA (PD-L3) activity or VISTA
(PD-L3) interaction with its natural binding partner(s), can be
used prophylactically in vaccines against various polypeptides,
e.g., polypeptides derived from pathogens. Immunity against a
pathogen, e.g., a virus, can be induced by vaccinating with a viral
polypeptide along with an agent that inhibits VISTA (PD-L3)
activity, in an appropriate adjuvant. Alternately, a vector
comprising genes which encode for both a pathogenic antigen and a
form of VISTA (PD-L3) that blocks VISTA (PD-L3) interaction with
immune cells can be used for vaccination. Nucleic acid vaccines can
be administered by a variety of means, for example, by injection
(e.g., intramuscular, intradermal, or the biolistic injection of
DNA-coated gold particles into the epidermis with a gene gun that
uses a particle accelerator or a compressed gas to inject the
particles into the skin. (Haynes, et al. (1996) J. Biotechnol.
44:37.) Alternatively, nucleic acid vaccines can be administered by
non-invasive means. For example, pure or lipid-formulated DNA can
be delivered to the respiratory system or targeted elsewhere, e.g.,
Peyers patches by oral delivery of DNA. Schubbert (1997) Proc Natl.
Acad. Sci. USA 94: 961. Attenuated microorganisms can be used for
delivery to mucosal surfaces. Sizemore et al. (1995) Science
270:29.
[0351] The antigen in the vaccine may be a self-antigen. Such a
vaccine is useful in the modulation of tolerance in an organism.
Immunization with a self antigen and an agent that blocks VISTA
(PD-L3) activity or VISTA (PD-L3) interaction with its natural
binding partner can break tolerance (i.e., interfere with tolerance
of a self antigen). Such a vaccine may also include adjuvants such
as alum or cytokines (e.g., GM-CSF, IL-12, B7-1, or B7-2). In one
embodiment, an agent which inhibits VISTA (PD-L3) activity or VISTA
(PD-L3) interaction with its natural binding partner(s), can be
administered with class I MHC polypeptides by, for example, a cell
transfected to coexpress a VISTA (PD-L3) polypeptide or blocking
antibody and MHC class I .alpha. chain polypeptide and .beta.2
microglobulin to result in activation of T cells and provide
immunity from infection. For example, viral pathogens for which
vaccines are useful include: hepatitis B, hepatitis C, Epstein-Barr
virus, cytomegalovirus, HIV-1, HIV-2, tuberculosis, malaria and
schistosomiasis.
[0352] Inhibition of VISTA (PD-L3) activity or VISTA (PD-L3)
interaction with its natural binding partner(s), can be useful in
the treatment of tumor immunity. Tumor cells (e.g., sarcoma,
melanoma, lymphoma, leukemia, neuroblastoma, or carcinoma) can be
transfected with a nucleic acid molecule that inhibits VISTA
(PD-L3) activity. These molecules can be, e.g., nucleic acid
molecules which are antisense to VISTA (PD-L3), or can encode
non-activating anti-VISTA (PD-L3) antibodies. These molecules can
also be the variable region of an anti-VISTA (PD-L3) antibody. If
desired, the tumor cells can also be transfected with other
polypeptides which activate costimulation (e.g., B7-1 or B7-2). The
transfected tumor cells are returned to the patient, which results
in inhibition (e.g., local inhibition) of VISTA (PD-L3) activity
Alternatively, gene therapy techniques can be used to target a
tumor cell for transfection in vivo.
[0353] Stimulation of an immune response to tumor cells can also be
achieved by inhibiting VISTA (PD-L3) activity or VISTA (PD-L3)
interaction with its natural binding partner(s), by treating a
patient with an agent that inhibits VISTA (PD-L3) activity or VISTA
(PD-L3) interaction with its natural binding partner(s). Preferred
examples of such agents include, e.g., antisense nucleic acid
molecules, antibodies that recognize and block VISTA (PD-L3), and
compounds that block the interaction of VISTA (PD-L3) with its
naturally occurring binding partner(s) on an immune cell (e.g.,
soluble, monovalent VISTA (PD-L3) molecules; soluble forms of VISTA
(PD-L3) molecules that do not bind to Fc receptors on antigen
presenting cells; soluble forms of VISTA (PD-L3) binding
partner(s); and compounds identified in the subject screening
assays). In addition, tumor cells which lack MHC class I or MHC
class II molecules, or which fail to express sufficient amounts of
MHC class I or MHC class II molecules, can be transfected with
nucleic acid encoding all or a portion of (e.g., a
cytoplasmic-domain truncated portion) of an MHC class I .alpha.
chain polypeptide and beta2 microglobulin polypeptide or an MHC
class II .alpha. chain polypeptide and an MHC class II .beta. chain
polypeptide to thereby express MHC class I or MHC class II
polypeptides on the cell surface. Expression of the appropriate
class I or class II MHC in conjunction with an VISTA (PD-L3)
inhibiting polypeptide or antisense nucleic acid induces a T cell
mediated immune response against the transfected tumor cell.
Optionally, a gene encoding an antisense construct which blocks
expression of an MHC class II-associated polypeptide, such as the
invariant chain, can also be cotransfected with a DNA encoding a
VISTA (PD-L3) inhibiting polypeptide or antisense nucleic acid to
promote presentation of tumor associated antigens and induce tumor
specific immunity. Expression of B7-1 by B7-negative murine tumor
cells has been shown to induce T cell mediated specific immunity
accompanied by tumor rejection and prolonged protection to tumor
challenge in mice. Chen, et al. (1992) Cell 71: 1093-1102; Townsend
& Allison (1993) Science 259: 368-370; Baskar, et al. (1993)
Proc Natl. Acad. Sci. 90: 5687-5690. Thus, the induction of an
immune cell-mediated immune response in a human subject can be
sufficient to overcome tumor-specific tolerance in the subject. In
another embodiment, the immune response can be stimulated by the
inhibition of VISTA (PD-L3) activity or VISTA (PD-L3) interaction
with its natural binding partner(s), such that preexisting
tolerance is overcome. For example, immune responses against
antigens to which a subject cannot mount a significant immune
response, e.g., tumor-specific antigens, can be induced by
administering an agent that inhibits the activity of VISTA (PD-L3)
activity or the ability of VISTA (PD-L3) to bind to its natural
binding partner, can be used as adjuvants to boost responses to
foreign antigens in the process of active immunization.
[0354] Immune cells may be obtained from a subject and cultured ex
vivo in the presence of an agent that that inhibits VISTA (PD-L3)
activity or VISTA (PD-L3) interaction with its natural binding
partner(s), to expand the population of immune cells. In a further
embodiment the immune cells are then administered to a subject.
Immune cells can be stimulated to proliferate in vitro by, for
example, providing the immune cells with a primary activation
signal and a costimulatory signal, as is known in the art. Various
forms of VISTA (PD-L3) polypeptides or agents that inhibit VISTA
(PD-L3) activity can also be used to costimulate proliferation of
immune cells. In one embodiment, immune cells are cultured ex vivo
according to the methods described in WO 94/29436. The
costimulatory molecule can be soluble, attached to a cell membrane
or attached to a solid surface, such as a bead.
[0355] In performing any of the methods described herein, it is
within the scope of the invention to upregulate an immune response
by administering one or more additional agents. For example, the
use of other agents known to stimulate the immune response, such as
cytokines, adjuvants, or stimulatory forms of costimulatory
molecules or their ligands can be used in conjunction with an agent
that inhibits VISTA (PD-L3) activity or VISTA (PD-L3) interaction
with its natural binding partner(s).
Identification of Cytokines Modulated by Modulation of VISTA
(PD-L3) Activity or VISTA (PD-L3)-Interactions with its Counter
Receptor on T cells
[0356] The VISTA (PD-L3) molecules described herein may be used to
identify cytokines which are produced by or whose production is
enhanced or inhibited in immune cells in response to modulation of
VISTA (PD-L3) activity or VISTA (PD-L3) interaction with its
natural binding partner(s), Immune cells may be suboptimally
stimulated in vitro with a primary activation signal, for example,
T cells can be stimulated with phorbol ester, anti-CD3 antibody or
preferably, antigen, in association with an MHC class II molecule,
and given a costimulatory signal, e.g., by a stimulatory form of B7
family antigen, for instance by a cell transfected with nucleic
acid encoding a B7 polypeptide and expressing the peptide on its
surface, or by a soluble, stimulatory form of the peptide. The
cells can then be contacted with cells expressing VISTA (PD-L3)
(e.g., antibodies against VISTA (PD-L3) Known cytokines released
into the media can be identified by ELISA or by the ability of an
antibody which blocks the cytokine to inhibit immune cell
proliferation or proliferation of other cell types that are induced
by the cytokine. For example, an IL-4 ELISA kit is available from
Genzyme (Cambridge, Mass.), as is an IL-7 blocking antibody.
Blocking antibodies against IL-9 and IL-12 are available from
Genetics Institute (Cambridge, Mass.). The effect of stimulating or
blocking VISTA (PD-L3) activity or the interaction of VISTA (PD-L3)
and its binding partner(s) on the cytokine profile can then be
determined. As noted supra and shown in the examples VISTA (PD-L3)
apparently suppresses the expression of IL-2 and gamma interferon
by immune cells.
[0357] An in vitro immune cell costimulation assay as described
above can also be used in a method for identifying novel cytokines
which can be modulated by modulation of VISTA (PD-L3) activity. For
example, where stimulation of the CD28/CTLA4 pathway seems to
enhance IL-2 secretion, stimulation of the ICOS pathway seems to
enhance IL-10 secretion. Hutloff, et al. (1999) Nature 397: 263. If
a particular activity induced upon costimulation, e.g., immune cell
proliferation, cannot be inhibited by addition of blocking
antibodies to known cytokines, the activity may result from the
action of an unknown cytokine. Following costimulation, this
cytokine can be purified from the media by conventional methods and
its activity measured by its ability to induce immune cell
proliferation.
[0358] To identify cytokines which may play a role the induction of
tolerance, an in vitro T cell costimulation assay as described
above can be used. In this case, T cells would be given the primary
activation signal and contacted with a selected cytokine, but would
not be given the costimulatory signal. After washing and resting
the immune cells, the cells would be rechallenged with both a
primary activation signal and a costimulatory signal. If the immune
cells do not respond (e.g., proliferate or produce cytokines) they
have become tolerized and the cytokine has not prevented the
induction of tolerance. However, if the immune cells respond,
induction of tolerance has been prevented by the cytokine. Those
cytokines which are capable of preventing the induction of
tolerance can be targeted for blockage in vivo in conjunction with
reagents which block B lymphocyte antigens as a more efficient
means to induce tolerance in transplant recipients or subjects with
autoimmune diseases. For example, one could administer a cytokine
blocking antibody to a subject along with an agent that promotes
VISTA (PD-L3) activity or VISTA (PD-L3) interaction with a binding
partner.
[0359] Thus, to summarize a novel member of the Programmed Death
Ligand (PDL) family has now been identified which is expressed by
Treg cells. This novel protein has been designated VISTA (PD-L3).
The receptors of this PD-L family are type I transmembrane proteins
containing a single IgV domain, while the ligands are type I
transmembrane proteins expressing both an IgV and an IgC
extracellular domains. Like other members of the PDL family, VISTA
(PD-L3) co-stimulates .alpha.CD3 proliferation of T cells in vitro.
In addition, the expression of VISTA (PD-L3) is increased in
.alpha.CD3 activated Treg and reduced in the presence of
.alpha.GITR.
[0360] A second, TNF-like, protein has also been identified as
being upregulated upon .alpha.CD.sup.3/.alpha.GITR stimulation.
This protein has been designated Treg-sTNF. These proteins may be
involved in contact-dependent and paracrine suppression of immunity
and therefore are useful for modulating (e.g., inhibiting or
stimulating) an immune response and in the treatment of diseases
and conditions involving Treg signaling. For example, the VISTA
(PD-L3) protein can be used as a co-stimulatory signal for
stimulating or enhancing immune cell activation. VISTA (PD-L3)
proteins and VISTA (PD-L3) binding agents and VISTA (PD-L3)
agonists and antagonists are especially useful in treating immune
conditions wherein regulation of T cell immunity is desired, e.g.,
modulation of T cell activation, differentiation and proliferation,
and in particular modulation of CD4+ and CD8+ T cell proliferation,
cytokine production, and T cell responses during cognate
interactions between T cells and myeloid derived APCs.
Vista and Vista Conjugate Polypeptides
[0361] The invention provides VISTA and VISTA conjugate
polypeptides. The inventors surprisingly discovered that VISTA and
VISTA conjugate polypeptides act as negative immune modulators.
Exemplary VISTA polypeptides are provided in SEQ ID NO: 2, 4, and
5. VISTA (PD-L3) molecules of the invention include at least one or
more of the following domains: a signal peptide domain, an IgV
domain, an extracellular domain, a transmembrane domain, or a
cytoplasmic domain. Isolated polypeptides of the present invention,
preferably VISTA (PD-L3) polypeptides, may comprise an amino acid
sequence sufficiently identical to the amino acid sequence of SEQ
ID NO: 2 or 4, or 5 or are encoded by a nucleotide sequence
sufficiently identical to SEQ ID NO: 1 or 3 or fragment or
complement thereof. As used herein, the term "sufficiently
identical" refers to a first amino acid or nucleotide sequence
which contains a sufficient or minimum number of identical or
equivalent (e.g., an amino acid residue which has a similar side
chain) amino acid residues or nucleotides to a second amino acid or
nucleotide sequence such that the first and second amino acid or
nucleotide sequences share common structural domains or motifs
and/or a common functional activity. For example, amino acid or
nucleotide sequences which share common structural domains have at
least 30%, 40%, or 50% homology, preferably 60% homology, more
preferably 70-80%, and even more preferably 90-95% homology across
the amino acid sequences of the domains and contain at least one
and preferably two structural domains or motifs, are defined herein
as sufficiently identical. Furthermore, amino acid or nucleotide
sequences which share at least 30%, 40%, or 50%, preferably 60%,
more preferably 70-80%, or 90-95% homology and share a common
functional activity are defined herein as sufficiently identical.
An extracellular domain of the VISTA polypeptide may comprise an
IgV domain and may include a signal peptide domain. See FIGS. 1A-1E
and 23A-23C.
[0362] VISTA (PD-L3) polypeptides may have at least one
extracellular domain, and one or more of a signal peptide domain,
an IgV domain, an transmembrane domain, and a cytoplasmic domain,
and are, preferably, encoded by a nucleic acid molecule having a
nucleotide sequence which hybridizes under stringent hybridization
conditions to a nucleic acid molecule comprising a complement of
the nucleotide sequence of SEQ ID NO: 1 or 3 herein. The nucleotide
and amino acid sequences sequence of the exemplified isolated human
and murine VISTA (PD-L3) cDNA and the predicted amino acid sequence
of the human VISTA (PD-L3) polypeptide are contained in the
sequence listing herein.
[0363] A VISTA (PD-L3) polypeptide of the present invention may be
identified based on the presence of a "transmembrane domain". The
transmembrane domain region of PDL3 are identified herein. See
e.g., FIGS. 1A-1E and 23A-23C. A VISTA (PD-L3) molecule of the
present invention may be identified based on the absence of an "IgC
domain" and the presence of an "IgV domain" in the polypeptide or
corresponding nucleic acid molecule. The amino acid residues of the
native human and murine VISTA (PD-L3) polypeptide, constituting the
IgV domain can be seen in FIGS. 1A-1E and 23A-23C. The presence of
an IgV domain is likely required for binding of VISTA (PD-L3) to
its natural binding partner(s).
[0364] Nucleic acids encoding VISTA polypeptides may be modified
using standard molecular biological techniques that result in
variants polypeptides comprising at least one VISTA and VISTA
conjugate including but not limited to deletions, additions and
substitutions in the amino acid sequence, that retain the specific
antigenicity of the VISTA and VISTA conjugate (e.g., the VISTA
polypeptides is bound by an anti-VISTA antibody). Additionally,
variant polypeptides comprising at least one VISTA polypeptide may
also retain the antigenicity of the VISTA polypeptide (e.g., raise
a specific immune response against the VISTA polypeptide and
variant VISTA polypeptide, respectively, upon immunization in a
subject). The VISTA and VISTA conjugate polypeptides may be
formulated with a pharmaceutical carrier to manufacture an antigen
composition useful as a "cancer vaccine" (e.g., a pharmaceutical
composition that elicits a specific immune response against the
VISTA and VISTA conjugate, that produces anti-tumor antibodies
after immunization in a subject). The VISTA polypeptides and VISTA
conjugates described herein may be used to treat autoimmune
disorders and inflammatory diseases.
Polypeptide Derivatives and Analogs
[0365] It are appreciated that polypeptides described herein may be
degradation products, synthetic peptides or recombinant peptides as
well as peptidomimetics, synthetic peptides, peptoids, and
semipeptoids (e.g., peptide analogs, which may have, for example,
modifications rendering the peptides more stable while in a body or
more capable of penetrating into cells.) Modifications of the VISTA
and VISTA conjugate polypeptides described herein include, but are
not limited to N-terminus modification, C-terminus modification,
peptide bond modification (e.g., CH.sub.2--NH, CH.sub.2--S,
CH.sub.2--S.dbd.O, O.dbd.C--NH, CH.sub.2--O, CH.sub.2--CH.sub.2,
S.dbd.C--NH, CH.dbd.CH or CF.dbd.CH), backbone modifications, and
residue modification. Methods for preparing peptidomimetic
compounds are well known in the art. Martin, (2010) Quantitative
Drug Design: A Critical Introduction [2.sup.nd Ed.] CRC Press.
[0366] Peptide bonds (--CO--NH--) within the peptide may be
substituted, for example, by N-methylated bonds
(--N(CH.sub.3)--CO--), ester bonds (--C(R)H--C--O--O--C(R)--N--),
ketomethylen bonds (--CO--CH2-), .alpha.-aza bonds
(--NH--N(R)--CO--), wherein R is any alkyl, e.g., methyl, carba
bonds (--CH.sub.2--NH--), hydroxyethylene bonds
(--CH(OH)--CH.sub.2--), thioamide bonds (--CS--NH--), olefinic
double bonds (--CH.dbd.CH--), retro amide bonds (--NH--CO--),
peptide derivatives (--N(R)--CH.sub.2--CO--), wherein R is the
"normal" side chain, naturally presented on the carbon atom. These
modifications can occur at any of the bonds along the peptide chain
and even at several (2-3) at the same time.
[0367] Natural aromatic amino acids, Trp, Tyr and Phe, may be
substituted by synthetic non-natural acid such as phenylglycine,
TIC, naphthylelanine (Nol), ring-methylated derivatives of
phenylalanine, halogenated derivatives of phenylalanine or
o-methyl-tyrosine. In addition to the above, the polypeptides of
the present invention may also include one or more modified amino
acids or one or more non-amino acid monomers (e.g. fatty acids,
complex carbohydrates), for example, hydroxyproline, phosphoserine
and phosphothreonine; and other unusual amino acids including, but
not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine,
nor-valine, nor-leucine and ornithine. Furthermore, the term "amino
acid" includes both D- and L-amino acids.
[0368] Since the polypeptides of the present invention are
preferably utilized in therapeutics which requires the peptides to
be in soluble form, the polypeptides of the present invention may
comprise one or more non-natural or natural polar amino acids,
including but not limited to serine and threonine which are capable
of increasing peptide solubility due to their hydroxyl-containing
side chain.
[0369] The polypeptides of the present invention may be in a linear
form, although it are appreciated that in cases may also be
utilized.
[0370] The VISTA and VISTA conjugate polypeptides described herein
may be purified from cells that have been altered to express it
(e.g., recombinant). DNA sequences encoding the VISTA and VISTA
conjugate polypeptides may be inserted into an expression vector
and then transformed (or transfected) in an appropriate host cell
and/or expressed in a transgenic animal. The VISTA and VISTA
conjugate polypeptides so expressed may then be isolated by methods
known in the art. See, e.g., Maniatis, et al. (2001) Molecular
Cloning: A Laboratory Manual [3.sup.rd Ed.] Cold Spring Harbor
Laboratory Press.
[0371] The polypeptides of the present invention may be
biochemically synthesized such as by using standard solid phase
techniques. These methods include exclusive solid phase synthesis,
partial solid phase synthesis methods, fragment condensation,
classical solution synthesis. These methods are preferably used
when the peptide is relatively short (i.e., 10 kDa) and/or when it
cannot be produced by recombinant techniques (i.e., not encoded by
a nucleic acid sequence) and therefore involves different
chemistry. Solid phase peptide synthesis procedures are well known
in the art and further described by Stewart (1984) Solid Phase
Peptide Syntheses [2.sup.nd Ed.] Pierce Chemical Company and
Benoiton (2005) Chemistry of Peptide Synthesis CRC Press. Synthetic
peptides may be purified by preparative high performance liquid
chromatography and the composition of which may be confirmed via
amino acid sequencing. See Creighton (1992) [2.sup.nd Ed.]
Proteins, Structures and Molecular Principles W.H. Freeman and
Company; Aguilar (2004) [Ed.] HPLC of Peptides and Proteins:
Methods and Protocols Humana Press; Simpson (2002) Protein
Sequencing Protocols [2.sup.nd Ed.] Humana Press.
[0372] In cases where large amounts of the polypeptides of the
present invention are desired, the polypeptides of the present
invention may be generated using recombinant techniques such as
described by Invitrogen (2002) "Guide to Baculovirus Expression
Vector Systems (BEVs) and Insect Culture Techniques" Instruction
Manual; Hatti-Kaul and Mattiasson (2003) [Eds] Isolation and
Purification of Proteins; Ahmed (2004) Principles and Reactions of
Protein Extraction, Purification and Characterization CRC Press.
Further recombinant techniques such as described by, for example,
Bitter, et al. (1987) Methods in Enzymol. 153: 516-544, Studier, et
al. (1990) Methods in Enzymol. 185: 60-89, Brisson, et al. (1984)
Nature 310: 511-514, Takamatsu, et al. (1987) EMBO J. 6: 307-311,
Coruzzi, et al. (1984) EMBO J. 3: 1671-1680 and Brogli, et al.
(1984) Science 224: 838-843, Gurley, et al. (1986) Mol. Cell. Biol.
6: 559-565 and Weissbach & Weissbach (1988) Methods for Plant
Molecular Biology, Academic Press, NY, Section VIII, pages
421-463.
Polypeptide Sequence Variants
[0373] For any VISTA and VISTA conjugate sequence described herein,
further characterization or optimization may be achieved by
systematically either adding or removing amino acid residues to
generate longer or shorter peptides, and testing those and
sequences generated by walking a window of the longer or shorter
size up or down the antigen from that point. Coupling this approach
to generating new candidate targets with testing for effectiveness
of antigenic molecules based on those sequences in an
immunogenicity assay, as known in the art or as described herein,
may lead to further manipulation of the antigen. Further still,
such optimized sequences may be adjusted by, e.g., the addition,
deletions, or other mutations as known in the art and/or discussed
herein to further optimize the VISTA and VISTA conjugate (e.g.,
increasing serum stability or circulating half-life, increasing
thermal stability, enhancing delivery, enhance immunogenicity,
increasing solubility, targeting to a particular in vivo location
or cell type).
[0374] The VISTA and VISTA conjugate polypeptides described herein
may comprise conservative substitution mutations, (i.e., the
substitution of one or more amino acids by similar amino acids).
For example, conservative substitution refers to the substitution
of an amino acid with another within the same general class, e.g.,
one acidic amino acid with another acidic amino acid, one basic
amino acid with another basic amino acid, or one neutral amino acid
by another neutral amino acid.
[0375] VISTA and VISTA conjugate polypeptide sequences may have at
least about 60, 65, 70, 75, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89,
90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% sequence homology
to any one or more of the polypeptide sequences of SEQ ID NO: 2, 4,
or 5. More preferably, the invention contemplates polypeptide
sequences having at least about 95% sequence homology, even more
preferably at least about 98% sequence homology, and still more
preferably at least about 99% sequence homology to any one or more
of the polypeptide sequences of VISTA and VISTA conjugate
polypeptide sequences of SEQ ID NO: 2, 4, or 5. Methods for
determining homology between amino acid sequences, as well as
nucleic acid sequences, are well known to those of ordinary skill
in the art. See, e.g., Nedelkov & Nelson (2006) New and
Emerging Proteomic Techniques Humana Press.
[0376] Thus, a VISTA and VISTA conjugate polypeptide may have at
least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence
homology with a polypeptide sequence. For example, a VISTA and
VISTA conjugate polypeptide may have at least about 80%, 81%, 82%,
83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, or 100% sequence homology with SEQ ID NO: 2, 4,
or 5.
[0377] The term homology, or identity, is understood as meaning the
number of agreeing amino acids (identity) with other proteins,
expressed in percent. The identity is preferably determined by
comparing a given sequence with other proteins with the aid of
computer programs. If sequences which are compared with each other
are different in length, the identity is to be determined in such a
way that the number of amino acids which the short sequence shares
with the longer sequence determines the percentage identity. The
identity can be determined routinely by means of known computer
programs which are publicly available such as, for example,
ClustalW. Thompson, et al. (1994) Nucleic Acids Research 22:
4673-4680. ClustalW is publicly available from the European
Molecular Biology Laboratory and may be downloaded from various
internet pages, inter alio the IGBMC (Institut de Genetique et de
Biologie Moleculaire et Cellulaire) and the EBI and all mirrored
EBI internet pages (European Bioinformatics Institute). If the
ClustalW computer program Version 1.8 is used to determine the
identity between, for example, the reference protein of the present
application and other proteins, the following parameters are to be
set: KTUPLE=1, TOPDIAG=5, WINDOW=5, PAIRGAP=3, GAPOPEN=10,
GAPEXTEND=0.05, GAPDIST=8, MAXDIV=40, MATRIX=GONNET, ENDGAPS(OFF),
NOPGAP, NOHGAP. See also European Bioinformatics Institute (EBI)
toolbox available on-line and Smith (2002) Protein Sequencing
Protocols [2.sup.nd Ed.] Humana Press.
[0378] One possibility of finding similar sequences is to carry out
sequence database researches. Here, one or more sequences may be
entered as what is known as a query. This query sequence is then
compared with sequences present in the selected databases using
statistical computer programs. Such database queries (blast
searches) are known to the skilled worker and may be carried out at
different suppliers. If, for example, such a database query is
carried out at the NCBI (National Center for Biotechnology
Information); the standard settings for the respective comparison
query should be used. For protein sequence comparisons (blastp),
these settings are: Limit entrez=not activated; Filter=low
complexity activated; Expect value=10; word size=3;
Matrix=BLOSUM62; Gap costs: Existence=11, Extension=1. The result
of such a query is, among other parameters, the degree of identity
between the query sequence and the similar sequences found in the
databases.
[0379] VISTA and VISTA conjugates include functional fragments of
said polypeptides. A "functional fragment" of said polypeptide
includes a fragment of the gene or cDNA encoding said VISTA and
VISTA conjugate, which fragment is capable of eliciting an immune
response (e.g., humoral or cellular immune response.) Thus, for
example, fragments of the VISTA and VISTA conjugate according to
the invention which correspond to amino acid residues that
contribute to the immunogenicity of the antigen and which fragments
may serve to function as antigens to elicit an immune response
(e.g., humoral or cellular immune response.) This aspect of the
invention also includes differentially spliced isoforms and
transcriptional starts of the polypeptides according to the
invention. The polypeptides according to the invention also may
comprise fragments, derivatives and allelic variants of the VISTA
and VISTA conjugates. Methods and materials for making fragments of
VISTA and VISTA conjugate polypeptides are well known in the art.
See, e.g., Maniatis, et al. (2001) Molecular Cloning: A Laboratory
Manual [3.sup.rd Ed.] (Cold Spring Harbor Laboratory Press).
[0380] Variant VISTA and VISTA conjugate polypeptides may retain
their antigenic specificity to bind their respective antibodies
(e.g., a variant VISTA polypeptide are bound by an anti-VISTA
antibody.) Fully antigenic variants may contain only conservative
variations or variations in non-critical residues or in
non-critical regions. Antigenic variants may also contain
substitution of similar amino acids that result in no change or an
insignificant change in antigenicity. Alternatively, such
substitutions may positively or negatively affect antigenicity to
some degree. Non-antigenic variants typically contain one or more
non-conservative amino acid substitutions, deletions, insertions,
inversions, or truncation or a substitution, insertion, inversion,
or deletion in a critical residue or critical region of an epitope.
Molecular biology and biochemistry techniques for modifying VISTA
and VISTA conjugate polypeptides while preserving specific
antigenicity of the polypeptides for their respective antibodies
are well known in the art. See, e.g., Ho, et al. (1989) Gene 77(1):
51-59; Landt, et al. (1990) Gene 96(1): 125-128; Hopp & Woods
(1991) Proc. Natl. Acad. Sci. USA 78(6): 3824-3828; Kolaskar &
Tongaonkar (1990) FEBS Letters 276(1-2): 172-174; and Welling, et
al. (1985) FEBS Letters 188(2): 215-218.
[0381] "Variants of the VISTA polypeptides which function as either
VISTA agonists (mimetics) or as VISTA antagonists"
[0382] Variants of the VISTA polypeptides can be generated by
mutagenesis, e.g., discrete point mutation or truncation of a VISTA
polypeptide. An agonist of the VISTA polypeptides can retain
substantially the same, or a subset, of the biological activities
of the naturally occurring form of a VISTA polypeptide. An
antagonist of a VISTA polypeptide can inhibit one or more of the
activities of the naturally occurring form of the VISTA polypeptide
by, for example, competitively modulating a VISTA-mediated activity
of a VISTA polypeptide. Thus, specific biological effects can be
elicited by treatment with a variant of limited function. For
example, a subject may be treated with a variant having a subset of
the biological activities of the naturally occurring form of the
polypeptide has fewer side effects in a subject relative to
treatment with the naturally occurring form of the VISTA
polypeptide.
[0383] Variants of a VISTA polypeptide which function as either
VISTA agonists (mimetics) or as VISTA antagonists may be identified
by screening combinatorial libraries of mutants, e.g., truncation
mutants, of a VISTA polypeptide for VISTA polypeptide agonist or
antagonist activity. Diseases treatable with the subject VISTA
(PD-L3) binding agents are identified previously and include
various inflammatory, autoimmune, cancer, allergic and infectious
disorders. A particularly preferred indication is multiple
sclerosis.
Peptidomimetics
[0384] In addition to VISTA polypeptides consisting only of
naturally-occurring amino acids, VISTA peptidomimetics are also
provided. Peptide analogs are commonly used in the pharmaceutical
industry as non-peptide drugs with properties analogous to those of
the template peptide. These types of non-peptide compounds are
termed "peptide mimetics" or "peptidomimetics" (Fauchere (1986)
Adv. Drug Res. 15: 29; Advances in Amino Acid Mimetics and
Peptidomimetics (Volume 2) Andrew Abell (Ed.) (1999) JAI Press,
Inc. and Evans et al. (1987) J. Med. Chem 30: 1229) and are usually
developed with the aid of computerized molecular modeling. Peptide
mimetics that are structurally similar to therapeutically useful
peptides can be used to produce an equivalent therapeutic or
prophylactic effect. Generally, peptidomimetics are structurally
similar to a paradigm polypeptide (i e., a polypeptide that has a
biological or pharmacological activity), such as human or mouse
VISTA, but have one or more peptide linkages optionally replaced by
a linkage selected from the group consisting of --CH.sub.2NH--,
--CH.sub.2S--, --CH.sub.2--CH.sub.2--, --CH.dbd.CH-- (cis and
trans), --COCH.sub.2--, --CH(OH)CH.sub.2--, and --CH.sub.2SO--, by
methods known in the art and further described in the following
references: Spatola in Chemistry and Biochemistry of Amino Acids,
Peptides, and Proteins Weinstein, B., ed., Marcel Dekker, New York,
p. 267 (1983); Spatola, Vega Data (March 1983), Vol. 1, Issue 3,
"Peptide Backbone Modifications"; Morley (1980) Trends. Pharm. Sci.
pp. 463-468; Hudson, et al. (1979) Int. J. Pept. Prot. Res.
14:177-185 (--CH.sub.2NH--, CH.sub.2CH.sub.2--); Spatola, et al.
(1986) Life. Sci. 38:1243-1249 (--CH2-S); Hann, (1982) J. Chem. SoC
Perkin. Trans. I 307-314 (--CH--CH--, cis and trans); Almquist, et
al. (1980) J. Med. Chem. 23:1392-1398 (--COCH.sub.2--);
Jennings-White, et al. (1982) Tetrahedron Lett. 23:2533
(--COCH.sub.2--); (--CH(OH)CH.sub.2--); Holladay, et al. (1983)
Tetrahedron. Lett. 24:4401-4404 (--C(OH)CH.sub.2--); and Hruby
(1982) Life Sci. 31:189-199 (--CH.sub.2--S--). A particularly
preferred non-peptide linkage is --CH.sub.2NH--. Such peptide
mimetics may have significant advantages over polypeptide
embodiments, including, for example: more economical production,
greater chemical stability, enhanced pharmacological properties
(half-life, absorption, potency, and efficacy), altered specificity
(e.g., a broad-spectrum of biological activities), reduced
antigenicity, and others. Labeling of peptidomimetics usually
involves covalent attachment of one or more labels, directly or
through a spacer (e.g., an amide group), to non-interfering
position(s) on the peptidomimetic that are predicted by
quantitative structure-activity data and/or molecular modeling.
Such non-interfering positions generally are positions that do not
form direct contacts with the macromolecules(s) to which the
peptidomimetic binds to produce the therapeutic effect.
Derivitization (e.g., labeling) of peptidomimetics should not
substantially interfere with the desired biological or
pharmacological activity of the peptidomimetic.
[0385] Systematic substitution of one or more amino acids of a
VISTA amino acid sequence with a D-amino acid of the same type
(e.g., D-lysine in place of L-lysine) can be used to generate more
stable peptides. In addition, constrained peptides comprising a
VISTA amino acid sequence or a substantially identical sequence
variation can be generated by methods known in the art (Rizo and
Gierasch (1992) Annu. Rev. Biochem. 61:387); for example, by adding
internal cysteine residues capable of forming intramolecular
disulfide bridges which cyclize the peptide. The amino acid
sequences of the VISTA polypeptides identified herein will enable
those of skill in the art to produce polypeptides corresponding to
VISTA peptide sequences and sequence variants thereof. Such
polypeptides can be produced in prokaryotic or eukaryotic host
cells by expression of polynucleotides encoding a VISTA peptide
sequence, frequently as part of a larger polypeptide.
Alternatively, such peptides can be synthesized by chemical
methods. Methods for expression of heterologous polypeptides in
recombinant hosts, chemical synthesis of polypeptides, and in vitro
translation are well known in the art. Certain amino-terminal
and/or carboxy-terminal modifications and/or peptide extensions to
the core sequence can provide advantageous physical, chemical,
biochemical, and pharmacological properties, such as: enhanced
stability, increased potency and/or efficacy, resistance to serum
proteases, desirable pharmacokinetic properties, and others.
Peptides can be used therapeutically to treat disease, e.g., by
altering costimulation in a patient.
[0386] Amino acids that are essential for function may be
identified by methods known in the art, such as site-directed
mutagenesis or alanine-scanning mutagenesis. Cunningham, et al.
(1989) Sci. 244: 1081-85. The latter procedure introduces single
alanine mutations at every residue in the molecule. The resulting
mutant molecules are then tested for biological activity such as
epitope binding or in vitro ADCC activity. Sites that are critical
for ligand-receptor binding may also be determined by structural
analysis such as crystallography, nuclear magnetic resonance, or
photoaffinity labeling. Smith, et al. (1992) J. Mol. Biol. 224:
899-904; de Vos, et al. (1992) Sci. 255: 306-12.
[0387] For example, one class of substitutions is conserved amino
acid substitutions. Such substitutions are those that substitute a
given amino acid in a VISTA and VISTA conjugate polypeptide with
another amino acid of like characteristics. Typically seen as
conservative substitutions are the replacements, one for another,
among the aliphatic amino acids Ala, Val, Leu, and Ile; interchange
of the hydroxyl residues Ser and Thr, exchange of the acidic
residues Asp and Glu, substitution between the amide residues Asn
and Gln, exchange of the basic residues Lys and Arg, replacements
among the aromatic residues Phe, Tyr. Guidance concerning which
amino acid changes are likely to be phenotypically silent is found
in, for example, Bowie, et al. (1990) Sci. 247: 1306-10. Hence, one
of ordinary skill in the art appreciates that the inventors possess
peptide variants without delineation of all the specific variants.
As to amino acid sequences, one of skill will recognize that
individual substitutions, deletions or additions to a nucleic acid,
peptide, polypeptide, or protein sequence which alters, adds or
deletes a single amino acid or a small percentage of amino acids in
the encoded sequence is a "conservatively modified variant" where
the alteration results in the substitution of an amino acid with a
chemically similar amino acid. Conservative substitution tables
providing functionally similar amino acids are well known in the
art. Such conservatively modified variants are in addition to and
do not exclude polymorphic variants, interspecies homologs, and
alleles of the invention. See, e.g., Creighton (1992), Proteins:
Structures and Molecular Properties [2.sup.nd Ed.] W. H.
Freeman.
[0388] Moreover, polypeptides often contain amino acids other than
the twenty "naturally occurring" amino acids. Further, many amino
acids, including the terminal amino acids, may be modified by
natural processes, such as processing and other post-translational
modifications, or by chemical modification techniques well known in
the art. Known modifications include, but are not limited to,
acetylation, acylation, ADP-ribosylation, amidation, covalent
attachment of flavin, covalent attachment of a heme moiety,
covalent attachment of a nucleotide or nucleotide derivative,
covalent attachment of a lipid or lipid derivative, covalent
attachment of phosphotidylinositol, cross-linking, cyclization,
disulfide bond formation, demethylation, formation of covalent
crosslinks, formation of cystine, formation of pyroglutamate,
formylation, g-carboxylation, glycosylation, GPI anchor formation,
hydroxylation, iodination, methylation, myristoylation, oxidation,
proteolytic processing, phosphorylation, prenylation, racemization,
selenoylation, sulfation, transfer-RNA mediated addition of amino
acids to proteins such as arginylation, and ubiquitination. See
Creighton (1992) Proteins: Structure and Molecular Properties
[2.sup.nd Ed.] and Lundblad (1995) Techniques in Protein
Modification [1.sup.st Ed.] Many detailed reviews are available on
this subject. See, e.g., Wold (1983) Posttranslational Covalent
Modification of Proteins Acad. Press, NY; Seifter, et al. (1990)
Meth. Enzymol. 182: 626-46; and Rattan, et al. (1992) Ann. NY Acad.
Sci. 663: 48-62.
Fragments
[0389] A biologically active portion of a VISTA polypeptide
includes a fragment of a VISTA polypeptide which participates in an
interaction between a VISTA molecule and a non-VISTA molecule,
e.g., a natural ligand of VISTA. Biologically active portions of a
VISTA polypeptide include peptides comprising amino acid sequences
sufficiently identical to or derived from the amino acid sequence
of the VISTA polypeptide, e.g., the amino acid sequence shown in
SEQ ID NO: 2, 4 or 5, which include fewer amino acids than the full
length VISTA polypeptides, and exhibit at least one activity of a
VISTA polypeptide. Typically, biologically active portions comprise
a domain or motif with at least one activity of the VISTA
polypeptide, e.g., modulating (suppressing) CD4 T cell
proliferative responses to anti-CD3, suppression of the
proliferative response of cognate CD4 T cells in an antigen
specific manner, effects on the expression of specific cytokines. A
biologically active portion of a VISTA polypeptide can be a
polypeptide which is, for example, 25, 50, 75, 100, 125, 150, 175,
200, 225 or more amino acids in length. Biologically active
portions of a VISTA polypeptide can be used as targets for
developing agents which modulate a VISTA-mediated activity, e.g.,
immune cell activation.
[0390] A biologically active portion of a VISTA polypeptide may
comprise at least a portion of an extracellular domain. A
biologically active portion of a VISTA polypeptide may contain at
least a portion of an extracellular domain (e.g., comprising an
IgV), and one or more of the following domains: a signal peptide
domain, a transmembrane domain, or a cytoplasmic domain. Moreover,
other biologically active portions, in which other regions of the
polypeptide are deleted, can be prepared by recombinant techniques
and evaluated for one or more of the functional activities of a
native VISTA polypeptide.
[0391] The VISTA polypeptide may have the amino acid sequence shown
in SEQ ID NO: 2, 4 or 5. The VISTA polypeptide may be substantially
identical to SEQ ID NO: 2, 4 or 5, and retains the functional
activity of the polypeptide of SEQ ID NO: 2, 4 or 5, yet differs in
amino acid sequence due to natural allelic variation or
mutagenesis, as described herein.
Fusion Proteins
[0392] Fusions comprising the VISTA and VISTA conjugate
polypeptides are also within the scope of the present invention.
For example, the fusion protein may be linked to a GST fusion
protein in which the VISTA and VISTA conjugate polypeptide
sequences are fused to the C-terminus of the GST sequences. Such
fusion proteins may facilitate the purification of the recombinant
VISTA and VISTA conjugate polypeptides. Alternatively, VISTA and
VISTA conjugate polypeptides may be fused with a protein that binds
B-cell follicles, thus initiating both a humoral immune response
and activation of T cells. Berney, et al. (1999) J. Exp. Med. 190:
851-60. Alternatively, for example, the VISTA and VISTA conjugate
polypeptides may be genetically coupled with and anti-dendritic
cell antibody to deliver the antigen to the immune system and
stimulate a cellular immune response. He, et al. (2004) Clin.
Cancer Res. 10: 1920-27. A chimeric or fusion protein of the
invention may be produced by standard recombinant DNA techniques.
For example, DNA fragments coding for the different polypeptide
sequences are ligated together in-frame in accordance with
conventional techniques, e.g., by employing blunt-ended or
stagger-ended termini for ligation, restriction enzyme digestion to
provide for appropriate termini, filling-in of cohesive ends as
appropriate, alkaline phosphatase treatment to avoid undesirable
joining, and enzymatic ligation. The fusion gene may be synthesized
by conventional techniques including automated DNA
synthesizers.
[0393] Fusion proteins may include C-terminal or N-terminal
translocation sequences. Further, fusion proteins can comprise
additional elements, e.g., for protein detection, purification, or
other applications. Detection and purification facilitating domains
including but not limited to metal chelating peptides such as
polyhistidine tracts, histidine-tryptophan modules, or other
domains that allow purification on immobilized metals; maltose
binding protein; protein A domains that allow purification on
immobilized immunoglobulin; or the domain utilized in the FLAG
extension/affinity purification system (Immunex Corp, Seattle
Wash.)
[0394] A fusion protein may be prepared from a protein of the
invention by fusion with a portion of an immunoglobulin comprising
a constant region of an immunoglobulin. More preferably, the
portion of the immunoglobulin comprises a heavy chain constant
region which is optionally and more preferably a human heavy chain
constant region. The heavy chain constant region is most preferably
an IgG heavy chain constant region, and optionally and most
preferably is an Fc chain, most preferably an IgG Fc fragment that
comprises CH2 and CH3 domains. Although any IgG subtype may
optionally be used, the IgG1 subtype is preferred. The Fc chain may
optionally be a known or "wild type" Fc chain, or alternatively may
be mutated. See, e.g., U.S. Patent Application Publication No.
2006/0034852. The term "Fc chain" also optionally comprises any
type of Fc fragment. Several of the specific amino acid residues
that are involved in antibody constant region-mediated activity in
the IgG subclass have been identified. Inclusion, substitution or
exclusion of these specific amino acids therefore allows for
inclusion or exclusion of specific immunoglobulin constant
region-mediated activity. Furthermore, specific changes may result
in aglycosylation for example and/or other desired changes to the
Fc chain. At least some changes may optionally be made to block a
function of Fc which is considered to be undesirable, such as an
undesirable immune system effect. See McCafferty, et al. (2002)
Antibody Engineering: A Practical Approach (Eds.) Oxford University
Press.
[0395] The inclusion of a cleavable linker sequences such as Factor
Xa (See, e.g., Ottavi, (1998) Biochimie 80: 289-93), subtilisin
protease recognition motif (See, e.g., Polyak (1997) Protein Eng.
10: 615-19); enterokinase (Invitrogen, San Diego, Calif.), between
the translocation domain (for efficient plasma membrane expression)
and the rest of the newly translated polypeptide may be useful to
facilitate purification. For example, one construct can include a
polypeptide encoding a nucleic acid sequence linked to six
histidine residues followed by a thioredoxin, an enterokinase
cleavage site (See, e.g., Williams (1995) Biochemistry 34:
1787-97), and an C-terminal translocation domain. The histidine
residues facilitate detection and purification while the
enterokinase cleavage site provides a means for purifying the
desired protein(s) from the remainder of the fusion protein.
Technology pertaining to vectors encoding fusion proteins and
application of fusion proteins are well described in the scientific
and patent literature. See, e.g., Kroll (1993) DNA Cell. Biol. 12:
441-53.
[0396] A fusion protein may be a GST-VISTA fusion protein in which
the VISTA sequences are fused to the C-terminus of the GST
sequences. Such fusion proteins can facilitate the purification of
recombinant VISTA. In another embodiment, the fusion protein is a
VISTA polypeptide containing a heterologous signal sequence at its
N-terminus. In certain host cells (e.g., mammalian host cells),
expression and/or secretion of VISTA can be increased through use
of a heterologous signal sequence. In an embodiment, the fusion
protein is an Ig-VISTA fusion protein in which the VISTA sequences
are fused to a portion of an Ig molecule. The Ig portion of the
fusion protein can include and immunoglobulin constant region,
e.g., a human C.gamma.1 domain or a C.gamma.4 domain (e.g., the
hinge, CH2, and CH3 regions of human IgC.gamma.1 or human
IgC.gamma.4 (see, e.g., U.S. Pat. Nos. 5,116,964; 5,580,756;
5,844,095). A resulting fusion protein may have altered VISTA
solubility, binding affinity, stability and/or valency (i.e., the
number of binding sites per molecule) and may increase the
efficiency of protein purification.
[0397] Particularly preferred VISTA Ig fusion proteins include an
extracellular domain portion of VISTA coupled to an immunoglobulin
constant region (e.g, the Fc region). The immunoglobulin constant
region may contain genetic modifications which reduce or eliminate
effector activity inherent in the immunoglobulin structure. For
example, DNA encoding an extracellular portion of a VISTA
polypeptide can be joined to DNA encoding the hinge, CH2, and CH3
regions of human IgG.gamma.1 and/or IgG.gamma.4 modified by
site-directed mutagenesis, e.g., as taught in WO 97/28267. The
VISTA fusion proteins of the invention can be incorporated into
pharmaceutical compositions and administered to a subject in vivo.
The VISTA fusion proteins can be used to affect the bioavailability
of a VISTA binding partner. Use of VISTA fusion proteins may be
useful therapeutically for the treatment of conditions or disorders
that would benefit from modulation of the immune response.
Moreover, the VISTA-fusion proteins of the invention can be used as
immunogens to produce anti-VISTA antibodies in a subject, to purify
VISTA-binding proteins, and in screening assays to identify
molecules which inhibit the interaction of VISTA with its natural
binding partner.
Conjugates
[0398] The VISTA and VISTA conjugate, antibodies that bind the
VISTA and VISTA conjugate and fragments thereof, may be conjugated
to other moieties. Such conjugates are often used in the
preparation of vaccines. The VISTA and VISTA conjugate polypeptide
may be conjugated to a carbohydrate (e.g., mannose, fucose,
glucose, GlcNAs, maltose), which is recognized by the mannose
receptor present on dendritic cells and macrophages. The ensuing
binding, aggregation, and receptor-mediated endocytosis and
phagocytosis functions provide enhanced innate and adaptive
immunity. See Mahnke, et al. (2000) J. Cell Biol. 151: 673-84;
Dong, et al. (1999) J. Immonol. 163: 5427-34.
[0399] Other moieties suitable for conjugation to elicit an immune
response includes but not limited to Keyhole Limpit Hemocyannin
(KLH), diphtheria toxoid, cholera toxoid, Pseudomonas exoprotein A,
and microbial outer membrane proteins (OMPS).
Polypeptide Isolation
[0400] The present invention also provides methods for isolation of
the VISTA and VISTA conjugate polypeptides. For example, relevant
cell lines or tumor samples may be obtained from a cancer patient.
After homogenization and solubilization in a detergent, the antigen
is chromatographically purified. Size-exclusion or affinity
chromatography may be used for this, and may be used in conjunction
with anti-VISTA and anti-VISTA-Ig conjugate antibodies. For
example, anti-VISTA or anti-VISTA-Ig conjugate antibody may be
immobilized on a solid support (e.g., coupled to resins, magnetic
beads) for simple antigen adsorption, washing, and elution from the
solid support. The eluted protein is then studied further for
antigen presence, characterization, and identification. See Walker
(2002) Protein Protocols Handbook [2.sup.nd Ed.] Humana Press and
Culture (2003) [Ed.] Protein Purification Protocols Humana
Press.
[0401] The antigen isolated in this way may be used for preparing a
pharmaceutical using the conventional pharmaceutical excipient and
carrier substance. For example, in-vivo administration of the
purified antigen in a physiological NaCl solution.
[0402] Additionally, the VISTA and VISTA conjugate polypeptides
according to the invention may serve as an antigen in the
identification of activities as part of a high-throughput
screening. High-throughput screening methods are known to persons
skilled in the art. Wells (2002) High Throughout Bioanalytical
Sample Preparation Elsevier Health Sciences.
Polynucleotides Encoding VISTA and VISTA Conjugate
[0403] The present invention also provides nucleotides which encode
VISTA and VISTA conjugates. The present invention also provides
polynucleotides comprising the nucleic acid sequences of SEQ ID
NOs: 1 and 3 which encode VISTA polypeptides. The present invention
also provides for fragments, sequences hybridizable with, and
sequences homologous to the polynucleotide sequences described
herein which are at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%,
87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or
100%.
[0404] The invention also provides polynucleotides comprising at
least one VISTA and VISTA conjugate sequence encoding similar
polypeptides with different codon usage, altered sequences
characterized by mutations, such as deletion, insertion or
substitution of one or more nucleotides, either naturally occurring
or man induced, either randomly or in a targeted fashion. The
present invention also encompasses homologous nucleic acid
sequences (e.g., which form a part of a polynucleotide sequence of
the present invention), which include sequence regions unique to
the polynucleotides of the present invention.
[0405] The present invention also encompasses nucleic acids
encoding homologues of VISTA and VISTA conjugate polypeptides, such
homologues can be at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%,
87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or
100% identical homologous to the amino acid sequences set forth
herein, as may be determined using BlastP software of the National
Center of Biotechnology Information (NCBI) using default
parameters. The present invention also encompasses fragments of the
above described polynucleotides and polypeptides having mutations,
such as deletions, insertions or substitutions of one or more
nucleic acids, either naturally occurring or man induced, either
randomly or in a targeted fashion.
[0406] Nucleic acid molecules may encode a VISTA and VISTA
conjugate, or a functional fragment of said nucleic acid molecule.
A "functional fragment" of said nucleic acid includes a fragment of
the gene or cDNA encoding said VISTA and VISTA conjugate, which
fragment is capable of being expressed to produce a VISTA and VISTA
conjugate capable of eliciting an immune response (e.g., antibodies
which selectively bind the VISTA and VISTA conjugate) Thus, for
example, fragments of the VISTA and VISTA conjugate according to
the invention which correspond to amino acid residues that
contribute to the immunogenicity of the antigen and which fragments
may serve to function as antigens to elicit an immune response
(e.g., humoral or cellular immune response.) This aspect of the
invention also includes differentially spliced isoforms and
transcriptional starts of the nucleic acids according to the
invention. The nucleic acid molecules according to the invention
also comprise fragments, derivatives and allelic variants of the
nucleic acid molecules described above that encodes a VISTA and
VISTA conjugate according to the invention. Methods and materials
for making nucleic acids encoding fragments of VISTA and VISTA
conjugate are well known in the art. See, e.g., Maniatis, et al.
(2001) Molecular Cloning: A Laboratory Manual [3.sup.rd Ed.] Cold
Spring Harbor Laboratory Press.
[0407] A nucleic acid molecule encompassing all or a portion of SEQ
ID NO: 1, 3, or an ortholog or variant can be isolated by the
polymerase chain reaction (PCR) using synthetic oligonucleotide
primers designed based upon the sequence of SEQ ID NO: 1,2, 3, 4 or
5.
[0408] A nucleic acid molecule of the invention can be amplified
using cDNA, mRNA or, alternatively, genomic DNA as a template and
appropriate oligonucleotide primers according to standard PCR
amplification techniques. The nucleic acid molecule so amplified
can be cloned into an appropriate vector and characterized by DNA
sequence analysis. Furthermore, oligonucleotides corresponding to
VISTA (PD-L3) nucleotide sequences can be prepared by standard
synthetic techniques, e.g., using an automated DNA synthesizer.
[0409] In an embodiment, an isolated VISTA encoding nucleic acid
molecule of the invention comprises the nucleotide sequence shown
in SEQ ID NO: 1 or 3, or a fragment thereof. In another embodiment
the nucleic acid molecule of the invention comprises a nucleic acid
molecule which is a complement of the nucleotide sequence shown in
SEQ ID NO: 1 or 3, or a portion of any of these nucleotide
sequences. A nucleic acid molecule which is complementary to the
nucleotide sequence shown in SEQ ID NO: 1 or 3, is one which is
sufficiently complementary to the nucleotide sequence shown in SEQ
ID NO: 1 or 3 such that it can hybridize to the nucleotide sequence
shown in SEQ ID NO: 1 or 3 respectively, thereby forming a stable
duplex.
[0410] In another embodiment, an isolated nucleic acid molecule of
the present invention comprises a nucleotide sequence which is at
least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, or 99.5% identical to the entire length of the
nucleotide sequence shown in SEQ ID NO: 1 or 3, or a portion of any
of these nucleotide sequences.
[0411] Moreover, the nucleic acid molecule of the invention can
comprise only a portion of the nucleic acid sequence of SEQ ID NO:
1 or 3, for example, a fragment which can be used as a probe or
primer or a fragment which encodes a portion of a VISTA
polypeptide, e.g., a biologically active portion of a
VISTA-polypeptide. The nucleotide sequences determined from the
cloning of the human PD-L2 gene allow for the generation of probes
and primers designed for use in identifying and/or cloning other
PD-L2 family members, as well as VISTA homologues from other
species. The probe/primer typically comprises substantially
purified oligonucleotide. The oligonucleotide typically comprises a
region of nucleotide sequence that hybridizes under stringent
conditions to at least about 12 or 15, preferably about 20 or 25,
more preferably about 30, 35, 40, 45, 50, 55, 60, 65, or 75
consecutive nucleotides of a sense sequence of SEQ ID NO: 1 or 3;
of an anti-sense sequence of SEQ ID NO: 1, 3, or a naturally
occurring allelic variant or mutant of SEQ ID NO: 1 or 3.
[0412] In one embodiment, a nucleic acid molecule of the present
invention comprises a nucleotide sequence which is greater than
about 50-100, 100-150, 150-200, 200-250, 250-300, 300-350, 350-400,
400-450, 450-500, 500-550, 550-600, 600-650, 650-700, 700-750,
750-800, 800-850, 850-900, 900-950, or more nucleotides in length
and hybridizes under stringent hybridization conditions to a
nucleic acid molecule of SEQ ID NO: 1 or 3, or the complement
thereof In a further embodiment, a nucleic acid molecule of the
present invention comprises a nucleotide sequence which is greater
than about 880-900, 900-950, 950-1000, 1000-1050, 1050-1100,
1100-1150, or more nucleotides in length and hybridizes under
stringent hybridization conditions to a nucleic acid molecule of
SEQ ID NO: 1 or 3, or the complement thereof. In yet another
embodiment, a nucleic acid molecule of the present invention
comprises a nucleotide sequence which is greater than 50-100,
100-150, 150-200, 200-250, 250-300 or more nucleotides in length
and hybridizes under stringent hybridization conditions to a
nucleic acid molecule comprising the coding region in SEQ ID NO: 1
or 3, or a complement thereof. In yet a further embodiment, a
nucleic acid molecule of the present invention comprises a
nucleotide sequence which is greater than about 50-100, 100-150,
150-200, 200-250, 250-300, 300-350, 350-400, 400-450, 450-500,
500-550, 550-600, 600-650, 650-700, 700-750, 750-800, 850-900,
900-950, or more nucleotides in length, includes at least about 15
(i.e., 15 contiguous) nucleotides of the sequence comprising the
coding region of SEQ ID NO: 1 or 3, or a complement thereof, and
hybridizes under stringent conditions to a nucleic acid molecule
comprising the nucleotide sequence shown in SEQ ID NO: 1 or 3 a
complement thereof.
[0413] Probes based on the VISTA nucleotide sequences can be used
to detect transcripts or genomic sequences encoding the same or
homologous polypeptides. In embodiments, the probe further
comprises a label group attached thereto, e.g., the label group can
be a radioisotope, a fluorescent compound, an enzyme, or an enzyme
co-factor. Such probes can be used as a part of a diagnostic test
kit for identifying cells or tissue which misexpress a VISTA
polypeptide, such as by measuring a level of a VISTA-encoding
nucleic acid in a sample of cells from a subject, e.g., detecting
VISTA mRNA levels or determining whether a genomic VISTA gene has
been mutated or deleted.
[0414] In addition to the VISTA nucleotide sequences of SEQ ID NO:
1 and 3, it are appreciated by those skilled in the art that DNA
sequence polymorphisms that lead to changes in the amino acid
sequences of the VISTA polypeptides may exist within a population
(e.g., the human population). Such genetic polymorphism in the
VISTA genes may exist among individuals within a population due to
natural allelic variation. As used herein, the terms "gene" and
"recombinant gene" refer to nucleic acid molecules which include an
open reading frame encoding a VISTA polypeptide, preferably a
mammalian VISTA polypeptide, and can further include non-coding
regulatory sequences, and introns.
[0415] Allelic variants of human or mouse VISTA include both
functional and non-functional VISTA polypeptides. Functional
allelic variants are naturally occurring amino acid sequence
variants of the human or mouse VISTA polypeptide that maintain the
ability to bind natural VISTA binding partner(s)and/or modulate
CD4+ and CD8+ T cell proliferation and cytokine production and
lymphocyte activation. Functional allelic variants will typically
contain only conservative substitution of one or more amino acids
of SEQ ID NO: 2, 4 or 5, or substitution, deletion or insertion of
non-critical residues in non-critical regions of the
polypeptide.
[0416] Non-functional allelic variants are naturally occurring
amino acid sequence variants of the human or mouse VISTA
polypeptide that do not have the ability to either bind natural
VISTA binding partners, and/or modulate any of the VISTA activities
described herein. Non-functional allelic variants will typically
contain a non-conservative substitution, deletion, or insertion or
premature truncation of the amino acid sequence of SEQ ID NO: 2, 4
or 5, or a substitution, insertion or deletion in critical residues
or critical regions of the polypeptide, e.g., in an IgV domain.
[0417] The present invention further provides non-human, non-mouse
orthologs of the human or mouse VISTA polypeptide. Orthologs of the
human or mouse VISTA polypeptide are polypeptides that are isolated
from non-human, non-mouse organisms and possess the same binding
activity and/or lymphocyte activation-modulating activity, and
ability to modulate CD4+ and CD8+ T cell proliferation and cytokine
production as the human and murine VISTA polypeptides disclosed
herein. Orthologs of the human or mouse PD-L3 polypeptide can
readily be identified as comprising an amino acid sequence that is
substantially identical to SEQ ID NO: 2, 4 or 5.
[0418] A mutant VISTA polypeptide may be assayed for the ability to
bind to and/or modulate the activity of a natural VISTA binding
partner, to modulate intra- or intercellular signaling, modulate
activation of T lymphocytes, and/or modulate the immune response of
an organism.
[0419] Isolated nucleic acid molecules encoding a VISTA or VISTA
fusion proteins. Such nucleic acid molecules, comprising at least a
first nucleotide sequence encoding a VISTA or VISTA protein,
polypeptide or peptide operatively linked to a second nucleotide
sequence encoding a non-VISTA protein, polypeptide or peptide, can
be prepared by standard recombinant DNA techniques.
[0420] Furthermore, identity refers broadly to the that functional
and/or structural equivalence that exists between the nucleic acid
molecules concerned or the proteins coded by them. The nucleic acid
molecules, which are homologous to the molecules described above
and constitute derivatives of these molecules, are generally
variations of these molecules, which constitute modifications,
which execute the same biological function. At the same time, the
variations may occur naturally, for example they may be sequences
from other species, or they may be mutants, wherein these mutants
may have occurred in a natural manner or have been introduced by
objective mutagenesis. The variations may also be synthetically
manufactured sequences. The allelic variants may be both naturally
occurring variants and also synthetically manufactured variants or
variants produced by recombinant DNA techniques. Nucleic acid
molecules, which deviate from nucleic acid molecules according to
the invention due to degeneration of the genetic code, constitute a
special form of derivatives.
[0421] Included also within the scope of the invention is any
nucleotide sequence that encodes the amino acid sequence of VISTA
and VISTA conjugate thereof. Because the genetic code is
degenerate, more than one codon may be used to encode a particular
amino acid. Using the genetic code, one or more different
nucleotides may be identified, each of which would be capable of
encoding the amino acid. The probability that a particular
nucleotide will, in fact, constitute the actual codon encoding
sequence may be estimated by considering abnormal base pairing
relationships and the frequency with which a particular codon is
actually used (to encode a particular amino acid) in eukaryotic or
prokaryotic cells expressing a VISTA and VISTA conjugate thereof.
Such "codon usage rules" are disclosed by Lathe, et al. (1985) J.
Molec. Biol. 183: 1-12.
Modified VISTA and VISTA Conjugate Polynucleotides
[0422] The nucleotides of the present invention may be modified
polynucleotides. Unmodified nucleotide are often less optimal in
some applications, e.g., prone to degradation by cellular
nucleases. Chemical modifications to one or more of the subunits of
oligonucleotide may confer improved properties, e.g., may render
polynucleotides more stable to nucleases. Typical oligonucleotide
modifications are well-known in the art and may include one or more
of: (i) alteration, e.g., replacement, of one or both of the
non-linking phosphate oxygens and/or of one or more of the linking
phosphate oxygens in the phosphodiester intersugar linkage; (ii)
alteration, e.g., replacement, of a constituent of the ribose
sugar, e.g., of the modification or replacement of the 2' hydroxyl
on the ribose sugar; (iii) wholesale replacement of the phosphate
moiety; (iv) modification or replacement of a naturally occurring
base with a non-natural base; (v) replacement or modification of
the ribose-phosphate backbone, e.g. with peptide nucleic acid
(PNA); (vi) modification of the 3' end or 5' end of the
oligonucelotide; and (vii) modification of the sugar, e.g., six
membered rings. Polynucleotides used in accordance with this
invention may be synthesized by any number of means well-known in
the art, or purchased from a variety of commercial vendors (LC
Sciences, Houston, Tex.; Promega, Madison, Wis.; Invitrogen,
Carlsbad, Calif.).
Antisense
[0423] In addition to the nucleic acid molecules encoding VISTA
polypeptides described above, another embodiment of the invention
pertains to isolated nucleic acid molecules which are antisense
thereto. An "antisense" nucleic acid comprises a nucleotide
sequence which is complementary to a "sense" nucleic acid encoding
a polypeptide, e.g., complementary to the coding strand of a
double-stranded cDNA molecule or complementary to an mRNA sequence.
Accordingly, an antisense nucleic acid can hydrogen bond to a sense
nucleic acid. The antisense nucleic acid can be complementary to an
entire VISTA coding strand, or to only a portion thereof. In one
embodiment, an antisense nucleic acid molecule is antisense to a
"coding region" of the coding strand of a nucleotide sequence
encoding a VISTA. The term "coding region" refers to the region of
the nucleotide sequence comprising codons which are translated into
amino acid residues. In another embodiment, the antisense nucleic
acid molecule is antisense to a "noncoding region" of the coding
strand of a nucleotide sequence encoding PD-L. The term "noncoding
region" refers to 5' and 3' sequences which flank the coding region
that are not translated into amino acids (also referred to as 5'
and 3' untranslated regions). Given the coding strand sequences
encoding human or mouse VISTA or VISTA disclosed herein, antisense
nucleic acids of the invention can be designed according to the
rules of Watson and Crick base pairing. The antisense nucleic acid
molecule can be complementary to the entire coding region of VISTA
mRNA, but more preferably is an oligonucleotide which is antisense
to only a portion of the coding or noncoding region of VISTA mRNA.
For example, the antisense oligonucleotide can be complementary to
the region surrounding the translation start site of VISTA or VISTA
mRNA. An antisense oligonucleotide can be, for example, about 5,
10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An
antisense nucleic acid molecule of the invention can be constructed
using chemical synthesis and enzymatic ligation reactions using
procedures known in the art. For example, an antisense nucleic acid
molecule (e.g., an antisense oligonucleotide) can be chemically
synthesized using naturally occurring nucleotides or variously
modified nucleotides designed to increase the biological stability
of the molecules or to increase the physical stability of the
duplex formed between the antisense and sense nucleic acids, e.g.,
phosphorothioate derivatives and acridine substituted nucleotides
can be used. Examples of modified nucleotides which can be used to
generate the antisense nucleic acid include 5-fluorouracil,
5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine,
4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil,
5-carboxymethylaminomethyl-2-thiouridine,
5-carboxymethylaminomethyluracil, dihydrouracil,
beta-D-galactosylqueosine, inosine, N6-isopentenyladenine,
1-methylguanine, 1-methylinosine, 2,2-dimethylguanine,
2-methyladenine, 2-methylguanine, 3-methylcytosine,
5-methylcytosine, N6-adenine, 7-methylguanine,
5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiour-acil,
beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil,
5-methoxyuracil, 2-methylthio-N6-isopentenyladenine,
uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine,
2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil,
5-methyluracil, uracil-5-oxyacetic acid methylester,
uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil,
3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and
2,6-diaminopurine. Alternatively, the antisense nucleic acid can be
produced biologically using an expression vector into which a
nucleic acid has been subcloned in an antisense orientation (i.e.,
RNA transcribed from the inserted nucleic acid are of an antisense
orientation to a target nucleic acid of interest, described further
in the following subsection).
[0424] The antisense nucleic acid molecules of the invention are
typically administered to a subject or generated in situ such that
they hybridize with or bind to cellular mRNA and/or genomic DNA
encoding a VISTA or VISTA polypeptide to thereby inhibit expression
of the polypeptide, e.g., by inhibiting transcription and/or
translation. The hybridization can be by conventional nucleotide
complementarity to form a stable duplex, or, for example, in the
case of an antisense nucleic acid molecule which binds to DNA
duplexes, through specific interactions in the major groove of the
double helix. An example of a route of administration of antisense
nucleic acid molecules of the invention include direct injection at
a tissue site. Alternatively, antisense nucleic acid molecules can
be modified to target selected cells and then administered
systemically. For example, for systemic administration, antisense
molecules can be modified such that they specifically bind to
receptors or antigens expressed on a selected cell surface, e.g.,
by linking the antisense nucleic acid molecules to peptides or
antibodies which bind to cell surface receptors or antigens. The
antisense nucleic acid molecules can also be delivered to cells
using the vectors described herein. To achieve sufficient
intracellular concentrations of the antisense molecules, vector
constructs in which the antisense nucleic acid molecule is placed
under the control of a strong pol II or pol III promoter are
preferred.
[0425] The VISTA antisense nucleic acid molecule may be an
.alpha.-anomeric nucleic acid molecule. An .alpha.-anomeric nucleic
acid molecule forms specific double-stranded hybrids with
complementary RNA in which, contrary to the usual .beta.-units, the
strands run parallel to each other. Gaultier, et al. (1987) Nucleic
Acids Res. 15: 6625-6641. The antisense nucleic acid molecule can
also comprise a 2'-O-methylribonucleotide (Inoue, et al. (1987)
Nucleic Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue
(Inoue, et al. (1987) FEBS Lett. 215: 327-330).
[0426] A VISTA antisense nucleic acid may be a ribozyme. Ribozymes
are catalytic RNA molecules with ribonuclease activity which are
capable of cleaving a single-stranded nucleic acid, such as an
mRNA, to which they have a complementary region. Thus, ribozymes
(e.g., hammerhead ribozymes (described in Haseloff and Gerlach
(1988) Nature 334:585-591)) can be used to catalytically cleave
VISTA mRNA transcripts to thereby inhibit translation of VISTA
mRNA. A ribozyme having specificity for a VISTA-encoding nucleic
acid can be designed based upon the nucleotide sequence of a VISTA
cDNA disclosed herein (i.e., SEQ ID NO: 1 or 3). For example, a
derivative of a Tetrahymena L-19 IVS RNA can be constructed in
which the nucleotide sequence of the active site is complementary
to the nucleotide sequence to be cleaved in a VISTA-encoding mRNA.
See, e.g., U.S. Pat. No. 4,987,071 and U.S. Pat. No. 5,116,742.
Alternatively, VISTA mRNA can be used to select a catalytic RNA
having a specific ribonuclease activity from a pool of RNA
molecules. See, e.g., Bartel and Szostak (1993) Science
261:1411-1418.
[0427] Alternatively, VISTA gene expression can be inhibited by
targeting nucleotide sequences complementary to the regulatory
region of the VISTA (e.g., the VISTA promoter and/or enhancers; to
form triple helical structures that prevent transcription of the
PD-L3 gene in target cells. See generally, Helene (1991) Anticancer
Drug Des. 6(6):569-84; Helene, et al. (1992) Ann. N.Y. Acad. Sci.
660:27-36; and Maher, L. J. (1992) Bioessays 14(12):807-15.
Peptide Nucleic Acid
[0428] In yet another embodiment, the VISTA nucleic acid molecules
of the present invention can be modified at the base moiety, sugar
moiety or phosphate backbone to improve, e.g., the stability,
hybridization, or solubility of the molecule. For example, the
deoxyribose phosphate backbone of the nucleic acid molecules can be
modified to generate peptide nucleic acids. See Hyrup and Nielsen
(1996) Bioorg. Med. Chem. 4(1): 5-23. As used herein, the terms
"peptide nucleic acids" or "PNAs" refer to nucleic acid mimics,
e.g, DNA mimics, in which the deoxyribose phosphate backbone is
replaced by a pseudopeptide backbone and only the four natural
nucleobases are retained. The neutral backbone of PNAs has been
shown to allow for specific hybridization to DNA and RNA under
conditions of low ionic strength. The synthesis of PNA oligomers
can be performed using standard solid phase peptide synthesis
protocols as described in Hyrup and Nielsen (1996) supra and
Perry-O'Keefe et al. (1996) Proc Natl. Acad. Sci. USA
93:14670-675.
[0429] PNAs of VISTA nucleic acid molecules can be used in
therapeutic and diagnostic applications. For example, PNA scan be
used as antisense or antigene agents for sequence-specific
modulation of gene expression by, for example, inducing
transcription or translation arrest or inhibiting replication. PNAs
of VISTA nucleic acid molecules can also be used in the analysis of
single base pair mutations in a gene (e.g., by PNA-directed PCR
clamping); as `artificial restriction enzymes` when used in
combination with other enzymes (e.g., S1 nucleases (Hyrup and
Nielsen (1996) supra)); or as probes or primers for DNA sequencing
or hybridization (Hyrup and Nielsen (1996) supra; Perry-O'Keefe et
al. (1996) supra).
[0430] PNAs of VISTA can be modified (e.g., to enhance their
stability or cellular uptake), by attaching lipophilic or other
helper groups to PNA, by the formation of PNA-DNA chimeras, or by
the use of liposomes or other techniques of drug delivery known in
the art. For example, PNA-DNA chimeras of VISTA nucleic acid
molecules can be generated which may combine the advantageous
properties of PNA and DNA. Such chimeras allow DNA recognition
enzymes (e.g., RNAse H and DNA polymerases), to interact with the
DNA portion while the PNA portion would provide high binding
affinity and specificity. PNA-DNA chimeras can be linked using
linkers of appropriate lengths selected in terms of base stacking,
number of bonds between the nucleobases, and orientation (Hyrup and
Nielsen (1996) supra). The synthesis of PNA-DNA chimeras can be
performed as described in Hyrup and Nielsen (1996) supra and Finn
P. J. et al. (1996) Nucleic Acids Res. 24 (17):3357-63. For
example, a DNA chain can be synthesized on a solid support using
standard phosphoramidite coupling chemistry and modified nucleoside
analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine
phosphoramidite, can be used as a bridge between the PNA and the 5'
end of DNA (Mag, M. et al. (1989) Nucleic Acids Res. 17:5973-88).
PNA monomers are then coupled in a stepwise manner to produce a
chimeric molecule with a 5' PNA segment and a 3' DNA segment (Finn
P. J. et al. (1996) supra). Alternatively, chimeric molecules can
be synthesized with a 5' DNA segment and a 3' PNA segment
(Peterser, et al. (1975) Bioorganic Med. Chem. Lett.
5:1119-11124).
Oligonucleotide
[0431] The oligonucleotide may include other appended groups such
as peptides (e.g., for targeting host cell receptors in vivo), or
agents facilitating transport across the cell membrane (See, e.g.,
Letsinger et al. (1989) Proc Natl. Acad. Sci. USA 86:6553-6556;
Lemaitre et al. (1987) Proc Natl. Acad. Sci. USA 84:648-652; PCT
Publication No. WO 88/09810) or the blood-brain barrier (see, e.g.,
PCT Publication No. WO 89/10134). In addition, oligonucleotides can
be modified with hybridization-triggered cleavage agents (See,
e.g., Krol et al. (1988) Biotechniques 6:958-976) or intercalating
agents (See, e.g., Zon (1988) Pharm. Res. 5:539-549). To this end,
the oligonucleotide may be conjugated to another molecule (e.g., a
peptide, hybridization triggered cross-linking agent, transport
agent, or hybridization-triggered cleavage agent).
siRNA
[0432] Small interfering RNA (siRNA) is a class of double-stranded
RNA molecules usually about 20-25 nucleotides in length that bind
to a specific mRNA and direct it to mRNA degradation, thus
suppressing the transcription (e.g., expression) of the gene. See
Hamilton & Baulcombe (1999) Science 286(5441): 950-2 and
Elbashir, et al. (2001) Nature 411(6836): 494-8. It is also
possible to take advantage of ribozyme or RNA interference (siRNA)
technology, which prevents a gene from producing a functional
protein by destroying the messenger RNA. An siRNA molecule may bind
to VISTA mRNA transcribed from a VISTA DNA comprising the nucleic
acid sequence of SEQ ID NO: 1 or 3. A siRNA molecule may bind to
VISTA mRNA transcribed from a VISTA DNA encoding the amino acid
sequence set forth in SEQ ID NO: 2, 4 or 5.
[0433] A siRNA molecule which targets VISTA mRNA transcribed from a
VISTA DNA may comprise the nucleic acid sequence of SEQ ID NO: 1 or
3. A siRNA molecule which targets VISTA mRNA transcribed from a
VISTA DNA encoding the amino acid sequence set forth in SEQ ID NO:
2, 4 or 5. The siRNA molecule that targets VISTA may comprise the
nucleic acid sequence of any one of SEQ ID NOs: 38-67. A siRNA
molecule that targets either the ORF or UTR region of VISTA may
comprise the amino acid sequence of any one of SEQ ID NO: 38-47. A
siRNA molecule that targets the UTR region only of VISTA may
comprise the amino acid sequence of any one of SEQ ID NO: 48-57. A
siRNA molecule that targets the ORF region only of VISTA may
comprise the amino acid sequence of any one of SEQ ID NO: 58-67. A
siRNA molecule that targets VISTA may consist of the nucleic acid
sequence of any one of SEQ ID NOs: 38-67. A siRNA molecule that
targets either the ORF or UTR region of VISTA may consist of the
amino acid sequence of any one of SEQ ID NO: 38-47. A siRNA
molecule that targets the UTR region only of VISTA may consist the
amino acid sequence of any one of SEQ ID NO: 48-57. A siRNA
molecule that targets the ORF region only of VISTA may consist the
amino acid sequence of any one of SEQ ID NO: 58-67.
TABLE-US-00001 TABLE 1 siRNA for human VISTA Target region siRNA
sequence of VISTA SEQ ID NO: GGGCACGATGTGACCTTCTACAAGA ORF 38
CAGATGCCAAATGACTTACATCTTA UTR3 39 GAGATGGATTGTAAGAGCCAGTTTA UTR3 40
GGGCTTTGAGGAGAGGGTAAACATA UTR3 41 CCTATCTCCTGACATTCACAGTTTA UTR3 42
CAGTTTAATAGAGACTTCCTGCCTT UTR3 43 CAGGGAGAGGCTGAAGGAATGGAAT UTR3 44
GGAATGTGTTGAGAGGGATTCTGAA UTR3 45 GAGAGGGATTCTGAATGATCAATAT UTR3 46
CACAGAGGGCAATAGAGGTTCTGAA UTR3 47 CAGATGCCAAATGACTTACATCTTA UTR3 48
GAGATGGATTGTAAGAGCCAGTTTA UTR3 49 GGTGAGTCCTCTGTGGAATTGTGAT UTR3 50
GGGCTTTGAGGAGAGGGTAAACATA UTR3 51 CCTATCTCCTGACATTCACAGTTTA UTR3 52
CAGTTTAATAGAGACTTCCTGCCTT UTR3 53 CAGGGAGAGGCTGAAGGAATGGAAT UTR3 54
GGAATGTGTTGAGAGGGATTCTGAA UTR3 55 GAGAGGGATTCTGAATGATCAATAT UTR3 56
CACAGAGGGCAATAGAGGTTCTGAA UTR3 57 ACAAAGGGCACGATGTGACCTTCTA ORF 58
GGGCACGATGTGACCTTCTACAAGA ORF 59 GACCACCATGGCAACTTCTCCATCA ORF 60
CAGACAGGCAAAGATGCACCATCCA ORF 61 GGCAAAGATGCACCATCCAACTGTG ORF 62
CCATCCAACTGTGTGGTGTACCCAT ORF 63 GGATGGACAGCAACATTCAAGGGAT ORF 64
GACAGCAACATTCAAGGGATTGAAA ORF 65 CCCTGTCCCTGACTCTCCAAACTTT ORF 66
CCTGACTCTCCAAACTTTGAGGTCA ORF 67
Expression
[0434] Isolation and expression of the VISTA and VISTA conjugate of
the invention may be effected by well-established cloning
procedures using probes or primers constructed based on the VISTA
and VISTA conjugate nucleic acids sequences disclosed in the
application. Related VISTA and VISTA conjugate sequences may also
be identified from human or other species genomic databases using
the sequences disclosed herein and known computer-based search
technologies, e.g., BLAST sequence searching. The pseudogenes
disclosed herein may be used to identify functional alleles or
related genes.
[0435] Expression vectors can then be used to infect or transfect
host cells for the functional expression of these sequences. These
genes and vectors can be made and expressed in vitro or in vivo.
One of skill will recognize that desired phenotypes for altering
and controlling nucleic acid expression can be obtained by
modulating the expression or activity of the genes and nucleic
acids (e.g., promoters, enhancers) within the vectors of the
invention. Any of the known methods described for increasing or
decreasing expression or activity can be used.
[0436] In another embodiment, the recombinant mammalian expression
vector is capable of directing expression of the nucleic acid
preferentially in a particular cell type (e.g., tissue-specific
regulatory elements are used to express the nucleic acid).
Tissue-specific regulatory elements are known in the art.
Non-limiting examples of suitable tissue-specific promoters include
the albumin promoter (liver-specific; Pinkert et al. (1987) Genes
Dev. 1:268-277), lymphoid-specific promoters (Calame and Eaton
(1988) Adv. Immunol. 43:235-275), particular promoters of T cell
receptors (Winoto and Baltimore (1989) EMBO J. 8:729-733) and
immunoglobulins (Banerji et al. (1983) Cell 33:729-740; Queen and
Baltimore (1983) Cell 33:741-748), neuron-specific promoters (e.g.,
the neurofilament promoter; Byrne and Ruddle (1989) Proc Natl.
Acad. Sci. USA 86:5473-5477), pancreas-specific promoters (Edlund
et al. (1985) Science 230:912-916), and mammary gland-specific
promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and
European Application Publication No. 264,166).
Developmentally-regulated promoters are also encompassed, for
example by the murine hox promoters (Kessel and Gruss (1990)
Science 249:374-379) and the .alpha.-fetoprotein promoter (Campes
and Tilghman (1989) Genes Dev. 3: 537-546).
[0437] The polynucleotide sequences provided herein may be
generated according to any oligonucleotide synthesis method known
in the art such as enzymatic synthesis or solid phase synthesis.
Equipment and reagents for executing solid-phase synthesis are
commercially available from, for example, Applied Biosystems. Any
other means for such synthesis may also be employed; the actual
synthesis of the polynucleotides is well within the capabilities of
one skilled in the art. See, e.g., Maniatis, et al. (2001)
Molecular Cloning: A Laboratory Manual [3.sup.rd Ed.] Cold Spring
Harbor Laboratory Press; Swamy (2008) Laboratory Manual on
Biotechnology Rastogi Publications; Herdewijn (2005) [Ed.] Methods
in Molecular Biolog: Oligonucleotide Synthesis: Methods and
Applications Volume 288 Humana Press; and Rapley (2000) [Ed.] The
Nucleic Acid Protocols Handbook Humana Press. Double-stranded DNA
fragments may then be obtained either by synthesizing the
complementary strand and annealing the strands together under
appropriate conditions, or by adding the complementary strand using
DNA polymerase with an appropriate primer sequence.
[0438] Techniques for the manipulation of nucleic acids, such as,
for example, for generating mutations in sequences, subcloning,
labeling probes, sequencing, hybridization are well described in
the scientific and patent literature. See, e.g., Sambrook, et al.
(2001) (Eds.) Molecular Cloning: A Laboratory Manual (3.sup.rd Ed.)
Cold Spring Harbor Laboratory; Ausubel, et al. (2011) Ed., Current
Protocols in Molecular Biology, John Wiley & Sons, Inc., New
York; Tijssen (1993) [Ed.] Laboratory Techniques in Biochemistry
and Molecular Biology: Hybridization With Nucleic Acid Probes, Part
I, Theory and Nucleic Acid Preparation, Elsevier, N.Y.
[0439] Hybridization and the strength of hybridization (e.g., the
strength of the association between polynucleotides) is impacted by
many factors well known in the art including the degree of
complementarity between the polynucleotides, and the stringency of
the conditions involved, which is affected by such conditions as
the concentration of salts, the presence of other components (e.g.,
the presence or absence of polyethylene glycol), the molarity of
the hybridizing strands and the G+C content of the polynucleotide
strands, all of which results in a characteristic melting
temperature (T.sub.m) of the formed hybrid. Techniques of nucleic
acid hybridization are disclosed by Sambrook, et al. (2001) (Eds.)
Molecular Cloning: A Laboratory Manual [3.sup.rd Ed.] Cold Spring
Harbor Laboratory, and by Hayrnes, et al. (1985) in NUCLEIC ACID
HYBRIDIZATION, A PRACTICAL APPROACH (IRL Press, DC). Hybridization
wash conditions may include wash solution of 0.2.times.SSC/0.1% SDS
and incubation with rotation for 10 minutes at room temperature,
(low stringency wash), wash solution of prewarmed (42.degree. C.)
0.2.times.SSC/0.1% SDS and incubation with rotation for 15 minutes
at 42.degree. C. (medium stringency wash) and wash solution of
prewarmed (68.degree. C.) 0.1.times.SSC/0.1% SDS and incubation
with rotation for 15 minutes at 68.degree. C. (high stringency
wash). See Ausubel, et al. (2011) [Ed.] Current Protocols in
Molecular Biology John Wiley & Sons, Inc.
[0440] Oligonucleotide primers may be used to amplify nucleic acids
encoding a VISTA and VISTA conjugate. The nucleic acids described
herein can also be cloned or measured quantitatively using
amplification techniques. Amplification methods are also well known
in the art, and include, e.g., polymerase chain reaction (PCR)
(Innis (1990) [Ed.] PCR Protocols, a Guide to Methods and
Applications, Academic Press, NY.; Innis (1995) [Ed.] PCR
Strategies, Academic Press, Inc., NY.); ligase chain reaction (LCR)
(Wu (1989) Genomics 4: 560; Landegren (1988) Science 241: 1077;
Barringer (1990) Gene 89: 117); transcription amplification (Kwoh
(1989) PNAS 86: 1173); self-sustained sequence replication
(Guatelli (1990) PNAS 87: 1874); Q Beta replicase amplification
(Smith (1997) J. Clin. Microbiol. 35: 1477-91)); automated Q-beta
replicase amplification assay (Burg (1996) Mol. Cell. Probes 10:
257-71); and other RNA polymerase mediated techniques (e.g., NASBA,
Cangene, Mississauga, Ontario). See, also, Berger (1987) Methods
Enzymol. 152: 307-16; Sambrook, et al. (2001) (Eds.) Molecular
Cloning: A Laboratory Manual (3.sup.rd Ed.) Cold Spring Harbor
Laboratory; Ausubel, et al. (2011) [Ed.] Current Protocols in
Molecular Biology, John Wiley & Sons, Inc., New York; Maniatis,
et al. (2001) Molecular Cloning: A Laboratory Manual [3.sup.rd Ed.]
Cold Spring Harbor Laboratory Press; U.S. Pat. Nos. 4,683,195 and
4,683,202; Sooknanan (1995) Biotechnology 13: 563-64.
[0441] Paradigms to design degenerate primer pairs are well known
in the art. For example, a COnsensus-DEgenerate Hybrid
Oligonucleotide Primer (CODEHOP) strategy computer program is
readily accessible and is directly linked from the BlockMaker
multiple sequence alignment sites for hybrid primer prediction
beginning with a set of related protein sequences, such as the
VISTA and VISTA conjugate sequences provided herein. See, e.g.,
Rose (1998) Nucleic Acids Res. 26: 1628-35; Singh (1998)
Biotechniques 24: 318-19.
[0442] Polymorphic variants, alleles, and interspecies homologs
that are substantially identical to VISTA and VISTA conjugate
disclosed herein may be isolated using the nucleic acid probes
described above. Alternatively, expression libraries can be used to
clone VISTA and VISTA conjugates and polymorphic variants, alleles,
and interspecies homologs thereof, by detecting expressed homologs
immunologically with antisera or purified antibodies made against a
VISTA and VISTA conjugate, which also recognize and selectively
bind to the VISTA or VISTA conjugate homolog.
[0443] Nucleic acids that encode VISTA and VISTA conjugate may be
generated by amplification (e.g., PCR) of appropriate nucleic acid
sequences using appropriate (perfect or degenerate) primer pairs.
The amplified nucleic acid can be genomic DNA from any cell or
tissue or mRNA or cDNA derived from VISTA or VISTA conjugate
expressing cells. Methods for expression of heterologous sequences
in host cells are well known in the art. See, e.g., Maniatis, et
al. (2001) Molecular Cloning: A Laboratory Manual [3.sup.rd Ed.]
Cold Spring Harbor Laboratory Press.
Fusion Proteins Comprising a VISTA and VISTA Conjugate
[0444] Hybrid protein-coding sequences comprising nucleic acids
encoding VISTA and VISTA conjugate fused to a translocation
sequences may be constructed. Also provided are hybrid VISTA and
VISTA conjugate comprising the motifs and antigenic regions. These
nucleic acid sequences may be operably linked to transcriptional or
translational control elements, e.g., transcription and translation
initiation sequences, promoters and enhancers, transcription and
translation terminators, polyadenylation sequences, and other
sequences useful for transcribing DNA into RNA. In construction of
recombinant expression cassettes, vectors, and transgenics, a
promoter fragment can be employed to direct expression of the
desired nucleic acid in all desired cells or tissues.
[0445] Fusion proteins may comprise C-terminal or N-terminal
translocation sequences. Further, fusion proteins can comprise
additional elements, e.g., for protein detection, purification, or
other applications. Detection and purification facilitating domains
include, e.g., metal chelating peptides such as polyhistidine
tracts, histidine-tryptophan modules, or other domains that allow
purification on immobilized metals; maltose binding protein;
protein A domains that allow purification on immobilized
immunoglobulin; or the domain utilized in the FLAGS
extension/affinity purification system (Immunex Corp, Seattle
Wash.)
[0446] The inclusion of a cleavable linker sequences such as Factor
Xa (see, e.g., Ottavi, (1998) Biochimie 80: 289-93), subtilisin
protease recognition motif (see, e.g., Polyak (1997) Protein Eng.
10: 615-19); enterokinase (Invitrogen, San Diego, Calif.), between
the translocation domain (for efficient plasma membrane expression)
and the rest of the newly translated polypeptide may be useful to
facilitate purification. For example, one construct can include a
polypeptide encoding a nucleic acid sequence linked to six
histidine residues followed by a thioredoxin, an enterokinase
cleavage site (see, e.g., Williams (1995) Biochemistry 34:
1787-97), and an C-terminal translocation domain. The histidine
residues facilitate detection and purification while the
enterokinase cleavage site provides a means for purifying the
desired protein(s) from the remainder of the fusion protein.
Technology pertaining to vectors encoding fusion proteins and
application of fusion proteins are well described in the scientific
and patent literature. See, e.g., Kroll (1993) DNA Cell. Biol. 12:
441-53.
Systems for Recombinant Expression of the VISTA and VISTA
Conjugate
[0447] Expression vectors, either as individual expression vectors
or as libraries of expression vectors, comprising the
ligand-binding region encoding sequences may be introduced into a
genome or into the cytoplasm or a nucleus of a cell and expressed
by a variety of conventional techniques, well described in the
scientific and patent literature. See, e.g., Sambrook, et al.
(2001) [Eds.] Molecular Cloning: A Laboratory Manual (3.sup.rd Ed.)
Cold Spring Harbor Laboratory; Ausubel, et al. (2011) [Ed.] Current
Protocols in Molecular Biology John Wiley & Sons, Inc.
[0448] The nucleic acids can be expressed in expression cassettes,
vectors or viruses which are stably or transiently expressed in
cells (e.g., episomal expression systems). Selection markers can be
incorporated into expression cassettes and vectors to confer a
selectable phenotype on transformed cells and sequences. For
example, selection markers can code for episomal maintenance and
replication such that integration into the host genome is not
required. For example, the marker may encode antibiotic resistance
(e.g., chloramphenicol, kanamycin, G418, bleomycin, hygromycin) or
herbicide resistance (e.g., chlorosulfurone or Basta) to permit
selection of those cells transformed with the desired DNA
sequences. See, e.g., Ausubel, et al. (2011) [Ed.] Current
Protocols in Molecular Biology John Wiley & Sons, Inc.; and
Walker & Papley (2009) Molecular Biology and Biotechnology
[5.sup.th Ed.] Royal Society of Chemistry. Because selectable
marker genes conferring resistance to substrates like neomycin or
hygromycin can only be utilized in tissue culture, chemoresistance
genes are also used as selectable markers in vitro and in vivo.
[0449] To enable cellular expression of the polynucleotides of the
present invention, a nucleic acid construct according to the
present invention may be used, which includes at least a coding
region of one of the above nucleic acid sequences, and further
includes at least one cis acting regulatory element. Preferably,
the promoter utilized by the nucleic acid construct of the present
invention is active in the specific cell population transformed.
Examples of cell type-specific and/or tissue-specific promoters are
well-known in the art. See Bernardi (2003) [Ed.] Gene Transfer and
Expression in Mammalian Cells Volume 38 Elsevier Science B.V. The
nucleic acid construct of the present invention can further include
an enhancer, which can be adjacent or distant to the promoter
sequence and can function in up regulating the transcription
therefrom.
[0450] The nucleic acid construct of the present invention
preferably further includes an appropriate selectable marker and/or
an origin of replication. Preferably, the nucleic acid construct
utilized is a shuttle vector, which can propagate both in E. coli
(wherein the construct comprises an appropriate selectable marker
and origin of replication) and be compatible for propagation in
cells, or integration in a gene and a tissue of choice. The
construct according to the present invention can be, for example, a
plasmid, a bacmid, a phagemid, a cosmid, a phage, a virus or an
artificial chromosome.
[0451] Examples of suitable constructs include, but are not limited
to, pcDNA3, pcDNA3.1 (+/-), pGL3, PzeoSV2 (+/-), pDisplay,
pEF/myc/cyto, pCMV/myc/cyto each of which is commercially available
from Invitrogen Co. (Carlsbad, Calif.) Examples of retroviral
vector and packaging systems are those sold by Clontech (San Diego,
Calif.), including Retro-X vectors pLNCX and pLXSN, which permit
cloning into multiple cloning sites and the transgene is
transcribed from CMV promoter. Vectors derived from Mo-MuLV are
also included such as pBabe, where the transgene are transcribed
from the 5' LTR promoter.
[0452] The recombinant expression vectors of the invention comprise
a nucleic acid of the invention in a form suitable for expression
of the nucleic acid in a host cell, which means that the
recombinant expression vectors include one or more regulatory
sequences, selected on the basis of the host cells to be used for
expression, that is operatively-linked to the nucleic acid sequence
to be expressed. Within a recombinant expression vector,
"operably-linked" is intended to mean that the nucleotide sequence
of interest is linked to the regulatory sequence(s) in a manner
that allows for expression of the nucleotide sequence (e.g., in an
in vitro transcription/translation system or in a host cell when
the vector is introduced into the host cell).
[0453] The term "regulatory sequence" is intended to includes
promoters, enhancers and other expression control elements (e.g.,
polyadenylation signals). Such regulatory sequences are described,
for example, in Goeddel (1990) Gene Expression Technology: Methods
in Enzymology 185, Academic Press, San Diego, Calif. Regulatory
sequences include those that direct constitutive expression of a
nucleotide sequence in many types of host cell and those that
direct expression of the nucleotide sequence only in certain host
cells (e.g., tissue-specific regulatory sequences). It are
appreciated by those skilled in the art that the design of the
expression vector can depend on such factors as the choice of the
host cell to be transformed, the level of expression of protein
desired. The expression vectors of the invention can be introduced
into host cells to thereby produce proteins or peptides, including
fusion proteins or peptides, encoded by nucleic acids as described
herein.
[0454] The recombinant expression vectors of the invention may be
designed for production of variant proteins in prokaryotic or
eukaryotic cells. For example, proteins of the invention can be
expressed in bacterial cells such as Escherichia coli, insect cells
(e.g., using baculovirus expression vectors), yeast cells, or
mammalian cells. Suitable host cells are discussed further in
Goeddel (1990) Gene Expression Technology: Methods in Enzymology
185, Academic Press, San Diego, Calif. Alternatively, the
recombinant expression vector can be transcribed and translated in
vitro, for example using T7 promoter regulatory sequences and T7
polymerase.
[0455] Expression of proteins in prokaryotes is most often carried
out in Escherichia coli with vectors containing constitutive or
inducible promoters directing the expression of either fusion or
non-fusion proteins. Fusion vectors add a number of amino acids to
a protein encoded therein, to the amino or C terminus of the
recombinant protein. Such fusion vectors typically serve three
purposes: (i) to increase expression of recombinant protein; (ii)
to increase the solubility of the recombinant protein; and (iii) to
aid in the purification of the recombinant protein by acting as a
ligand in affinity purification. Often, in fusion expression
vectors, a proteolytic cleavage site is introduced at the junction
of the fusion moiety and the recombinant protein to enable
separation of the recombinant protein from the fusion moiety
subsequent to purification of the fusion protein. Such enzymes, and
their cognate recognition sequences, include Factor Xa, thrombin,
PreScission, TEV and enterokinase. Typical fusion expression
vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson
(1988) Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.)
and pRIT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione
5-transferase (GST), maltose E binding protein, or protein A,
respectively, to the target recombinant protein.
[0456] The recombinant mammalian expression vector is capable of
directing expression of the nucleic acid may be in a particular
cell type (e.g., tissue-specific regulatory elements are used to
express the nucleic acid). Tissue-specific regulatory elements are
known in the art. For efficient production of the protein, it is
preferable to place the nucleotide sequences encoding the protein
of the invention under the control of expression control sequences
optimized for expression in a desired host. For example, the
sequences may include optimized transcriptional and/or
translational regulatory sequences (e.g., altered Kozak
sequences).
[0457] One strategy to maximize recombinant protein expression in
E. coli is to express the protein in a host bacterium with an
impaired capacity to proteolytically cleave the recombinant
protein. See, e.g., Gottesman (1990) Gene Expression Technology:
Methods in Enzymology Academic Press, San Diego, Calif. 185:
119-128. Another strategy is to alter the nucleic acid sequence of
the nucleic acid to be inserted into an expression vector so that
the individual codons for each amino acid are those preferentially
utilized in E. coli. See, e.g., Wada, et al. (1992) Nucl. Acids
Res. 20: 2111-2118. Such alteration of nucleic acid sequences of
the invention can be carried out by standard DNA synthesis
techniques. Another strategy to solve codon bias is by using
BL21-codon plus bacterial strains (Invitrogen) or Rosetta bacterial
strain (Novagen), these strains contain extra copies of rare E.
coli tRNA genes.
[0458] The expression vector encoding for the protein of the
invention may be a yeast expression vector. Examples of vectors for
expression in yeast Saccharomyces cerevisiae include pYepSec1
(Baldari, et al. (1987) EMBO J. 6: 229-234), pMFa (Kurjan and
Herskowitz (1982) Cell 30: 933-943), pJRY88 (Schultz, et al. (1987)
Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego,
Calif.), and picZ (Invitrogen Corp, San Diego, Calif.)
[0459] Alternatively, polypeptides of the present invention can be
produced in insect cells using baculovirus expression vectors.
Baculovirus vectors available for expression of proteins in
cultured insect cells (e.g., SF9 cells) include the pAc series
(Smith, et al. (1983) Mol. Cell. Biol. 3: 2156-2165) and the pVL
series (Lucklow and Summers (1989) Virology 170: 31-39). In yet
another embodiment, a nucleic acid of the invention is expressed in
mammalian cells using a mammalian expression vector. Examples of
mammalian expression vectors include pCDM8 (Seed (1987) Nature 329:
840) and pMT2PC (Kaufman, et al. (1987) EMBO J. 6: 187-195),
pIRESpuro (Clontech), pUB6 (Invitrogen), pCEP4 (Invitrogen) pREP4
(Invitrogen), pcDNA3 (Invitrogen). When used in mammalian cells,
the expression vector's control functions are often provided by
viral regulatory elements. For example, commonly used promoters are
derived from polyoma, adenovirus 2, cytomegalovirus, Rous Sarcoma
Virus, and simian virus 40. For other suitable expression systems
for both prokaryotic and eukaryotic cells see, e.g., Sambrook, et
al. (2001) (Eds.) Molecular Cloning: A Laboratory Manual (3.sup.rd
Ed.) Cold Spring Harbor Laboratory.
[0460] A host cell can be any prokaryotic or eukaryotic cell. For
example, protein of the invention can be produced in bacterial
cells such as E. coli, insect cells, yeast, plant or mammalian
cells (e.g., Chinese hamster ovary cells (CHO), COS, HEK293 cells).
Other suitable host cells are known to those skilled in the
art.
[0461] Vector DNA can be introduced into prokaryotic or eukaryotic
cells via conventional transformation or transfection techniques.
As used herein, the terms "transformation" and "transfection" are
intended to refer to a variety of art-recognized techniques for
introducing foreign nucleic acid (e.g., DNA) into a host cell,
including calcium phosphate or calcium chloride co-precipitation,
DEAE-dextran-mediated transfection, lipofection, or
electroporation. Suitable methods for transforming or transfecting
host cells can be found in Sambrook, et al. (2001) [Eds.] Molecular
Cloning: A Laboratory Manual (3.sup.rd Ed.) Cold Spring Harbor
Laboratory and other laboratory manuals.
[0462] Any of the well-known procedures for introducing foreign
nucleotide sequences into host cells may be used. These include the
use of calcium phosphate transfection, polybrene, protoplast
fusion, electroporation, liposomes, microinjection, plasma vectors,
viral vectors and any of the other well known methods for
introducing cloned genomic DNA, cDNA, synthetic DNA or other
foreign genetic material into a host cell. See, e.g., Sambrook, et
al. (2001) (Eds.) Molecular Cloning: A Laboratory Manual (3.sup.rd
Ed.) Cold Spring Harbor Laboratory and Walker & Papley (2009)
Molecular Biology and Biotechnology [5.sup.th Ed.]Royal Society of
Chemistry. It is only necessary that the particular genetic
engineering procedure used be capable of successfully introducing
at lest one nucleic acid molecule into the host cell capable of
expressing the VISTA and VISTA conjugate, fragment, or variant of
interest.
[0463] For stable transfection of mammalian cells, it is known
that, depending upon the expression vector and transfection
technique used, only a small fraction of cells may integrate the
foreign DNA into their genome. In order to identify and select
these integrants, a gene that encodes a selectable marker (e.g.,
resistance to antibiotics) is generally introduced into the host
cells along with the gene of interest. Various selectable markers
include those that confer resistance to drugs, such as G418,
hygromycin, puromycin, blasticidin and methotrexate. Nucleic acids
encoding a selectable marker can be introduced into a host cell on
the same vector as that encoding protein of the invention or can be
introduced on a separate vector. Cells stably transfected with the
introduced nucleic acid can be identified by drug selection (e.g.,
cells that have incorporated the selectable marker gene will
survive, while the other cells die).
[0464] A host cell of the invention, such as a prokaryotic or
eukaryotic host cell in culture, can be used to produce (i.e.,
express) protein of the invention. Accordingly, the invention
further provides methods for producing proteins of the invention
using the host cells of the invention. In one embodiment, the
method comprises culturing the host cell of the present invention
(into which a recombinant expression vector encoding protein of the
invention has been introduced) in a suitable medium such that the
protein of the invention is produced. In another embodiment, the
method further comprises isolating protein of the invention from
the medium or the host cell.
[0465] After the expression vector is introduced into the cells,
the transfected cells are cultured under conditions favoring
expression of the receptor, fragment, or variant of interest, which
is then recovered from the culture using standard techniques.
Examples of such techniques are well known in the art. See, e.g.,
WO 00/06593.
Antibodies Which Bind VISTA or VISTA Conjugates
[0466] The present invention also provides antibodies which
selectively bind the VISTA and VISTA conjugate including but not
limited monoclonal and humanized monoclonal antibodies. The
antibodies which selectively bind the VISTA and VISTA conjugate may
be admixed in compositions with pharmaceutical carriers and
additional antibodies (e.g., anti-PD-L1, PD-L2 or CTLA-4
antibodies).
[0467] An isolated VISTA polypeptide, or a portion or fragment
thereof, can be used as an immunogen to generate antibodies that
bind VISTA using standard techniques for polyclonal and monoclonal
antibody preparation. A full-length VISTA polypeptide can be used
or, alternatively, the invention provides antigenic peptide
fragments of VISTA for use as immunogens. In one embodiment, an
antigenic peptide of VISTA comprises at least 8 amino acid residues
of the amino acid sequence shown in SEQ ID NO: 2, 4 or 5 and
encompasses an epitope of VISTA such that an antibody raised
against the peptide forms a specific immune complex with the VISTA
polypeptide. Preferably, the antigenic peptide comprises at least
10 amino acid residues, more preferably at least 15 amino acid
residues, even more preferably at least 20 amino acid residues, and
most preferably at least 30 amino acid residues. Preferred epitopes
encompassed by the antigenic peptide are regions of VISTA that are
located in the extracellular domain of the polypeptide, e.g.,
hydrophilic regions, as well as regions with high antigenicity.
[0468] A VISTA immunogen typically is used to prepare antibodies by
immunizing a suitable subject (e.g., rabbit, goat, mouse, or other
mammal) with the immunogen. An appropriate immunogenic preparation
can contain, for example, recombinantly expressed VISTA polypeptide
or a chemically synthesized VISTA polypeptide. The preparation can
further include an adjuvant, such as Freund's complete or
incomplete adjuvant, or similar immunostimulatory agent.
Immunization of a suitable subject with an immunogenic VISTA
preparation induces a polyclonal anti-VISTA antibody response.
[0469] Antibodies may comprise of two identical light polypeptide
chains of molecular weight approximately 23,000 daltons ("light
chain"), and two identical heavy chains of molecular weight
53,000-70,000 ("heavy chain"). See Edelman (1971) Ann. NY. Acad.
Sci. 190: 5. The four chains are joined by disulfide bonds in a "Y"
configuration wherein the light chains bracket the heavy chains
starting at the mouth of the "Y" configuration. The "branch"
portion of the "Y" configuration is designated the F.sub.ab region;
the stem portion of the "Y" configuration is designated the F.sub.C
region. The amino acid sequence orientation runs from the
N-terminal end at the top of the "Y" configuration to the
C-terminal end at the bottom of each chain. The N-terminal end
possesses the variable region having specificity for the antigen
that elicited it, and is about 100 amino acids in length, there
being slight variations between light and heavy chain and from
antibody to antibody.
[0470] The variable region is linked in each chain to a constant
region that extends the remaining length of the chain and that
within a particular class of antibody does not vary with the
specificity of the antibody (i.e., the antigen eliciting it). There
are five known major classes of constant regions that determine the
class of the immunoglobulin molecule (e.g., IgG, IgM, IgA, IgD, and
IgE corresponding to .gamma., .mu., .alpha., .delta., and .epsilon.
heavy chain constant regions). The constant region or class
determines subsequent effector function of the antibody, including
activation of complement (Kabat (1976) Structural Concepts in
Immunology and Immunochemistry [2.sup.nd Ed.] pages 413-436; Holt,
Rinehart, Winston) and other cellular responses (Andrews, et al.
(1980) Clinical Immunobiology 1-18; Kohl, et al. (1983) Immunology
48: 187) while the variable region determines the antigen with
which it will react. Light chains are classified as either .kappa.
(kappa) or .lamda. (lambda). Each heavy chain class may be prepared
with either kappa or lambda light chain. The light and heavy chains
are covalently bonded to each other, and the "tail" portions of the
two heavy chains are bonded to each other by covalent disulfide
linkages when the immunoglobulins are generated either by
hybridomas or by B cells.
[0471] Specific binding to an antibody under such conditions may
require an antibody that is selected for its specificity for a
particular protein. For example, polyclonal antibodies raised to
seminal basic protein from specific species such as rat, mouse, or
human can be selected to obtain only those polyclonal antibodies
that are specifically immunoreactive with seminal basic protein and
not with other proteins, except for polymorphic variants and
alleles of seminal basic protein. This selection may be achieved by
subtracting out antibodies that cross-react with seminal basic
protein molecules from other species. A variety of immunoassay
formats may be used to select antibodies specifically
immunoreactive with a particular protein. For example, solid-phase
ELISA immunoassays are routinely used to select antibodies
specifically immunoreactive with a protein. See, e.g., Harlow &
Lane (1998) USING ANTIBODIES: A LABORATORY MANUAL Cold Spring
Harbor Laboratory, for a description of immunoassay formats and
conditions that can be used to determine specific immunoreactivity.
Typically a specific or selective reaction are at least twice
background signal or noise and more typically more than about 10 to
100 times background.
[0472] Antibodies may be screened to identify those that bind to
specific epitopes of VISTA, e.g. in the IgV domain or other
specific domains and/or to select antibodies possessing high
affinity and avidity to VISTA protein. In addition these antibodies
are screened to identify those of which modulate specific functions
and effects of VISTA on immunity and immune cells in vitro and in
vivo. For example assays can be conducted to ascertain the
modulatory effect, if any, of a particular anti-VISTA antibody on
immune functions negatively regulated by VISTA including cytokine
production by CD4+ or CD8+ T cells, CD28 costimulation, CD4+ T cell
proliferation, and the proliferation of naive and memory CD4+ T
cells, et al. In an embodiment assays are conducted to identify
potential therapeutic anti-VISTA antibodies which in vitro, when
the presence of VISTA-Ig enhance the suppression by VISTA-Ig as
these anti-VISTA antibodies behave oppositely in vivo, i.e., they
are immunosuppressive. The invention encompasses anti-VISTA
antibodies and use thereof that specifically bind to the 136 amino
acid extracellular domain, e.g., to amino acids 1-50, 50-100,
100-136, antibodies that specifically bind the IgV, antibodies that
specifically bind the stalk region, antibodies that specifically
bind the transmembrane region and antibodies that specifically bind
the cytoplasmic region of VISTA. These specific regions are
identified in the application.
[0473] In another embodiment, the recombinant mammalian expression
vector is capable of directing expression of the nucleic acid
preferentially in a particular cell type (e.g., tissue-specific
regulatory elements are used to express the nucleic acid).
Tissue-specific regulatory elements are known in the art.
Non-limiting examples of suitable tissue-specific promoters include
the albumin promoter (liver-specific; Pinkert et al. (1987) Genes
Dev. 1:268-277), lymphoid-specific promoters (Calame and Eaton
(1988) Adv. Immunol. 43:235-275), particular promoters of T cell
receptors (Winoto and Baltimore (1989) EMBO J. 8:729-733) and
immunoglobulins (Banerji et al. (1983) Cell 33:729-740; Queen and
Baltimore (1983) Cell 33:741-748), neuron-specific promoters (e.g.,
the neurofilament promoter; Byrne and Ruddle (1989) Proc Natl.
Acad. Sci. USA 86:5473-5477), pancreas-specific promoters (Edlund
et al. (1985) Science 230:912-916), and mammary gland-specific
promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and
European Application Publication No. 264,166).
Developmentally-regulated promoters are also encompassed, for
example by the murine hox promoters (Kessel and Gruss (1990)
Science 249:374-379) and the .alpha.-fetoprotein promoter (Campes
and Tilghman (1989) Genes Dev. 3: 537-546).
Polyclonal Antibody
[0474] Polyclonal antibodies are heterogeneous populations of
antibody molecules derived from the sera of animals immunized with
an antigen. Polyclonal antibodies which selectively bind the VISTA
and VISTA conjugate may be made by methods well-known in the art.
See, e.g., Howard & Kaser (2007) Making and Using Antibodies: A
Practical Handbook CRC Press.
Monoclonal Antibody
[0475] A monoclonal antibody contains a substantially homogeneous
population of antibodies specific to antigens, which population
contains substantially similar epitope binding sites. Monoclonal
antibodies may be obtained by methods known to those skilled in the
art. See, e.g. Kohler and Milstein (1975) Nature 256: 495-497; U.S.
Pat. No. 4,376,110; Ausubel, et al. [Eds.] (2011) CURRENT PROTOCOLS
IN MOLECULAR BIOLOGY, Greene Publishing Assoc. and Wiley
Interscience, NY.; and Harlow & Lane (1998) USING ANTIBODIES: A
LABORATORY MANUAL Cold Spring Harbor Laboratory; Colligan, et al.
(2005) [Eds.] Current Protocols in Immunology Greene Publishing
Assoc. and Wiley Interscience, NY. Such antibodies may be of any
immunoglobulin class including IgG, IgM, IgE, IgA, GILD and any
subclass thereof. A hybridoma producing an antibody of the present
invention may be cultivated in vitro, in situ, or in vivo.
Chimeric Antibody
[0476] Chimeric antibodies are molecules different portions of
which are derived from different animal species, such as those
having variable region derived from a murine antibody and a human
immunoglobulin constant region, which are primarily used to reduce
immunogenicity in application and to increase yields in production,
for example, where murine monoclonal antibodies have higher yields
from hybridomas but higher immunogenicity in humans, such that
human murine chimeric monoclonal antibodies are used. Chimeric
antibodies and methods for their production are known in the art.
See Cabilly, et al. (1984) Proc. Natl. Acad. Sci. USA 81:
3273-3277; Morrison, et al. (1994) Proc. Natl. Acad. Sci. USA 81:
6851-6855, Boulianne, et al. (1984) Nature 312: 643-646; Neuberger,
et al. (1985) Nature 314: 268-270; European Patent Application
173494 (1986); WO 86/01533 (1986); European Patent Application
184187 (1986); European Patent Application 73494 (1986); Sahagan,
et al. (1986) J. Immunol. 137: 1066-1074; Liu, et al. (1987) Proc.
Natl. Acad. Sci. USA 84: 3439-3443; Sun, et al. (1987) Proc. Natl.
Acad. Sci. USA 84: 214-218; Better, et al. (1988) Science 240:
1041-1043; and Harlow & Lane (1998) USING ANTIBODIES: A
LABORATORY MANUAL Cold Spring Harbor Laboratory; U.S. Pat. No.
5,624,659.
Humanized Antibody
[0477] Humanized antibodies are engineered to contain even more
human-like immunoglobulin domains, and incorporate only the
complementarity-determining regions of the animal-derived antibody.
This may be accomplished by examining the sequence of the
hyper-variable loops of the variable regions of the monoclonal
antibody, and fitting them to the structure of the human antibody
chains. See, e.g., U.S. Pat. No. 6,187,287. Likewise, other methods
of producing humanized antibodies are now well known in the art.
See, e.g., U.S. Pat. Nos. 5,225,539; 5,530,101; 5,585,089;
5,693,762; 6,054,297; 6,180,370; 6,407,213; 6,548,640; 6,632,927;
and 6,639,055; Jones, et al. (1986) Nature 321: 522-525; Reichmann,
et al. (1988) Nature 332: 323-327; Verhoeyen, et al. (1988) Science
239: 1534-36; and Zhiqiang An (2009) [Ed.] Therapeutic Monoclonal
Antibodies: From Bench to Clinic John Wiley & Sons, Inc.
Antibody Fragments
[0478] In addition to entire immunoglobulins (or their recombinant
counterparts), immunoglobulin fragments comprising the epitope
binding site (e.g., Fab', F(ab').sub.2, or other fragments) may be
synthesized. "Fragment," or minimal immunoglobulins may be designed
utilizing recombinant immunoglobulin techniques. For instance "Fv"
immunoglobulins for use in the present invention may be produced by
synthesizing a fused variable light chain region and a variable
heavy chain region. Combinations of antibodies are also of
interest, e.g. diabodies, which comprise two distinct Fv
specificities. Antigen-binding fragments of immunoglobulins include
but are not limited to SMIPs (small molecule
immunopharmaceuticals), camelbodies, nanobodies, and IgNAR.
Anti-Idiotypic Antibody
[0479] An anti-idiotypic (anti-Id) antibody is an antibody which
recognizes unique determinants generally associated with the
antigen-binding site of an antibody. An Id antibody may be prepared
by immunizing an animal of the same species and genetic type (e.g.,
mouse strain) as the source of the antibody with the antibody to
which an anti-Id is being prepared. The immunized animal will
recognize and respond to the idiotypic determinants of the
immunizing antibody by producing an antibody to these idiotypic
determinants (the anti-ld antibody). See e.g., U.S. Pat. No.
4,699,880. The anti-Id antibody may also be used as an "immunogen"
to induce an immune response in yet another animal, producing a
so-called anti-anti-Id antibody. The anti-anti-Id may be
epitopically identical to the original antibody which induced the
anti-Id. Thus, by using antibodies to the idiotypic determinants of
an antibody it is possible to identify other clones expressing
antibodies of identical specificity.
Engineered and Modified Antibodies
[0480] An antibody of the invention further may be prepared using
an antibody having one or more of the VH and/or VL sequences
derived from an antibody starting material to engineer a modified
antibody, which modified antibody may have altered properties from
the starting antibody. An antibody may be engineered by modifying
one or more residues within one or both variable regions (i.e., VH
and/or VL), for example within one or more CDR regions and/or
within one or more framework regions. Additionally or
alternatively, an antibody may be engineered by modifying residues
within the constant region(s), for example to alter the effector
function(s) of the antibody.
[0481] One type of variable region engineering that may be
performed is CDR grafting. Antibodies interact with target antigens
predominantly through amino acid residues that are located in the
six heavy and light chain complementarity determining regions
(CDRs). For this reason, the amino acid sequences within CDRs are
more diverse between individual antibodies than sequences outside
of CDRs. Because CDR sequences are responsible for most
antibody-antigen interactions, it is possible to express
recombinant antibodies that mimic the properties of specific
naturally occurring antibodies by constructing expression vectors
that include CDR sequences from the specific naturally occurring
antibody grafted onto framework sequences from a different antibody
with different properties. See, e.g., Riechmann, et al. (1998)
Nature 332: 323-327; Jones, et al. (1986) Nature 321: 522-525;
Queen, et al. (1989) Proc. Natl. Acad. U.S.A. 86: 10029-10033; U.S.
Pat. Nos. 5,225,539; 5,530,101; 5,585,089; 5,693,762; and
6,180,370.
[0482] Suitable framework sequences may be obtained from public DNA
databases or published references that include germline antibody
gene sequences. For example, germline DNA sequences for human heavy
and light chain variable region genes may be found in the "VBase"
human germline sequence database (available on the Internet), as
well as in Kabat, E. A., et al. (1991) Sequences of Proteins of
Immunological Interest [5th Ed.]U.S. Department of Health and Human
Services, NIH Publication No. 91-3242; Tomlinson, et al. (1992)
"The Repertoire of Human Germline VH Sequences Reveals about Fifty
Groups of VH Segments with Different Hypervariable Loops" J. Mol.
Biol. 227: 776-798; and Cox, et al. (1994) Eur. J Immunol. 24:
827-836.
[0483] Another type of variable region modification is to mutate
amino acid residues within the VH and/or VL CDR 1, CDR2 and/or CDR3
regions to thereby improve one or more binding properties (e.g.,
affinity) of the antibody of interest. Site-directed mutagenesis or
PCR-mediated mutagenesis may be performed to introduce the
mutation(s) and the effect on antibody binding, or other functional
property of interest, may be evaluated in appropriate in vitro or
in vivo assays. Preferably conservative modifications (as discussed
herein) may be introduced. The mutations may be amino acid
substitutions, additions or deletions, but are preferably
substitutions. Moreover, typically no more than one, two, three,
four or five residues within a CDR region are altered.
[0484] Engineered antibodies of the invention include those in
which modifications have been made to framework residues within VH
and/or VL, e.g. to improve the properties of the antibody.
Typically such framework modifications are made to decrease the
immunogenicity of the antibody. For example, one approach is to
"backmutate" one or more framework residues to the corresponding
germline sequence. More specifically, an antibody that has
undergone somatic mutation may contain framework residues that
differ from the germline sequence from which the antibody is
derived. Such residues may be identified by comparing the antibody
framework sequences to the germline sequences from which the
antibody is derived.
[0485] In addition or alternative to modifications made within the
framework or CDR regions, antibodies of the invention may be
engineered to include modifications within the Fc region, typically
to alter one or more functional properties of the antibody, such as
serum half-life, complement fixation, Fc receptor binding, and/or
antigen-dependent cellular cytotoxicity. Furthermore, an antibody
of the invention may be chemically modified (e.g., one or more
chemical moieties may be attached to the antibody) or be modified
to alter its glycosylation, again to alter one or more functional
properties of the antibody. Such embodiments are described further
below. The numbering of residues in the Fc region is that of the EU
index of Kabat.
[0486] The hinge region of CH1 may be modified such that the number
of cysteine residues in the hinge region is altered, e.g.,
increased or decreased. See U.S. Pat. No. 5,677,425. The number of
cysteine residues in the hinge region of CH1 may be altered to, for
example, facilitate assembly of the light and heavy chains or to
increase or decrease the stability of the antibody.
[0487] The Fc hinge region of an antibody may be mutated to
decrease the biological half life of the antibody. More
specifically, one or more amino acid mutations may be introduced
into the CH2-CH3 domain interface region of the Fc-hinge fragment
such that the antibody has impaired Staphylococcal protein A (SpA)
binding relative to native Fc-hinge domain SpA binding. See, e.g.,
U.S. Pat. No. 6,165,745.
[0488] The antibody may be modified to increase its biological half
life. Various approaches are possible. For example, one or more of
the following mutations may be introduced: T252L, T254S, T256F. See
U.S. Pat. No. 6,277,375. Alternatively, to increase the biological
half life, the antibody may be altered within the CH1 or CL region
to contain a salvage receptor binding epitope taken from two loops
of a CH2 domain of an Fc region of an IgG. See U.S. Pat. Nos.
5,869,046 and 6,121,022.
[0489] The Fc region may be altered by replacing at least one amino
acid residue with a different amino acid residue to alter the
effector function(s) of the antibody. For example, one or more
amino acids selected from amino acid residues 234, 235, 236, 237,
297, 318, 320 and 322 may be replaced with a different amino acid
residue such that the antibody has an altered affinity for an
effector ligand but retains the antigen-binding ability of the
parent antibody. The effector ligand to which affinity may be
altered may be, for example, an Fc receptor or the C1 component of
complement. See U.S. Pat. Nos. 5,624,821 and 5,648,260.
[0490] The glycosylation of an antibody may be modified. For
example, an aglycoslated antibody may be made (i.e., the antibody
lacks glycosylation). Glycosylation may be altered to, for example,
increase the affinity of the antibody for antigen. Such
carbohydrate modifications may be accomplished by, for example,
altering one or more sites of glycosylation within the antibody
sequence. For example, one or more amino acid substitutions may be
made that result in elimination of one or more variable region
framework glycosylation sites to thereby eliminate glycosylation at
that site. Such aglycosylation may increase the affinity of the
antibody for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and
6,350,861.
[0491] Additionally or alternatively, an antibody may be made that
has an altered type of glycosylation, such as a hypofucosylated
antibody having reduced amounts of fucosyl residues or an antibody
having increased bisecting GlcNac structures. Such altered
glycosylation patterns have been demonstrated to increase the ADCC
ability of antibodies. Such carbohydrate modifications may be
accomplished by, for example, expressing the antibody in a host
cell with altered glycosylation machinery. Cells with altered
glycosylation machinery have been described in the art and may be
used as host cells in which to express recombinant antibodies of
the invention to thereby produce an antibody with altered
glycosylation. See U.S. Patent Application Publication No.
2004/0110704 and Yamane-Ohnuki, et al. (2004) Biotechnol Bioeng.
87: 614-22; EP 1,176,195; WO 2003/035835; Shields, et al. (2002) J.
Biol. Chem. 277: 26733-26740; WO 99/54342; Umana, et al. (1999)
Nat. Biotech. 17: 176-180; and Tarentino, et al. (1975) Biochem.
14: 5516-23.
[0492] An antibody may be Pegylated to, for example, increase the
biological (e.g., serum) half life of the antibody. To pegylate an
antibody, the antibody, or fragment thereof, typically is reacted
with polyethylene glycol (PEG), such as a reactive ester or
aldehyde derivative of PEG, under conditions in which one or more
PEG groups become attached to the antibody or antibody fragment.
Preferably, the pegylation is carried out via an acylation reaction
or an alkylation reaction with a reactive PEG molecule (or an
analogous reactive water-soluble polymer).
[0493] The invention also provides variants and equivalents that
are substantially homologous to the antibodies, antibody fragments,
diabodies, SMIPs, camelbodies, nanobodies, IgNAR, polypeptides,
variable regions and CDRs set forth herein. These may contain,
e.g., conservative substitution mutations, (i.e., the substitution
of one or more amino acids by similar amino acids). For example,
conservative substitution refers to the substitution of an amino
acid with another within the same general class, e.g., one acidic
amino acid with another acidic amino acid, one basic amino acid
with another basic amino acid, or one neutral amino acid by another
neutral amino acid.
Antibody Conjugates
[0494] Further, an antibody (or fragment thereof) may be conjugated
to a therapeutic moiety such as a cytotoxin, a therapeutic agent or
a radioactive metal ion. A cytotoxin or cytotoxic agent includes
any agent that is detrimental to cells. Examples include taxol,
cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin,
etoposide, tenoposide, vincristine, vinblastine, colchicin,
doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone,
mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids,
procaine, tetracaine, lidocaine, propranolol, and puromycin and
analogs or homologs thereof. Therapeutic agents include, but are
not limited to, antimetabolites (e.g., methotrexate,
6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil
decarbazine), alkylating agents (e.g., mechlorethamine, thioepa
chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU),
cyclothosphamide, busulfan, dibromomannitol, streptozotocin,
mitomycin C, and cis-dichlorodiamine platinum (II) (DDP)
cisplatin), anthracyclines (e.g., daunorubicin (formerly
daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin
(formerly actinomycin), bleomycin, mithramycin, and anthramycin
(AMC)), and anti-mitotic agents (e.g., vincristine and
vinblastine).
Methods of Engineering Antibodies
[0495] Antibodies having VH and VL sequences disclosed herein may
be used to create new variant antibodies by modifying the VH and/or
VL sequences, or the constant region(s) attached thereto. Thus, the
structural features of a variant antibody of the invention, are
used to create structurally related variant antibodies that retain
at least one functional property of the antibodies of the
invention, such as binding to VISTA and VISTA conjugate. For
example, one or more CDR regions of one Anti-VISTA variant antibody
or anti-VISTA conjugate variant antibody, or mutations thereof, may
be combined recombinantly with known framework regions and/or other
CDRs to create additional, recombinantly-engineered, anti-VISTA or
anti-VISTA conjugate antibodies (e.g., antibodies which bind the
VISTA and VISTA conjugate) of the invention, as discussed herein.
The starting material for the engineering method may be one or more
of the VH and/or VK sequences provided herein, or one or more CDR
regions thereof. To create the engineered antibody, it is not
necessary to actually prepare (i.e., express as a protein) an
antibody having one or more of the VH and/or VK sequences provided
herein, or one or more CDR regions thereof Rather, the information
contained in the sequence(s) is used as the starting material to
create a "second generation" sequence(s) derived from the original
sequence(s) and then the "second generation" sequence(s) is
prepared and expressed as a protein. Standard molecular biology
techniques may be used to prepare and express altered antibody
sequence.
[0496] The antibody encoded by the altered antibody sequence(s) may
retain one, some or all of the functional properties of the
anti-VISTA or anti-VISTA conjugate antibodies produced by methods
and with sequences provided herein, which functional properties
include binding to variant VISTA or variant VISTA conjugate with a
specific KD level or less and/or modulating immune cell activity,
and/or selectively binding to desired target cells such as, for
example, colorectal carcinoma, lung cancer, prostate cancer,
pancreas cancer, ovarian cancer, gastric cancer, and liver cancer.
The functional properties of the altered antibodies may be assessed
using standard assays available in the art and/or described
herein.
[0497] Mutations may be introduced randomly or selectively along
all or part of an anti-VISTA or anti-VISTA conjugate antibody
coding sequence and the resulting modified anti-VISTA or anti-VISTA
conjugate antibodies may be screened for binding activity and/or
other desired functional properties. See WO 2011/120013.
Nucleic Acids Encoding Antibodies that Selectively Bind VISTA or
VISTA Conjugate
[0498] Another embodiment of the invention pertains to nucleic acid
molecules that encode the antibodies of the invention which bind
the VISTA and VISTA conjugate. The nucleic acids may be present in
whole cells, in a cell lysate, or in a partially purified or
substantially pure form. A nucleic acid may be isolated by
purification away from other cellular components or other
contaminants (e.g., other cellular nucleic acids or proteins) by
standard techniques, including alkaline/SDS treatment, CsCl
banding, column chromatography, agarose gel electrophoresis and
others well known in the art. See Ausubel, et al. (2011) Current
Protocols in Molecular Biology John Wiley & Sons, Inc. A
nucleic acid of the invention may be, for example, DNA or RNA and
may or may not contain intronic sequences. The nucleic acid may be
a cDNA molecule.
[0499] Nucleic acids of the invention may be obtained using
standard molecular biology techniques. For antibodies expressed by
hybridomas (e.g., hybridomas prepared from transgenic mice carrying
human immunoglobulin genes as described further below), cDNAs
encoding the light and heavy chains of the antibody made by the
hybridoma may be obtained by standard PCR amplification or cDNA
cloning techniques. For antibodies obtained from an immunoglobulin
gene library (e.g., using phage display techniques), nucleic acid
encoding the antibody may be recovered from the library.
[0500] Specifically, degenerate codon substitutions may be achieved
by generating, e.g., sequences in which the third position of one
or more selected codons is substituted with mixed-base and/or
deoxyinosine residues. Batzer, et al. (1991) Nucleic Acid Res. 19:
5081; Ohtsuka, et al. (1985) J. Biol. Chem. 260: 2605-08;
Rossolini, et al. (1994) Mol. Cell. Probes 8: 91-98.
[0501] Once DNA fragments encoding VH and VL segments are obtained,
these DNA fragments may be further manipulated by standard
recombinant DNA techniques, for example to convert the variable
region genes to full-length antibody chain genes, to Fab fragment
genes or to a scFv gene. In these manipulations, a VL- or
VH-encoding DNA fragment is operatively linked to another DNA
fragment encoding another protein, such as an antibody constant
region or a flexible linker.
[0502] The isolated DNA encoding the VH region may be converted to
a full-length heavy chain gene by operatively linking the
VH-encoding DNA to another DNA molecule encoding heavy chain
constant regions (CH1, CH2 and CH3). The sequences of human heavy
chain constant region genes are known in the art (see, e.g., Kabat,
et al. (1991) Sequences of Proteins of Immunological Interest,
Fifth Edition, U.S. Department of Health and Human Services, NIH
Publication No. 91-3242) and DNA fragments encompassing these
regions may be obtained by standard PCR amplification. The heavy
chain constant region may be an IgG1, IgG2, IgG3, IgG4, IgA, IgE,
IgM, or IgD constant region, but most preferably is an IgG1 or IgG4
constant region. For a Fab fragment heavy chain gene, the
VH-encoding DNA may be operatively linked to another DNA molecule
encoding only the heavy chain CH1 constant region.
[0503] The isolated DNA encoding the VL region may be converted to
a full-length light chain gene (as well as a Fab light chain gene)
by operatively linking the VL-encoding DNA to another DNA molecule
encoding the light chain constant region, CL. The sequences of
human light chain constant region genes are known in the art (see,
e.g., Kabat, et al. (1991) Sequences of Proteins of Immunological
Interest Fifth Edition, U.S. Department of Health and Human
Services, NIH Publication No. 91-3242) and DNA fragments
encompassing these regions may be obtained by standard PCR
amplification. The light chain constant region may be a kappa or
lambda constant region, but most preferably is a kappa constant
region.
[0504] To create a scFv gene, the VH- and VL-encoding DNA fragments
are operatively linked to another fragment encoding a flexible
linker, e.g., encoding the amino acid sequence (Gly4-Ser).sub.3,
such that the VH and VL sequences may be expressed as a contiguous
single-chain protein, with the VL and VH regions joined by the
flexible linker. See, e.g., Bird, et al. (1988) Science 242:
423-426; Huston, et al. (1988) Proc. Natl. Acad. Sci. USA 85:
5879-5883; McCafferty, et al. (1990) Nature 348: 552-554.
Methods of Producing Antibodies and Fragments Thereof
[0505] The present invention also provides methods for producing
antibodies and fragments thereof. Methods of producing antibodies
are well known to those of ordinary skill in the art. For example,
methods of producing chimeric antibodies are now well known in the
art. See, e.g., U.S. Pat. No. 4,816,567; Morrison, et al. (1984)
PNAS USA 81: 8651-55; Neuberger, et al. (1985) Nature 314: 268-270;
Boulianne, et al. (1984) Nature 312: 643-46.
[0506] For example, antibodies or antigen binding fragments may be
produced by genetic engineering. In this technique, as with other
methods, antibody-producing cells are sensitized to the desired
antigen or immunogen. The messenger RNA isolated from antibody
producing cells is used as a template to make cDNA using PCR
amplification. A library of vectors, each containing one heavy
chain gene and one light chain gene retaining the initial antigen
specificity, is produced by insertion of appropriate sections of
the amplified immunoglobulin cDNA into the expression vectors. A
combinatorial library is constructed by combining the heavy chain
gene library with the light chain gene library. This results in a
library of clones which co-express a heavy and light chain
(resembling the Fab fragment or antigen binding fragment of an
antibody molecule). The vectors that carry these genes are
co-transfected into a host cell. When antibody gene synthesis is
induced in the transfected host, the heavy and light chain proteins
self-assemble to produce active antibodies that may be detected by
screening with the antigen or immunogen.
[0507] Antibodies, and fragments thereof, of the invention may also
be produced by constructing, using conventional techniques well
known to those of ordinary skill in the art, an expression vector
containing an operon and a DNA sequence encoding an antibody heavy
chain in which the DNA sequence encoding the CDRs required for
antibody specificity is derived from a non-human cell source, while
the DNA sequence encoding the remaining parts of the antibody chain
is derived from a human cell source. Furthermore, the invention
relates to vectors, especially plasmids, cosmids, viruses,
bacteriophages and other vectors common in genetic engineering,
which contain the above-mentioned nucleic acid molecules of the
invention. The nucleic acid molecules contained in the vectors may
be linked to regulatory elements that ensure the transcription in
prokaryotic and eukaryotic cells.
[0508] Vectors contain elements that facilitate manipulation for
the expression of a foreign protein within the target host cell.
Conveniently, manipulation of sequences and production of DNA for
transformation is first performed in a bacterial host (e.g., E.
coli) and usually vectors will include sequences to facilitate such
manipulations, including a bacterial origin of replication and
appropriate bacterial selection marker. Selection markers encode
proteins necessary for the survival or growth of transformed host
cells grown in a selective culture medium. Host cells not
transformed with the vector containing the selection gene will not
survive in the culture medium. Typical selection genes encode
proteins that confer resistance to antibiotics or other toxins,
complement auxotrophic deficiencies, or supply critical nutrients
not available from complex media. Exemplary vectors and methods for
transformation of yeast are described in the art. See, e.g., Burke,
et al. (2000) Methods in Yeast Genetics Cold Spring Harbor
Laboratory Press.
[0509] The polypeptide coding sequence of interest may be operably
linked to transcriptional and translational regulatory sequences
that provide for expression of the polypeptide in yeast cells.
These vector components may include, but are not limited to, one or
more of the following: an enhancer element, a promoter, and a
transcription termination sequence. Sequences for the secretion of
the polypeptide may also be included (e.g., a signal sequence).
[0510] Nucleic acids are "operably linked" when placed into a
functional relationship with another nucleic acid sequence. For
example, DNA for a signal sequence is operably linked to DNA for a
polypeptide if it is expressed as a preprotein that participates in
the secretion of the polypeptide; a promoter or enhancer is
operably linked to a coding sequence if it affects the
transcription of the sequence. Generally, "operably linked" refers
broadly to contiguous linked DNA sequences, and, in the case of a
secretory leader, contiguous and in reading frame. However,
enhancers do not have to be contiguous.
[0511] Promoters are untranslated sequences located upstream (5')
to the start codon of a structural gene (generally within about 100
to 1000 bp) that control the transcription and translation of
particular nucleic acid sequences to which they are operably
linked. Such promoters fall into several classes: inducible,
constitutive, and repressible promoters (e.g., that increase levels
of transcription in response to absence of a repressor). Inducible
promoters may initiate increased levels of transcription from DNA
under their control in response to some change in culture
conditions (e.g., the presence or absence of a nutrient or a change
in temperature.)
[0512] A second expression vector may be produced using the same
conventional means well known to those of ordinary skill in the
art, said expression vector containing an operon and a DNA sequence
encoding an antibody light chain in which the DNA sequence encoding
the CDRs required for antibody specificity is derived from a
non-human cell source, preferably a rabbit B-cell source, while the
DNA sequence encoding the remaining parts of the antibody chain is
derived from a human cell source.
[0513] The expression vectors are transfected into a host cell by
convention techniques well known to those of ordinary skill in the
art to produce a transfected host cell, said transfected host cell
cultured by conventional techniques well known to those of ordinary
skill in the art to produce said antibody polypeptides.
[0514] The host cell may be co-transfected with the two expression
vectors described above, the first expression vector containing DNA
encoding an operon and a light chain-derived polypeptide and the
second vector containing DNA encoding an operon and a heavy
chain-derived polypeptide. The two vectors contain different
selectable markers, but preferably achieve substantially equal
expression of the heavy and light chain polypeptides.
Alternatively, a single vector may be used, the vector including
DNA encoding both the heavy and light chain polypeptides. The
coding sequences for the heavy and light chains may comprise cDNA,
genomic DNA, or both.
[0515] The host cells used to express the antibodies, and fragments
thereof, may be either a bacterial cell such as E. coli, or a
eukaryotic cell. A mammalian cell of a well-defined type for this
purpose, such as a myeloma cell, a Chinese hamster ovary (CHO), a
NSO, or a HEK293 cell line may be used.
[0516] The general methods by which the vectors may be constructed,
transfection methods required to produce the host cell and
culturing methods required to produce the antibodies, and fragments
thereof, from said host cells all include conventional techniques.
Although preferably the cell line used to produce the antibody is a
mammalian cell line, any other suitable cell line, such as a
bacterial cell line such as an E. coli-derived bacterial strain, or
a yeast cell line, may be used.
[0517] Similarly, once produced the antibodies may be purified
according to standard procedures in the art, such as for example
cross-flow filtration, ammonium sulphate precipitation, and
affinity column chromatography.
Generation of Antibodies that Bind a VISTA or VISTA Conjugate Using
Animals
[0518] The antibodies of the invention that selectively bind the
VISTA and VISTA conjugate may be human monoclonal antibodies. Such
human monoclonal antibodies directed against a VISTA and VISTA
conjugate may be generated using transgenic or transchromosomic
mice carrying parts of the human immune system rather than the
mouse system. These transgenic and transchromosomic mice include
mice referred to herein as the HuMAb Mouse.RTM. and KM Mouse.RTM.
respectively, and are collectively referred to herein as "human Ig
mice." The HuMAb Mouse.RTM. (Medarex, Inc.) contains human
immunoglobulin gene miniloci that encode unrearranged human heavy
(.mu. and .gamma.) and .kappa. light chain immunoglobulin
sequences, together with targeted mutations that inactivate the
endogenous .mu. and .kappa. chain loci. See, e.g., Lonberg, et al.
(1994) Nature 368(6474): 856-859. Accordingly, the mice exhibit
reduced expression of mouse IgM or .kappa., and in response to
immunization, the introduced human heavy and light chain transgenes
undergo class switching and somatic mutation to generate high
affinity human IgG.kappa. monoclonal. Lonberg (1994) Handbook of
Experimental Pharmacology 113: 49-101; Lonberg and Huszar (1995)
Intern. Rev. Immunol. 13: 65-93, and Harding and Lonberg (1995)
Ann. NY. Acad. Sci. 764: 536-546. The preparation and use of the
HuMab Mouse.RTM., and the genomic modifications carried by such
mice, is further described in Taylor, et al. (1992) Nucleic Acids
Research 20: 6287-6295; Chen, et al. (1993) International
Immunology 5: 647-656; Tuaillon, et al. (1993) Proc. Natl. Acad.
Sci. USA 90: 3720-3724; Choi, et al. (1993) Nature Genetics 4:
117-123; Chen, et al. (1993) EMBO J. 12: 821-830; Tuaillon, et al.
(1994) J. Immunol. 152: 2912-2920; Taylor, et al. (1994)
International Immunology 6: 579-591; and Fishwild, et al. (1996)
Nature Biotechnology 14: 845-851. See further, U.S. Pat. Nos.
5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,877,397;
5,661,016; 5,814,318; 5,874,299; 5,770,429; and 5,545,807; WO
92/03918, WO 93/12227, WO 94/25585; WO 97/13852; WO 98/24884; WO
99/45962; and WO 01/14424.
[0519] Human anti-VISTA and anti-VISTA-Ig conjugate antibodies
(e.g., antibodies which selectively bind the VISTA and VISTA
conjugate) of the invention may be raised using a mouse that
carries human immunoglobulin sequences on transgenes and
transchromosomes, such as a mouse that carries a human heavy chain
transgene and a human light chain transchromosome. Such mice,
referred to herein as "KM mice.RTM.", are described in detail in WO
02/43478.
[0520] Still further, alternative transgenic animal systems
expressing human immunoglobulin genes are available in the art and
may be used to raise anti-VISTA and anti-VISTA-Ig conjugate
antibodies of the invention. For example, an alternative transgenic
system referred to as the Xenomouse (Abgenix, Inc.) may be used;
such mice are described in, for example, U.S. Pat. Nos. 5,939,598;
6,075,181; 6,114,598; 6,150,584 and 6,162,963.
[0521] Moreover, alternative transchromosomic animal systems
expressing human immunoglobulin genes are available in the art and
may be used to raise anti-VISTA and anti-VISTA-Ig conjugate
antibodies of the invention. For example, mice carrying both a
human heavy chain transchromosome and a human light chain
transchromosome, referred to as "TC mice" may be used. See
Tomizuka, et al. (2000) Proc. Natl. Acad. Sci. USA 97: 722-727.
Furthermore, cows carrying human heavy and light chain
transchromosomes have been described in the art (Kuroiwa, et al.
(2002) Nature Biotechnology 20: 889-894) and may be used to raise
anti-VISTA and anti-VISTA-Ig conjugate antibodies of the
invention.
[0522] Human monoclonal antibodies of the invention may also be
prepared using phage display methods for screening libraries of
human immunoglobulin genes. Such phage display methods for
isolating human antibodies are established in the art. See, for
example, U.S. Pat. Nos. 5,223,409; 5,403,484; 5,571,698; 5,427,908
5,580,717; 5,969,108; 6,172,197; 5,885,793; 6,521,404; 6,544,731;
6,555,313; 6,582,915 and 6,593,081.
[0523] Human monoclonal antibodies of the invention may also be
prepared using SCID mice into which human immune cells have been
reconstituted such that a human antibody response may be generated
upon immunization. See, e.g., U.S. Pat. Nos. 5,476,996 and
5,698,767.
[0524] When human Ig mice are used to raise human antibodies of the
invention, such mice may be immunized with a purified or enriched
preparation of VISTA and VISTA conjugate polypeptide, as described
by Lonberg, et al. (1994) Nature 368(6474): 856-859; Fishwild, et
al. (1996) Nature Biotechnology 14: 845-851; WO 98/24884 and WO
01/14424. Preferably, the mice are 6-16 weeks of age upon the first
infusion. For example, a purified or recombinant preparation (5-50
.mu.g) of VISTA and VISTA conjugate may be used to immunize the
human Ig mice intraperitoneally.
[0525] Prior experience with various antigens by others has shown
that the transgenic mice respond when initially immunized
intraperitoneally (IP) with antigen in complete Freund's adjuvant,
followed by every other week IP immunizations (up to a total of 6)
with antigen in incomplete Freund's adjuvant. However, adjuvants
other than Freund's are also found to be effective. In addition,
whole cells in the absence of adjuvant are found to be highly
immunogenic. The immune response may be monitored over the course
of the immunization protocol with plasma samples being obtained by
retroorbital bleeds. The plasma may be screened by ELISA (as
described below), and mice with sufficient titers of anti-VISTA or
anti-VISTA-Ig human immunoglobulin may be used for fusions. Mice
may be boosted intravenously with antigen 3 days before sacrifice
and removal of the spleen. It is expected that 2-3 fusions for each
immunization may need to be performed. Between 6 and 24 mice are
typically immunized for each antigen. Usually both HCo7 and HCo12
strains are used. In addition, both HCo7 and HCo12 transgene may be
bred together into a single mouse having two different human heavy
chain transgenes (HCo7/HCo12). Alternatively or additionally, the
KM Mouse.RTM. strain may be used.
Generation of Hybridomas Producing Human Monoclonal Antibodies of
the Invention
[0526] To generate hybridomas producing human monoclonal antibodies
of the invention, splenocytes and/or lymph node cells from
immunized mice may be isolated and fused to an appropriate
immortalized cell line, such as a mouse myeloma cell line. The
resulting hybridomas may be screened for the production of
antigen-specific antibodies. For example, single cell suspensions
of splenic lymphocytes from immunized mice may be fused to
one-sixth the number of P3X63-Ag8.653 nonsecreting mouse myeloma
cells (ATCC, CRL 1580) with 50% PEG. Cells may be plated at
approximately 2.times.10.sup.-5 in flat bottom microtiter plate,
followed by a two week incubation in selective medium containing
20% fetal Clone Serum, 18% "653" conditioned media, 5% origen
(IGEN), 4 mM L-glutamine, 1 mM sodium pyruvate, 5 mM HEPES, 0.055
mM 2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml
streptomycin, 50 mg/ml gentamycin and 1.times. HAT (Sigma; the HAT
is added 24 hours after the fusion). After approximately two weeks,
cells may be cultured in medium in which the HAT is replaced with
HT. Individual wells may then be screened by ELISA for human
monoclonal IgM and IgG antibodies. Once extensive hybridoma growth
occurs, medium may be observed usually after 10-14 days. The
antibody secreting hybridomas may be replated, screened again, and
if still positive for human IgG, the monoclonal antibodies may be
subcloned at least twice by limiting dilution. The stable subclones
may then be cultured in vitro to generate small amounts of antibody
in tissue culture medium for characterization.
[0527] To purify human monoclonal antibodies, selected hybridomas
may be grown in two-liter spinner-flasks for monoclonal antibody
purification. Supernatants may be filtered and concentrated before
affinity chromatography with protein A-Sepharose (Pharmacia,
Piscataway, N.J.) Eluted IgG may be checked by gel electrophoresis
and high performance liquid chromatography to ensure purity. The
buffer solution may be exchanged into PBS, and the concentration
may be determined by OD280 using 1.43 extinction coefficient. The
monoclonal antibodies may be aliquoted and stored at -80.degree.
C.
Transgenic Animals
[0528] The host cells of the invention can also be used to produce
non-human transgenic animals. For example, in one embodiment, a
host cell of the invention is a fertilized oocyte or an embryonic
stem cell into which VISTA-coding sequences have been introduced.
Such host cells can then be used to create non-human transgenic
animals in which exogenous VISTA sequences have been introduced
into their genome or homologous recombinant animals in which
endogenous VISTA sequences have been altered. Such animals are
useful for studying the function and/or activity of a VISTA and for
identifying and/or evaluating modulators of VISTA activity. As used
herein, a "transgenic animal" is a non-human animal, preferably a
mammal, more preferably a rodent such as a rat or mouse, in which
one or more of the cells of the animal includes a transgene. Other
examples of transgenic animals include non-human primates, sheep,
dogs, cows, goats, chickens, amphibians, and the like. A transgene
is exogenous DNA which is integrated into the genome of a cell from
which a transgenic animal develops and which remains in the genome
of the mature animal, thereby directing the expression of an
encoded gene product in one or more cell types or tissues of the
transgenic animal. As used herein, a "homologous recombinant
animal" is a non-human animal, preferably a mammal, more preferably
a mouse, in which an endogenous VISTA gene has been altered by
homologous recombination between the endogenous gene and an
exogenous DNA molecule introduced into a cell of the animal, e.g.,
an embryonic cell of the animal, prior to development of the
animal. A transgenic animal of the invention can be created by
introducing a VISTA-encoding nucleic acid into the male pronuclei
of a fertilized oocyte, e.g., by microinjection, retroviral
infection, and allowing the oocyte to develop in a pseudopregnant
female foster animal. The VISTA cDNA sequence of SEQ ID NO: 1 or 4
can be introduced as a transgene into the genome of a non-human
animal. Alternatively, a nonhuman homologue of a human VISTA gene,
such as a monkey or rat VISTA gene, can be used as a transgene.
Alternatively, a VISTA gene homologue, such as another VISTA family
member, can be isolated based on hybridization to the VISTA cDNA
sequences of SEQ ID NO: 1 or 3 and used as a transgene. Intronic
sequences and polyadenylation signals can also be included in the
transgene to increase the efficiency of expression of the
transgene. A tissue-specific regulatory sequence(s) can be operably
linked to a VISTA transgene to direct expression of a VISTA
polypeptide to particular cells. Methods for generating transgenic
animals via embryo manipulation and microinjection, particularly
animals such as mice, have become conventional in the art and are
described, for example, in U.S. Pat. Nos. 4,736,866 and 4,870,009,
both by Leder, et al. U.S. Pat. No. 4,873,191 by Wagner et al. and
in Hogan, B., Manipulating the Mouse Embryo, (Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y., 1986). Similar methods
are used for production of other transgenic animals. A transgenic
founder animal can be identified based upon the presence of a VISTA
transgene in its genome and/or expression of VISTA mRNA in tissues
or cells of the animals. A transgenic founder animal can then be
used to breed additional animals carrying the transgene. Moreover,
transgenic animals carrying a transgene encoding a VISTA
polypeptide can further be bred to other transgenic animals
carrying other transgenes.
[0529] To create a homologous recombinant animal, a vector is
prepared which contains at least a portion of a VISTA gene into
which a deletion, addition or substitution has been introduced to
thereby alter, e.g., functionally disrupt, the VISTA gene. The
VISTA gene can be a human or murine gene (e.g., the cDNA of SEQ ID
NO: 1 or 3)
[0530] In another embodiment, transgenic non-human animals can be
produced which contain selected systems which allow for regulated
expression of the transgene. One example of such a system is the
cre/loxP recombinase system of bacteriophage P1. For a description
of the cre/loxP recombinase system, see, e.g., Lakso et al. (1992)
Proc Natl. Acad. Sci. USA 89:6232-6236. Another example of a
recombinase system is the FLP recombinase system of S. cerevisiae
(O'Gorman et al. (1991) Science 251:1351-1355. If a cre/loxP
recombinase system is used to regulate expression of the transgene,
animals containing transgenes encoding both the Cre recombinase and
a selected polypeptide are required. Such animals can be provided
through the construction of "double" transgenic animals, e.g., by
mating two transgenic animals, one containing a transgene encoding
a selected polypeptide and the other containing a transgene
encoding a recombinase.
[0531] Clones of the non-human transgenic animals described herein
can also be produced according to the methods described in Wilmut,
et al. (1997) Nature 385: 810-813; WO 97/07668; and WO 97/07669. In
brief, a cell, e.g., a somatic cell, from the transgenic animal can
be isolated and induced to exit the growth cycle and enter G0
phase. The quiescent cell can then be fused, e.g., through the use
of electrical pulses, to an enucleated oocyte from an animal of the
same species from which the quiescent cell is isolated. The
reconstructed oocyte is then cultured such that it develops to the
morula or blastocyst stage and then transferred to pseudopregnant
female foster animal. The offspring borne of this female foster
animal are a clone of the animal from which the cell, e.g., the
somatic cell, is isolated.
Labels
[0532] The polypeptides, conjugates, and antibodies described
herein may be modified post-translationally to add effector
moieties such as chemical linkers, detectable moieties such as for
example fluorescent dyes, enzymes, substrates, bioluminescent
materials, radioactive materials, chemiluminescent moieties, a
cytotoxic agent, radioactive materials, or functional moieties.
[0533] A wide variety of entities, e.g., ligands, may be coupled to
the oligonucleotides as known in the art. Ligands may include
naturally occurring molecules, or recombinant or synthetic
molecules. Exemplary ligands include, but are not limited to,
avadin, biotin, peptides, peptidomimetics, polylysine (PLL),
polyethylene glycol (PEG), mPEG, cationic groups, spermine,
spermidine, polyamine, thyrotropin, melanotropin, lectin,
glycoprotein, surfactant protein A, mucin, glycosylated
polyaminoacids, transferrin, aptamer, immunoglobulins (e.g.,
antibodies), insulin, transferrin, albumin, sugar, lipophilic
molecules (e.g., steroids, bile acids, cholesterol, cholic acid,
and fatty acids), vitamin A, vitamin E, vitamin K, vitamin B, folic
acid, B12, riboflavin, biotin, pyridoxal, vitamin cofactors,
lipopolysaccharide, hormones and hormone receptors, lectins,
carbohydrates, multivalent carbohydrates, radiolabeled markers,
fluorescent dyes, and derivatives thereof. See, e.g., U.S. Pat.
Nos. 6,153,737; 6,172,208; 6,300,319; 6,335,434; 6,335,437;
6,395,437; 6,444,806; 6,486,308; 6,525,031; 6,528,631; and
6,559,279.
[0534] Additionally, moieties may be added to the antigen or
epitope to increase half-life in vivo (e.g., by lengthening the
time to clearance from the blood stream. Such techniques include,
for example, adding PEG moieties (also termed pegilation), and are
well-known in the art. See U.S. Patent Application Publication No.
2003/0031671.
[0535] An antigen, antibody or antigen binding fragment thereof,
described herein may be "attached" to a substrate when it is
associated with the solid label through a non-random chemical or
physical interaction. The attachment may be through a covalent
bond. However, attachments need not be covalent or permanent.
Materials may be attached to a label through a "spacer molecule" or
"linker group." Such spacer molecules are molecules that have a
first portion that attaches to the biological material and a second
portion that attaches to the label. Thus, when attached to the
label, the spacer molecule separates the label and the biological
materials, but is attached to both. Methods of attaching biological
material (e.g., label) to a label are well known in the art, and
include but are not limited to chemical coupling.
Detectable Labels
[0536] The VISTA and VISTA conjugate described herein may be
modified post-translationally to add effector labels such as
chemical linkers, detectable labels such as for example fluorescent
dyes, enzymes, substrates, bioluminescent materials, radioactive
materials, and chemiluminescent labels, or functional labels such
as for example streptavidin, avidin, biotin, a cytotoxin, a
cytotoxic agent, and radioactive materials. Further exemplary
enzymes include, but are not limited to, horseradish peroxidase,
acetylcholinesterase, alkaline phosphatase, .beta.-galactosidase
and luciferase. Further exemplary fluorescent materials include,
but are not limited to, rhodamine, fluorescein, fluorescein
isothiocyanate, umbelliferone, dichlorotriazinylamine,
phycoerythrin and dansyl chloride. Further exemplary
chemiluminescent labels include, but are not limited to, luminol.
Further exemplary bioluminescent materials include, but are not
limited to, luciferin, luciferase, and aequorin. Further exemplary
radioactive materials include, but are not limited to, bismuth-213
(.sup.213Bs), carbon-14 (.sup.14C), carbon-11 (.sup.11C),
chlorine-18 (Cl.sup.18), chromium-51 (.sup.51Cr), cobalt-57
(.sup.57Co), cobalt-60 (.sup.60Co), copper-64 (.sup.64Cu),
copper-67 (.sup.67Cu), dysprosium-165 (.sup.165Dy), erbium-169
(.sup.169Er), fluorine-18 (.sup.18F), gallium-67 (.sup.67Ga),
gallium-68 (.sup.68Ga), germanium-68 (.sup.68Ge), holmium-166
(.sup.166Ho), indium-111 (.sup.111In), iodine-125 (.sup.125I),
iodine-123 (.sup.124I), iodine-124 (.sup.124I), iodine-131
(.sup.131I), iridium-192 (.sup.192Ir), iron-59 (.sup.59Fe),
krypton-81 (.sup.81Kr), lead-212 (.sup.212Pb), lutetium-177
(.sup.177Lu), molybdenum-99 (.sup.99Mo), nitrogen-13 (.sup.13N),
oxygen-15 (.sup.15O), palladium-103 (.sup.103Pd), phosphorus-32
(.sup.32P), potassium-42 (.sup.42K), rhenium-186 (.sup.186Re),
rhenium-188 (.sup.188Re), rubidium-81 (.sup.81Rb), rubidium-82
(.sup.82Rb), samarium-153 (.sup.153Sm), selenium-75 (.sup.75Se),
sodium-24 (.sup.24Na), strontium-82 (.sup.82Sr), strontium-89
(.sup.89Sr), sulfur 35 (.sup.35S), technetium-99m (.sup.99Tc),
thallium-201 (.sup.201Tl), tritium (.sup.3H), xenon-133
(.sup.133Xe), ytterbium-169 (.sup.169Yb), ytterbium-177
(.sup.177Yb), and yttrium-90 (.sup.90Y).
Cytotoxic Agents
[0537] For making cytotoxic agents, VISTA polypeptides and VISTA
conjugates of the invention may be linked, or operatively attached,
to toxins using techniques that are known in the art. A wide
variety of toxins are known that may be conjugated to polypeptides
or antibodies of the invention. Examples include: numerous useful
plant-, fungus- or even bacteria-derived toxins, which, by way of
example, include: various A chain toxins, particularly ricin A
chain; ribosome inactivating proteins such as saporin or gelonin;
alpha-sarcin; aspergillin; restrictocin; and ribonucleases such as
placental ribonuclease, angiogenic, diphtheria toxin, or
pseudomonas exotoxin. A preferred toxin moiety for use in
connection with the invention is toxin A chain which has been
treated to modify or remove carbohydrate residues, deglycosylated A
chain. U.S. Pat. No. 5,776,427.
[0538] The VISTA and VISTA conjugates described herein may be
conjugated to cytotoxic agents including, but are not limited to,
methotrexate, aminopterin, 6-mercaptopurine, 6-thioguanine,
cytarabine, 5-fluorouracil decarbazine; alkylating agents such as
mechlorethamine, thioepa chlorambucil, melphalan, carmustine
(BSNU), mitomycin C, lomustine (CCNU), 1-methylnitrosourea,
cyclothosphamide, mechlorethamine, busulfan, dibromomannitol,
streptozotocin, mitomycin C, cis-dichlorodiamine platinum (II)
(DDP) cisplatin and carboplatin (paraplatin); anthracyclines
include daunorubicin (formerly daunomycin), doxorubicin
(adriamycin), detorubicin, carminomycin, idarubicin, epirubicin,
mitoxantrone and bisantrene; antibiotics include dactinomycin
(actinomycin D), bleomycin, calicheamicin, mithramycin, and
anthramycin (AMC); and antimytotic agents such as the vinca
alkaloids, vincristine and vinblastine. Other cytotoxic agents
include paclitaxel (TAXOL.RTM.), ricin, pseudomonas exotoxin,
gemcitabine, cytochalasin B, gramicidin D, ethidium bromide,
emetine, etoposide, tenoposide, colchicin, dihydroxy anthracin
dione, 1-dehydrotestosterone, glucocorticoids, procaine,
tetracaine, lidocaine, propranolol, puromycin, procarbazine,
hydroxyurea, asparaginase, corticosteroids, mytotane (O,P'-(DDD)),
interferons, and mixtures of these cytotoxic agents.
[0539] Further cytotoxic agents include, but are not limited to,
chemotherapeutic agents such as carboplatin, cisplatin, paclitaxel,
gemcitabine, calicheamicin, doxorubicin, 5-fluorouracil, mitomycin
C, actinomycin D, cyclophosphamide, vincristine, bleomycin, VEGF
antagonists, EGFR antagonists, platins, taxols, irinotecan,
5-fluorouracil, gemcytabine, leucovorine, steroids,
cyclophosphamide, melphalan, vinca alkaloids (e.g., vinblastine,
vincristine, vindesine and vinorelbine), mustines, tyrosine kinase
inhibitors, radiotherapy, sex hormone antagonists, selective
androgen receptor modulators, selective estrogen receptor
modulators, PDGF antagonists, TNF antagonists, IL-1 antagonists,
interleukins (e.g., IL-12 or IL-2), IL-12R antagonists, Toxin
conjugated monoclonal antibodies, tumor antigen specific monoclonal
antibodies, Erbitux.RTM., Avastin.RTM., Pertuzumab, anti-CD20
antibodies, Rituxan.RTM., ocrelizumab, ofatumumab, DXL625,
Herceptin.RTM., or any combination thereof. Toxic enzymes from
plants and bacteria such as ricin, diphtheria toxin and Pseudomonas
toxin may be conjugated to the humanized antibodies, or binding
fragments thereof, to generate cell-type-specific-killing reagents.
Youle, et al. (1980) Proc. Nat'l Acad. Sci. USA 77: 5483;
Gilliland, et al. (1980) Proc. Nat'l Acad. Sci. USA 77: 4539;
Krolick, et al. (1980) Proc. Nat'l Acad. Sci. USA 77: 5419. Other
cytotoxic agents include cytotoxic ribonucleases. See U.S. Pat. No.
6,653,104.
[0540] The VISTA protein described herein may be conjugated to a
radionuclide that emits alpha or beta particles (e.g.,
radioimmunoconjuagtes). Such radioactive isotopes include but are
not limited to beta-emitters such as phosphorus-32 (.sup.32P),
scandium-47 (.sup.47Sc), copper-67 (.sup.67Cu), gallium-67
(.sup.67Ga), yttrium-88 (.sup.88Y), yttrium-90 (.sup.90Y),
iodine-125 (.sup.125I), iodine-131 (.sup.131I), samarium-153
(.sup.153Sm), lutetium-177 (.sup.177Lu), rhenium-186 (.sup.186Re),
rhenium-188 (.sup.188Re), and alpha-emitters such as astatine-211
(.sup.211At), lead-212 (.sup.212Pb), bismuth-212 (.sup.212Bi),
bismuth-213 (.sup.213Bi) or actinium-225 (.sup.225Ac).
[0541] Methods are known in the art for conjugating a VISTA and
VISTA conjugate described herein to a label, such as those methods
described by Hunter, et al (1962) Nature 144: 945; David, et al.
(1974) Biochemistry 13: 1014; Pain, et al. (1981) J. Immunol. Meth.
40: 219; and Nygren (1982) Histochem and Cytochem, 30: 407.
Substrates
[0542] The VISTA and VISTA conjugate described herein may be
attached to a substrate. A number of substrates (e.g., solid
supports) known in the art are suitable for use with the VISTA and
VISTA conjugate described herein. The substrate may be modified to
contain channels or other configurations. See Fung (2004) [Ed.]
Protein Arrays: Methods and Protocols Humana Press and Kambhampati
(2004) [Ed.] Protein Microarray Technology John Wiley &
Sons.
[0543] Substrate materials include, but are not limited to
acrylics, agarose, borosilicate glass, carbon (e.g., carbon
nanofiber sheets or pellets), cellulose acetate, cellulose,
ceramics, gels, glass (e.g., inorganic, controlled-pore, modified,
soda-lime, or functionalized glass), latex, magnetic beads,
membranes, metal, metalloids, nitrocellulose, NYLON.RTM., optical
fiber bundles, organic polymers, paper, plastics,
polyacryloylmorpholide, poly(4-methylbutene), poly(ethylene
terephthalate), poly(vinyl butyrate), polyacrylamide, polybutylene,
polycarbonate, polyethylene, polyethyleneglycol terephthalate,
polyformaldehyde, polymethacrylate, polymethylmethacrylate,
polypropylene, polysaccharides, polystyrene, polyurethanes,
polyvinylacetate, polyvinylchloride, polyvinylidene difluoride
(PVDF), polyvinylpyrrolidinone, rayon, resins, rubbers,
semiconductor materials, SEPHAROSE.RTM., silica, silicon, styrene
copolymers, TEFLON.RTM., and variety of other polymers.
[0544] Substrates need not be flat and can include any type of
shape including spherical shapes (e.g., beads) or cylindrical
shapes (e.g., fibers). Materials attached to solid supports may be
attached to any portion of the solid support (e.g., may be attached
to an interior portion of a porous solid support material).
[0545] The substrate body may be in the form of a bead, box,
column, cylinder, disc, dish (e.g., glass dish, PETRI dish), fiber,
film, filter, microtiter plate (e.g., 96-well microtiter plate),
multi-bladed stick, net, pellet, plate, ring, rod, roll, sheet,
slide, stick, tray, tube, or vial. The substrate may be a singular
discrete body (e.g., a single tube, a single bead), any number of a
plurality of substrate bodies (e.g, a rack of 10 tubes, several
beads), or combinations thereof (e.g., a tray comprises a plurality
of microtiter plates, a column filled with beads, a microtiter
plate filed with beads).
[0546] An VISTA and VISTA conjugate may be "attached" to a
substrate when it is associated with the solid substrate through a
non-random chemical or physical interaction. The attachment may be
through a covalent bond. However, attachments need not be covalent
or permanent. Materials may be attached to a substrate through a
"spacer molecule" or "linker group." Such spacer molecules are
molecules that have a first portion that attaches to the biological
material and a second portion that attaches to the substrate. Thus,
when attached to the substrate, the spacer molecule separates the
substrate and the biological materials, but is attached to both.
Methods of attaching biological material (e.g., label) to a
substrate are well known in the art, and include but are not
limited to chemical coupling.
[0547] Plates, such as microtiter plates, which support and contain
the solid-phase for solid-phase synthetic reactions may be used.
Microtiter plates may house beads that are used as the solid-phase.
By "particle" or "microparticle" or "nanoparticle" or "bead" or
"microbead" or "microsphere" herein is meant microparticulate
matter having any of a variety of shapes or sizes. The shape may be
generally spherical but need not be spherical, being, for example,
cylindrical or polyhedral. As are appreciated by those in the art,
the particles may comprise a wide variety of materials depending on
their use, including, but not limited to, cross-linked starch,
dextrans, cellulose, proteins, organic polymers including styrene
polymers such as polystyrene and methylstyrene as well as other
styrene co-polymers, plastics, glass, ceramics, acrylic polymers,
magnetically responsive materials, colloids, thoriasol, carbon
graphite, titanium dioxide, nylon, latex, and TEFLON.RTM.. See
e.g., "Microsphere Detection Guide" from Bangs Laboratories,
Fishers, Ind.
[0548] The VISTA and VISTA conjugate described herein may be
attached to on any of the forms of substrates described herein
(e.g., bead, box, column, cylinder, disc, dish (e.g., glass dish,
PETRI dish), fiber, film, filter, microtiter plate (e.g., 96-well
microtiter plate), multi-bladed stick, net, pellet, plate, ring,
rod, roll, sheet, slide, stick, tray, tube, or vial). In
particular, particles or beads may be a component of a gelling
material or may be separate components such as latex beads made of
a variety of synthetic plastics (e.g., polystyrene). The label
(e.g., streptavidin) may be bound to a substrate (e.g., bead).
Pharmaceutical Compositions
[0549] A "pharmaceutical composition" refers to a chemical or
biological composition suitable for administration to a mammal.
Such compositions may be specifically formulated for administration
via one or more of a number of routes, including but not limited to
buccal, epicutaneous, epidural, inhalation, intraarterial,
intracardial, intracerebroventricular, intradermal, intramuscular,
intranasal, intraocular, intraperitoneal, intraspinal, intrathecal,
intravenous, oral, parenteral, rectally via an enema or
suppository, subcutaneous, subdermal, sublingual, transdermal, and
transmucosal. In addition, administration may occur by means of
injection, powder, liquid, gel, drops, or other means of
administration.
[0550] A "pharmaceutical excipient" or a "pharmaceutically
acceptable excipient" is a carrier, usually a liquid, in which an
active therapeutic agent is formulated. In one embodiment of the
invention, the active therapeutic agent is a humanized antibody
described herein, or one or more fragments thereof. The excipient
generally does not provide any pharmacological activity to the
formulation, though it may provide chemical and/or biological
stability, and release characteristics. Exemplary formulations may
be found, for example, in Grennaro (2005) [Ed.] Remington: The
Science and Practice of Pharmacy [21.sup.st Ed.]
[0551] Pharmaceutical compositions typically must be sterile and
stable under the conditions of manufacture and storage. The
invention contemplates that the pharmaceutical composition is
present in lyophilized form. The composition may be formulated as a
solution, microemulsion, liposome, or other ordered structure
suitable to high drug concentration. The carrier may be a solvent
or dispersion medium containing, for example, water, ethanol,
polyol (for example, glycerol, propylene glycol, and liquid
polyethylene glycol), and suitable mixtures thereof. The invention
further contemplates the inclusion of a stabilizer in the
pharmaceutical composition.
[0552] The polypeptides, conjugates, and antibodies described
herein may be formulated into pharmaceutical compositions of
various dosage forms. To prepare the pharmaceutical compositions of
the invention, at least one VISTA and VISTA conjugate as the active
ingredient may be intimately mixed with appropriate carriers and
additives according to techniques well known to those skilled in
the art of pharmaceutical formulations. See Grennaro (2005) [Ed.]
Remington: The Science and Practice of Pharmacy [21.sup.st Ed.] For
example, the antibodies described herein may be formulated in
phosphate buffered saline pH 7.2 and supplied as a 5.0 mg/mL clear
colorless liquid solution.
[0553] Similarly, compositions for liquid preparations include
solutions, emulsions, dispersions, suspensions, syrups, and
elixirs, with suitable carriers and additives including but not
limited to water, alcohols, oils, glycols, preservatives, flavoring
agents, coloring agents, and suspending agents. Typical
preparations for parenteral administration comprise the active
ingredient with a carrier such as sterile water or parenterally
acceptable oil including but not limited to polyethylene glycol,
polyvinyl pyrrolidone, lecithin, arachis oil or sesame oil, with
other additives for aiding solubility or preservation may also be
included. In the case of a solution, it may be lyophilized to a
powder and then reconstituted immediately prior to use. For
dispersions and suspensions, appropriate carriers and additives
include aqueous gums, celluloses, silicates, or oils.
[0554] For each of the recited embodiments, the VISTA and VISTA
conjugate may be administered by a variety of dosage forms. Any
biologically-acceptable dosage form known to persons of ordinary
skill in the art, and combinations thereof, are contemplated.
Examples of such dosage forms include, without limitation,
reconstitutable powders, elixirs, liquids, solutions, suspensions,
emulsions, powders, granules, particles, microparticles,
dispersible granules, cachets, inhalants, aerosol inhalants,
patches, particle inhalants, implants, depot implants, injectables
(including subcutaneous, intramuscular, intravenous, and
intradermal), infusions, and combinations thereof.
[0555] In many cases, it are preferable to include isotonic agents,
e.g., sugars, polyalcohols such as mannitol, sorbitol, or sodium
chloride in the composition. Prolonged absorption of the injectable
compositions may be brought about by including in the composition
an agent which delays absorption, e.g., monostearate salts and
gelatin. Moreover, the compounds described herein may be formulated
in a time release formulation, e.g. in a composition that includes
a slow release polymer. The VISTA and VISTA conjugate may be
prepared with carriers that will protect the compound against rapid
release, such as a controlled release formulation, including
implants and microencapsulated delivery systems. Biodegradable,
biocompatible polymers may be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters,
polylactic acid and polylactic, polyglycolic copolymers (PLG). Many
methods for the preparation of such formulations are known to those
skilled in the art.
[0556] Supplementary active compounds can also be incorporated into
the compositions.
[0557] For example, compositions may further comprise a desired
antigen, e.g., a tumor antigen or another immune modulatory
compounds such as Toll like receptor agonists, type 1 interferon
such as alpha and beta interferons and CD40 agonists such as
agonistic CD40 antibodies and antibody fragments, preferably
anti-human CD40 agonistic antibodies and antibody fragments or
other immune enhancers or suppressors such as PD-L1, PD-L2, CTLA4
fusion proteins and antibodies specific thereto.
[0558] Compositions comprising VISTA may further comprise an
antigen or other immune agonist. The antigen may be administered in
an amount that, in combination with the other components of the
combination, is effective to generate an immune response against
the antigen. For example, the antigen may be administered in an
amount from about 100 .mu.g/kg to about 100 mg/kg. In some
embodiments, the antigen may be administered in an amount from
about 10 .mu.g/kg to about 10 mg/kg. In some embodiments, the
antigen may be administered in an amount from about 1 mg/kg to
about 5 mg/kg. The particular amount of antigen that constitutes an
amount effective to generate an immune response, however, depends
to some extent upon certain factors such as, for example, the
particular antigen being administered; the particular agonist being
administered and the amount thereof; the particular agonist being
administered and the amount thereof; the state of the immune
system; the method and order of administration of the agonist and
the antigen; the species to which the formulation is being
administered; and the desired therapeutic result. Accordingly, it
is not practical to set forth generally the amount that constitutes
an effective amount of the antigen. Those of ordinary skill in the
art, however, can readily determine the appropriate amount with due
consideration of such factors.
[0559] The antigen can be any material capable of raising a Th1
immune response, which may include one or more of, for example, a
CD8+ T cell response, an NK T cell response, a .gamma./.delta. T
cell response, or a Th1 antibody response. Suitable antigens
include but are not limited to peptides; polypeptides; lipids;
glycolipids; polysaccharides; carbohydrates; polynucleotides;
prions; live or inactivated bacteria, viruses or fungi; and
bacterial, viral, fungal, protozoal, tumor-derived, or
organism-derived antigens, toxins or toxoids.
[0560] Furthermore, certain currently experimental antigens,
especially materials such as recombinant proteins, glycoproteins,
and peptides that do not raise a strong immune response, can be
used in connection with adjuvant combinations of the invention.
Exemplary experimental subunit antigens include those related to
viral disease such as adenovirus, AIDS, chicken pox,
cytomegalovirus, dengue, feline leukemia, fowl plague, hepatitis A,
hepatitis B, HSV-1, HSV-2, hog cholera, influenza A, influenza B,
Japanese encephalitis, measles, parainfluenza, rabies, respiratory
syncytial virus, rotavirus, wart, and yellow fever.
[0561] The antigen may be a cancer antigen or a tumor antigen. The
terms cancer antigen and tumor antigen are used interchangeably and
refer to an antigen that is differentially expressed by cancer
cells. Therefore, cancer antigens can be exploited to
differentially target an immune response against cancer cells.
Cancer antigens may thus potentially stimulate tumor-specific
immune responses. Certain cancer antigens are encoded, though not
necessarily expressed, by normal cells. Some of these antigens may
be characterized as normally silent (i.e., not expressed) in normal
cells, those that are expressed only at certain stages of
differentiation, and those that are temporally expressed (e.g.,
embryonic and fetal antigens). Other cancer antigens can be encoded
by mutant cellular genes such as, for example, oncogenes (e.g.,
activated ras oncogene), suppressor genes (e.g., mutant p53), or
fusion proteins resulting from internal deletions or chromosomal
translocations. Still other cancer antigens can be encoded by viral
genes such as those carried by RNA and DNA tumor viruses.
[0562] Examples of tumor antigens include MAGE, MART-1/Melan-A,
gp100, Dipeptidyl peptidase IV (DPPUV), adenosine deaminase-binding
protein (ADAbp), cyclophilin b, Colorectal associated antigen
(CRC)-C017-1A/GA733, Carcinoembryonic Antigen (CEA) and its
antigenic epitopes CAP-1 and CAP-2, etv6, aml1, Prostate Specific
Antigen (PSA) and its antigenic epitopes PSA-1, PSA-2, and PSA-3,
prostate-specific membrane antigen (PSMA), T-cell
receptor/CD3-.zeta. chain, MAGE-family of tumor antigens (e.g.,
MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7,
MAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12, MAGE-Xp2 (MAGE-B2),
MAGE-Xp3 (MAGE-B3), MAGE-Xp4 (MAGE-B4), MAGE-C1, MAGE-C2, MAGE-C3,
MAGE-C4, MAGE-C5), GAGE-family of tumor antigens (e.g., GAGE-1,
GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7, GAGE-8, GAGE-9),
BAGE, RAGE, LAGE-1, NAG, GnT-V, MUM-1, CDK4, tyrosinase, p53, MUC
family, HER2/neu, p21ras, RCAS1, .alpha.-fetoprotein,
.epsilon.-cadherin, .alpha.-catenin, .beta.-catenin,
..gamma.-catenin, p120ctn, gp10.sup.Pmel117, PRAME, NY-ESO-1,
cdc27, adenomatous polyposis coli protein (APC), fodrin, Connexin
37, Ig-idiotype, p15, gp75, GM2 and GD2 gangliosides, viral
products such as human papilloma virus proteins, Smad family of
tumor antigens, Imp-1, PIA, EBV-encoded nuclear antigen (EBNA)-1,
brain glycogen phosphorylase, SSX-1, SSX-2 (HOM-MEL-40), SSX-3,
SSX-4, SSX-5, SCP-1 and CT-7, and c-erbB-2.
[0563] Cancers or tumors and specific tumor antigens associated
with such tumors (but not exclusively), include acute lymphoblastic
leukemia (etv6, aml1, cyclophilin b), B cell lymphoma
(Ig-idiotype), glioma (E-cadherin, .alpha.-catenin, .beta.-catenin,
..gamma.-catenin, p120ctn), bladder cancer (p21ras), biliary cancer
(p21ras), breast cancer (MUC family, HER2/neu, c-erbB-2), cervical
carcinoma (p53, p21ras), colon carcinoma (p21ras, HER2/neu,
c-erbB-2, MUC family), colorectal cancer (Colorectal associated
antigen (CRC)-CO17-1A/GA733, APC), choriocarcinoma (CEA),
epithelial cell cancer (cyclophilin b), gastric cancer (HER2/neu,
c-erbB-2, ga733 glycoprotein), hepatocellular cancer
(.alpha.-fetoprotein), Hodgkins lymphoma (Imp-1, EBNA-1), lung
cancer (CEA, MAGE-3, NY-ESO-1), lymphoid cell-derived leukemia
(cyclophilin b), melanoma (p5 protein, gp75, oncofetal antigen, GM2
and GD2 gangliosides, Melan-A/MART-1, cdc27, MAGE-3, p21ras,
gp100.sup.Pmel117), myeloma (MUC family, p21ras), non-small cell
lung carcinoma (HER2/neu, c-erbB-2), nasopharyngeal cancer (Imp-1,
EBNA-1), ovarian cancer (MUC family, HER2/neu, c-erbB-2), prostate
cancer (Prostate Specific Antigen (PSA) and its antigenic epitopes
PSA-1, PSA-2, and PSA-3, PSMA, HER2/neu, c-erbB-2, ga733
glycoprotein), renal cancer (HER2/neu, c-erbB-2), squamous cell
cancers of the cervix and esophagus (viral products such as human
papilloma virus proteins), testicular cancer (NY-ESO-1), and T cell
leukemia (HTLV-1 epitopes).
[0564] A person of skill in the art would be able to determine an
effective dosage and frequency of administration through routine
experimentation, for example guided by the disclosure herein and
the teachings in Goodman, et al. (2011) Goodman & Gilman's The
Pharmacological Basis of Therapeutics [12.sup.th Ed.]; Howland, et
al. (2005) Lippincott's Illustrated Reviews: Pharmacology [2.sup.nd
Ed.]; and Golan, (2008) Principles of Pharmacology: The
Pathophysiologic Basis of Drug Therapy [2.sup.nd Ed.] See, also,
Grennaro (2005) [Ed.] Remington: The Science and Practice of
Pharmacy [21.sup.st Ed.]
Routes of Administration
[0565] The compositions described herein may be administered in any
of the following routes: buccal, epicutaneous, epidural, infusion,
inhalation, intraarterial, intracardial, intracerebroventricular,
intradermal, intramuscular, intranasal, intraocular,
intraperitoneal, intraspinal, intrathecal, intravenous, oral,
parenteral, pulmonary, rectally via an enema or suppository,
subcutaneous, subdermal, sublingual, transdermal, and transmucosal.
The preferred routes of administration are intravenous injection or
infusion. The administration can be local, where the composition is
administered directly, close to, in the locality, near, at, about,
or in the vicinity of, the site(s) of disease, e.g., tumor, or
systemic, wherein the composition is given to the patient and
passes through the body widely, thereby reaching the site(s) of
disease. Local administration (e.g., injection) may be accomplished
by administration to the cell, tissue, organ, and/or organ system,
which encompasses and/or is affected by the disease, and/or where
the disease signs and/or symptoms are active or are likely to occur
(e.g., tumor site). Administration can be topical with a local
effect, composition is applied directly where its action is desired
(e.g., tumor site).
[0566] For each of the recited embodiments, the compounds can be
administered by a variety of dosage forms as known in the art. Any
biologically-acceptable dosage form known to persons of ordinary
skill in the art, and combinations thereof, are contemplated.
Examples of such dosage forms include, without limitation, chewable
tablets, quick dissolve tablets, effervescent tablets,
reconstitutable powders, elixirs, liquids, solutions, suspensions,
emulsions, tablets, multi-layer tablets, bi-layer tablets,
capsules, soft gelatin capsules, hard gelatin capsules, caplets,
lozenges, chewable lozenges, beads, powders, gum, granules,
particles, microparticles, dispersible granules, cachets, douches,
suppositories, creams, topicals, inhalants, aerosol inhalants,
patches, particle inhalants, implants, depot implants, ingestibles,
injectables (including subcutaneous, intramuscular, intravenous,
and intradermal), infusions, and combinations thereof.
[0567] Other compounds which can be included by admixture are, for
example, medically inert ingredients (e.g., solid and liquid
diluent), such as lactose, dextrosesaccharose, cellulose, starch or
calcium phosphate for tablets or capsules, olive oil or ethyl
oleate for soft capsules and water or vegetable oil for suspensions
or emulsions; lubricating agents such as silica, talc, stearic
acid, magnesium or calcium stearate and/or polyethylene glycols;
gelling agents such as colloidal clays; thickening agents such as
gum tragacanth or sodium alginate, binding agents such as starches,
arabic gums, gelatin, methylcellulose, carboxymethylcellulose or
polyvinylpyrrolidone; disintegrating agents such as starch, alginic
acid, alginates or sodium starch glycolate; effervescing mixtures;
dyestuff; sweeteners; wetting agents such as lecithin, polysorbates
or laurylsulphates; and other therapeutically acceptable accessory
ingredients, such as humectants, preservatives, buffers and
antioxidants, which are known additives for such formulations.
[0568] Liquid dispersions for oral administration can be syrups,
emulsions, solutions, or suspensions. The syrups can contain as a
carrier, for example, saccharose or saccharose with glycerol and/or
mannitol and/or sorbitol. The suspensions and the emulsions can
contain a carrier, for example a natural gum, agar, sodium
alginate, pectin, methylcellulose, carboxymethylcellulose, or
polyvinyl alcohol.
[0569] In further embodiments, the present invention provides kits
including one or more containers comprising pharmaceutical dosage
units comprising an effective amount of one or more antibodies and
fragments thereof of the present invention. Kits may include
instructions, directions, labels, marketing information, warnings,
or information pamphlets.
Dosages
[0570] The amount of VISTA or VISTA conjugate in a therapeutic
composition according to any embodiments of this invention may vary
according to factors such as the disease state, age, gender,
weight, patient history, risk factors, predisposition to disease,
administration route, pre-existing treatment regime (e.g., possible
interactions with other medications), and weight of the individual.
Dosage regimens may be adjusted to provide the optimum therapeutic
response. For example, a single bolus may be administered, several
divided doses may be administered over time, or the dose may be
proportionally reduced or increased as indicated by the exigencies
of therapeutic situation.
[0571] It is especially advantageous to formulate parenteral
compositions in dosage unit form for ease of administration and
uniformity of dosage. Dosage unit form as used herein refers to
physically discrete units suited as unitary dosages for the
mammalian subjects to be treated; each unit containing a
predetermined quantity of antibodies, and fragments thereof,
calculated to produce the desired therapeutic effect in association
with the required pharmaceutical carrier. The specification for the
dosage unit forms of the invention are dictated by and directly
dependent on the unique characteristics of the antibodies, and
fragments thereof, and the particular therapeutic effect to be
achieved, and the limitations inherent in the art of compounding
such an antibodies, and fragments thereof, for the treatment of
sensitivity in individuals. In therapeutic use for treatment of
conditions in mammals (e.g., humans) for which the antibodies and
fragments thereof of the present invention or an appropriate
pharmaceutical composition thereof are effective, the antibodies
and fragments thereof of the present invention may be administered
in an effective amount. The dosages as suitable for this invention
may be a composition, a pharmaceutical composition or any other
compositions described herein.
[0572] The dosage may be administered as a single dose, a double
dose, a triple dose, a quadruple dose, and/or a quintuple dose. The
dosages may be administered singularly, simultaneously, and
sequentially.
[0573] The dosage form may be any form of release known to persons
of ordinary skill in the art. The compositions of the present
invention may be formulated to provide immediate release of the
active ingredient or sustained or controlled release of the active
ingredient. In a sustained release or controlled release
preparation, release of the active ingredient may occur at a rate
such that blood levels are maintained within a therapeutic range
but below toxic levels over an extended period of time (e.g., 4 to
24 hours). The preferred dosage forms include immediate release,
extended release, pulse release, variable release, controlled
release, timed release, sustained release, delayed release, long
acting, and combinations thereof, and are known in the art.
[0574] As defined herein, a therapeutically effective amount of
protein or polypeptide (i.e., an effective dosage) ranges from
about 0.001 to 30 mg/kg body weight, preferably about 0.01 to 25
mg/kg body weight, more preferably about 0.1 to 20 mg/kg body
weight, and even more preferably about 1 to 10 mg/kg, 2 to 9 mg/kg,
3 to 8 mg/kg, 4 to 7 mg/kg, or 5 to 6 mg/kg body weight. The
skilled artisan will appreciate that certain factors may influence
the dosage required to effectively treat a subject, including but
not limited to the severity of the disease or disorder, previous
treatments, the general health and/or age of the subject, and other
diseases present. Moreover, treatment of a subject with a
therapeutically effective amount of a protein, polypeptide, or
antibody can include a single treatment or, preferably, can include
a series of treatments.
[0575] In a preferred example, a subject is treated with antibody,
protein, or polypeptide in the range of between about 0.1 to 20
mg/kg body weight, one time per week for between about 1 to 10
weeks, preferably between 2 to 8 weeks, more preferably between
about 3 to 7 weeks, and even more preferably for about 4, 5, or 6
weeks. It will also be appreciated that the effective dosage of
antibody, protein, or polypeptide used for treatment may increase
or decrease over the course of a particular treatment. Changes in
dosage may result and become apparent from the results of
diagnostic assays as described herein.
[0576] It are appreciated that the pharmacological activity of the
compositions may be monitored using standard pharmacological models
that are known in the art. Furthermore, it are appreciated that the
compositions comprising a VISTA and VISTA conjugate, antibody or
antigen-binding fragment thereof, may be incorporated or
encapsulated in a suitable polymer matrix or membrane for
site-specific delivery, or may be functionalized with specific
targeting agents capable of effecting site specific delivery. These
techniques, as well as other drug delivery techniques are well
known in the art. Determination of optimal dosages for a particular
situation is within the capabilities of those skilled in the art.
See, e.g., Grennaro (2005) [Ed.] Remington: The Science and
Practice of Pharmacy [21.sup.st Ed.]
Methods of Treatment
[0577] The VISTA and VISTA conjugates described herein may be used
in methods for treating inflammatory disorders, autoimmune
diseases, suppress CD4.sup.+ T cell proliferation, suppress
CD8.sup.+ T cell proliferation, suppress CD4.sup.+ T cell cytokine
production, and suppress CD8.sup.+ T cell cytokine production
comprising administering an effective amount of a VISTA and VISTA
conjugate to a subject in need thereof. Further, the VISTA and
VISTA conjugates described herein may be used to manufacture
medicaments for use in treating autoimmune diseases, suppress
CD4.sup.+ T cell proliferation, suppress CD8.sup.+ T cell
proliferation, suppress CD4.sup.+ T cell cytokine production, and
suppress CD8.sup.+ T cell cytokine production comprising an
effective amount of a VISTA and VISTA conjugate described herein.
The VISTA and VISTA conjugates described herein may be admixed with
a pharmaceutically acceptable carrier to manufacture a composition
for treating autoimmune diseases, suppress CD4.sup.+ T cell
proliferation, suppress CD8.sup.+ T cell proliferation, suppress
CD4.sup.+ T cell cytokine production, and suppress CD8.sup.+ T cell
cytokine production comprising an effective amount of a VISTA or
VISTA conjugate described herein.
[0578] The therapeutic methods described herein may comprise
administration of PD-L3 or VISTA, is a novel and
structurally-distinct, Ig-superfamily inhibitory ligand, whose
extracellular domain bears homology to the B7 family ligand PD-L1.
This molecule is referred to interchangeably herein as PD-L3 or
VISTA or as V-domain Immunoglobulin Suppressor of T cell Activation
(VISTA). VISTA is expressed primarily within the hematopoietic
compartment and is highly regulated on myeloid APCs and T cells.
Therapeutic intervention of the VISTA inhibitory pathway represents
a novel approach to modulate T cell-mediated immunity for the
treatment of a wide variety of cancers. VISTA polypeptides,
conjugates, nucleic acids, ligands, and modulators thereof, may be
useful in regulating immunity, especially T cell immunity, for the
treatment of autoimmune disorders and inflammatory disorders.
[0579] The use of VISTA, VISTA-conjugates (e.g., VISTA-Ig), and
anti-VISTA antibodies to treat cancers including but not limited to
bladder cancer, ovarian cancer, and melanoma, autoimmune disorders,
and inflammatory disorders. In addition, the present invention in
particular relates to the use of VISTA proteins, especially
multimeric VISTA proteins and viral vectors (e.g., adenoviral) that
express same to treat conditions wherein immunosupression is
therapeutically desired such as allergy, autoimmune disorders, and
inflammatory conditions.
[0580] The patient may express symptoms of an autoimmune disease or
a patient without symptoms. The methods described herein may be
used on cells, e.g., human cells, in vitro or ex vivo.
Alternatively, the method may be performed on cells present in a
subject as part of an in vivo (e.g., therapeutic) protocol.
[0581] The present invention provides for both prophylactic and
therapeutic methods of treating a subject at risk of (or
susceptible to) a disorder characterized by insufficient or
excessive production of VISTA (PD-L3) protein or production of
VISTA (PD-L3) protein forms which have decreased or aberrant
activity compared to VISTA (PD-L3) wild type protein. Moreover, the
anti-VISTA (PD-L3) antibodies of the invention can be used to
detect and isolate VISTA (PD-L3) proteins, regulate the
bioavailability of VISTA (PD-L3) proteins, and modulate VISTA
(PD-L3) activity, e.g., by modulating the interaction of VISTA
(PD-L3) with its counter receptor.
Uses and Methods of the Invention
[0582] The VISTA molecules, e.g., the VISTA nucleic acid molecules,
polypeptides, polypeptide homologues, and antibodies and antibody
fragments described herein can be used in one or more of the
following methods: a) screening assays; b) predictive medicine
(e.g., diagnostic assays, prognostic assays, and monitoring
clinical trials); and c) methods of treatment (e.g., therapeutic
and prophylactic, e.g., by up- or down-modulating the immune
response). As described herein, a VISTA (PD-L3) polypeptide of the
invention has one or more of the following activities: 1) binds to
and/or modulates the activity of its natural binding partner(s), 2)
modulates intra- or intercellular signaling, 3) modulates
activation of T lymphocytes, 4) modulates the immune response of an
organism, e.g., a mammalian organism, such as a mouse or human. The
isolated nucleic acid molecules of the invention can be used, for
example, to express VISTA (PD-L3) polypeptide (e.g., via a
recombinant expression vector in a host cell in gene therapy
applications), to detect VISTA (PD-L3) mRNA (e.g., in a biological
sample) or a genetic alteration in a VISTA (PD-L3) gene, and to
modulate VISTA (PD-L3) activity, as described further below. The
VISTA (PD-L3) polypeptides can be used to treat conditions or
disorders characterized by insufficient or excessive production of
a VISTA (PD-L3) polypeptide or production of VISTA (PD-L3)
inhibitors. In addition, the VISTA (PD-L3) polypeptides can be used
to screen for naturally occurring VISTA (PD-L3) binding partner(s),
to screen for drugs or compounds which modulate VISTA (PD-L3)
activity, as well as to treat conditions or disorders characterized
by insufficient or excessive production of VISTA (PD-L3)
polypeptide or production of VISTA (PD-L3) polypeptide forms which
have decreased, aberrant or unwanted activity compared to VISTA
(PD-L3) wild-type polypeptide (e.g., immune system disorders such
as severe combined immunodeficiency, multiple sclerosis, systemic
lupus erythematosus, type I diabetes mellitus, lymphoproliferative
syndrome, inflammatory bowel disease, allergies, asthma,
graft-versus-host disease, and transplant rejection; immune
responses to infectious pathogens such as bacteria and viruses; and
immune system cancers such as lymphomas and leukemias). Moreover,
the anti-VISTA (PD-L3) antibodies of the invention can be used to
detect and isolate VISTA (PD-L3) polypeptides, regulate the
bioavailability of VISTA (PD-L3) polypeptides, and modulate VISTA
(PD-L3) activity, e.g., by modulating the interaction between VISTA
(PD-L3) and its natural binding partner(s).
[0583] Anti-VISTA (PD-L3) antibodies for use as therapeutics may be
selected based on the fact that in the presence of soluble VISTA
(PD-L3)-proteins (e.g., VISTA (PD-L3)-Ig fusion protein), the
anti-VISTA antibodies enhance the suppressive effects of VISTA
(PD-L3) on VISTA (PD-L3) related immune functions. This is quite
unexpected as these anti-VISTA antibodies behave in vivo opposite
to what would be expected from their in vitro effect on immunity
(i.e., these anti-VISTA monoclonal antibodies are
immunosuppressive.)
[0584] An important aspect of the invention pertains to methods of
modulating VISTA (PD-L3) expression or activity or interaction with
its natural binding partners, Relevant to therapy VISTA (PD-L3) has
been demonstrated to inhibit CD28 costimulation, to inhibit TCR
activation of immune cells, to inhibit proliferation of activated
immune cells (CD4+ and CD8+ T cells), to inhibit cytokine
production by T cells (IL-2, gamma interferon) and to transmit an
inhibitory signal to immune cells. Accordingly, the activity and/or
expression of VISTA (PD-L3), as well as the interaction between
VISTA (PD-L3) and its binding partners) on T cells can be modulated
in order to modulate the immune response. Because VISTA (PD-L3)
binds to inhibitory receptors (on T cells), upregulation of VISTA
(PD-L3) activity should result in downregulation of immune
responses, whereas downregulation of VISTA (PD-L3) activity should
results in upregulation of immune responses. In an embodiment,
VISTA (PD-L3) binds to inhibitory receptors. As noted previously,
counterintuitively VISTA (PD-L3) specific antibodies produced by
Applicant which in vitro (in the presence of VISTA (PD-L3)-Ig)
enhance the suppressive activities of VISTA (PD-L3)-Ig fusion
proteins (i.e., these antibodies enhance the suppression of VISTA
(PD-L3) related activities such as effects of VISTA (PD-L3) on
cytokine production, T cell proliferation, differentiation or
activation and other functions noted previously), behave oppositely
to what would be expected in vivo, i.e., these antibodies have been
found to be immunosuppressive in vivo.
[0585] Modulatory methods of the invention involve contacting a
cell with a VISTA (PD-L3) polypeptide or agent that modulates one
or more of the activities of VISTA (PD-L3) polypeptide activity
associated with the cell, e.g., an agent that modulates expression
or activity of VISTA (PD-L3) and/or modulates the interaction of
VISTA (PD-L3) and its natural binding partner(s). An agent that
modulates VISTA (PD-L3) polypeptide activity can be an agent as
described herein, such as a nucleic acid or a polypeptide, a
naturally-occurring binding partner of a VISTA (PD-L3) polypeptide
a VISTA (PD-L3) antibody, a VISTA (PD-L3) agonist or antagonist, a
peptidomimetic of a VISTA (PD-L3) agonist or antagonist, a VISTA
(PD-L3) peptidomimetic, or other small molecule. Soluble forms of
VISTA (PD-L3) may also be used to interfere with the binding of
VISTA (PD-L3) to any of its natural binding partner(s) or
ligands.
[0586] An agent that modulates the expression of VISTA (PD-L3) is,
e.g., an antisense nucleic acid molecule, triplex oligonucleotide,
ribozyme, or recombinant vector for expression of a VISTA (PD-L3)
polypeptide. For example, an oligonucleotide complementary to the
area around a VISTA (PD-L3) polypeptide translation initiation site
can be synthesized. One or more antisense oligonucleotides can be
added to cell media, typically at 200 .mu.g/ml, or administered to
a patient to prevent the synthesis of a VISTA (PD-L3) polypeptide.
The antisense oligonucleotide is taken up by cells and hybridizes
to a VISTA (PD-L3) mRNA to prevent translation. Alternatively, an
oligonucleotide which binds double-stranded DNA to form a triplex
construct to prevent DNA unwinding and transcription can be used.
As a result of either, synthesis of VISTA (PD-L3) polypeptide is
blocked. When VISTA (PD-L3) expression is modulated, preferably,
such modulation occurs by a means other than by knocking out the
VISTA (PD-L3) gene.
[0587] Agents which modulate expression, by virtue of the fact that
they control the amount of VISTA (PD-L3) in a cell, also modulate
the total amount of VISTA (PD-L3) activity in a cell. In one
embodiment, the agent the modulates VISTA (PD-L3) stimulates one or
more VISTA (PD-L3) activities. Examples of such stimulatory agents
include active VISTA (PD-L3) polypeptide and a nucleic acid
molecule encoding VISTA (PD-L3) that has been introduced into the
cell. In another embodiment, the agent inhibits one or more VISTA
(PD-L3) activities. Examples of such inhibitory agents include
antisense VISTA (PD-L3) nucleic acid molecules, anti-VISTA (PD-L3)
antibodies, VISTA (PD-L3) inhibitors, and compounds identified in
the subject screening assays. In a further embodiment, an
inhibitory agent is a combination of an anti-VISTA (PD-L3) antibody
and an anti-PD-L1 or anti-PD-L2 antibody. These modulatory methods
can be performed in vitro (e.g., by contacting the cell with the
agent) or, alternatively, by contacting an agent with cells in vivo
(e.g., by administering the agent to a subject). As such, the
present invention provides methods of treating an individual
afflicted with a condition or disorder that would benefit from up-
or down-modulation of a VISTA (PD-L3) polypeptide, e.g., a disorder
characterized by unwanted, insufficient, or aberrant expression or
activity of a VISTA (PD-L3) polypeptide or nucleic acid molecule.
In one embodiment, the method involves administering an agent
(e.g., an agent identified by a screening assay described herein),
or combination of agents that modulates (e.g., upregulates or
downregulates) VISTA (PD-L3) expression or activity. In another
embodiment, the method involves administering a VISTA (PD-L3)
polypeptide or nucleic acid molecule as therapy to compensate for
reduced, aberrant, or unwanted VISTA (PD-L3) expression or
activity.
[0588] The invention provides a method for preventing in a subject,
a disease or condition associated with an aberrant or unwanted
VISTA (PD-L3) expression or activity, by administering to the
subject a VISTA (PD-L3) polypeptide or an agent which modulates
VISTA (PD-L3) expression or at least one VISTA (PD-L3) activity.
Subjects at risk for a disease or disorder which is caused or
contributed to by aberrant or unwanted VISTA (PD-L3) expression or
activity can be identified by, for example, any or a combination of
diagnostic or prognostic assays as described herein. Administration
of a prophylactic agent can occur prior to the manifestation of
symptoms characteristic of the VISTA (PD-L3) aberrancy, such that a
disease or disorder is prevented or, alternatively, delayed in its
progression. Depending on the type of VISTA (PD-L3) aberrancy, for
example, a VISTA (PD-L3) polypeptide, VISTA (PD-L3) agonist or
VISTA (PD-L3) antagonist (e.g., an anti-VISTA (PD-L3) antibody)
agent can be used for treating the subject. The appropriate agent
can be determined based on screening assays described herein.
[0589] The VISTA and VISTA conjugate, may be admixed with
additional chemotherapeutic agents, cytotoxic agent, antibodies
(e.g., anti-PD-L1, PD-L2 or CTLA-4 antibodies), lymphokine, or
hematopoietic growth factor. The VISTA and VISTA conjugate, may
also be administered in combination with another antibody, a
lymphokine, cytotoxic agent (e.g., a moiety that inhibits DNA, RNA,
or protein synthesis, a radionuclide, or ribosomal inhibiting
protein, e.g., .sup.212Bi, .sup.131I, .sup.188Re, .sup.90Y,
vindesine, methotrexate, adriamycin, cisplatin, pokeweed antiviral
protein, Pseudomonas exotoxin A, ricin, diphtheria toxin, ricin A
chain, or cytotoxic phospholipase enzyme), immunosuppressive agent
(e.g., cyclosporine, leflunomide, methotrexate, azothiprine,
mercaptopurine, dactinomycin, tacrolimus, or sirolimus) or a
hematopoietic growth factor. The VISTA and VISTA conjugate, may be
label with a chemiluminescent label, paramagnetic label (e.g.,
aluminum, manganese, platinum, oxygen, lanthanum, lutetium,
scandium, yttrium, or gallium), an MRI contrast agent, fluorescent
label, bioluminescent label, or radioactive label. In the methods
described herein, the second agent may be administered
simultaneously or sequentially with the antibody. For example, the
second agent may be an agent that downregulates an immune response
(e.g., PD-L1, PD-L2 or CTLA-4 fusion protein or antibody specific
thereto.)
[0590] In one embodiment, methods of treating a subject with an
autoimmune disease comprising administering a VISTA and VISTA
conjugate, to a subject who may be receiving secondary therapy.
Examples of secondary therapy include chemotherapy, radiotherapy,
immunotherapy, phototherapy, cryotherapy, toxin therapy, hormonal
therapy, or surgery. Thus, the invention contemplates use of the
methods and compositions in conjunction with standard anti-cancer
therapies. The patient to be treated may be of any age. One of
skill in the art will recognize the presence and development of
other anticancer therapies which may be used in conjugation with
the VISTA or VISTA conjugate.
[0591] Determination of dose is within the level of ordinary skill
in the art. The VISTA and VISTA conjugate, may be administered for
acute treatment, over one week or less, often over a period of one
to three days or may be used in chronic treatment, over several
months or years. In general, a therapeutically effective amount of
the VISTA and VISTA conjugate is an amount sufficient to produce a
clinically significant change in the autoimmune disease.
[0592] An inhibitory signal as transduced by an inhibitory receptor
can occur even if a costimulatory receptor (e.g., CD28 or ICOS) in
not present on the immune cell and, thus, is not simply a function
of competition between inhibitory receptors and costimulatory
receptors for binding of costimulatory molecules (Fallarino, et al.
(1998) J. Exp. Med. 188: 205). Transmission of an inhibitory signal
to an immune cell can result in unresponsiveness, anergy or
programmed cell death in the immune cell. Preferably, transmission
of an inhibitory signal operates through a mechanism that does not
involve apoptosis.
Autoimmune Diseases
[0593] The VISTA polypeptides, multimeric VISTA polypeptides, VISTA
fusion proteins (e.g., VISTA-Ig), and anti-VISTA antibodies
described herein may be used in compositions, uses, and methods for
the treatment of autoimmune diseases.
[0594] V-domain Immunoglobulin containing Suppressor of T cell
Activation (VISTA) is a member of a family related to the
Immunoglobulin (Ig) superfamily, which exerts profound impact on
the immune system. The Ig superfamily consists of many critical
immune regulators, such as the B7 family ligands and receptors. The
best characterized costimulatory ligands are B7.1 and B7.2 that
belong to the Ig superfamily and are expressed on professional APCs
and whose receptors are CD28 and CTLA-4.
[0595] The B7 family ligands have expanded to include
co-stimulatory B7-H2 (ICOS Ligand) and B7-H3, as well as
co-inhibitory B7-H1 (PD-L1), B7-DC (PD-L2), B7-H4 (B7S1 or B7x),
and B7-H6. Brandt, et al. (2009) J Exp Med 206, 1495-1503;
Greenwald, et al. (2005) Annu Rev Immunol 23: 515-548. Accordingly,
additional CD28 family receptors have been identified. ICOS is
expressed on activated T cells and binds to B7-H2. ICOS is a
positive co-regulator, important for T-cell activation,
differentiation and function. Dong, et al. (2001) Nature 409,
97-101. On the other hand, programmed death 1 (PD-1) negatively
regulates T cell responses. PD-1.sup.-/- mice develop lupus-like
autoimmune disease, or autoimmune dilated cardiomyopathy.
Nishimura, et al. (2001) Science 291: 319-322. Recently, CD80 was
identified as a second receptor for PD-L1 that transduces
inhibitory signals into T cells. Butte, et al. (2007) Immunity 27,
111-122. The two inhibitory B7 family ligands, PD-L1 and PD-L2,
have distinct expression patterns. PD-L2 is expressed inducibly on
DCs and macrophages, whereas PD-L1 is broadly expressed on both
hematopoietic cells and non-hematopoietic cell types. Consistent
with the immune-suppressive role of PD-1 receptor, studies using
PD-L1.sup.-/- and PD-L2.sup.-/- mice have shown that both ligands
have overlapping roles in inhibiting T-cell proliferation and
cytokine production. At this time, VISTA appears to be selectively
expressed hematopoietic cells, which distinguishes it from PD-L1 in
distribution, and likely plays a critical role in negatively
regulating the development of autoimmune disease.
[0596] A novel and structurally-distinct, Ig-superfamily inhibitory
ligand, whose extracellular domain bears highest homology to the B7
family ligand PD-L1. Although its closest relative phylogenetically
is PD-L1, it was not designated a PD-L name due to its modest level
of similarity (20%). It has a 93 aa cytoplasmic domain with no
obvious signal transducing motifs, except a possible protein kinase
C binding site. See FIG. 4. VISTA is a negative, regulatory ligand
and that is based on the following facts:
[0597] A soluble VISTA-Ig fusion protein suppresses in vitro
CD4.sup.+ and CD8.sup.- T cell proliferation and cytokine
production. Suppression is observed with PD-1.sup.-/- T cells
indicating that PD-1 is not the VISTA receptor.
[0598] Overexpression of VISTA on APCs suppresses in vitro
CD4.sup.+ and CD8.sup.+ T cell proliferation.
[0599] VISTA over-expression on tumor cells impaired protective
anti-tumor immunity in tumor-vaccinated hosts.
[0600] VISTA.sup.-/- mice develop an inflammatory phenotype,
establishing that VISTA has an immunosuppressive function.
VISTA.sup.-/- DC stimulate more T cell proliferation then WT
DCs.
[0601] Anti-VISTA monoclonal antibody (13F3) blocked VISTA-induced
suppression of T cell responses by VISTA.sup.+ APCs in vitro to
enhance T cell activation.
[0602] Anti-VISTA monoclonal antibody exacerbated EAE and increased
the frequency of encephalitogenic Th17s in vivo.
[0603] Anti-VISTA monoclonal antibody induces tumor remission in
multiple (6) murine tumor models and VISTA expression on myeloid
derived suppressor cells (MDSC) in these models is extremely high,
suggesting that VISTA.sup.+ MDSC suppress tumor specific
immunity.
[0604] The VISTA polypeptides, multimeric VISTA polypeptides, VISTA
fusion proteins (e.g., VISTA-Ig), siRNA molecules consisting of any
one of the nucleic acid sequences SEQ ID NO: 38-67, and anti-VISTA
antibodies described herein may be used in compositions, uses, and
methods for the treatment of autoimmune diseases or disorders.
Examples of autoimmune diseases or disorders include, but are not
limited to acquired immune deficiency syndrome (AIDS), acquired
spenic atrophy, acute anterior uveitis, Acute Disseminated
Encephalomyelitis (ADEM), acute gouty arthritis, acute necrotizing
hemorrhagic leukoencephalitis, acute or chronic sinusitis, acute
purulent meningitis (or other central nervous system inflammatory
disorders), acute serious inflammation, Addison's disease,
adrenalitis, adult onset diabetes mellitus (Type II diabetes),
adult-onset idiopathic hypoparathyroidism (AOIH),
Agammaglobulinemia, agranulocytosis, vasculitides, including
vasculitis (including large vessel vasculitis (including
polymyalgia rheumatica and giant cell (Takayasu's) arthritis),
allergic conditions, allergic contact dermatitis, allergic
dermatitis, allergic granulomatous angiitis, allergic
hypersensitivity disorders, allergic neuritis, allergic reaction,
alopecia areata, alopecia totalis, Alport's syndrome, alveolitis
(e.g., allergic alveolitis and fibrosing alveolitis), Alzheimer's
disease, amyloidosis, amylotrophic lateral sclerosis (ALS; Lou
Gehrig's disease), an eosinophil-related disorder (e.g.,
eosinophilia), anaphylaxis, ankylosing spondylitis, antgiectasis,
antibody-mediated nephritis, Anti-GBM/Anti-TBM nephritis,
antigen-antibody complex-mediated diseases, antiglomerular basement
membrane disease, anti-phospholipid antibody syndrome,
antiphospholipid syndrome (APS), aphthae, aphthous stomatitis,
aplastic anemia, arrhythmia, arteriosclerosis, arteriosclerotic
disorders, arthritis (e.g., rheumatoid arthritis such as acute
arthritis, chronic rheumatoid arthritis), arthritis chronica
progrediente, arthritis deformans, ascariasis, aspergilloma (or
granulomas containing eosinophils), aspergillosis, aspermiogenese,
asthma (e.g., asthma bronchiale, bronchial asthma, and auto-immune
asthma), ataxia telangiectasia, ataxic sclerosis, atherosclerosis,
autism, autoimmune angioedema, autoimmune aplastic anemia,
autoimmune atrophic gastritis, autoimmune diabetes, autoimmune
disease of the testis and ovary including autoimmune orchitis and
oophoritis, autoimmune disorders associated with collagen disease,
autoimmune dysautonomia, autoimmune ear disease (e.g., autoimmune
inner ear disease (AGED)), autoimmune endocrine diseases including
thyroiditis such as autoimmune thyroiditis, autoimmune enteropathy
syndrome, autoimmune gonadal failure, autoimmune hearing loss,
autoimmune hemolysis, Autoimmune hepatitis, autoimmune
hepatological disorder, autoimmune hyperlipidemia, autoimmune
immunodeficiency, autoimmune inner ear disease (AIED), autoimmune
myocarditis, autoimmune neutropenia, autoimmune pancreatitis,
autoimmune polyendocrinopathies, autoimmune polyglandular syndrome
type I, autoimmune retinopathy, autoimmune thrombocytopenic purpura
(ATP), autoimmune thyroid disease, autoimmune urticaria,
autoimmune-mediated gastrointestinal diseases, Axonal &
neuronal neuropathies, Balo disease, Behcet's disease, benign
familial and ischemia-reperfusion injury, benign lymphocytic
angiitis, Berger's disease (IgA nephropathy), bird-fancier's lung,
blindness, Boeck's disease, bronchiolitis obliterans
(non-transplant) vs NSIP, bronchitis, bronchopneumonic
aspergillosis, Bruton's syndrome, bullous pemphigoid, Caplan's
syndrome, Cardiomyopathy, cardiovascular ischemia, Castleman's
syndrome, Celiac disease, celiac sprue (gluten enteropathy),
cerebellar degeneration, cerebral ischemia, and disease
accompanying vascularization, Chagas disease, channelopathies
(e.g., epilepsy), channelopathies of the CNS, chorioretinitis,
choroiditis, an autoimmune hematological disorder, chronic active
hepatitis or autoimmune chronic active hepatitis, chronic contact
dermatitis, chronic eosinophilic pneumonia, chronic fatigue
syndrome, chronic hepatitis, chronic hypersensitivity pneumonitis,
chronic inflammatory arthritis, Chronic inflammatory demyelinating
polyneuropathy (CIDP), chronic intractable inflammation, chronic
mucocutaneous candidiasis, chronic neuropathy (e.g., IgM
polyneuropathies or IgM-mediated neuropathy), chronic obstructive
airway disease, chronic pulmonary inflammatory disease, Chronic
recurrent multifocal ostomyelitis (CRMO), chronic thyroiditis
(Hashimoto's thyroiditis) or subacute thyroiditis, Churg-Strauss
syndrome, cicatricial pemphigoid/benign mucosal pemphigoid, CNS
inflammatory disorders, CNS vasculitis, Coeliac disease, Cogans
syndrome, cold agglutinin disease, colitis polyposa, colitis such
as ulcerative colitis, colitis ulcerosa, collagenous colitis,
conditions involving infiltration of T cells and chronic
inflammatory responses, congenital heart block, congenital rubella
infection, Coombs positive anemia, coronary artery disease,
Coxsackie myocarditis, CREST syndrome (calcinosis, Raynaud's
phenomenon), Crohn's disease, cryoglobulinemia, Cushing's syndrome,
cyclitis (e.g., chronic cyclitis, heterochronic cyclitis,
iridocyclitis, or Fuch's cyclitis), cystic fibrosis,
cytokine-induced toxicity, deafness, degenerative arthritis,
demyelinating diseases (e.g., autoimmune demyelinating diseases),
demyelinating neuropathies, dengue, dermatitis herpetiformis and
atopic dermatitis, dermatitis including contact dermatitis,
dermatomyositis, dermatoses with acute inflammatory components,
Devic's disease (neuromyelitis optica), diabetic large-artery
disorder, diabetic nephropathy, diabetic retinopathy, Diamond
Blackfan anemia, diffuse interstitial pulmonary fibrosis, dilated
cardiomyopathy, discoid lupus, diseases involving leukocyte
diapedesis, Dressler's syndrome, Dupuytren's contracture, echovirus
infection, eczema including allergic or atopic eczema, encephalitis
such as Rasmussen's encephalitis and limbic and/or brainstem
encephalitis, encephalomyelitis (e.g., allergic encephalomyelitis
or encephalomyelitis allergica and experimental allergic
encephalomyelitis (EAE)), endarterial hyperplasia, endocarditis,
endocrine ophthamopathy, endometriosis, endomyocardial fibrosis,
endophthalmia phacoanaphylactica, endophthalmitis, enteritis
allergica, eosinophilia-myalgia syndrome, eosinophilic faciitis,
epidemic keratoconjunctivitis, epidermolisis bullosa acquisita
(EBA), episclera, episcleritis, Epstein-Barr virus infection,
erythema elevatum et diutinum, erythema multiforme, erythema
nodosum leprosum, erythema nodosum, erythroblastosis fetalis,
esophageal dysmotility, Essential mixed cryoglobulinemia, ethmoid,
Evan's syndrome, Experimental Allergic Encephalomyelitis (EAE),
Factor VIII deficiency, farmer's lung, febris rheumatica, Felty's
syndrome, fibromyalgia, fibrosing alveolitis, flariasis, focal
segmental glomerulosclerosis (FSGS), food poisoning, frontal,
gastric atrophy, giant cell arthritis (temporal arthritis), giant
cell hepatitis, giant cell polymyalgia, glomerulonephritides,
glomerulonephritis (GN) with and without nephrotic syndrome such as
chronic or acute glomerulonephritis (e.g., primary GN),
Goodpasture's syndrome, gouty arthritis, granulocyte
transfusion-associated syndromes, granulomatosis including
lymphomatoid granulomatosis, granulomatosis with polyangiitis
(GPA), granulomatous uveitis, Grave's disease, Guillain-Barre
syndrome, gutatte psoriasis, haemoglobinuria paroxysmatica,
Hamman-Rich's disease, Hashimoto's disease, Hashimoto's
encephalitis, Hashimoto's thyroiditis, hemochromatosis, hemolytic
anemia or immune hemolytic anemia including autoimmune hemolytic
anemia (AIHA), hemolytic anemia, hemophilia A, Henoch-Schonlein
purpura, Herpes gestationis, human immunodeficiency virus (HIV)
infection, hyperalgesia, hypogammaglobulinemia, hypogonadism,
hypoparathyroidism, idiopathic diabetes insipidus, idiopathic
facial paralysis, idiopathic hypothyroidism, idiopathic IgA
nephropathy, idiopathic membranous GN or idiopathic membranous
nephropathy, idiopathic nephritic syndrome, idiopathic pulmonary
fibrosis, idiopathic sprue, Idiopathic thrombocytopenic purpura
(ITP), IgA nephropathy, IgE-mediated diseases (e.g., anaphylaxis
and allergic and atopic rhinitis), IgG4-related sclerosing disease,
ileitis regionalis, immune complex nephritis, immune responses
associated with acute and delayed hypersensitivity mediated by
cytokines and T-lymphocytes, immune-mediated GN, immunoregulatory
lipoproteins, including adult or acute respiratory distress
syndrome (ARDS), Inclusion body myositis, infectious arthritis,
infertility due to antispermatozoan antobodies, inflammation of all
or part of the uvea, inflammatory bowel disease (IBD) inflammatory
hyperproliferative skin diseases, inflammatory myopathy,
insulin-dependent diabetes (type 1), insulitis, Interstitial
cystitis, interstitial lung disease, interstitial lung fibrosis,
iritis, ischemic re-perfusion disorder, joint inflammation,
Juvenile arthritis, juvenile dermatomyositis, juvenile diabetes,
juvenile onset (Type I) diabetes mellitus, including pediatric
insulin-dependent diabetes mellitus (IDDM), juvenile-onset
rheumatoid arthritis, Kawasaki syndrome, keratoconjunctivitis
sicca, kypanosomiasis, Lambert-Eaton syndrome, leishmaniasis,
leprosy, leucopenia, leukocyte adhesion deficiency,
Leukocytoclastic vasculitis, leukopenia, lichen planus, lichen
sclerosus, ligneous conjunctivitis, linear IgA dermatosis, Linear
IgA disease (LAD), Loffler's syndrome, lupoid hepatitis, lupus
(including nephritis, cerebritis, pediatric, non-renal,
extra-renal, discoid, alopecia), Lupus (SLE), lupus erythematosus
disseminatus, Lyme arthritis, Lyme disease, lymphoid interstitial
pneumonitis, malaria, male and female autoimmune infertility,
maxillary, medium vessel vasculitis (including Kawasaki's disease
and polyarteritis nodosa), membrano- or membranous proliferative GN
(MPGN), including Type I and Type II, and rapidly progressive GN,
membranous GN (membranous nephropathy), Meniere's disease,
meningitis, microscopic colitis, microscopic polyangiitis,
migraine, minimal change nephropathy, Mixed connective tissue
disease (MCTD), mononucleosis infectiosa, Mooren's ulcer,
Mucha-Habermann disease, multifocal motor neuropathy, multiple
endocrine failure, multiple organ injury syndrome such as those
secondary to septicemia, trauma or hemorrhage, multiple organ
injury syndrome, multiple sclerosis (MS) such as spino-optical MS,
multiple sclerosis, mumps, muscular disorders, myasthenia gravis
such as thymoma-associated myasthenia gravis, myasthenia gravis,
myocarditis, myositis, narcolepsy, necrotizing enterocolitis, and
transmural colitis, and autoimmune inflammatory bowel disease,
necrotizing, cutaneous, or hypersensitivity vasculitis, neonatal
lupus syndrome (NLE), nephrosis, nephrotic syndrome, neurological
disease, neuromyelitis optica (Devic's), neuromyelitis optica,
neuromyotonia, neutropenia, non-cancerous lymphocytosis,
nongranulomatous uveitis, non-malignant thymoma, ocular and orbital
inflammatory disorders, ocular cicatricial pemphigoid, oophoritis,
ophthalmia symphatica, opsoclonus myoclonus syndrome (OMS),
opsoclonus or opsoclonus myoclonus syndrome (OMS), and sensory
neuropathy, optic neuritis, orchitis granulomatosa, osteoarthritis,
palindromic rheumatism, pancreatitis, pancytopenia, PANDAS
(Pediatric Autoimmune Neuropsychiatric Disorders Associated with
Streptococcus), paraneoplastic cerebellar degeneration,
paraneoplastic syndrome, paraneoplastic syndromes, including
neurologic paraneoplastic syndromes (e.g., Lambert-Eaton myasthenic
syndrome or Eaton-Lambert syndrome), parasitic diseases such as
Lesihmania, paroxysmal nocturnal hemoglobinuria (PNH), Parry
Romberg syndrome, pars planitis (peripheral uveitis),
Parsonnage-Turner syndrome, parvovirus infection, pemphigoid such
as pemphigoid bullous and skin pemphigoid, pemphigus (including
pemphigus vulgaris), pemphigus erythematosus, pemphigus foliaceus,
pemphigus mucus-membrane pemphigoid, pemphigus, peptic ulcer,
periodic paralysis, peripheral neuropathy, perivenous
encephalomyelitis, pernicious anemia (anemia perniciosa),
pernicious anemia, phacoantigenic uveitis, pneumonocirrhosis, POEMS
syndrome, polyarteritis nodosa, Type I, II, & III,
polyarthritis chronica primaria, polychondritis (e.g., refractory
or relapsed polychondritis), polyendocrine autoimmune disease,
polyendocrine failure, polyglandular syndromes (e.g., autoimmune
polyglandular syndromes (or polyglandular endocrinopathy
syndromes)), polymyalgia rheumatica, polymyositis,
polymyositis/dermatomyositis, polyneuropathies, polyradiculitis
acuta, post-cardiotomy syndrome, posterior uveitis, or autoimmune
uveitis, postmyocardial infarction syndrome, postpericardiotomy
syndrome, post-streptococcal nephritis, post-vaccination syndromes,
presenile dementia, primary biliary cirrhosis, primary
hypothyroidism, primary idiopathic myxedema, primary lymphocytosis,
which includes monoclonal B cell lymphocytosis (e.g., benign
monoclonal gammopathy and monoclonal gammopathy of undetermined
significance, MGUS), primary myxedema, primary progressive MS
(PPMS), and relapsing remitting MS (RRMS), primary sclerosing
cholangitis, progesterone dermatitis, progressive systemic
sclerosis, proliferative arthritis, psoriasis such as plaque
psoriasis, psoriasis, psoriatic arthritis, pulmonary alveolar
proteinosis, pulmonary infiltration eosinophilia, pure red cell
anemia or aplasia (PRCA), pure red cell aplasia, purulent or
nonpurulent sinusitis, pustular psoriasis and psoriasis of the
nails, pyelitis, pyoderma gangrenosum, Quervain's thyreoiditis,
Raynauds phenomenon, reactive arthritis, recurrent abortion,
reduction in blood pressure response, reflex sympathetic dystrophy,
refractory sprue, Reiter's disease or syndrome, relapsing
polychondritis, reperfusion injury of myocardial or other tissues,
reperfusion injury, respiratory distress syndrome, restless legs
syndrome, retinal autoimmunity, retroperitoneal fibrosis, Reynaud's
syndrome, rheumatic diseases, rheumatic fever, rheumatism,
rheumatoid arthritis, rheumatoid spondylitis, rubella virus
infection, Sampter's syndrome, sarcoidosis, schistosomiasis,
Schmidt syndrome, SCID and Epstein-Barr virus-associated diseases,
sclera, scleritis, sclerodactyl, scleroderma (including systemic
scleroderma), sclerosing cholangitis, sclerosis disseminata,
sclerosis such as systemic sclerosis, sensoneural hearing loss,
seronegative spondyloarthritides, Sheehan's syndrome, Shulman's
syndrome, silicosis, Sjogren's syndrome, sperm & testicular
autoimmunity, sphenoid sinusitis, Stevens-Johnson syndrome,
stiff-man (or stiff-person) syndrome, subacute bacterial
endocarditis (SBE), subacute cutaneous lupus erythematosus, sudden
hearing loss, Susac's syndrome, Sydenham's chorea, sympathetic
ophthalmia, systemic lupus erythematosus (SLE) or systemic lupus
erythematodes (e.g., cutaneous SLE), systemic necrotizing
vasculitis, and ANCA-associated vasculitis, such as Churg-Strauss
vasculitis or syndrome (CSS)), tabes dorsalis, Takayasu's
arteritis, telangiectasia, temporal arteritis/Giant cell arteritis,
thromboangitis ubiterans, thrombocytopenia (as developed by
myocardial infarction patients, for example), including thrombotic
thrombocytopenic purpura (TTP) and autoimmune or immune-mediated
thrombocytopenia such as idiopathic thrombocytopenic purpura (ITP)
including chronic or acute ITP, thrombocytopenic purpura (TTP),
thyrotoxicosis, tissue injury, Tolosa-Hunt syndrome, toxic
epidermal necrolysis, toxic-shock syndrome, transfusion reaction,
transient hypogammaglobulinemia of infancy, transverse myelitis,
traverse myelitis, tropical pulmonary eosinophilia, tuberculosis,
ulcerative colitis, undifferentiated connective tissue disease
(UCTD), urticaria (e.g., chronic allergic urticaria and chronic
idiopathic urticaria, including chronic autoimmune urticaria),
uveitis (e.g., anterior uveitis), uveoretinitis, valvulitis,
vascular dysfunction, vasculitis, vertebral arthritis,
vesiculobullous dermatosis, vitiligo, Wegener's granulomatosis (now
termed Granulomatosis with Polyangiitis (GPA), Wiskott-Aldrich
syndrome, and x-linked hyper IgM syndrome.
Treatment of Cancer
[0605] The VISTA polypeptides, multimeric VISTA polypeptides, VISTA
fusion proteins (e.g., VISTA-Ig), siRNA molecules consisting of any
one of the nucleic acid sequences of SEQ ID NO: 38-67, and
anti-VISTA antibodies described herein may be used in compositions,
uses, and methods for the treatment of cancer (e.g., tumors).
[0606] Examples of cancer include but are not limited to,
carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More
particular examples of such cancers include squamous cell cancer,
lung cancer (including small-cell lung cancer, non-small cell lung
cancer, adenocarcinoma of the lung, and squamous carcinoma of the
lung), cancer of the peritoneum, hepatocellular cancer, gastric or
stomach cancer (including gastrointestinal cancer), pancreatic
cancer, glioblastoma, cervical cancer, ovarian cancer, liver
cancer, bladder cancer, hepatoma, breast cancer, colon cancer,
colorectal cancer, endometrial or uterine carcinoma, salivary gland
carcinoma, kidney or renal cancer, liver cancer, prostate cancer,
vulval cancer, thyroid cancer, hepatic carcinoma and various types
of head and neck cancer, as well as B-cell lymphoma (including low
grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic
(SL) NHL; intermediate grade/follicular NHL; intermediate grade
diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic
NHL; high grade small non-cleaved cell NHL; bulky disease NHL;
mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's
Macroglobulinemia); chronic lymphocytic leukemia (CLL); acute
lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic
myeloblastic leukemia; multiple myeloma and post-transplant
lymphoproliferative disorder (PTLD).
[0607] The term cancer amenable for treatment by the present
invention include, but not limited to, carcinoma, lymphoma,
blastoma, sarcoma, and leukemia or lymphoid malignancies. More
particular examples of such cancers include bladder, ovarian,
melanoma, squamous cell cancer, lung cancer (including small-cell
lung cancer, non-small cell lung cancer, adenocarcinoma of the
lung, and squamous carcinoma of the lung), cancer of the
peritoneum, hepatocellular cancer, gastric or stomach cancer
(including gastrointestinal cancer), pancreatic cancer,
glioblastoma, cervical cancer, ovarian cancer, liver cancer,
bladder cancer, hepatoma, breast cancer, colon cancer, colorectal
cancer, endometrial or uterine carcinoma, salivary gland carcinoma,
kidney or renal cancer, liver cancer, prostate cancer, vulval
cancer, thyroid cancer, hepatic carcinoma and various types of head
and neck cancer, as well as B-cell lymphoma (including low
grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic
(SL) NHL; intermediate grade/follicular NHL; intermediate grade
diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic
NHL; high grade small non-cleaved cell NHL; bulky disease NHL;
mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's
Macroglobulinemia); chronic lymphocytic leukemia (CLL); acute
lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic
myeloblastic leukemia; and post-transplant lymphoproliferative
disorder (PTLD), as well as abnormal vascular proliferation
associated with phakomatoses, edema (such as that associated with
brain tumors), and Meigs' syndrome. Preferably, the cancer is
selected from the group consisting of breast cancer, colorectal
cancer, rectal cancer, non-small cell lung cancer, non-Hodgkins
lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer,
pancreatic cancer, soft-tissue sarcoma, kaposi's sarcoma, carcinoid
carcinoma, head and neck cancer, melanoma, ovarian cancer,
mesothelioma, and multiple myeloma. The cancer may be an early
advanced (including metastatic) bladder, ovarian or melanoma. The
cancer may be colorectal cancer. The cancerous conditions amenable
for treatment of the invention include metastatic cancers wherein
VISTA expression by myeloid derived suppressor cells suppress
antitumor responses and anti-invasive immune responses. The method
of the present invention is particularly suitable for the treatment
of vascularized tumors.
[0608] The invention is also suitable for treating cancers in
combination with chemotherapy or radiotherapy or other biologics
and for enhancing the activity thereof, i.e., in individuals
wherein VISTA expression by myeloid derived suppressor cells
suppress antitumor responses and the efficacy of chemotherapy or
radiotherapy or biologic efficacy. Any chemotherapeutic agent
exhibiting anticancer activity can be used according to the present
invention. Preferably, the chemotherapeutic agent may be selected
from the group consisting of alkylating agents, antimetabolites,
folic acid analogs, pyrimidine analogs, purine analogs and related
inhibitors, vinca alkaloids, epipodopyyllotoxins, antibiotics,
L-Asparaginase, topoisomerase inhibitor, interferons, platinum
coordination complexes, anthracenedione substituted urea, methyl
hydrazine derivatives, adrenocortical suppressant,
adrenocorticosteroides, progestins, estrogens, antiestrogen,
androgens, antiandrogen, and gonadotropin-releasing hormone analog.
More preferably, the chemotherapeutic agent may be selected from
the group consisting of 5-fluorouracil (5-FU), leucovorin (LV),
irenotecan, oxaliplatin, capecitabine, paclitaxel and doxetaxel.
Two or more chemotherapeutic agents can be used in a cocktail to be
administered in combination with administration of the anti-VEGF
antibody. One preferred combination chemotherapy is
fluorouracil-based, comprising 5-FU and one or more other
chemotherapeutic agent(s). Suitable dosing regimens of combination
chemotherapies are known in the art and described in, for example,
Saltz, et al. (1999) Proc ASCO 18:233a and Douillard, et al. (2000)
Lancet 355: 1041-7. The biologic may be another immune potentiators
such as antibodies to PD-L1, PD-L2, CTLA-4 and PD-L1, PD-L2, CTLA-4
fusion proteins as well as cytokines, growth factor antagonists and
agonists, hormones and anti-cytokine antibodies.
Allergies
[0609] The VISTA polypeptides, multimeric VISTA polypeptides, VISTA
fusion proteins (e.g., VISTA-Ig), and anti-VISTA antibodies
described herein may be used in compositions, uses, and methods for
the treatment of allergies (e.g., allergic reactions to
allergens).
[0610] Examples of allergens include mite antigens and pollen
antigens.
[0611] Representative allergic diseases include bronchial asthma,
allergic rhinitis, atopic dermatitis, and pollen and insect
allergies. Allergic diathesis is a genetic factor that can be
inherited by the children of allergic parents. Familial allergic
diseases are also called atopic diseases, and the causative,
genetically transmitted factor is atopic diathesis. "Atopic
dermatitis" is a general term for an atopic disease, especially
diseases accompanied by dermatitis symptoms. Preferred examples
include allergic condition is selected from the group consisting of
eczema, allergic rhinitis, hay fever, urticaria, and food
allergies. Allergic conditions include eczema, allergic rhinitis or
coryza, hay fever, bronchial asthma, urticaria (hives) and food
allergies, and other atopic conditions.
Inflammatory Conditions and Inflammatory Diseases
[0612] The VISTA polypeptides, multimeric VISTA polypeptides, VISTA
fusion proteins (e.g., VISTA-Ig), siRNA molecules consisting of any
one of the nucleic acid sequences of SEQ ID NO: 38-67, and
anti-VISTA antibodies described herein may be used in compositions,
uses, and methods for the treatment of inflammatory conditions and
inflammatory disease.
[0613] Inflammatory conditions and inflammatory diseases, include
but are not limited to rheumatic diseases (e.g., rheumatoid
arthritis, osteoarthritis, psoriatic arthritis)
spondyloarthropathies (e.g., ankylosing spondylitis, reactive
arthritis, Reiter's syndrome), crystal arthropathies (e.g., gout,
pseudogout, calcium pyrophosphate deposition disease), multiple
sclerosis, Lyme disease, polymyalgia rheumatica; connective tissue
diseases (e.g., systemic lupus erythematosus, systemic sclerosis,
polymyositis, dermatomyositis, Sjogren's syndrome); vasculitides
(e.g., polyarteritis nodosa, Wegener's granulomatosis,
Churg-Strauss syndrome); inflammatory conditions including
consequences of trauma or ischaemia, sarcoidosis; vascular diseases
including atherosclerotic vascular disease, atherosclerosis, and
vascular occlusive disease (e.g., atherosclerosis, ischaemic heart
disease, myocardial infarction, stroke, peripheral vascular
disease), and vascular stent restenosis; ocular diseases including
uveitis, corneal disease, iritis, iridocyclitis, and cataracts.
[0614] Inflammatory conditions also include, but are not limited to
acid Reflux/Heartburn, Acne, Acne Vulgaris, Allergies and
Sensitivities, Alzheimer's Disease, Asthma, Atherosclerosis and
Vascular Occlusive Disease (e.g., Atherosclerosis, Ischaemic Heart
Disease, Myocardial Infarction, Stroke, Peripheral Vascular
Disease) and Vascular Stent Restenosis, Autoimmune Diseases,
Bronchitis, Cancer, Carditis, Cataracts, Celiac Disease, Chronic
Pain, Chronic Prostatitis, Cirrhosis, Colitis, Connective Tissue
Diseases (e.g., Systemic Lupus Erythematosus, Systemic Sclerosis,
Polymyositis, Dermatomyositis, Sjogren's Syndrome), Corneal
Disease, Crohn's Disease, Crystal Arthropathies (e.g., Gout,
Pseudogout, Calcium Pyrophosphate Deposition Disease), Dementia,
Dermatitis, Diabetes, Dry Eyes, Eczema, Edema, Emphysema,
Fibromyalgia, Gastroenteritis, Gingivitis, Glomerulonephritis,
Heart Disease, Hepatitis, High Blood Pressure, Hypersensitivities,
Inflammatory Bowel Diseases, Inflammatory Conditions including
Consequences of Trauma or Ischaemia, Insulin Resistance,
Interstitial Cystitis, Iridocyclitis, Iritis, Joint
Pain/Arthritis/Rheumatoid Arthritis, Lyme Disease, Metabolic
Syndrome (Syndrome X), Multiple Sclerosis, Myositis, Nephritis,
Obesity, Ocular Diseases including Uveitis, Osteopenia,
Osteoporosis, Parkinson's Disease, Pelvic Inflammatory Disease,
Periodontal Disease, Polyarteritis, Polychondritis, Polymyalgia
Rheumatica, Psoriasis, Reperfusion Injury, Rheumatic Arthritis,
Rheumatic Diseases (e.g., Rheumatoid Arthritis, Osteoarthritis,
Psoriatic Arthritis), Rheumatoid Arthritis, Sarcoidosis,
Scleroderma, Sinusitis, Sjogren's Syndrome, Spastic Colon,
Spondyloarthropathies (e.g., Ankylosing Spondylitis, Reactive
Arthritis, Reiter's Syndrome), Systemic Candidiasis, Tendonitis,
Transplant Rejection, UTI's, Vaginitis, Vascular Diseases including
Atherosclerotic Vascular Disease, Vasculitides (e.g., Polyarteritis
Nodosa, Wegener's Granulomatosis, Churg-Strauss Syndrome), and
Vasculitis.
Graft Versus Host Disease
[0615] The VISTA polypeptides, multimeric VISTA polypeptides, VISTA
fusion proteins (e.g., VISTA-Ig), siRNA molecules consisting of any
one of the nucleic acid sequences of SEQ ID NO: 38-67, and
anti-VISTA antibodies described herein may be used in compositions,
uses, and methods for the treatment of graft-versus-host disease
(GVHD).
[0616] The invention also provides a method of treaint
graft-versus-host-disease (GVHD) comprising administration of an
effective amount of a VISTA fusion protein, optionally a VISTA-Ig
fusion protein, or the multimeric VISTA protein. A method for
treating graft-versus-host disease (GVHD), acute graft-versus-host
disease, chronic graft-versus-host disease, acute graft-versus-host
disease associated with stem cell transplant, chronic
graft-versus-host disease associated with stem cell transplant,
acute graft-versus-host disease associated with bone marrow
transplant, acute graft-versus-host disease associated with
allogeneic hemapoetic stem cell transplant (HSCT), or chronic
graft-versus-host disease associated with bone marrow transplant
may comprise administering of an effective amount of a VISTA fusion
protein, optionally a VISTA-Ig fusion protein, or the multimeric
VISTA protein.
[0617] The graft-versus-host disease (GVHD) may be
graft-versus-host disease (GVHD), acute graft-versus-host disease,
chronic graft-versus-host disease, acute graft-versus-host disease
associated with stem cell transplant, chronic graft-versus-host
disease associated with stem cell transplant, acute
graft-versus-host disease associated with bone marrow transplant,
acute graft-versus-host disease associated with allogeneic
hemapoetic stem cell transplant (HSCT), or chronic
graft-versus-host disease associated with bone marrow transplant.
The patient treated to be treated may have at least one symptom of
graft-versus-host disease (GVHD), optionally wherein the patient
exhibits acute GVHD includes but is not limited to abdominal pain,
abdominal cramps, diarrhea, fever, jaundice, skin rash, vomiting,
and weight loss. The patient may have at least one symptom of
chronic graft-versus-host disease (GVHD) includes but is not
limited to dry eyes, dry mouth, hair loss, hepatisis, lung
disorder, gastrointestinal tract disorders, skin rash, and skin
thickening. The patient may have or may be to receive allogeneic
stem cell or bone marrow transplant. The patient may have or may be
to receive autologous stem cell or bone marrow transplant.
Diagnostic Methods
[0618] The anti-VISTA and anti-VISTA conjugate antibodies which
selectively bind the VISTA and VISTA conjugate, siRNA molecules
consisting of any one of the nucleic acid sequences of SEQ ID NO:
38-67, and antigen-binding fragments thereof, may be used in
diagnostic methods for detecting the presence or absence of an
VISTA and VISTA conjugate. Anti-VISTA and anti-VISTA conjugate
antibodies may be used in methods comprising (a) contacting a test
sample with an antibody, or fragment thereof, that binds a VISTA or
VISTA conjugate, and (b) assaying for antibody-epitope complexes.
The antibody-epitope complex may be detected by Western blot,
radioimmunoassay, ELISA (enzyme linked immunosorbent assay),
"sandwich" immunoassay, immunoprecipitation assay, precipitation
reaction, gel diffusion precipitation reaction, immunodiffusion
assay, agglutination assay, complement-fixation assay,
immunohistochemical assay, fluorescent immunoassay, and protein A
immunoassay. The sample may be sample is a tissue biopsy, lymph,
urine, cerebrospinal fluid, amniotic fluid, inflammatory exudate,
blood, serum, stool, or liquid collected from the colorectal
tract.
[0619] The antibodies which selectively bind a VISTA and VISTA
conjugate may be recombinant. The fragments of antibodies which
selectively bind a VISTA and VISTA conjugate may be a Fab, Fab',
F(ab')2, Fv, CDR, paratope, or portion of an antibody that is
capable of binding the antigen. The antibodies which selectively
bind a VISTA and VISTA conjugate may be chimeric, humanized,
anti-idiotypic, single-chain, bifunctional, or co-specific. The
antibodies which selectively bind a VISTA and VISTA conjugate may
be or fragment is conjugated to a label, including but not limited
to a chemiluminescent label, paramagnetic label (e.g., aluminum,
manganese, platinum, oxygen, lanthanum, lutetium, scandium,
yttrium, or gallium), an MRI contrast agent, fluorescent label,
bioluminescent label, or radioactive label.
[0620] Additionally, VISTA and VISTA conjugate, antibody which
selectively bind a VISTA and VISTA conjugate, and antigen-binding
fragments thereof, may be attached to a solid support (e.g., bead,
test tube, sheet, culture dish, or test strip) such as an
array.
[0621] The method may comprise imaging a VISTA polypeptide or VISTA
conjugate by positron emission tomography (PET), CCD low-light
monitoring system, x-ray, CT scanning, scintigraphy, photo acoustic
imaging, single photon emission computed tomography (SPECT),
magnetic resonance imaging (MRI), ultrasound, paramagnetic imaging,
and endoscopic optical coherence tomography.
Screening Assays
[0622] The invention provides a method for identifying modulators
("screening assay"), i.e., candidate or test compounds or agents
(e.g., peptides, peptidomimetics, small molecules or other drugs)
which bind to VISTA polypeptides, have a stimulatory or inhibitory
effect on, for example, VISTA expression or VISTA activity, or have
a stimulatory or inhibitory effect on the interaction between VISTA
and its natural binding partner(s).
[0623] Assays for screening candidate or test compounds which bind
to the VISTA polypeptide or biologically active portion thereof,
e.g., modulate the ability of the VISTA polypeptide to interact
with its natural binding partner(s) may comprise contacting a
candidate compound with a VISTA polypeptide and testing for the
modulating of the ability of the VISTA polypeptide to interact with
its natural binding partner. Assays for screening candidate or test
compounds which bind to or modulate the activity of a VISTA protein
or polypeptide or biologically active portion thereof may comprise
contacting a VISTA polypeptide and testing for binding between the
VISTA polypeptide and the candidate agent. Assays for screening
candidate or test compounds which have a stimulatory or inhibitory
effect on immune functions negatively regulated by VISTA such as
are identified herein or based on its effect on the interaction of
between VISTA and its natural binding partner(s). These VISTA
related functions include by way of example inhibiting cytokine
production (e.g., II-2, gamma interferon by T cells, suppressing
moderate CD28 costimulation, inhibiting CD4+ and CD8+ T cell
proliferation, suppressing proliferation of naive and memory CD4+ T
cells, and suppressing TCR activation without inducing apoptosis.)
The test compounds of the present invention can be obtained using
any of the numerous approaches in combinatorial library methods
known in the art, including: biological libraries; spatially
addressable parallel solid phase or solution phase libraries;
synthetic library methods requiring deconvolution; the "one-bead
one-compound" library method; and synthetic library methods using
affinity chromatography selection. The biological library approach
is limited to peptide libraries, while the other four approaches
are applicable to peptide, non-peptide oligomer or small molecule
libraries of compounds. Lam (1997) Anticancer Drug Des. 12:
145.
[0624] An assay may be a cell-based assay in which a cell which
expresses a VISTA polypeptide or biologically active portion
thereof comprising contacting a VISTA polypeptide or biologically
active portion thereof with a test compound, and determining the
ability of the test compound to modulate VISTA activity.
Determining the ability of the test compound to modulate VISTA
activity can be accomplished by monitoring, for example, the
ability of VISTA to bind to its natural binding partner(s), and
modulate immune cell activity. The immune cell can be a T cell, a B
cell, or a myeloid cell. Determining the ability of the test
compound to modulate VISTA binding to its counter-receptor can be
accomplished, for example, by coupling VISTA with a radioisotope or
enzymatic label to monitor the ability of a test compound to
modulate VISTA binding to T cells which express the VISTA
counter-receptor. Determining the ability of the test compound to
bind VISTA can be accomplished, for example, by coupling the
compound with a radioisotope or enzymatic label such that binding
of the compound to VISTA can be determined by detecting the labeled
VISTA compound in a complex.
[0625] Assays may be used to determine the ability of a compound to
interact with VISTA without the labeling of any of the
interactants. For example, a microphysiometer can be used to detect
the interaction of a compound with VISTA without the labeling of
either the compound or the VISTA. McConnell, H. M. et al. (1992)
Science 257:1906-1912. A microphysiometer (e.g., Cytosensor) is an
analytical instrument that measures the rate at which a cell
acidifies its environment using a light-addressable potentiometric
sensor (LAPS). Changes in this acidification rate can be used as an
indicator of the interaction between a compound and VISTA.
[0626] An assay may be a cell-based assay comprising contacting a T
cell expressing a VISTA binding partner with a test compound and
determining the ability of the test compound to modulate (e.g.,
stimulate or inhibit) the activity of the VISTA binding partner.
Determining the ability of the test compound to modulate the
activity of a VISTA binding partner can be accomplished, for
example, by determining the ability of the VISTA polypeptide to
bind to or interact with the VISTA binding partner.
[0627] Determining the ability of the VISTA polypeptide, or a
biologically active fragment thereof, to bind to or interact with a
VISTA binding partner, can be accomplished by one of the methods
described above for determining direct binding. In an embodiment,
determining the ability of the VISTA polypeptide to bind to or
interact with a VISTA binding partner can be accomplished by
determining the activity of the binding partner. For example, the
activity of the binding partner can be determined by detecting
induction of a cellular second messenger (e.g., tyrosine kinase or
phosphatase activity), detecting catalytic/enzymatic activity of an
appropriate substrate, detecting the induction of a reporter gene
(comprising a target-responsive regulatory element operatively
linked to a nucleic acid encoding a detectable marker, e.g.,
luciferase), or detecting a target-regulated cellular response. For
example, determining the ability of the VISTA polypeptide to bind
to or interact with a natural VISTA binding partner, can be
accomplished by measuring the ability of a compound to modulate
immune cell costimulation or inhibition in a proliferation assay,
or by interfering with the ability of a VISTA polypeptide to bind
to antibodies that recognize a portion of the VISTA polypeptide. In
one embodiment, compounds that modulate T cell activation can be
identified by determining the ability of a compound to modulate T
cell proliferation or cytokine production. In an embodiment,
compounds that modulate T cell activation can be identified by
determining the ability of a compound to modulate T cell
proliferation or cytokine production at more than one antigen
concentration.
[0628] An assay may be a cell-free assay in which a VISTA
polypeptide or biologically active portion thereof is contacted
with a test compound and the ability of the test compound to bind
to the VISTA polypeptide or biologically active portion thereof is
determined. Preferred biologically active portions of the VISTA
polypeptides to be used in assays of the present invention include
fragments which participate in interactions with non-VISTA
molecules, e.g., at least a portion of an extracellular domain
which binds to a VISTA binding partner. Binding of the test
compound to the VISTA polypeptide can be determined either directly
or indirectly as described above.
[0629] The assay may be a cell-free assay in which a VISTA
polypeptide or biologically active portion thereof is contacted
with a test compound and the ability of the test compound to
modulate (e.g., stimulate or inhibit) the activity of the VISTA
polypeptide or biologically active portion thereof is determined.
Determining the ability of the test compound to modulate the
activity of a VISTA polypeptide can be accomplished, for example,
by determining the ability of the VISTA polypeptide to bind to a
VISTA binding partner by one of the methods described above for
determining direct binding. The cell-free assays of the present
invention are amenable to use of both soluble and/or membrane-bound
forms of polypeptides (e.g., VISTA polypeptides or biologically
active portions thereof, or binding partners to which VISTA binds).
In the case of cell-free assays in which a membrane-bound form a
polypeptide is used (e.g., a cell-surface VISTA), it may be
desirable to utilize a solubilizing agent such that the
membrane-bound form of the polypeptide is maintained in solution.
Examples of such solubilizing agents include non-ionic detergents
such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside,
octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton.RTM.
X-100, Triton.RTM. X-114, Thesit, Isotridecypoly(ethylene glycol
ether)n, 3-[(3-cholamidopropyl)dimethylamminio]-1-propane sulfonate
(CHAPS), 3-[(3-cholamidopropyl)dimethylamminio]-2-hydroxy-1-propane
sulfonate (CHAPSO), or
N-dodecyl.dbd.N,N-dimethyl-3-ammonio-1-propane sulfonate.
[0630] In assay methods, it may be desirable to immobilize either
VISTA or its binding partner to facilitate separation of complexed
from uncomplexed forms of one or both of the polypeptides, as well
as to accommodate automation of the assay. Binding of a test
compound to a VISTA polypeptide, or interaction of a VISTA
polypeptide with its binding partner in the presence and absence of
a candidate compound, can be accomplished in any vessel suitable
for containing the reactants. Examples of such vessels include
microtitre plates, test tubes, and micro-centrifuge tubes. In one
embodiment, a fusion protein can be provided which adds a domain
that allows one or both of the polypeptides to be bound to a
matrix. For example, glutathione-S-transferase/VISTA fusion
proteins or glutathione-S-transferase/binding partner fusion
proteins can be adsorbed onto glutathione SEPHAROSE.RTM. beads
(Sigma Chemical, St. Louis, Mo.) or glutathione derivatized
microtitre plates, which are then combined with the test compound
or the test compound and either the non-adsorbed binding partner
polypeptide or VISTA polypeptide, and the mixture incubated under
conditions conducive to complex formation (e.g., at physiological
conditions for salt and pH). Following incubation, the beads or
microtitre plate wells are washed to remove any unbound components,
the matrix is immobilized in the case of beads, and complex
formation is determined either directly or indirectly, for example,
as described above. Alternatively, the complexes can be dissociated
from the matrix, and the level of VISTA binding or activity
determined using standard techniques. Other techniques for
immobilizing polypeptides on matrices can also be used in the
screening assays of the invention. Determining the ability of the
test compound to modulate the activity of a VISTA polypeptide may
be accomplished by determining the ability of the test compound to
modulate the activity of a molecule that functions downstream of
VISTA, e.g., by interacting with the cytoplasmic domain of a VISTA
binding partner. For example, levels of second messengers, the
activity of the interacting molecule on an appropriate target, or
the binding of the interactor to an appropriate target can be
determined as previously described.
[0631] Modulators of VISTA expression may be identified in a method
wherein a cell is contacted with a candidate compound and the
expression of VISTA mRNA or polypeptide in the cell is determined.
The level of expression of VISTA mRNA or polypeptide in the
presence of the candidate compound is compared to the level of
expression of VISTA mRNA or polypeptide in the absence of the
candidate compound. The candidate compound can then be identified
as a modulator of VISTA expression based on this comparison if the
change is statistically significant.
[0632] The VISTA polypeptides may be used as "bait proteins" in a
two-hybrid assay or three-hybrid assay (See, e.g., U.S. Pat. No.
5,283,317; Zervos, et al. (1993) Cell 72:223-232; Madura, et al.
(1993) J. Biol. Chem. 268:12046-12054; Bartel, et al. (1993)
Biotechniques 14:920-924; Iwabuchi, et al. (1993) Oncogene
8:1693-1696; and WO 94/10300), to identify other polypeptides which
bind to or interact with VISTA ("VISTA-binding proteins", "VISTA
binding partners", or "VISTA-bp") and are involved in VISTA
activity. Such VISTA-binding proteins are also likely to be
involved in the propagation of signals by the VISTA polypeptides or
VISTA targets as, for example, downstream elements of a
VISTA-mediated signaling pathway. Alternatively, such VISTA-binding
polypeptides may be VISTA inhibitors. The two-hybrid system is
based on the modular nature of most transcription factors, which
consist of separable DNA-binding and activation domains. Briefly,
the assay utilizes two different DNA constructs. In one construct,
the gene that codes for a VISTA polypeptide is fused to a gene
encoding the DNA binding domain of a known transcription factor
(e.g, GAL-4). In the other construct, a DNA sequence, from a
library of DNA sequences, that encodes an unidentified polypeptide
"prey" or "sample", is fused to a gene that codes for the
activation domain of the known transcription factor. If the "bait"
and the "prey" polypeptides are able to interact, in vivo, forming
a VISTA-dependent complex, the DNA-binding and activation domains
of the transcription factor are brought into close proximity. This
proximity allows transcription of a reporter gene (e.g, LacZ) which
is operably linked to a transcriptional regulatory site responsive
to the transcription factor. Expression of the reporter gene can be
detected and cell colonies containing the functional transcription
factor can be isolated and used to obtain the cloned gene which
encodes the polypeptide which interacts with the VISTA
polypeptide.
[0633] A combination of two or more of the assays described herein.
For example, a modulating agent may be identified using a
cell-based or a cell-free assay, and the ability of the agent to
modulate the activity of a VISTA polypeptide can be confirmed in
vivo, e.g., in an animal such as an animal model for cellular
transformation and/or tumorigenesis.
[0634] This invention further pertains to novel agents identified
by the above-described screening assays. An agent as identified in
the methods described herein in an appropriate animal model. For
example, an agent identified as described herein (e.g., a VISTA
modulating agent, an antisense VISTA nucleic acid molecule, a
VISTA-specific antibody, or a VISTA binding partner) can be used in
an animal model to determine the efficacy, toxicity, or side
effects of treatment with such an agent. Alternatively, an agent
identified as described herein can be used in an animal model to
determine the mechanism of action of such an agent. Furthermore,
this invention pertains to uses of novel agents identified by the
above-described screening assays for treatments as described
herein.
Detection Assays
[0635] Portions or fragments of the cDNA sequences identified
herein (and the corresponding complete gene sequences) can be used
in numerous ways as polynucleotide reagents. For example, these
sequences can be used to: (i) map their respective genes on a
chromosome; and, thus, locate gene regions associated with genetic
disease; (ii) identify an individual from a minute biological
sample (tissue typing); and (iii) aid in forensic identification of
a biological sample. These applications are described in the
subsections below.
Chromosome Mapping
[0636] Once the sequence (or a portion of the sequence) of a gene
has been isolated, this sequence can be used to map the location of
the gene on a chromosome. This process is called chromosome
mapping. Accordingly, portions or fragments of the VISTA nucleotide
sequences, described herein, can be used to map the location of the
VISTA genes on a chromosome. The mapping of the VISTA sequences to
chromosomes is an important first step in correlating these
sequences with genes associated with disease. Briefly, VISTA genes
can be mapped to chromosomes by preparing PCR primers (preferably
15-25 bp in length) from the VISTA nucleotide sequences. Computer
analysis of the VISTA sequences can be used to predict primers that
do not span more than one exon in the genomic DNA, thus
complicating the amplification process. These primers can then be
used for PCR screening of somatic cell hybrids containing
individual human chromosomes. Only those hybrids containing the
human gene corresponding to the VISTA sequences will yield an
amplified fragment. Somatic cell hybrids are prepared by fusing
somatic cells from different mammals (e.g., human and mouse cells).
As hybrids of human and mouse cells grow and divide, they gradually
lose human chromosomes in random order, but retain the mouse
chromosomes. By using media in which mouse cells cannot grow,
because they lack a particular enzyme, but human cells can, the one
human chromosome that contains the gene encoding the needed enzyme
are retained. By using various media, panels of hybrid cell lines
can be established. Each cell line in a panel contains either a
single human chromosome or a small number of human chromosomes, and
a full set of mouse chromosomes, allowing easy mapping of
individual genes to specific human chromosomes. D'Eustachio, et al.
(1983) Science 220: 919-924. Somatic cell hybrids containing only
fragments of human chromosomes can also be produced by using human
chromosomes with translocations and deletions.
[0637] PCR mapping of somatic cell hybrids is a rapid procedure for
assigning a particular sequence to a particular chromosome. Three
or more sequences can be assigned per day using a single thermal
cycler. Using the VISTA nucleotide sequences to design
oligonucleotide primers, sublocalization can be achieved with
panels of fragments from specific chromosomes. Other mapping
strategies which can similarly be used to map a VISTA sequence to
its chromosome include in situ hybridization (described in Fan, et
al. (1990) Proc Natl. Acad. Sci. USA 87:6223-27), pre-screening
with labeled flow-sorted chromosomes, and pre-selection by
hybridization to chromosome specific cDNA libraries.
[0638] Fluorescence in situ hybridization (FISH) of a DNA sequence
to a metaphase chromosomal spread can further be used to provide a
precise chromosomal location in one step. Chromosome spreads can be
made using cells whose division has been blocked in metaphase by a
chemical such as colcemid that disrupts the mitotic spindle. The
chromosomes can be treated briefly with trypsin, and then stained
with Giemsa. A pattern of light and dark bands develops on each
chromosome, so that the chromosomes can be identified individually.
The FISH technique can be used with a DNA sequence as short as 500
or 600 bases. However, clones larger than 1,000 bases have a higher
likelihood of binding to a unique chromosomal location with
sufficient signal intensity for simple detection. Preferably 1,000
bases, and more preferably 2,000 bases will suffice to get good
results in a reasonable amount of time. For a review of this
technique, see Verma, et al. Human Chromosomes: A Manual of basic
Techniques (Pergamon Press, New York 1988). Reagents for chromosome
mapping can be used individually to mark a single chromosome or a
single site on that chromosome, or panels of reagents can be used
for marking multiple sites and/or multiple chromosomes. Reagents
corresponding to noncoding regions of the genes actually are
preferred for mapping purposes. Coding sequences are more likely to
be conserved within gene families, thus increasing the chance of
cross hybridization during chromosomal mapping.
[0639] Once a sequence has been mapped to a precise chromosomal
location, the physical position of the sequence on the chromosome
can be correlated with genetic map data Ultimately, complete
sequencing of genes from several individuals can be performed to
confirm the presence of a mutation and to distinguish mutations
from polymorphisms.
Tissue Typing
[0640] The VISTA sequences of the present invention can also be
used to identify individuals from minute biological samples.
Furthermore, the sequences of the present invention can be used to
provide an alternative technique which determines the actual
base-by-base DNA sequence of selected portions of an individual's
genome. Thus, the VISTA nucleotide sequences described herein can
be used to prepare two PCR primers from the 5' and 3' ends of the
sequences. These primers can then be used to amplify an
individual's DNA and subsequently sequence it.
[0641] Panels of corresponding DNA sequences from individuals,
prepared in this manner, can provide unique individual
identifications, as each individual will have a unique set of such
DNA sequences due to allelic differences. The sequences of the
present invention can be used to obtain such identification
sequences from individuals and from tissue. The VISTA nucleotide
sequences of the invention uniquely represent portions of the human
genome. Allelic variation occurs to some degree in the coding
regions of these sequences, and to a greater degree in the
noncoding regions. It is estimated that allelic variation between
individual humans occurs with a frequency of about once per each
500 bases. Each of the sequences described herein can, to some
degree, be used as a standard against which DNA from an individual
can be compared for identification purposes. Because greater
numbers of polymorphisms occur in the noncoding regions, fewer
sequences are necessary to differentiate individuals. The noncoding
sequences of SEQ ID NO: 1 or 4 can comfortably provide positive
individual identification with a panel of perhaps 10 to 1,000
primers which each yield a noncoding amplified sequence of 100
bases. If predicted coding sequences, such as those in SEQ ID NO: 3
or 6 are used, a more appropriate number of primers for positive
individual identification would be 500-2000.
[0642] If a panel of reagents from VISTA nucleotide sequences
described herein is used to generate a unique identification
database for an individual, those same reagents can later be used
to identify tissue from that individual. Using the unique
identification database, positive identification of the individual,
living or dead, can be made from extremely small tissue
samples.
Use of VISTA Sequences in Forensic Biology
[0643] DNA-based identification techniques can also be used in
forensic biology. The sequences of the present invention can be
used to provide polynucleotide reagents, e.g., PCR primers,
targeted to specific loci in the human genome, which can enhance
the reliability of DNA-based forensic identifications by, for
example, providing another "identification marker" (i.e., another
DNA sequence that is unique to a particular individual). As
mentioned above, actual base sequence information can be used for
identification as an accurate alternative to patterns formed by
restriction enzyme generated fragments. Sequences targeted to
noncoding regions of SEQ ID NO: 1 or 3 are particularly appropriate
for this use as greater numbers of polymorphisms occur in the
noncoding regions, making it easier to differentiate individuals
using this technique. Examples of polynucleotide reagents include
the VISTA nucleotide sequences or portions thereof, e.g., fragments
derived from the noncoding regions of SEQ ID NO: 1 or 3 having a
length of at least 20 bases, preferably at least 30 bases. The
VISTA nucleotide sequences described herein can further be used to
provide polynucleotide reagents, e.g., labeled or labelable probes
which can be used in, for example, an in situ hybridization
technique, to identify a specific tissue, e.g., lymphocytes. This
can be very useful in cases where a forensic pathologist is
presented with a tissue of unknown origin. Panels of such VISTA
probes can be used to identify tissue by species and/or by organ
type. In a similar fashion, these reagents, e.g., VISTA primers or
probes can be used to screen tissue culture for contamination
(i.e., screen for the presence of a mixture of different types of
cells in a culture).
Diagnostic Assays
[0644] An exemplary method for detecting the presence or absence of
VISTA polypeptide or nucleic acid in a biological sample involves
obtaining a biological sample from a test subject and contacting
the biological sample with a compound or an agent capable of
detecting VISTA polypeptide or nucleic acid (e.g., mRNA or genomic
DNA) that encodes VISTA polypeptide such that the presence of VISTA
polypeptide or nucleic acid is detected in the biological sample. A
preferred agent for detecting VISTA mRNA or genomic DNA is a
labeled nucleic acid probe capable of hybridizing to VISTA mRNA or
genomic DNA. The nucleic acid probe can be, for example, the VISTA
nucleic acid set forth in SEQ ID NO: 1 or 3, or a portion thereof,
such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500
nucleotides in length and sufficient to specifically hybridize
under stringent conditions to VISTA mRNA or genomic DNA. Other
suitable probes for use in the diagnostic assays of the invention
are described herein. A preferred agent for detecting VISTA
polypeptide is an antibody capable of binding to VISTA polypeptide,
preferably an antibody with a detectable label. Antibodies can be
polyclonal, or more preferably, monoclonal. An intact antibody, or
a fragment thereof (e.g., Fab or F(ab').sub.2) can be used. The
term "labeled", with regard to the probe or antibody, is intended
to encompass direct labeling of the probe or antibody by coupling
(i.e., physically linking) a detectable substance to the probe or
antibody, as well as indirect labeling of the probe or antibody by
reactivity with another reagent that is directly labeled. Examples
of indirect labeling include detection of a primary antibody using
a fluorescently labeled secondary antibody and end-labeling of a
DNA probe with biotin such that it can be detected with
fluorescently labeled streptavidin. The term "biological sample" is
intended to include tissues, cells, and biological fluids isolated
from a subject, as well as tissues, cells, and fluids present
within a subject. That is, the detection method of the invention
can be used to detect VISTA mRNA, polypeptide, or genomic DNA in a
biological sample in vitro as well as in vivo. For example, in
vitro techniques for detection of PD-L2 mRNA include Northern
hybridizations and in situ hybridizations. in vitro techniques for
detection of VISTA polypeptide include enzyme linked immunosorbent
assays (ELISAs), Western blots, immunoprecipitations and
immunofluorescence in vitro techniques for detection of VISTA
genomic DNA include Southern hybridizations. Furthermore, in vivo
techniques for detection of VISTA polypeptide include introducing
into a subject a labeled anti-VISTA antibody. For example, the
antibody can be labeled with a radioactive marker whose presence
and location in a subject can be detected by standard imaging
techniques. In one embodiment, the biological sample contains
polypeptide molecules from the test subject. Alternatively, the
biological sample can contain mRNA molecules from the test subject
or genomic DNA molecules from the test subject. A preferred
biological sample is a serum sample isolated by conventional means
from a subject. In another embodiment, the methods further involve
obtaining a control biological sample from a control subject,
contacting the control sample with a compound or agent capable of
detecting VISTA polypeptide, mRNA, or genomic DNA, such that the
presence of VISTA polypeptide, mRNA or genomic DNA is detected in
the biological sample, and comparing the presence of VISTA
polypeptide, mRNA or genomic DNA in the control sample with the
presence of VISTA polypeptide, mRNA or genomic DNA in the test
sample.
[0645] The invention also encompasses kits for detecting the
presence of VISTA in a biological sample. For example, the kit can
comprise a labeled compound or agent capable of detecting VISTA
polypeptide or mRNA in a biological sample; means for determining
the amount of VISTA in the sample; and means for comparing the
amount of VISTA in the sample with a standard. The compound or
agent can be packaged in a suitable container. The kit can further
comprise instructions for using the kit to detect VISTA polypeptide
or nucleic acid.
Prognostic Assays
[0646] The diagnostic methods described herein can furthermore be
utilized to identify subjects having or at risk of developing a
disease or disorder associated with aberrant or unwanted VISTA
expression or activity. As used herein, the term "aberrant"
includes a VISTA expression or activity which deviates from the
wild type VISTA expression or activity. Aberrant expression or
activity includes increased or decreased expression or activity, as
well as expression or activity which does not follow the wild type
developmental pattern of expression or the subcellular pattern of
expression. For example, aberrant VISTA expression or activity is
intended to include the cases in which a mutation in the VISTA gene
causes the VISTA gene to be under-expressed or over-expressed and
situations in which such mutations result in a non-functional VISTA
polypeptide or a polypeptide which does not function in a wild-type
fashion, e.g., a polypeptide which does not interact with a VISTA
binding partner, or one which interacts with a non-VISTA binding
partner. As used herein, the term "unwanted" includes an unwanted
phenomenon involved in a biological response such as immune cell
activation. For example, the term unwanted includes a VISTA
expression or activity which is undesirable in a subject.
[0647] The assays described herein, such as the preceding
diagnostic assays or the following assays, can be utilized to
identify a subject having or at risk of developing a disorder
associated with a misregulation in VISTA polypeptide activity or
nucleic acid expression, such as an autoimmune disorder, an
immunodeficiency disorder, an immune system disorder such as
autoimmunity, allergic or inflammatory disorder or cancer. Thus,
the present invention provides a method for identifying a disease
or disorder associated with aberrant or unwanted VISTA expression
or activity in which a test sample is obtained from a subject and
VISTA polypeptide or nucleic acid (e.g., mRNA or genomic DNA) is
detected, wherein the presence of VISTA polypeptide or nucleic acid
is diagnostic for a subject having or at risk of developing a
disease or disorder associated with aberrant or unwanted VISTA
expression or activity. As used herein, a "test sample" refers to a
biological sample obtained from a subject of interest. For example,
a test sample can be a biological fluid (e.g., cerebrospinal fluid
or serum), cell sample, or tissue.
[0648] Furthermore, the prognostic assays described herein can be
used to determine whether a subject can be administered an agent
(e.g., an agonist, antagonist, peptidomimetic, polypeptide,
peptide, nucleic acid, small molecule, or other drug candidate) to
treat a disease or disorder associated with aberrant or unwanted
VISTA expression or activity. For example, such methods can be used
to determine whether a subject can be effectively treated with an
agent for an autoimmune disorder, immunodeficiency disorder, immune
system cancer, or allergic or inflammatory disorder. Thus, the
present invention provides methods for determining whether a
subject can be effectively treated with an agent for a disorder
associated with aberrant or unwanted VISTA expression or activity
in which a test sample is obtained and VISTA polypeptide or nucleic
acid expression or activity is detected (e.g., wherein the
abundance of VISTA polypeptide or nucleic acid expression or
activity is diagnostic for a subject that can be administered the
agent to treat a disorder associated with aberrant or unwanted
VISTA expression or activity). The methods of the invention can
also be used to detect genetic alterations in a VISTA gene, thereby
determining if a subject with the altered gene is at risk for a
disorder characterized by misregulation in VISTA polypeptide
activity or nucleic acid expression, such as an autoimmune
disorder, an immunodeficiency disorder, an immune system cancer, an
allergic disorder, or an inflammatory disorder. The methods
described herein may be performed, for example, by utilizing
pre-packaged diagnostic kits comprising at least one probe nucleic
acid or antibody reagent described herein, which may be
conveniently used, e.g., in clinical settings to diagnose patients
exhibiting symptoms or family history of a disease or illness
involving a VISTA gene. Furthermore, any cell type or tissue in
which VISTA is expressed may be utilized in the prognostic assays
described herein.
Immunoassays
[0649] The VISTA and VISTA conjugate, antibodies and
antigen-binding fragments that bind the VISTA and VISTA conjugate,
may be used in immunoassays to qualitatively or quantitatively
detect and analyze markers in a sample. This method comprises
providing an antibody specifically binds to a VISTA or VISTA
conjugate; contacting a sample with the antibody; and detecting the
presence of a complex of the antibody bound to the marker in the
sample.
[0650] VISTA and VISTA conjugate may be detected and/or quantified
using any of a number of well recognized immunological binding
assays. Useful assays include, for example, an enzyme immune assay
(EIA) such as enzyme-linked immunosorbent assay (ELISA), a
radioimmunoassay (RIA), a Western blot assay, or a slot blot assay.
See, e.g., U.S. Pat. Nos. 4,366,241; 4,376,110; 4,517,288; and
4,837,168. Generally, a sample obtained from a subject can be
contacted with the antibody specifically binds the VISTA or VISTA
conjugate.
[0651] Optionally, the antibody can be fixed to a solid support to
facilitate washing and subsequent isolation of the complex, prior
to contacting the antibody with a sample. Examples of solid
supports include but are not limited to glass or plastic in the
form of, e.g., a microtiter plate, a stick, a bead, or a microbead.
Antibodies may be attached to a solid support.
[0652] After incubating the sample with antibodies, the mixture is
washed and the antibody-marker complex formed may be detected. This
can be accomplished by incubating the washed mixture with a
detection reagent. Alternatively, the marker in the sample can be
detected using an indirect assay, wherein, for example, a second,
labeled antibody is used to detect bound marker-specific antibody,
and/or in a competition or inhibition assay wherein, for example, a
monoclonal antibody which binds to a distinct epitope of the marker
are incubated simultaneously with the mixture.
[0653] Throughout the assays, incubation and/or washing steps may
be required after each combination of reagents. Incubation steps
can vary from about 5 seconds to several hours, preferably from
about 5 minutes to about 24 hours. However, the incubation time
will depend upon the assay format, marker, volume of solution,
concentrations. Usually the assays are carried out at ambient
temperature, although they can be conducted over a range of
temperatures (e.g., 10.degree. C.-40.degree. C.).
[0654] The immunoassay can be used to determine a test amount of a
marker in a sample from a subject. First, a test amount of a marker
in a sample may be detected using the immunoassay methods described
above. If a marker is present in the sample, it will form an
antibody-marker complex with an antibody specifically binds the
marker under suitable incubation conditions described above. The
amount of an antibody-marker complex can optionally be determined
by comparing to a standard. As noted above, the test amount of
marker need not be measured in absolute units, as long as the unit
of measurement can be compared to a control amount and/or signal.
Several immunoassays are known in the art and the VISTA polypeptide
or VISTA conjugate described herein may used in such immunoassays
including but not limited to radio-immunoassay (RIA), enzyme linked
immunosorbent assay (ELISA), magnetic immunoassay, immunoblot,
Western blot, immunoprecipitation assays, immunohistochemical
analysis, and fluorescence activated cell sorting (FACS). See Wild,
(2008) [Ed.] The Immunoassay Handbook [3.sup.rd Ed.] Elsevier.
Radio-Imaging Methods
[0655] The VISTA and VISTA conjugate may be used in radio-imaging
methods to diagnosis cancer including pancreatic and colorectal
cancer, or monitor the progression of tumors. These methods include
but are not limited to, positron emission tomography (PET) single
photon emission computed tomography (SPECT). Both of these
techniques are non-invasive, and can be used to detect and/or
measure a wide variety of tissue events and/or functions, such as
detecting cancerous cells for example. SPECT may optionally be used
with two labels simultaneously. See U.S. Pat. No. 6,696,686.
Commercial Applications and Methods
[0656] The present invention further provides for the production of
VISTA and VISTA conjugate to reach commercial quantities. The VISTA
and VISTA conjugate may be produced on a large scale, stored if
necessary, and supplied to hospitals, clinicians or other
healthcare facilities.
[0657] Methods of production, storage, and distribution of VISTA
and VISTA conjugate may be produced by the methods disclosed
herein. Following production, the VISTA and VISTA conjugate may be
harvested, purified, and optionally stored prior to a patient's
treatment. For example, once a patient presents with an indication
such as, for example, cancer, autoimmune disease, or inflammatory
condition, VISTA and VISTA conjugate may be ordered and provided in
a timely manner. Accordingly, the present invention relates to
methods of producing VISTA and VISTA conjugate to attain antibodies
on a commercial scale, pharmaceutical compositions comprising
antibodies and antigen binding fragments thereof which selectively
bind to VISTA and VISTA conjugate, as well as methods of providing
(i.e., producing, optionally storing, and selling) the VISTA and
VISTA conjugate to hospitals and clinicians. The production of
VISTA and VISTA conjugate may be scaled up for commercial use.
[0658] The present invention also provides for methods of
conducting a pharmaceutical business comprising establishing a
distribution system for distributing the preparation for sale or
may include establishing a sales group for marketing the
pharmaceutical preparation.
Library of Nucleic Acids
[0659] A variegated library of VISTA (PD-L3) variants may be
generated by combinatorial mutagenesis at the nucleic acid level
and is encoded by a variegated gene library. A variegated library
of VISTA (PD-L3) variants may be produced by, for example,
enzymatically ligating a mixture of synthetic oligonucleotides into
gene sequences such that a degenerate set of potential VISTA
(PD-L3) sequences expressible as individual polypeptides, or
alternatively, as a set of larger fusion proteins (e.g., for phage
display) containing the set of VISTA (PD-L3) sequences therein.
There are a variety of methods which can be used to produce
libraries of potential VISTA (PD-L3) variants from a degenerate
oligonucleotide sequence. Chemical synthesis of a degenerate gene
sequence can be performed in an automatic DNA synthesizer, and the
synthetic gene then ligated into an appropriate expression vector.
Use of a degenerate set of genes allows for the provision, in one
mixture, of all of the sequences encoding the desired set of
potential VISTA (PD-L3) sequences. Methods for synthesizing
degenerate oligonucleotides are known in the art. See, e.g., Narang
(1983) Tetrahedron 39:3; Itakura, et al. (1984) Annu. Rev. Biochem.
53:323; Itakura, et al. (1984) Science 198:1056; Ike, et al. (1983)
Nucleic Acids Res. 11:477.
[0660] In addition, libraries of fragments of a VISTA (PD-L3)
polypeptide coding sequence may be used to generate a variegated
population of VISTA (PD-L3) fragments for screening and subsequent
selection of variants of a VISTA (PD-L3) polypeptide. A library of
coding sequence fragments can be generated by treating a double
stranded PCR fragment of a VISTA (PD-L3) coding sequence with a
nuclease under conditions wherein nicking occurs only about once
per molecule, denaturing the double stranded DNA, renaturing the
DNA to form double stranded DNA which can include sense/antisense
pairs from different nicked products, removing single stranded
portions from reformed duplexes by treatment with S1 nuclease, and
ligating the resulting fragment library into an expression vector.
By this method, an expression library can be derived which encodes
N-terminal, C-terminal and internal fragments of various sizes of
the VISTA (PD-L3) polypeptide.
[0661] Several techniques are known in the art for screening gene
products of combinatorial libraries made by point mutations or
truncation, and for screening cDNA libraries for gene products
having a selected property. Such techniques are adaptable for rapid
screening of the gene libraries generated by the combinatorial
mutagenesis of VISTA (PD-L3) polypeptides. The most widely used
techniques, which are amenable to high through-put analysis, for
screening large gene libraries typically include cloning the gene
library into replicable expression vectors, transforming
appropriate cells with the resulting library of vectors, and
expressing the combinatorial genes under conditions in which
detection of a desired activity facilitates isolation of the vector
encoding the gene whose product was detected. Recursive ensemble
mutagenesis (REM), a new technique which enhances the frequency of
functional mutants in the libraries, can be used in combination
with the screening assays to identify VISTA (PD-L3) variants. Arkin
and Youvan (1992) Proc Natl. Acad. Sci. USA 89:7811-7815; Delagrave
et al. (1993) Protein Eng. 6(3):327-331.
Predictive Medicine
[0662] The present invention also pertains to the field of
predictive medicine in which diagnostic assays, prognostic assays,
and monitoring clinical trials are used for prognostic (predictive)
purposes to thereby treat an individual prophylactically.
Accordingly, one aspect of the present invention relates to
diagnostic assays for determining VISTA polypeptide and/or nucleic
acid expression as well as VISTA activity, in the context of a
biological sample (e.g., blood, serum, cells, or tissue) to thereby
determine whether an individual is afflicted with a disease or
disorder, or is at risk of developing a disorder, associated with
aberrant or unwanted VISTA expression or activity. The invention
also provides for prognostic (or predictive) assays for determining
whether an individual is at risk of developing a disorder
associated with VISTA polypeptide, nucleic acid expression or
activity. For example, mutations in a VISTA gene can be assayed in
a biological sample. Such assays can be used for prognostic or
predictive purpose to thereby prophylactically treat an individual
prior to the onset of a disorder characterized by or associated
with VISTA polypeptide, nucleic acid expression or activity.
[0663] Another embodiment of the invention pertains to monitoring
the influence of agents (e.g., drugs, compounds) on the expression
or activity of VISTA in clinical trials. These and other agents are
described in further detail in the following sections.
Monitoring of Effects During Clinical Trials
[0664] Monitoring the influence of agents (e.g., drugs) on the
expression or activity of a VISTA polypeptide (e.g., the modulation
of cell proliferation and/or migration) can be applied not only in
basic drug screening, but also in clinical trials. For example, the
effectiveness of an agent determined by a screening assay as
described herein to increase VISTA gene expression, polypeptide
levels, or upregulate VISTA activity, can be monitored in clinical
trials of subjects exhibiting decreased VISTA gene expression,
polypeptide levels, or downregulated VISTA activity. Alternatively,
the effectiveness of an agent determined by a screening assay to
decrease VISTA gene expression, polypeptide levels, or downregulate
VISTA activity, can be monitored in clinical trials of subjects
exhibiting increased VISTA gene expression, polypeptide levels, or
VISTA activity. As noted VISTA is expressed on many hematopoietic
cell types including APCs (macrophages and myeloid dendritic
cells), and CD4+ T cells, and more specifically is expressed on
CD11c.sup.+ DCs, CD4.sup.+ T cells (including both Foxp3.sup.-
effector T cells and Foxp3.sup.+ nTregs), CD8.sup.+ T cells, and
Gr1.sup.+ granulocytes, and expressed at low levels on B cells and
NK cells In such clinical trials, the expression or activity of a
VISTA gene, and preferably, other genes that have been implicated
in, for example, a VISTA-associated disorder can be used as a "read
out" or marker of the phenotype of a particular cell.
[0665] For example, and not by way of limitation, genes, including
VISTA, that are modulated in cells by treatment with an agent
(e.g., compound, drug or small molecule) which modulates VISTA
activity (e.g., identified in a screening assay as described
herein) can be identified. Thus, to study the effect of agents on
VISTA-associated disorders, for example, in a clinical trial, cells
can be isolated and RNA prepared and analyzed for the levels of
expression of VISTA and other genes implicated in the
VISTA-associated disorder, respectively. The levels of gene
expression (e.g., a gene expression pattern) can be quantified by
Northern blot analysis or RT-PCR, as described herein, or
alternatively by measuring the amount of polypeptide produced, by
one of the methods as described herein, or by measuring the levels
of activity of VISTA or other genes. In this way, the gene
expression pattern can serve as a marker, indicative of the
physiological response of the cells to the agent. Accordingly, this
response state may be determined before, and at various points
during treatment of the individual with the agent. In an
embodiment, the present invention provides a method for monitoring
the effectiveness of treatment of a subject with an agent (e.g., an
agonist, antagonist, peptidomimetic, polypeptide, peptide, nucleic
acid, small molecule, or other drug candidate identified by the
screening assays described herein) including the steps of (i)
obtaining a pre-administration sample from a subject prior to
administration of the agent; (ii) detecting the level of expression
of a VISTA polypeptide, mRNA, or genomic DNA in the
preadministration sample; (iii) obtaining one or more
post-administration samples from the subject; (iv) detecting the
level of expression or activity of the VISTA polypeptide, mRNA, or
genomic DNA in the post-administration samples; (v) comparing the
level of expression or activity of the VISTA polypeptide, mRNA, or
genomic DNA in the pre-administration sample with the VISTA
polypeptide, mRNA, or genomic DNA in the post administration sample
or samples; and (vi) altering the administration of the agent to
the subject accordingly. For example, increased administration of
the agent may be desirable to increase the expression or activity
of VISTA to higher levels than detected, i.e., to increase the
effectiveness of the agent. Alternatively, decreased administration
of the agent may be desirable to decrease expression or activity of
VISTA to lower levels than detected, i.e., to decrease the
effectiveness of the agent. According to such an embodiment, VISTA
expression or activity may be used as an indicator of the
effectiveness of an agent, even in the absence of an observable
phenotypic response.
[0666] All publications (e.g., Non-Patent Literature), patents,
patent application publications, and patent applications mentioned
in this specification are indicative of the level of skill of those
skilled in the art to which this invention pertains. All such
publications (e.g., Non-Patent Literature), patents, patent
application publications, and patent applications are herein
incorporated by reference to the same extent as if each individual
publication, patent, patent application publication, or patent
application was specifically and individually indicated to be
incorporated by reference.
EXAMPLES
[0667] The invention now being generally described, it are more
readily understood by reference to the following examples, which
are included merely for purposes of illustration of certain aspects
and embodiments of the present invention, and are not intended to
limit the invention.
Example 1
Cloning and Sequence Analysis of VISTA (PD-L3)
[0668] VISTA (PD-L3) and Treg-sTNF were identified by global
transcriptional profiling of resting Treg, Treg activated with
.alpha.CD3, and Treg activated with .alpha.CD3/.alpha.GITR.
.alpha.GITR was selected for this analysis as triggering of GITR on
Treg has been shown to extinguish their contact-dependent
suppressive activity (Shimizu, et al. (2002) supra). VISTA (PD-L3)
and Treg-sTNF were identified on AFFIMETRIX.RTM. DNA arrays based
on their unique expression patterns (Table 2). VISTA (PD-L3)
exhibited an increase in expression in .alpha.CD3 activated Treg
and reduced expression in the presence of .alpha.GITR; and
Treg-sTNF exhibited a .alpha.CD3/.alpha.GITR-dependent increase in
expression.
[0669] Purified CD4+CD25+ T cells were stimulated in culture
overnight with none, .alpha.CD3, or .alpha.CD3/.alpha.GITR, and RNA
isolated for real-time PCR analysis. Expression listed is relative
to actin.
TABLE-US-00002 TABLE 2 Relative Expression mRNA None .alpha.CD3
.alpha.CD3/.alpha.GITR VISTA (PD-L3) 6 10 7 T.sup.reg-sTNF 0.2 0.3
1.5
[0670] AFFIMETRIX.RTM. analysis of activated vs. resting CD25+ CD4+
nTregs revealed the expression of a gene product (RIKEN cDNA
4632428N05, or 4632428N05Rik) with unknown function but with
sequence homology to the Ig superfamily.
[0671] More specifically, a 930 bp gene product was cloned from the
CD4+ T cell cDNA library, which matched the predicted size and
sequence. Silico-sequence and structural analysis predicts a
transmembrane protein of 309 amino acids upon maturation, with an
extracellular domain of 159 amino acids, a transmembrane domain of
22 amino acids and a cytoplasmic tail of 95 amino acids (FIG. 1A).
Amino acid sequence alignment reveals an extracellular
Immunoglobulin (Ig)-V like domain homologous to B7 family ligands
such as PD-L1, PD-L2, B7-H3 and B7-H4, as well as to the B7 family
receptors (i.e., PD-1, CTLA-4, CD28, BTLA, ICOS) (FIG. 1B-1C).
Although the sequence identity of the Ig-V domains between B7
family ligands and receptors in general is not very high (<40%),
the Ig-V domain of 4632428N05Rik bears the highest homology with B7
family ligands PD-L1 and PD-L2. Sequence alignment also reveals
several highly conserved cysteines (FIG. 1B) that are important for
intra-chain disulfide bond formation, which is characteristic of
the B7 family ligands. See also FIG. 23A-C; Sica, et al. (2003)
Immunity 18: 849-861.
[0672] The extracellular domain of 4632428N05Rik contains only the
Ig-V domain but lacks the Ig-C domain (FIG. 1B-1C). This unique
feature is characteristic of the B7 family receptors, and
distinguishes 4632428N05Rik from all other B7 family ligands, which
contain both Ig-V and Ig-C domains. Freeman (2008) Proc Natl Acad
Sci USA 105: 10275-10276; Lazar-Molnar, et al. (2008) Proc Natl
Acad Sci USA 105: 10483-10488; Lin, et al. (2008) Proc Natl Acad
Sci USA 105: 3011-3016; Schwartz, et al. (2001) Nature 410:
604-608; Stamper, et al. (2001) Nature 410: 608-61. Consistently,
the phylogenic analysis using PhyML algorithm (Phylogenetic Maximum
Likelihood) placed 4632428N05Rik in a closer evolutionary distance
with B7 family receptors, in particular with PD-1, than the B7
family ligands (FIG. 2). Guindon & Gascuel (2003) Syst Biol 52:
696-704. However, the cytoplasmic tail of VISTA (PD-L3) does not
contain any signaling domains (e.g. ITIM, ITAM or ITSM), which are
the signature domains of B7 family receptors. Sharpe & Freeman
(2002) Nat Rev Immunol. 2: 116-126. Despite its close evolutionary
relationship with the inhibitory receptor PD-1, 4632428N05Rik
represents a novel member of the B7 ligand family. Based on these
structural and phylogenic characteristics, this molecule was named
PD-1-eXpressed as Ligand (VISTA (PD-L3)). VISTA (PD-L3) is also
highly conserved between the mouse and human orthologs, sharing 77%
sequence identity (FIG. 1D).
[0673] The nucleic acid sequence encoding mouse VISTA (PD-L3) is
set forth herein as SEQ ID NO:1 and the mouse VISTA (PD-L3) protein
sequence is set forth as SEQ ID NO:2.
[0674] The human homolog of VISTA (PD-L3) is located on chromosome
10 (72.9 Mb) and composed of 6 exons thereby generating a
transcript of 4689 bases in length coding for a 311 residue
protein. The human homolog mRNA coding sequence is provided in
GENBANK accession number NM_022153 and protein sequence give as
NP_071436. The nucleic acid sequence encoding human VISTA (PD-L3)
is set forth herein as SEQ ID NO: 3 and the human VISTA (PD-L3)
protein sequence is set forth as SEQ ID NO:4. Mouse and human genes
share 74% homology and are 68% identical at the protein level.
Homologs were also identified in Rattus norvegicus on chromosome 20
(27.7 Mb; GENBANK accession number BC098723), as well as Fugu
rubripes and Danio rerio. In one embodiment, VISTA (PD-L3) proteins
of the present share the common amino acid sequence set forth in
SEQ ID NO: 5. Additional orthologues of VISTA have been identified
and are shown in FIG. 23C, e.g., (SEQ ID NO: 17), human (SEQ ID NO:
16), kangaroo (SEQ ID NO: 18), dolphin (SEQ ID NO: 19), chicken
(SEQ ID NO: 20), xenopus (SEQ ID NO: 21), zebra finch (SEQ ID NO:
22), zebrafish, and fugu (SEQ ID NO: 23).
Example 2
Expression Studies of VISTA (PD-L3) by RT-PCR Analysis and Flow
Cytometry
[0675] RT-PCR analysis was used to determine the mRNA expression
pattern of VISTA (PD-L3) in mouse tissues (FIG. 3A). VISTA (PD-L3)
is mostly expressed on hematopoietic tissues (spleen, thymus, bone
marrow), or tissues with ample infiltration of leukocytes (i.e.
lung). Weak expression was also detected in non-hematopoietic
tissues (i.e. heart, kidney, brain, and ovary). Analysis of several
hematopoietic cell types reveals expression of VISTA (PD-L3) on
peritoneal macrophages, splenic CD11b+ monocytes, CD11c+ DCs, CD4+
T cells and CD8+ T cells, but lower expression level on B cells
(FIG. 3B). This expression pattern is also largely consistent with
the GNF (Genomics Institute of Novartis Research Foundation) gene
array database, as well as NCBI GEO (gene expression omnibus)
database (FIG. 3A-3D). See Su, et al. (2002) Proc Natl Acad Sci USA
99: 4465-4470.
[0676] In order to study the protein expression, VISTA (PD-L3)
specific hamster 8D8 and 6E7 monoclonal antibodies were produced.
The specificity is demonstrated by positive staining on VISTA
(PD-L3)-overexpressing murine EL4 T cells, but negative staining on
PD-L1-overexpressing EL4 cells (FIG. 5).
[0677] Both polyclonal and monoclonal antibodies were raised
against VISTA (PD-L3). Using a rabbit anti-VISTA (PD-L3) antibody,
VISTA (PD-L3) protein was localized to lymphoid organs and
prominently found in brain tissue. Of the monoclonal antibodies
identified, the specificity of .alpha.VISTA (PD-L3) clone 8D8 was
further evaluated. In this analysis, clone 8D8 was tested for
binding against a panel of PD-L like-Ig fusion protein molecules
including CTLA-4, PD-1, PD-L1, PD-L2, B7-1, B7-2, VISTA (PD-L3) and
hlg. The results of this analysis indicated that 8D8 .alpha.PDL-3
was highly specific for VISTA (PD-L3).
[0678] Specifically, using the anti-VISTA (PD-L3) monoclonal
antibody clone 8D8, VISTA (PD-L3) expression was analyzed on
hematopoietic cells by flow cytometry. Foxp3GFP knock-in reporter
mice were used to distinguish CD4+ nTregs. In peripheral lymphoid
organs (spleen and lymph nodes), significant expression is seen on
all CD4+ T cell subsets (see total CD4+ T cells, or Foxp3-naive T
cells and Foxp3+ nTreg cells, and memory CD4+ T cells), whereas
CD8+ T cells express markedly lower amount of surface VISTA (PD-L3)
(FIG. 3C). In thymus, VISTA (PD-L3) expression is negative on
CD4+CD8+ double positive thymocytes, low on CD4 single positive
cells, and detectable on CD8 single positive cells. Next, a strong
correlation of high VISTA (PD-L3) expression with CD11b marker can
be seen for both splenic and peritoneal cells, including both F4/80
macrophages and myeloid CD11c+ DCs (FIG. 3D-3E). On the other hand,
B cells and NK cells are mostly negative for VISTA (PD-L3)
expression. A small percentage of Gr-1+ granulocytes also express
VISTA (PD-L3) (FIG. 3F).
[0679] A differential expression pattern is shown on the same
lineage of cells from different lymphoid organs (FIG. 3G). For CD4+
T cells and CD11b intermediate monocytes, the expression level
follows the pattern of mesenteric lymph node>peripheral LN and
spleen>peritoneal cavity and blood. This pattern is less
pronounced for CD11bhi cells. This data suggests that VISTA (PD-L3)
expression on certain cell types might be regulated by cell
maturity and/or tissue microenvironment.
[0680] In addition to freshly isolated cells, VISTA (PD-L3)
expression was analyzed on splenic CD4+ T cells, CD11bhi monocytes
and CD11c+ DCs upon in vitro culture with and without activation
(FIG. 6). Spleen cells were either cultured with medium, or with
anti-CD3 (for activating T cells), or with IFN.gamma. and LPS (for
activating monocytes and DCs) for 24 hrs before being analyzed for
the expression of VISTA (PD-L3) and other B7 family ligands (e.g.
PD-L1, PD-L2, B7-H3 and B7-H4). This comparison revealed
distinctive expression patterns between these molecules. VISTA
(PD-L3) expression is quickly lost on all cell types upon in vitro
culture, regardless of the activation status. In contrast, PD-L1
expression is upregulated on CD4+ T cells upon stimulation, or on
CD11bhi monocytes and CD11c+ DCs upon culture in medium alone, and
further enhanced in the face of stimulation. The expression of
PD-L2, B7-H3 and B7-H4 are not prominent under the culture
conditions used. The loss of VISTA (PD-L3) expression in vitro is
unique when compared to other B7 family ligands, but might reflect
non-optimal culture conditions that fail to mimic the tissue
microenvironment.
[0681] To address how VISTA (PD-L3) expression might be regulated
in vivo, CD4 TCR transgenic mice DO11.10 were immunized with the
cognate antigen chicken ovalbumin (OVA) emulsified in complete
Freund's adjuvant (CFA). At 24 hrs after immunization, cells from
the draining lymph node were analyzed for VISTA (PD-L3) expression
(FIG. 7A). Immunization with antigen (CFA/OVA) but not the adjuvant
alone drastically increased the CD11b+ VISTA (PD-L3)+ myeloid cell
population, which contained a mixed population of F4/80+
macrophages and CD11c+ DCs. Further comparison with PD-L1 and PD-L2
reveals that even though PD-L1 has the highest constitutive
expression level, VISTA (PD-L3) is the most highly upregulated
during such an inflammatory immune response (FIG. 7B).
Collectively, these data strongly suggest that the expression of
VISTA (PD-L3) on myeloid APCs is tightly regulated by the immune
system, which might contribute to its role in controlling immune
responses and regulating T cell immunity.
[0682] In contrast to its increased expression on APCs, VISTA
(PD-L3) expression is diminished on activated DO11.10 CD4+ T cells
at a later time point upon immunization (i.e. at 48 hr but not at
24 hr) (FIG. 8). This result suggests that VISTA (PD-L3) expression
on CD4 T cells in vivo may be regulated by its activation status
and cytokine microenvironment during an active immune response.
Example 3
Functional Impact of VISTA (PD-L3) Signaling on CD4+ and CD8+ T
Cell Responses
[0683] A VISTA (PD-L3)-Ig fusion proteins were was produced to
examine the regulatory roles of VISTA (PD-L3) on CD4+ T cell
responses. The VISTA (PD-L3)-Ig fusion protein contains the
extracellular domain of VISTA (PD-L3) fused to the human IgG1 Fc
region. When immobilized on the microplate, VISTA (PD-L3)-Ig but
not control Ig suppressed the proliferation of bulk purified CD4+
and CD8+ T cells in response to plate-bound anti-CD3 stimulation,
as determined by arrested cell division (FIG. 9A-9B). The VISTA
(PD-L3) Ig fusion protein did not affect the absorption of anti-CD3
antibody to the plastic wells, as determined by ELISA, thus
excluding the possibility of non-specific inhibitory effects. PD-1
KO CD4+ T cells were also suppressed (FIGS. 9C, 9D), indicating
that PD-1 is not the receptor for VISTA (PD-L3). The inhibitory
effect of PD-L1-Ig and VISTA (PD-L3)-Ig was also directly compared
(FIG. 10). When titrated amounts of Ig fusion proteins were
absorbed to the microplates together with .alpha.CD3 to stimulate
CD4+ T cells, VISTA (PD-L3)-Ig showed similar inhibitory efficacy
as PD-L1-Ig fusion protein.
[0684] Since bulk purified CD4+ T cells contain various subsets,
the impact of VISTA (PD-L3)-Ig on sorted naive
(CD25-CD44lowCD62Lhi) and memory (CD25-CD44hiCD62Llow) CD4+ T cell
subsets was evaluated (FIGS. 11A and 11B). VISTA (PD-L3) can
suppresses the proliferation of both subsets, albeit with much less
efficacy on the memory cells.
[0685] To further understand the mechanism of VISTA
(PD-L3)-mediated suppression, the expression of early TCR
activation markers and apoptosis were measured following T cell
activation in the presence or absence of VISTA (PD-L3)-Ig.
Consistent with the negative impact on cell proliferation, there is
a global suppression on the expression of the early activation
markers CD69, CD44, and CD62L (FIG. 12A). On the other hand, the
VISTA (PD-L3)-Ig fusion protein did not induce apoptosis. On the
contrary, less apoptosis (as determined by the percentage of
annexin V+ 7AAD-cells) was seen in the presence of VISTA (PD-L3) or
VISTA-Ig than the control-Ig, at both early (24 hr) and later stage
(48 hr) of TCR activation (FIG. 12B). For example, at 24 hr time
point, on total "ungated" population, .about.27% cells were
apoptotic in the presence of VISTA (PD-L3) or VISTA-Ig, but
.about.39% control cells were apoptotiC When examining the cells
within the live cell R1 gate, it is apparent that VISTA (PD-L3) or
VISTA-Ig strongly inhibited activation-induced-cell-death (ACID),
because about 72.6% control cells became apoptotic whereas only
43.5% cells were apoptotic when treated with VISTA (PD-L3) or
VISTA-Ig. Similar results were seen for the 48 hr time point.
Therefore, it appears that VISTA (PD-L3) or VISTA negatively
regulates CD4+ T cell responses by suppressing early TCR activation
and arresting cell division, but with minimum direct impact on
apoptosis. This mechanism of suppression is similar to that of
B7-H4. Sica, et al. (2003) Immunity 18: 849-861.
[0686] A 2-step assay was developed to determine whether VISTA
(PD-L3) or VISTA-Ig can suppress pre-activated CD4 T cells, and how
persistent its suppressive effect is. It is shown that the
suppressive effect of VISTA (PD-L3) or VISTA-Ig fusion protein
persists after its removal at 24 hr post activation (FIG. 9D). In
addition, both naive and pre-activated CD4+ T cells could be
suppressed by VISTA (PD-L3) or VISTA-Ig. See FIG. 9D, parts (i),
(iii), and (iv).
[0687] Next, the impact of VISTA (PD-L3) or VISTA-Ig on CD4+ T cell
cytokine production was analyzed. VISTA (PD-L3) or VISTA-Ig
suppressed the production of Th1 cytokines IL-2 and IFN.alpha. from
bulk purified CD4+ T cell culture (FIGS. 13A-13B). The impact of
VISTA (PD-L3) or VISTA was further tested on separate naive
(CD25-CD44lowCD62Lhi) and memory (CD25-CD44hiCD62Llow) CD4+ T cell
populations. It is shown that memory CD4+ T cells are the major
source for cytokine production within the CD4+ T cell compartment,
and VISTA (PD-L3) or VISTA can suppress this production (FIGS.
13C-13D). Similar inhibitory effect of VISTA (PD-L3) or VISTA on
IFN.alpha. production from CD8+ T cells was also shown (FIG. 13E).
This inhibitory effect of VISTA (PD-L3) or VISTA on cytokine
production by CD4+ and CD8+ T cells is consistent with the
hypothesis that VISTA (PD-L3) or VISTA is an inhibitory ligand that
down-regulates immune responses.
[0688] Next, studies were designed to determine the factors that
are able to overcome the inhibitory effect of VISTA (PD-L3) or
VISTA. Given that VISTA (PD-L3) or VISTA suppressed IL-2
production, and IL-2 is critical for T cell survival and
proliferation, IL-2 might circumvent the inhibitory activity of
VISTA (PD-L3) or VISTA. As shown in FIG. 14A, exogenous IL-2, but
not IL-15, IL-7, or IL-23, partially reversed the suppressive
effect of VISTA (PD-L3) or VISTA-Ig on cell proliferation. The
incomplete rescue by high levels of IL-2 indicates that VISTA
(PD-L3) or VISTA signaling targets broader T cell activation
pathways than simply IL-2 production. On the other hand, potent
co-stimulation signal provided by anti-CD28 agonistic antibody
completely reversed VISTA (PD-L3) or VISTA-Ig mediated suppression
(FIG. 14B), whereas intermediate levels of costimulation is still
suppressed by VISTA (PD-L3) or VISTA signaling (FIG. 14C). This
result suggests that VISTA (PD-L3) or VISTA-mediated immune
suppression would be more effective under less inflammatory
conditions, but are inevitably overwhelmed by strong positive
costimulatory signals. In this regard, VISTA (PD-L3) or VISTA
shares this feature with other suppressive B7 family ligands such
as PD-L1 and B7-H4. Sica, et al. (2003) Immunity 18: 849-861;
Carter, et al. (2002) Eur J Immunol. 32: 634-643.
[0689] In addition to VISTA (PD-L3) or VISTA-Ig fusion protein, it
is necessary to confirm that VISTA (PD-L3) or VISTA expressed on
APCs can suppress antigen-specific T cell activation during cognate
interactions between APCs and T cells. For this purpose, VISTA
(PD-L3) or VISTA-RFP or RFP control protein was over-expressed via
retroviral transduction in an artificial antigen presenting cell
line (CHO-APC) that stably expresses MHCII and B7-2 molecules
Latchman, et al. (2001) Nat Immunol 2: 261-268. One problem in
expressing VISTA (PD-L3) or VISTA in CHO is that the majority of
VISTA (PD-L3) or VISTA failed to localize to the cell surface,
perhaps due to the alien environment that lacks support for VISTA
(PD-L3) or VISTA surface localization. Although there are no clear
motifs present on the cytoplasmic tail of VISTA (PD-L3) or VISTA to
suggest the mode of regulation, the tail might play a role for its
intracellular localization. Consequently, a tail-less VISTA (PD-L3)
or VISTA mutant was designed and was found to successfully localize
to CHO cell surface.
[0690] To stimulate T cell response, CHO-VISTA (PD-L3) or VISTA or
CHO-RFP cells were incubated together with DO11.10 CD4+ T cells in
the presence of antigenic OVA peptide. As shown in FIGS. 15A-15D,
CHO-VISTA (PD-L3) or VISTA induced less proliferation of DO11.10
cells than CHO-RFP cells. This suppressive effect is more
pronounced at lower peptide concentrations, consistent with the
notion that a stronger stimulatory signal would overcome the
suppressive impact of VISTA (PD-L3) or VISTA.
[0691] In addition, the inhibitory effect of full-length VISTA
(PD-L3) or VISTA on natural APCs was confirmed. in vitro cultured
bone marrow derived dendritic cells (BMDC) do not express high
level of VISTA (PD-L3) or VISTA (FIG. 16). VISTA (PD-L3) or
VISTA-RFP or RFP was expressed in BMDCs by retroviral transduction
during the 10 day culture period. Transduced cells were sorted to
homogeneity based on RFP expression. The expression level of VISTA
(PD-L3) or VISTA on transduced DCs was estimated by staining with
anti-VISTA (PD-L3) or VISTA monoclonal antibody, and found to be
similar to the level on freshly isolated peritoneal macrophages,
thus within the physiological expression range (FIG. 16). Sorted
BMDCs were then used to stimulate OVA-specific transgenic CD4+ T
cells (OTII) in the presence of OVA peptide (FIG. 15D). Expression
of VISTA (PD-L3) or VISTA on BMDCs suppressed the cognate CD4+ T
cell proliferative responses. This result is consistent with
previous data using VISTA (PD-L3) or VISTA-Ig fusion protein and
CHO-APC cells, suggesting that VISTA (PD-L3) or VISTA can suppress
T cell-mediated immune responses.
Example 4
Evaluation of Anti-VISTA (PD-L3) or VISTA Antibodies in Multiple
Sclerosis Animal Model (EAE)
[0692] Because the .alpha.VISTA (PD-L3) or VISTA monoclonal
antibodies in vivo appeared to suppress T cell responses,
.alpha.VISTA (PD-L3) or VISTA was tested to evaluate if it can
inhibit a T cell-mediated autoimmune disease. Using the
Experimental Allergic Encephalomyelitis (EAE) model, the functional
impact of .alpha.PDL-L3 monoclonal antibodies on inflammatory
diseases was determined. EAE is a widely used murine model of the
human autoimmune disease multiple sclerosis. EAE can be induced by
either immunization with myelin antigens in adjuvant or by adoptive
transfer of myelin-specific T cells, which results in inflammatory
infiltrates of various effector T cells and B cells, and
macrophages, and demyelination of central nervous systems.
[0693] .alpha.PDL-L3 monoclonal antibody was tested in the passive
EAE model to avoid induction of anaphylaxis due to the injection of
large amount of monoclonal antibody as foreign antigen. In this
adoptive transfer EAE model, donor SJL mice were immunized with CFA
and PLP peptide. On day 10, total lymphocytes from draining LN were
isolated, and cultured in vitro with PLP peptide, IL-23 (20 ng/ml)
and anti-IFN.gamma. (10 .mu.g/ml) for 4 days. Expanded CD4 T cells
were then purified and adoptively transferred into naive recipient
mice. This analysis indicated that .alpha.PDL-L3 monoclonal
antibody delayed disease onset, as well as reduced disease
severity, thereby shifting the disease progression curve
significantly (A, Bure 17). In addition, it reduced severity in a
large percentage of the mice and greatly increased survival from
around 22% to over 75%. This demonstrated activity of .alpha.PDL-L3
monoclonal antibody in EAE is consistent with the in vitro data,
and demonstrates the use of this reagent as a novel
immunoregulatory reagent in various inflammatory diseases.
Example 5
Therapeutic Effect of VISTA-IgG2a in Active EAE Mice
[0694] Mice with active EAE produced as described in the previous
example were evaluated in order to assess the putative efficacy of
VISTA fusion polypeptides for treating multiple sclerosis. In these
experimenters groups of 6 EAE mice treated with PBS (control), 100
micrograms of control IgG2a polypeptide, 300 micrograms of control
IgG2a polypeptide, 100 micrograms of mVISTA IgG2a polypeptide, 300
micrograms of mVISTA IgG2a polypeptide As shown by the scores in
FIG. 42, the mVISTA-Ig treated mice had a pronounced and
atatistically significant therapeutic effect at both tested doses
(p=0.0051 and 0.0043 at the lower and higher doses).
[0695] We also conducted experiments assaying the effect of VISTA
on the fate and function of T cells in EAE. We wanted to assess if
VISTA alters the development of pathogenic, encephalitogenic T
cells, clonal T cell expansion, T cell polarity, longevity, and
conversion of Teff.fwdarw.Treg. We studied the impact of VISTA
blockade on T cell fate in EAE. Consistent with the higher disease
score, analysis of CNS at the end of disease course confirmed
significantly more IL17A-producing CD4+ T cell infiltration (from
0.66.fwdarw.11%) in 13F3 (.alpha.VISTA) treated group.
Example 6
Evaluation of VISTA-Ig for Prophylaxis of Lupus
[0696] For prophylaxis studies, NZBWF1 female mice were treated
from 8 weeks of age with PBS, 150 micrograms of control-IgG2a or
mVISTA-IgG2a wevery other day. Disease severity was monitored
weekly by weight loss and proteinuria. As shown in FIGS. 43A and
43B, the data was shown as the mean of +/.sub.-- SEM. Statistical
significance was determined between control IgG2a and the
mVISTA-IhGg2a. The p values was determined to be 0.0027 (by the
unpaired Mann Whitney test) (N=7) which indicated that the VISTA
fusion prevented the onset of SLE relative to the control.
Example 7
VISTA-Ig Promotes Survival in Lupus
[0697] As further shown in FIGS. 44A and 44B when 8 week, NZBWF1
female mice were administered PBS, 150 micrograms of control-IgG2a
or mVISTA-IgG2a every other day, that the VISTA-Ig treated mice had
less disease severity as evidenced by reduced proteinuria
(monitored weekly). The data is again shown as the mean level +/-
SEM and is representative of an experiment. The statistical
significance as determined by a p value by the unpaired
MannWhitnety test was shown to be 0.0009. The results in the
survival curve in FIG. 44A and the proteinuria data in FIG. 44B
indicate that VISTA-Ig polypeptides may enhance survival in lupus
patients, and alleviate or prevent kidney damage therein.
Example 8
Evaluation of VISTA Effects in EAE Model
[0698] Because the .alpha.VISTA (PD-L3) or VISTA monoclonal
antibodies in vivo appeared to suppress T cell responses,
.alpha.VISTA (PD-L3) or VISTA was tested to evaluate if it can
inhibit a T cell-mediated autoimmune disease. Using the
Experimental Allergic Encephalomyelitis (EAE) model, the functional
impact of .alpha.PDL-L3 monoclonal antibodies on inflammatory
diseases was determined. EAE is a widely used murine model of the
human autoimmune disease multiple sclerosis. EAE can be induced by
either immunization with myelin antigens in adjuvant or by adoptive
transfer of myelin-specific T cells, which results in inflammatory
infiltrates of various effector T cells and B cells, and
macrophages, and demyelination of central nervous systems.
Example 9
Expression of VISTA in the CNS
[0699] The expression of VISTA in the CNS was also effected. These
assays revealed that in mice with disease, VISTA expression is
markedly reduced (from 76%.fwdarw.33%) on the CD11b+ cells (FIG.
22), consistent with the hypothesis that the loss of VISTA may be
permissive for enhanced inflammation. This is interesting, and
likely functionally important when we contrast inflammatory myeloid
cells herein, with the MDSC in tumors that express extremely high
levels of VISTA. It has been reported that EAE mice have elevated
numbers of myeloid derived suppressor cells (CD11b+Ly-6Chigh MDSC)
in the spleen which are potently suppressive for T cell activation
and may temper disease32. Our data strongly suggest that VISTA may
play a role in myeloid-mediated suppression in EAE.
Example 10
The Impact of VISTA on the Fate and Function of T Cells in EAE
[0700] We also conducted experiments assaying the effect of VISTA
on the fate and function of T cells in EAE. We wanted to assess if
VISTA alters the development of pathogenic, encephalitogenic T
cells, clonal T cell expansion, T cell polarity, longevity, and
conversion of Teff.fwdarw.Treg. We studied the impact of VISTA
blockade on T cell fate in EAE. Consistent with the higher disease
score, analysis of CNS at the end of disease course confirmed
significantly more IL17A-producing CD4+ T cell infiltration (from
0.66.fwdarw.11%) in 13F3 (.alpha.VISTA) treated group.
Example 11
VISTA (PD-L3) or VISTA Transgenic and Knock-Out Mice
[0701] Using Lentiviral infection of embryos, four transgenic mice
ubiquitously expressing VISTA (PD-L3) or VISTA have been produced.
These mice express full-length VISTA (PD-L3) or VISTA under the
control of the human elongation factor 1 promoter. These mice were
generated using lentiviral vector pWPT. Similar to other PD-L1
family members (Appay, et al. (2002) J. Immunol. 168: 5954-8), it
is contemplated that VISTA (PD-L3) or VISTA will function as a
negative regulator in vivo while functioning to co-stimulate
.alpha.CD3 T cell proliferation in vitro. In this respect, these
mice are expected to spontaneously develop autoimmunity and in vivo
immune responses in the VISTA (PD-L3) or VISTA transgenic mice
(i.e., humoral immune responses, T cell priming) are evaluated to
assess systemic autoimmune disease development.
[0702] For knock-out mice, VISTA (PD-L3) or VISTA is inactivated by
homologous recombination. A BAC clone containing full-length VISTA
(PD-L3) or VISTA sequence was purchased from INVITROGEN.RTM.
(Carlsbad, Calif.). A VISTA (PD-L3) or VISTA targeting vector was
generated by inserting a 1.6 kb fragment located at the 5' side of
the second exon of VISTA (PD-L3) or VISTA gene upstream the
neomycin gene and the 5 kb fragment located at the 3' side of the
third exon of VISTA (PD-L3) or VISTA gene downstream the neomycin
gene. B6-derived embryonic stem (ES) cells are electroporated with
VISTA (PD-L3) or VISTA targeting vector and recombined clones are
selected. Selected clones are then injected into C57BL/6
blastocysts and the resulting chimeric male offspring are mated to
FLP-deleter mice to remove the neomycin cassette. Transmission of
the targeted allele in the offspring is determined by PCR from
genomic DNA. The second and the third exon contain the VISTA
(PD-L3) or VISTA domain, therefore, the resulting mice have only
the inactivated form of the VISTA (PD-L3) or VISTA molecule.
[0703] The overall immune capacity of VISTA (PD-L3) or VISTA
deficient mice is determined as with other PD-L-/- mice, including
assessment of T cell responses to antigen, humoral immune
responses, overt autoimmunity (e.g., Systemic Lupus Erythematosus,
inflammatory bowel disease), and increased susceptibility to
induced autoimmune disease (experimental autoimmune
encephalomyelitis) (Chen (2004) supra).
[0704] VISTA-/- mice, produced substantially as above-described
were obtained and their phenotype and immune function assessed.
Phenotypically, these mice were observed to have an increase in
lymphocytic infiltrate in the lung, liver and pancreas. As well
these mice had follicular hyperplasia in their lungs and spleen.
Also, they had neurtrophil infiltration in their stomack. By
contrast, their kidneys, adrenal, esophagus, small intestine and
colon did not exhibit and perceptible differences from normal
animals.
[0705] Immunologically, these mice had a heightened susceptibility
to EAE and in the females heightened IgG autoantibody production
(FIG. 45 and FIG. 46). Also, these mice showed increased
myelopoiesis (FIG. 47) relative to the control animals. These mice
also exhibit an inflammatory phenotype and possess increased
numbers of CD4+ and CD8+ T cells and express increased or altered
levels of cytokines and other polypeptides such as eotaxin, IP-10,
MCP-1, M1G, gamma interferon, IL-17F, and TNF alpha. (FIG. 48)
Example 12
VISTA (PD-L3) or VISTA Specific Antibodies Tested in
Collagen-Induced Arthritis Animal Model
[0706] Male DBA/1J mice were immunized at the base of their tail
with 100 .mu.l of emulsion containing 100 .mu.g chick type-II
collagen (C-II) in CFA (mycobacterium tuberculosis 3.5 mg/ml) and
boosted IP with 100 .mu.g aqueous C-II on day 21 post-immunization.
Mice of each treatment group (n=6) were either untreated (NT-black
circles), injected with 300 .mu.g hamster IgG (Ham Ig-black
squares) or injected with 300 .mu.g of monoclonal-antibody "7c9"
(red triangle) or "13F3" (green triangle), as indicated. Injections
were given every 2 days. Arthritic swelling was scored on a scale
of 0-4 for each paw of each mouse on the days indicated. The
arthritis score shown is the total score of all paws of mice in
each treatment group divided by the number of mice in the
group.
Example 13
VISTA Blockade by a Specific VISTA Monoclonal Antibody Enhances T
Cell Responses In Vitro
[0707] A VISTA-specific monoclonal antibody (13F3) was identified
which neutralizes VISTA-mediated suppression (FIG. 18).
CD11b.sup.hi myeloid APCs were purified from naive mice to
stimulate OT-II transgenic CD4.sup.+ T cells in the presence or
absence of 13F3. Consistent with its neutralizing effect, 13F3
enhanced T cell proliferation stimulated by CD11b.sup.hi myeloid
cells, which were shown to express high levels of VISTA.
Example 14
Anti-VISTA Enhances Anti-Tumor Immunity
[0708] Because of the capacity of anti-VISTA to enhance T cell
activation, whether anti-VISTA would enhance the protective immune
response to an immunogenic tumor was assessed. A model in which we
have a great deal of experience is the bladder carcinoma, MB49.
MB49 expresses male antigen, and thus it is modestly immunogenic in
female mice, although, it will grow and kill female mice if there
is no immune intervention. To test the efficacy of .alpha.VISTA
therapy, female mice were administered MB49 tumor cells
subcutaneously (sq) and treated with .alpha.VISTA. Days thereafter,
the size of the tumor was measured until the mice had to be
euthanized. FIG. 19 shows that anti-VISTA therapy greatly impairs
tumor growth. This is due to the ability of anti-VISTA to intensify
cell-mediated immune (CMI) responses.
Example 15
Effect of Anti-VISTA on Tumor Regression in 4 Murine Tumor
Models
[0709] Experiments in the immunogenic bladder carcinoma tumor MB49
have shown that neutralization of VISTA using monoclonal antibody
13F3 and protects host from tumor growth. The data indicates that
VISTA has a considerable negative immunoregulatory role in the
microenvironment of a tumor because of its extremely high
expression of MDSCs. Studies examining the effect of anti-mouse
VISTA on the growth of immunogenic (MB49) and highly
non-immunogenic (B16) tumor models will further confirm the
efficacy of .alpha.VISTA therapy, shed light on the mechanism of
action, and provide the basis for selecting the optimal dose and
timing. The rationale for each tumor model is detailed below.
TABLE-US-00003 TABLE 3 Tumor Name Tumor Type Host Groups ASSAYS
MB49 Bladder Carcinoma B6 Female .alpha.VISTA Tumor growth MB49
Bladder Carcinoma B6 Male Control Ig Survival B16.F10 Melanoma B6
Male Immune/ or female Autoimmune ID8 Ovarian Cancer B6 Female
Assays
[0710] MB49 in female mice: Efficacy in this murine model has been
demonstrated. MDSCs in this model also express elevated levels of
VISTA. In this model, due to the presence of H-Y antigen, the MB49
tumor is modestly immunogenic. Since we know anti-VISTA therapy is
effective, this model will serve as a "positive" control to
determine dosing (1-100 .mu.g/mouse; and timing (day of tumor
inoculation, or 4, 7, 10 days after tumor; therapeutic
intervention) of anti-VISTA therapy.
[0711] MB49 in male mice: Using doses and timing effective in
female mice, the efficacy of anti-VISTA therapy in male mice (in
which the tumor is less immunogenic) is determined.
[0712] B16 melanoma: Anti-CTLA-4 monoclonal antibody was shown
highly effective in this model, and represents a non-immunogenic
tumor where the mouse model has been valuable for predicting
success in humans. Dosing regimes and timing are similar to those
shown to be effective in the MB49 model.
[0713] ID8 Ovarian carcinoma: It is in this model, that VISTA
expression has been shown to be extremely high on MDSCs. Mice
bearing ID8 tumor are treated with .alpha.VISTA at the time of
tumor inoculum or at day 5, 15, 25 post inoculation.
[0714] Methods: B6 WT mice are used to determine the optimal dose
and timing of anti-VISTA treatment for the remission of all murine
tumor models noted. The models to be used are listed in the Table
3.
[0715] The readout for this dose and timing assay are tumor growth
kinetics. For MB49 and B16 studies, all tumor studies are done via
intradermal (i.d.) inoculation and therefore tumor size can be
readily measured. Tumor measurements are collected every 2-3 days
using a caliper. In each of these models, the impact of anti-VISTA
or control antibody are tested for its ability to slow tumor growth
or facilitate tumor regression. Growth of ID8 are followed using a
luciferase transduced ID8 and whole body imaging using an IVIS
Workstation. In addition, host survival will also be
determined.
[0716] Data on tumor growth is expressed as mean tumor
volume.+-.SEM and differences between groups are analyzed by
two-tailed ANOVA. Probability (p) values less than 0.05 is
considered statistically significant. Survival data is analyzed
using the Kaplan-Meier method with the Wilcoxon rank test and the
log-rank test used to verify the significance of the difference in
survival between groups. In the B16 models, frequencies of mice
that develop vitiligo is determined.
[0717] Using these methods slowed tumor growth and/or tumor
regression in mice treated with anti-VISTA monoclonal antibody is
obtained as compared with mice treated with control ab in several
of the non-immunogenic tumor models. It has already been shown that
anti-VISTA treatment delays tumor growth in an immunogenic tumor
model. As each of these tumor models have their own specific growth
kinetics and, anticipated dependency on VISTA to confer tumor
growth and suppress immunity, mice are administered monoclonal
antibody either at the time of tumor inoculum or at times
thereafter. Additionally, at least 3 different concentrations of
anti-VISTA monoclonal antibodies are tested to determine the
optimal dose for therapeutic benefit.
[0718] As shown in FIGS. 20A-20E, VISTA monoclonal antibody
treatment reduced tumor growth in all 4 of these tumor models
wherein mice were inoculated either subcutaneously (sq) with (A)
MB49, (B) MCA105, (C) EG7 tumor cells, or (D) intraperitoneal (ip)
with ID8-luciferase tumor cells, and treated with VISTA monoclonal
antibody 13F3 every other day (300 .mu.g) beginning on day +1.
Subcutaneous tumor growth was monitored. For ID8-luciferase tumor,
mice were imaged on day 30 using Xenogen IVIS. (E) VISTA expression
on myeloid leukocytes in tumor-bearing mice was also determined.
Draining LN and tumor tissues (ascites) were analyzed for VISTA
expression. These findings show that VISTA expressed on MDSC is a
major suppressive molecule that interferes with the development of
protective anti-tumor immunity, and .alpha.VISTA relieves this
suppressive activity allowing immune intervention and slowing
growth of tumor. These findings also support the conclusion that
VISTA on myeloid cells in autoimmune disease plays a pivotal
function in regulating the extent of inflammation.
Example 16
Synthesis of Oligomeric VISTA and VISTA Fusion Proteins Useful for
the Treatment of Autoimmunity
[0719] Soluble VISTA-Ig in vitro is not suppressive nor can its
binding to cells be readily detected. By contrast, this molecule
bound to plastic is profoundly suppressive. In addition, studies
using VISTA-Ig in vivo did not show overt activity. With respect to
these studies the VISTA-Ig that was created has mutations in the
CH2-CH3 domain precluding FcR binding, and therefore is not
cytophilic in vivo. Recent studies have shown that tetrameric PD-L1
bound 100.times. higher (K.sub.d 6.times.10.sup.-8 M) than
monomeric PD-L126 to PD-1, and that binding to cells was readily
detectable. Tetrameric PD-L1 was not tested in vivo, but in vitro
it was shown to block the functional suppression by native PD-L1.
Using similar methods oligomers are made that will target the VISTA
pathway and elicit potent immunosuppressive activity in vitro ad in
vivo.
[0720] Such oligomers are constructed using the monomeric
extracellular domain of VISTA or a fragment thereof, e.g., at least
50, 75, 100, 125, 150, 175 or 200 amino acids long which
extracellular domain or a portion thereof is used as the building
blocks for oligomer. In these methods the inventors take advantage
of the well-established MHC tetramer technologies. In these methods
the VISTA ectodomain construct or a fragment is linked to the
N-terminus of a variety of oligomerization domains (identified
herein) in order to generate a series of VISTA complexes with
valencies that span from divalent to heptavalent.
[0721] Thereby, a series of non-covalent oligomers is created based
on high affinity coiled-coil domains that direct the stable
formation of dimeric, trimeric, tetrameric, pentameric and
heptameric assemblie. These oligomeric constructs are expressed in
a host cell (e.g., E. coli). When expression is effected in E coli
the expressed oligomers are then refolded and purified from
inclusion bodies using standard laboratory protocols. This approach
has routinely produced high quality material for biological and
structural analysis, including MHC-peptide complexes and trimeric
GITRL66. The isolated oligomeric proteins are then assessed by
SDS-PAGE, analytical gel filtration, analytical ultracentrifugation
and mass spectrometry. These quality control measures ensure the
availability of homogeneous, well-characterized materials for in
vitro and in vivo studies. The parallel organization of these
constructs results in molecules in which the valency is equal to
the oligomeric state since each individual VISTA complex is
positioned to productively interact with cell surface bound VISTA
receptor. The above constructs possess extreme stability and
homogeneitiy of oligomeric state. (Non-covalent coiled-coil
oligomerization domains typically exhibit melting temperatures that
exceed 100.degree. C., except for the heptamer sequence which
exhibits a melting temperature of 95.degree. C.
[0722] In addition dimeric VISTA-Ig is tetramerized that is either
cytophilic or not cytophilic. The Fc fusion constructs of VISTA in
frame with the IgG1 Fc (both wild-type IgG1 and the existing
non-FcR-binding IgG1) are modified with an N-terminal BirA site for
enzymatic biotinylation and cloned into the pIRES2-EGFP vector.
Enzymatic biotinylation will allow specific, single residue
modification and orientation upon avidin multimerization. This
approach has been used for the generation of numerous Ig-fusion
proteins, including B7-1, PD-L1, PD-L2 and TIM-3. The expressed
proteins are then enzymatically biotinylated in vitro, purified by
size exclusion HPLC, and tetramerized using PE-Avidin. The activity
of the resulting tetramers which may be cytophilic or
non-cytophilic are assessed in vivo.
[0723] These engineered multimeric VISTA proteins are useful in
treating autoimmunity and other conditions wherein intervention in
the VISTA pathway and immunosuppression is therapeutically
warranted.
Example 17
VISTA Adenoviral Vectors for Inducing Immune Suppression
[0724] Gene transfer using recombinant adeno-associated virus (AAV)
has seen great technological development in gene therapy
Specifically, AAV-mediated gene delivery of PD-L1 gene, or CTLA4-Ig
and CD40-Ig has achieved therapeutic efficacy in autoimmune disease
models of lupus ENREF_69 and cardiac transplantation. These methods
are used to deliver either full length VISTA, or oligomeric VISTA
ectodomains, and their therapeutic effects are assessed in the EAE
model. Recombinant adenovirus vector expressing either full-length
murine VISTA, or oligomeric VISTA ectodomain, is created using the
Adeno-XTM Expression System (Clontech) according to the
manufacturer's instructions. Briefly, VISTA is cloned into an E1
and E3-deleted, pAdDEST-based expression vector, under the control
of the human cytomegalovirus (CMV) promoter. VISTA and control lacZ
expressing adenovirus are then purified from cell lysates. For
systemic overexpression of VISTA, adenovirusis administered to mice
by intravenous tail vein injection (1.times.10.sup.9 plaque-forming
units [Pfu]) either prior to or shortly after disease induction via
immunization, or after disease onset. The control mice will receive
100 .mu.l PBS. Disease development and alterations are monitored in
both SJL mice and C57BL/6 mice, which exhibit different disease
progression pattern, and which represent two distinct forms of
clinical manifestation of human MS patients.
Example 18
Functional Studies with Engineered Proteins and Adenoviral
Vectors
[0725] Mice are also administered (5-100 .mu.g of
protein/mouse.times.3 weekly) with engineered VISTA and/or
adenoviral vectors. Following administration, T cell expansion,
differentiation, as well as EAE development is determined.
Example 19
Structural Studies on VISTA and Determining Molecular Determinants
of VISTA Function
[0726] Affinity, specificity, oligomeric state, and the formation
and localization of organized signaling complexes are critical
contributors to immune function. All of these features impact
signaling and immune regulation, as the organization of the
receptor-ligand ectodomains directly controls the recruitment,
organization and function of non-covalently associated cytoplasmic
signaling and scaffolding molecules. The high resolution crystal
structure of VISTA is determined using techniques including
bacterial, insect and mammalian expression systems, as well as
high-throughput crystallization and structure determination
approaches. To validate the crystallographically-observed disulfide
bonding pattern, high resolution mass spectrometry using approaches
that successfully supported studies of TIM-3 and human DcR359 are
used. Based on these structural results, a series of mutants with
altered oligomeric properties is designed, as well as mutants in
the vicinity of any perturbed regions of the VISTA IgV domain.
These mutant proteins will provide additional direct mechanistic
insight into VISTA function and should be useful in therapeutics
wherein immunosuppression is desired such as the autoimmune,
allergic and inflammatory diseases identified herein. These
mutants, especially oligomers are tested in in vitro systems and
are assessed in animal autoimmune and inflammatory disease models
in order to assess the immunosuppressive effect on disease
progression, disease remission or in protecting the animal from
developing the autoimmune or inflammatory condition.
[0727] These oligomeric VISTA proteins will activate the VISTA
pathway and function as a target of immune intervention in
autoimmunity. This intervention will suppress immunity and exert a
therapeutic benefit on autoimmune disease and other conditions
wherein autoimmune suppression is desired. This is accomplished by
administering the oligomerized VISTA proteins in different
autoimmune and inflammatory models such as the EAE and
collagen-induced arthritis animal models. In addition, as discussed
above, adenoviral vectors that over-express full-length VISTA or
VISTA oligomers are constructed and tested in vivo. These studies
will confirm the immunosuppressive effects of VISTA oligomers.
Example 20
Experiments Using Conditional Over-Expressing VISTA Transgenic
Mouse Strain (VISTA Transgenic Mouse Strain: R26StopFLVISTA
(VISTA)
[0728] A targeting construct containing the full-length cDNA of
VISTA preceded by a loxP-flanked STOP cassette, has been targeted
into the ubiquitously expressed ROSA26 locus. Multiple correctly
targeted R26StopFL/-VISTA pups were born, and bred onto the CMV-Cre
deleter strain60. Preliminary data in the VISTA.times.CMV-cre
confirm GFP and heightened VISTA expression. Studies on the immune
status of these mice (T cell responses to antigen, antibody titers)
will confirm a suppressed phenotype. The VISTA strain are interbred
with CD4-cre, CD11c-cre, and Lys-Cre to determine if the lineage
location of VISTA expression influences suppression. The phenotype
and function of the T cells is also determined and it is determined
if over-expression of VISTA results in the generation of aTreg. In
these studies Tregs from OVA-immune cre.times.VISTA strain are
adoptively transferred into WT hosts, to see if antigen
immunization in the presence of over-expressed VISTA induces
antigen-specific Tregs. This should verify that VISTA impacts Treg
differentiation.
[0729] In addition, studies are effected in the EAE model whereby
the impact of VISTA proteins .quadrature. on different lineages (by
interbreeding with CD4-, CD11c-, Lys-cre) with respect to disease
development is assessed. Assuming that disease can be suppressed by
lineage restricted overexpression of VISTA mutants or in the
CMV.times.VISTA mutant.quadrature. the temporal control of disease
development is also using Cre-ERT2x VISTA.eta.. Through the
administration of tamoxifen we can induce overexpression of VISTA
prior to, or at disease initiation or at peak disease to determine
if VISTA can impact on the induction and/or effector phases of
immunity. Using BM chimeric mice, temporally-restricted
overexpression of VISTA can be restricted to the hematopoietic
compartment. For an appreciation of controlling the window of time
VISTA is overexpressed, VISTA is genetically turned on, then
serologically turned off with the administration of anti-VISTA
monoclonal antibody. These studies will determine where and when
VISTA has to act to control the development and progression of
autoimmune disease.
Example 21
Effect of Anti-VISTA Antibodies CD40/TLR Agonist Vaccine
[0730] As shown in FIG. 21, experiments were conducted that assayed
the effect of anti-VISTA antibodies on vaccine efficacy. These
results show that anti-VISTA enhances the therapeutic efficacy of a
CD40/TLR vaccine. C57BL/6 mice were challenged with 1.times.105
metastatic B16.F10 melanoma cells s.q. Four days later, mice were
vaccinated with 100 .mu.g of the tumor associated antigen .DELTA.V,
100 .mu.g .alpha.CD40 FGK45 (CD40 agonistic antibody) and 100 .mu.g
S-27609 (TLR7 agonist) with or without anti-VISTA (200
.mu.g.times.3/week). Growth of tumor was monitored by caliper
measurements.
Example 22
Expression Profiling
[0731] To facilitate comparisons with established expression
profiles of Treg cells, standard growth and activation conditions
were employed (McHugh, et al. (2002) supra). Briefly, fresh
isolated Treg cells (.about.96% positive) were inoculated at 106/mL
into complete RPMI medium supplemented with 10% fetal bovine serum
and 100 units IL-2 in a 24-well plate precoated with anti-CD3 with
or without anti-GITR (DTA-1) (Shimizu, et al. (2002) supra). The
cells were cultured at 37.degree. C. for 0 and 12 hours, RNA was
purified and subsequently analyzed using an AFFYMETRIX.RTM. mouse
genome A430 oligonucleotide array.
[0732] By comparing the data from resting or activated CD4+CD25+ T
cell groups, gene expression patterns were found to be similar to
those established in the art (Gavin, et al. (2002) supra; McHugh,
et al. (2002) supra). To identify genes regulated by GITR
signaling, gene expression profiles were compared between the
different cell populations with or without anti-GITR treatment. A
list of known as well as unknown genes were compiled including the
previously uncharacterized VISTA and Treg-sTNF.
Example 23
Molecular Cloning of VISTA, Retrovirus Production and Retroviral
Transduction of Cells
[0733] Full length VISTA was cloned from purified murine CD4+ T
cells. Total RNA was isolated from CD4+ T cells using Qiagen
RNAmini kit. cDNA was generated using Bio-Rad iScript.TM. cDNA
synthesis kit. Full-length VISTA was amplified and cloned into the
ECorI-Xhol site of a retroviral vector pMSCV-IRES-GFP (Zhang &
Ren (1998) Blood 92: 3829-3840) in which the IRES-GFP fragment was
replaced by RFP, thus resulting in a fusion protein of VISTA fused
to the N-terminus of RFP. Helper free retroviruses were generated
in HEK293T cells by transient transfection of the VISTA-RFP
retroviral vector together with an ecotrophic packaging vector
pCL-Eco (IMGENEX Corp.) Retroviral transduction of murine T cell
line EL4 cells, or bone marrow derived DCs were carried out by spin
infection at 2000 rpm at RT for 45 min in the presence of 8
.mu.g/ml polybrene (Sigma).
Example 24
Production of VISTA-Ig Fusion Protein
[0734] The extracellular domain of VISTA (amino acid 32-190) was
amplified and cloned into the SpeI-BamHI sites of the parental
vector CDM7B. Hollenbaugh, et al. (1995) J Immunol Methods 188:
1-7. This vector contains the mutant form of constant and hinge
regions of human IgG1, which has much reduced binding to Fc
receptors. The resulting vector CDM7B-VISTA was co-transfected with
a DHFR expression vector pSV-dhfr (McIvor & Simonsen (1990)
Nucleic Acids Res 18: 7025-7032) into the CHO (dhfr-) cell line
(ATCC #CRL-9096). Stable CHO cell clones that express VISTA-Ig were
selected in medium MEM-alpha without nucleotides (INVITROGEN.RTM.).
Further amplification with 0.5-1 .mu.M methotrexate (SIGMA.RTM.
M9929) yielded clones expressing high levels of soluble VISTA-Ig
fusion protein. The fusion protein was further purified from
culture supernatant using standard protein-G column affinity
chromatography.
Example 25
Generation of VISTA Monoclonal Antibodies
[0735] Armenian hamsters were immunized 4.times. times with EL4
cells over-expressing VISTA-RFP weekly, then boosted with VISTA-Ig
fusion protein emulsified in CFA. Four weeks after the boost,
hamsters were boosted again with soluble VISTA-Ig fusion protein.
Four days after the last boost, hamster spleen cells were harvested
and fused to the myeloma cell line SP2/0-Ag14 (ATCC #CRL-1581)
using standard hybridoma fusion techniques Shulman, et al. (1978)
Nature 276: 269-270. Hybridoma clones that secret VISTA specific
antibodies were selected after limiting dilution and screened by
both ELISA and flow cytometric methods.
Example 26
Inhibitory Activity of VISTA
[0736] The inhibitory activity of PD-L1 was revealed by using
antigen presenting cells over-expressing PD-L1 in vitro with CD4+
and CD8+ T cell antigen receptor transgenic T cells and antigen
stimulation (Carter, et al. (2002) Eur. J. Immunol. 32:634-43).
Similarly, the lentivector disclosed herein, which expresses the
full-length VISTA, is transduced into cell lines expressing class
II major histocompatibility complex (MHC) and class I MHC. The
response of TEa Tg or the 2C transgenic T cells to antigen
presented by empty vector-transduced or VISTA-transduced antigen
presenting cells is determined according to established
methods.
Example 27
Monoclonal Antibody Production
[0737] VISTA was overexpressed in the murine B cell line A20, and
the recombinant cell line was used to immunize Armenian hamsters.
After 5.times. cell immunization, hamsters were boosted with
purified VISTA-Ig fusion protein emulsified in CFA. Four weeks
later, a final boost was provided with soluble VISTA-Ig.
Subsequently, fusions of hamster splenocytes with SP2/0 cells were
performed on day 4. Sixteen different clones were identified that
recognized VISTA-Ig fusion protein by ELISA, as well as stained
VISTA but not PD-L1 overexpressed on the murine T cell line EL4.
Eleven of the clones were successfully subcloned and prepared for
evaluation of their ability to stain endogenous VISTA on cells and
tissues, and to block VISTA functions.
Example 28
VISTA-Ig Conjugates Negatively Regulates T Cell Responses
Materials and Methods
[0738] Mice. C57BL/6 mice, OT-II CD4 transgenic mice, and SJL/J
mice were purchased from the Jackson Laboratory. FoxP3-GFP reporter
mice were as previously described (Fontenot, et al. 2005) and were
provided by A. Rudensky (University of Washington School of
Medicine, Seattle, Wash.). PD-1 KO mice were provided by T. Honjo
(Kyoto University, Kyoto, Japan; Nishimura, et al. 1999, 2001). All
animals were maintained in a pathogen-free facility at Dartmouth
Medical School. All animal protocols were approved by the
Institutional Animal Care and Use Committee of Dartmouth
College.
[0739] Antibodies, cell lines, and reagents. Antibodies .alpha.-CD3
(2C11), .alpha.-CD28 (PV-1), .alpha.-CD4 (GK1.5), .alpha.-CD8
(53-6.7), .alpha.-CD11b (M1/70), .alpha.-F4/80 (BM8), .alpha.-CD11c
(N418), .alpha.-NK1.1 (PK136), .alpha.-Gr1 (RB6-8C5), .alpha.-PD-L1
(MIN5), .alpha.-PD-L2 (TY25), .alpha.-B7-H3 (M3.2D7), and
.alpha.-B7-H4 (188) were purchased from eBioscience. LPS
(Sigma-Aldrich), recombinant mouse IFN-.gamma. (PeproTech), human
IL-2 (PeproTech), and soluble PD-L1-Ig fusion protein (R&D
Systems) were used at the indicated concentrations. CFA and chicken
OVA were purchased from Sigma-Aldrich. The B cell lymphoma cell
line A20 (BALB/c origin) was obtained from the American Type
Culture Collection.
[0740] Molecular cloning of VISTA, retrovirus production, and
retroviral transduction of cells. Full-length VISTA was cloned from
purified mouse CD4.sup.+ T cells. Total RNA was isolated from
CD4.sup.+ T cells using an RNAmini kit (QIAGEN). cDNA was generated
using an iScript cDNA synthesis kit (Bio-Rad Laboratories).
Full-length VISTA was amplified and cloned into the ECORI-XhoI site
of a retroviral vector pMSCV-IRES-GFP (Zhang and Ren, 1998), in
which the IRES-GFP fragment was replaced by RFP, thus resulting in
a fusion protein of VISTA fused to the N terminus of RFP. Helper
free retroviruses were generated in HEK293T cells by transient
transfection of the VISTA-RFP retroviral vector together with an
ecotrophic packaging vector pCL-Eco (Imgenex Corp.). Retroviral
transduction of mouse T cell line EL4 cells or BMDCs was performed
by spin infection at 2,000 rpm at room temperature for 45 min in
the presence of 8 .mu.g/ml polybrene (Sigma-Aldrich).
[0741] Bioinformatics analysis of VISTA. Proteins that are
evolutionarily related to the VISTA Ig-V sequence were identified
by the BLAST algorithm (Altschul, et al. 1990). The most suitable
structural templates from the Protein Data Bank (Berman, et al.
2000) were identified with the mGenTHREADER algorithm (Lobley, et
al. 2009). PD-L1 (Protein Data Bank accession no. 3BIS), one of the
top scoring hits, was selected as the template for comparative
protein structure modeling. The structural model of VISTA was
constructed with the MMM server using the optimal combination of
two alignment methods, MUSCLE and HHalign (Rai and Fiser, 2006;
Rai, et al. 2006). 36 VISTA orthologous proteins were collected
from the ENSEMBL database (Flicek, et al. 2008). Structure and
sequence alignments were calculated with DALI (Holm and Park, 2000)
and Clustalw (Larkin, et al. 2007), respectively, and were
presented using the ESPript 2.2 server (Gouet, et al. 1999). The
BLAST pairwise comparison network was constructed as described
previously (Atkinson, et al. 2009) and analyzed using Cytoscape
(Shannon, et al. 2003).
[0742] Production of VISTA-Ig fusion protein. The extracellular
domain of VISTA (aa 32-190) was amplified and cloned into the
SpeI-BamHI sites of the parental vector CDM7B (Hollenbaugh, et al.
1995). This vector contains the mutant form of constant and hinge
regions of human IgG1, which has much reduced binding to Fc
receptors. The resulting vector CDM7B-VISTA was cotransfected with
a dihydrofolate reductase expression vector pSV-dhfr (McIvor and
Simonsen, 1990) into the Chinese hamster ovary (dhfr.sup.-) cell
line (#CRL-9096; American Type Culture Collection). Stable Chinese
hamster ovary cell clones that express VISTA-Ig were selected in
medium MEM-.alpha. without nucleotides (Invitrogen). Further
amplification with 0.5-1 .mu.M methotrexate (M9929; Sigma-Aldrich)
yielded clones expressing high levels of soluble VISTA-Ig fusion
protein. The fusion protein was further purified from culture
supernatant using standard protein G column affinity
chromatography.
[0743] Generation of VISTA monoclonal antibodies (mAb). Armenian
hamsters were immunized with EL4 cells overexpressing VISTA-RFP and
then boosted with VISTA-Ig fusion protein emulsified in CFA. 4 wk
after the boost, hamsters were boosted again with soluble VISTA-Ig
fusion protein. 4 d after the last boost, hamster spleen cells were
harvested and fused to the myeloma cell line SP2/0-Ag14 (#CRL-1581;
American Type Culture Collection) using standard hybridoma fusion
techniques (Shulman, et al. 1978). Hybridoma clones that secret
VISTA-specific antibodies were selected after limiting dilution and
screened by both ELISA and flow cytometry methods.
[0744] RNA and RT-PCR. Total RNA from various mouse tissue samples
or purified hematopoietic cell types were collected by using
TRIZOL.RTM. (Invitrogen) according to the company's instructions.
cDNAs were prepared by using the iScript cDNA synthesis kit
(Bio-Rad Laboratories). Equal amounts of tissue cDNAs (10 ng) were
used for RT-PCR reactions to amplify full-length VISTA. PCR
products were viewed after running through a 1% agarose gel.
[0745] Flow cytometry and analysis. Flow cytometry analysis was
performed on FACScan using CellQuest software (BD). Data analysis
was performed using FlowJo software (Tree Star, Inc.). To quantify
cell proliferation, the histogram profile of CFSE divisions was
analyzed, and the percentage of proliferative CFSE.sup.low cells
was graphed using Prism 4 (GraphPad Software, Inc.).
[0746] Cell preparation. Total CD4.sup.+ T cells were isolated from
naive mice using a total CD4.sup.+ T cell isolation kit (Miltenyi
Biotec). When indicated, enriched CD4.sup.+ T cells were flow
sorted into naive (CD44.sup.lowCD25.sup.-CD62L.sup.hi) and memory
(CD44.sup.hiCD25.sup.-CD62L.sup.low) populations. For in vitro
proliferation assays, CD4.sup.- T cells were labeled with 5 .mu.M
CFSE (Invitrogen) for 10 min at 37.degree. C. and washed twice
before being stimulated.
[0747] For A20 assay, A20-RFP or A20-PD-XL cells (20,000) were
pretreated with 100 .mu.g/ml mitomycin C (1 h) and then incubated
with CFSE-labeled DO11.10 CD4.sup.+ T cells (100,000) in the
presence of OVA peptide. Control-Ig or 13F3 monoclonal antibody was
added as indicated. Cell proliferation was analyzed at 72 h by CFSE
dilution. For sorting CD11b.sup.hi myeloid APCs, CD11b.sup.+
monocytes were enriched from naive splenocytes using CD11b magnetic
beads (Miltenyi Biotec). Total CD11b.sup.hi myeloid APCs, or
CD11b.sup.hiCD11c.sup.- monocytes and CD11b.sup.hiCD11c.sup.+
myeloid DCs were sorted, irradiated (2,500 rad), and used to
stimulate OT-II transgenic CD4.sup.+ T cells in the presence of OVA
peptide. Control-Ig or 13F3 monoclonal antibody was added as
indicated. Cell proliferation was measured by tritium incorporation
during the last 8 h of a 72-hour assay.
[0748] In vitro plate-bound T cell activation assay. Purified
CD4.sup.+ T cells (100,000 cells per well) were cultured in 96-well
flat-bottom plates in the presence of anti-CD3 (clone 2C11) and
either VISTA-Ig or control-Ig at the indicated concentration
ratios. For example, for a full-range titration, the 96-well plates
were coated with 2.5 .mu.g/ml of .alpha.-CD3 mixed together with
1.25 .mu.g/ml (ratio 2:1), 2.5 .mu.g/ml (ratio 1:1), 5 .mu.g/ml
(ratio 1:2), or 10 .mu.g/ml (ratio 1:4) VISTA-Ig or control-Ig
protein in PBS at 4.degree. C. overnight. Wells were washed three
times with PBS before adding CD4.sup.+ T cells. Replicate cultures
were in complete RPMI 1640 medium supplemented with 10% FBS, 10 mM
Hepes, 50 .mu.M .beta.-ME, and penicillin/streptomycin/L-glutamine.
When indicated, either 100 U/ml human IL-2 (PeproTech) or a
titrated amount of .alpha.-CD28 (clone PV-1; Bio X Cell) was coated
together with .alpha.-CD3 to rescue the inhibitory effects of
VISTA-Ig. Cultures were analyzed on day 3 for CFSE profiles or
according to a time course as indicated.
[0749] Culture of BMDCs, retroviral transduction, and stimulation
of transgenic CD4.sup.+ T cells. BMDCs were generated as described
previously (Lutz, et al. 1999; Son, et al. 2002), with some
modifications. In brief, on day 0, BM cells were isolated from
tibia and femur by flushing with a 27-gauge needle. After red blood
cell lysis, 1-2.times.10.sup.6 BM cells were resuspended in 1 ml
complete RPMI 1640 medium containing 20 ng/ml GM-CSF (PeproTech).
Cells were infected with RFP or VISTA-RFP retrovirus in the
presence of 8 .mu.g/ml Polybrene (Sigma-Aldrich). Infection was
performed by spinning the plate at 2,000 rpm for 45 min at room
temperature. Cells were then cultured for another 2 h before fresh
medium was added. Similar infection procedure was repeated on days
1, 3, and 5. Loosely adherent cells (90% were CD11c.sup.|) were
collected on day 10, and CD11c.sup.|RFP.sup.|-double positive cells
were sorted and used to stimulate OT-II transgenic CD4.sup.+ T
cells. For OT-II T cell proliferation assays, 100,000 CFSE-labeled
OT-II CD4.sup.+ T cells were cultured in 96-well round-bottom
plates with 30,000 sorted RFP.sup.+ or VISTA-RFP.sup.+ BMDCs, with
a titrated amount of synthetic OVA.sub.323-339 peptide (AnaSpec).
Proliferation of OT-II T cells was analyzed at 72 h by examining
CFSE profiles.
[0750] Tumor experiment. Parent MCA105 tumor cells were
retrovirally transduced with VISTA-RFP or RFP control and sorted to
homogeneity based on RFP expression. For tumor vaccination, naive
C57BL/6 mice were immunized with 1,000,000 irradiated MCA105
(10,000 rad) cells that were inoculated subcutaneously into the
left flank. On day 14, vaccinated mice were challenged with live
MCA105 tumor cells that were inoculated subcutaneously into the
right flank. Tumor growth was monitored every 2 d. Mice were
euthanized when tumor size reached 150 mm.sup.2. For T cell
depletion, vaccinated mice were pretreated intraperitoneally (250
.mu.g) with monoclonal antibody specific for CD4.sup.+ T cells
(clone GK1.5) and CD8.sup.+ T cells (clone 53.6.72) 2 d before live
tumor cell challenge, and the treatment was repeated every 3-4 d
until the end of the experiment. Mice were euthanized when tumor
size reached 160 mm.sup.2.
[0751] Passive induction of EAE and characterization of central
nervous system-infiltrating CD4.sup.+ T cells. For passive transfer
EAE, female SJL mice (6 wk old) were immunized subcutaneously with
200 .mu.l of emulsion containing 400 .mu.g Mycobacterium
tuberculosis H37Ra and 100 .mu.g PLP peptide. Draining LN cells
were harvested on day 10 for in vitro stimulation. Red blood cells
were lysed. Single cell suspensions (10,000,000 per microliter)
were cultured in complete IMDM medium with 10% FBS, 50 .mu.M 2-ME,
1 mM glutamine, 1% penicillin/streptavidin, 1 mM nonessential amino
acids, 20 ng/ml IL-23, 10 ng/ml IL-6, 10 ng/ml IL-1.beta., 20
.mu.g/ml anti- IFN-.gamma., and 20 .mu.g/ml PLP peptide. On day 4,
cells were harvested, and live CD4 T cells were purified using CD4
magnetic beads (Miltenyi Biotec). 1,500,000-2,000,000 purified live
CD4 T cells were adoptively transferred into naive SJL mice to
induce EAE. Mice were treated with either nonspecific hamster
control-Ig or 400 .mu.g VISTA-specific monoclonal antibody every 3
days. Disease was scored as the following: 0, no disease; 1, hind
limb weakness or loss of tail tone; 2, flaccid tail and hind limb
paresis; 2.5, one hind limb paralysis; 3, both hind limb paralysis;
4, front limb weakness; 5, moribund. Mice were euthanized at a
score of 4.
Cloning and Sequence and Structural Analysis of VISTA
[0752] Affymetrix.RTM. analysis of activated versus resting mouse
CD25.sup.+ CD4.sup.+ natural T.sub.reg cells (nT.sub.reg cells)
revealed the expression of a gene product (RIKEN cDNA 4632428N05 or
4632428N05Rik) with unknown function but with sequence homology to
the Ig superfamily. A 930-bp gene product was cloned from the mouse
CD4.sup.+ T cell cDNA library, which matched the predicted size and
sequence. Silico sequence and structural analysis predicts a type I
transmembrane protein of 309 aa upon maturation. Its extracellular
domain contains a single extracellular Ig-V domain of 136 aa, which
is linked to a 23-aa stalk region, a 21-residue transmembrane
segment, and a 97-aa cytoplasmic domain (FIG. 23A). The cytoplasmic
tail of 4632428N05Rik does not contain any signaling domains. Based
on the structural feature of the Ig-V domain and its
immune-suppressive function that is shown herein, this molecule was
named VISTA.
[0753] A BLAST (Altschul, et al. 1990) sequence search with the
VISTA Ig-V domain identified PD-L1 of the B7 family as the closest
evolutionarily related protein with a borderline significant
e-value score of 10.sup.-4 and with a sequence identity of 24%.
[0754] A structure-based sequence alignment of VISTA with the B7
family members PD-L1, PD-L2, B7-H3, and B7-H4 highlights several
amino acids that are known to be systematically conserved in all
Ig-V domain proteins and are thought to be important for the
stability of the Ig-V fold (FIG. 23C). Examples include the two
cysteines in the B and the F .beta. strands that form a disulfide
bond between the two .beta. sheets, which is a hallmark feature of
Ig superfamily proteins (FIG. 23C). This multiple sequence
alignment also reveals additional sequence features that are unique
to VISTA.
[0755] Expression experiments of VISTA by RT-PCR analysis and flow
cytometry. RT-PCR analysis was used to determine the messenger RNA
expression pattern of VISTA in mouse tissues (FIG. 3A). VISTA is
mostly expressed on hematopoietic tissues (spleen, thymus, and BM)
or tissues with ample infiltration of leukocytes (i.e., lung). Weak
expression was also detected in nonhematopoietic tissues (i.e.,
heart, kidney, brain, and ovary). Analysis of several hematopoietic
cell types revealed expression of VISTA on peritoneal macrophages,
splenic CD11b.sup.+ monocytes, CD11c.sup.+ DCs, CD4.sup.+ T cells,
and CD8.sup.+ T cells but a lower expression level on B cells (FIG.
3B). This expression pattern is also largely consistent with the
GNF (Genomics Institute of the Novartis Research Foundation) gene
array database (symbol 4632428N05Rik; Su, et al. 2002), as well as
the National Center for Biotechnology Information GEO (Gene
Expression Omnibus) database (Accession No. GDS868).
[0756] To study the protein expression, VISTA-specific hamster
monoclonal antibodies were produced. The specificity is
demonstrated by positive staining on VISTA-overexpressing mouse EL4
T cells but negative staining on PD-L1-overexpressing EL4
cells.
[0757] Using an .alpha.-VISTA monoclonal antibody clone 8D8, VISTA
expression was analyzed on hematopoietic cells by flow cytometry.
Foxp3-GFP knockin reporter mice were used to distinguish CD4.sup.+
nT.sub.reg cells (Fontenot, et al. 2005). In peripheral lymphoid
organs (spleen and LNs), significant expression was seen on all
CD4.sup.+ T cell subsets (see total CD4.sup.+ T cells or
Foxp3.sup.- naive T cells and Foxp3.sup.+ nT.sub.reg cells and
memory CD4.sup.+ T cells), whereas CD8.sup.+ T cells expressed a
markedly lower amount of surface VISTA (FIG. 3C). In thymus, VISTA
expression was negative on CD4.sup.+CD8.sup.+-double positive
thymocytes, low on CD4-single positive cells, and detectable on
CD8-single positive cells. Next, a strong correlation of high VISTA
expression with CD11b marker was seen for both splenic and
peritoneal cells, including both F4/80 macrophages and myeloid
CD11c.sup.+ DCs (FIGS. 3D and 3E). In contrast, B cells and NK
cells were mostly negative for VISTA expression. A small percentage
of Gr-1.sup.+ granulocytes also expressed VISTA (FIG. 3F).
[0758] A differential expression pattern was shown on the same
lineage of cells from different lymphoid organs (FIG. 3G). For
CD4.sup.+ T cells and CD11b.sup.intermediate monocytes, the
expression level followed the pattern of mesenteric
LN>peripheral LN and spleen>peritoneal cavity and blood. This
pattern was less pronounced for CD11b.sup.hi cells. These data
suggest that VISTA expression on certain cell types might be
regulated by cell maturity and/or tissue microenvironment.
[0759] In addition to freshly isolated cells, VISTA expression was
analyzed on splenic CD4.sup.| T cells, CD11b.sup.hi monocytes, and
CD11c.sup.+ DCs upon in vitro culture with and without activation
(FIG. 6). Spleen cells were cultured with medium, with .alpha.-CD3
(for activating T cells), or with IFN-.gamma. and LPS (for
activating monocytes and DCs) for 24 h before expression analysis
of VISTA and other B7 family ligands (e.g., PD-L1, PD-L2, B7-H3,
and B7-H4). This comparison revealed distinctive expression
patterns between these molecules. VISTA expression was quickly lost
on all cell types upon in vitro culture, regardless of the
activation status. In contrast, PD-L1 expression was up-regulated
on activated CD4.sup.+ T cells or on CD11b.sup.hi monocytes and
CD11c.sup.+ DCs after culture in medium alone and further enhanced
upon stimulation. The expression of PD-L2, B7-H3, and B7-H4 was not
prominent under the culture conditions used. The loss of VISTA
expression in vitro is unique when compared with other B7 family
ligands but might reflect nonoptimal culture conditions that fail
to mimic the tissue microenvironment.
[0760] To address how VISTA expression might be regulated in vivo,
CD4 TCR transgenic mice D011.10 were immunized with the cognate
antigen chicken OVA emulsified in CFA. At 24 h after immunization,
cells from the draining LN were analyzed for VISTA expression (FIG.
7A). Immunization with antigen (CFA/OVA) but not the adjuvant alone
drastically increased the CD11b.sup.+ VISTA.sup.+ myeloid cell
population, which contained a mixed population of F4/80.sup.+
macrophages and CD11c.sup.+ DCs. Further comparison with PD-L1 and
PD-L2 revealed that even though PD-L1 had the highest constitutive
expression level, VISTA was the most highly up-regulated during
such an inflammatory immune response (FIG. 7B). Collectively, these
data strongly suggest that the expression of VISTA on myeloid APCs
is tightly regulated by the immune system, which might contribute
to its role in controlling immune responses. In contrast to its
increased expression on APCs, VISTA expression was diminished on
activated DO11.10 CD4.sup.+ T cells at a later time point upon
immunization (i.e., at 48 h but not at 24 h).
[0761] Functional impact of VISTA signaling on CD4.sup.| and
CD8.sup.| T cell responses in vitro. A VISTA Ig fusion protein
(VISTA-Ig) was produced to examine the regulatory roles of VISTA on
CD4.sup.+ T cell responses. VISTA-Ig contained the extracellular
domain of VISTA fused to the human IgG.sub.1 Fc region. When
immobilized on the microplate, VISTA-Ig but not control-Ig
suppressed the proliferation of bulk purified CD4.sup.+ and
CD8.sup.+ T cells in response to .alpha.-CD3 stimulation (FIGS. 9A
and 9B). The VISTA-Ig did not affect the absorption of anti-CD3
antibody to the plastic wells, as determined by ELISA , thus
excluding the possibility of nonspecific inhibitory effects. The
inhibitory effect of PD-L1-Ig and VISTA-Ig was directly compared.
When titrated amounts of Ig fusion proteins were absorbed to the
microplates together with .alpha.-CD3 to stimulate CD4.sup.+ T
cells, VISTA-Ig showed potent inhibitory efficacy similar to the
PD-L1-Ig fusion protein. PD-1 KO CD4.sup.+ T cells were also
suppressed (FIG. 9C), indicating that PD-1 is not the receptor for
VISTA.
[0762] Because bulk purified CD4.sup.+ T cells contain various
subsets, the impact of VISTA-Ig on sorted naive
(CD25.sup.-CD44.sup.lowCD62L.sup.hi) and memory
(CD25.sup.-CD44.sup.hiCD62L.sup.low) CD4.sup.+ T cell subsets was
evaluated. VISTA suppressed the proliferation of both subsets,
albeit with less efficacy on the memory cells.
[0763] To further understand the mechanism of VISTA-mediated
suppression, the expression of early TCR activation markers and
apoptosis were measured after T cell activation. Consistent with
the negative effect on cell proliferation, there was a global
suppression on the expression of the early activation markers CD69,
CD44, and CD62L (FIG. 12A). In contrast, VISTA-Ig did not induce
apoptosis. Less apoptosis (as determined by the percentage of
annexin V.sup.+ 7AAD.sup.- cells) was seen in the presence of
VISTA-Ig than the control-Ig at both early (24 hours) and later (48
hours) stages of TCR activation (FIG. 12B). For example, at 24 h,
of the total ungated population, .about.27% of cells were apoptotic
in the presence of VISTA-Ig, but .about.39% of cells were apoptotic
in the presence of control-Ig. Similarly, of the cells within the
live cell R1 gate, .about.72.6% cells became apoptotic in the
presence of control-Ig, whereas only .about.43.5% cells were
apoptotic in the presence of VISTA-Ig. Similar results were seen at
the 48-h time point. Therefore, it appears that VISTA negatively
regulates CD4.sup.+ T cell responses by suppressing early TCR
activation and arresting cell division but with minimum direct
impact on apoptosis. This mechanism of suppression is similar to
that of B7-H4 (Sica, et al. 2003).
[0764] A two-step assay was developed to determine whether VISTA-Ig
can suppress preactivated CD4 T cells and how persistent its
suppressive effect is. The suppressive effect of VISTA-Ig fusion
protein persisted after its removal at 24 hours after activation
(FIG. 9D, ii). In addition, both naive and preactivated CD4.sup.+ T
cells were suppressed by VISTA-Ig (FIG. 9D, i, iii, and iv).
[0765] Next, the effect of VISTA-Ig on CD4.sup.+ T cell cytokine
production was analyzed. VISTA-Ig suppressed the production of Th1
cytokines IL-2 and IFN-.gamma. from bulk purified CD4.sup.- T cell
culture (FIGS. 13A and 13B). The impact of VISTA was further tested
on separate naive (CD25.sup.- CD44.sup.lowCD62Lhi) and memory
(CD25.sup.-CD44.sup.hiCD62L.sup.low) CD4.sup.+ T cell populations.
Memory CD4.sup.+ T cells were the major source for cytokine
production within the CD4.sup.| T cell compartment, and VISTA
suppressed this production (FIGS. 13C and 13D). IFN-.gamma.
production from CD8.sup.| T cells was also inhibited by VISTA-Ig
(FIG. 13E). This inhibitory effect of VISTA on cytokine production
by CD4.sup.+ and CD8.sup.+ T cells is consistent with the
hypothesis that VISTA is an inhibitory ligand that down-regulates T
cell-mediated immune responses.
[0766] Further experiments were designed to determine the factors
that are able to overcome the inhibitory effect of VISTA. Given
that VISTA suppressed IL-2 production and IL-2 is critical for T
cell survival and proliferation, we hypothesized that IL-2 might
circumvent the inhibitory activity of VISTA. As shown in FIG. 14A,
exogenous IL-2 but not IL-15, IL-7, or IL-23 partially reversed the
suppressive effect of VISTA-Ig on cell proliferation. The
incomplete rescue by high levels of IL-2 indicates that VISTA
signaling targets broader T cell activation pathways than simply
IL-2 production. In contrast, potent co-stimulatory signals
provided by .alpha.-CD28 agonistic antibody completely reversed
VISTA-Ig-mediated suppression (FIG. 14B), whereas intermediate
levels of co-stimulation continued to be suppressed by VISTA
signaling (FIG. 14C). In this regard, VISTA shares this feature
with other suppressive B7 family ligands such as PD-L1 and B7-H4
(Carter, et al. 2002; Sica, et al. 2003).
[0767] In addition to the VISTA-Ig fusion protein, it was necessary
to confirm that VISTA expressed on APCs can suppress
antigen-specific T cell activation during cognate interactions
between APCs and T cells. We have used two independent cell systems
to address this question. First, VISTA-RFP or RFP control protein
was overexpressed via retroviral transduction in a B cell line A20.
The correct cells surface localization of VISTA-RFP fusion protein
was confirmed by fluorescence microscopy. To stimulate T cell
response, A20-VISTA or A20-RFP cells were incubated together with
DO11.10 CD4.sup.+ T cells in the presence of antigenic OVA peptide.
As shown in FIGS. 15A and 15C, A20-VISTA induced less proliferation
of DO11.10 cells than A20-RFP cells. This suppressive effect is
more pronounced at lower peptide concentrations, which is
consistent with the notion that a stronger stimulatory signal would
overcome the suppressive impact of VISTA.
[0768] Second, the inhibitory effect of full-length VISTA on
natural APCs was confirmed, in vitro cultured BM-derived DCs
(BMDCs) did not express high levels of VISTA (FIG. 16). VISTA-RFP
or RFP was expressed in BMDCs by retroviral transduction during the
10-day culture period. Transduced cells were sorted to homogeneity
based on RFP expression. The expression level of VISTA on
transduced DCs was estimated by staining with .alpha.-VISTA
monoclonal antibody and found to be similar to the level on freshly
isolated peritoneal macrophages, thus within the physiological
expression range (FIG. 16). Sorted BMDCs were then used to
stimulate OVA-specific transgenic CD4.sup.+ T cells (OT-II) in the
presence of OVA peptide. The expression of VISTA on BMDCs
suppressed the cognate CD4.sup.+ T cell proliferation (FIG. 15D).
This result is consistent with data (FIG. 5) using VISTA-Ig fusion
protein or VISTA-expressing A20 cells, suggesting that VISTA
expressed on APCs can suppress T cell-mediated immune
responses.
[0769] To validate the impact of VISTA expression in vivo, whether
VISTA overexpression on tumor cells could impair the antitumor
immune response was examined. MCA105 (methylcholanthrene 105)
fibrosarcoma does not express VISTA. Two MCA105 tumor lines were
established by retroviral transduction with either VISTA-RFP or RFP
control virus. Because MCA105 tumor is immunogenic and can be
readily controlled in hosts preimmunized with irradiated MCA105
cells (Mackey, et al. 1997), we examined the effect of tumor VISTA
expression on such protective immunity. As shown in FIG. 24A,
VISTA-expressing MCA105 grew vigorously in vaccinated hosts,
whereas the control tumors failed to thrive. To confirm that there
is no intrinsic difference in tumor growth rate in the absence of T
cell-mediated antitumor immunity, tumors were inoculated in
vaccinated animals in which both CD4.sup.+ and CD8.sup.+ T cells
were depleted using monoclonal antibodies. As shown in FIG. 24B,
upon T cell depletion, both MCA105RFP and MCA105VISTA tumors grew
at an equivalent rate and much more rapidly than non-T-depleted
hosts. Together, these data indicate that VISTA expression on tumor
cells can interfere with the protective antitumor immunity in the
host.
VISTA Blockade by a Specific Monoclonal Antibody Enhanced T Cell
Responses In Vitro and In Vivo.
[0770] A VISTA-specific monoclonal antibody (13F3) was identified
to neutralize VISTA-mediated suppression in the A20-DO11.10 assay
system (FIG. 25A). To further confirm the impact of 13F3 on T cell
responses, CD11b.sup.hi myeloid APCs were purified from naive mice
to stimulate OT-II transgenic CD4.sup.+ T cells in the presence or
absence of 13F3 (FIG. 25B). Consistent with its neutralizing
effect, 13F3 enhanced T cell proliferation stimulated by
CD11b.sup.hi myeloid cells, which were shown to express high levels
of VISTA (FIGS. 3A-G). A similar effect of 13F3 could be seen on
both CD11b.sup.hiCD11c.sup.+ myeloid DCs and
CD11b.sup.hiCD11c.sup.- monocytes (FIGS. 25C-25D).
[0771] Next, the impact of VISTA blockade by monoclonal antibody
was examined in a passive transfer model of EAE, which is a mouse
autoimmune inflammatory disease model for human multiple sclerosis
(Stromnes and Goverman, 2006). Encephalitogenic CD4.sup.+ T cells
were primed in the donor mice by active immunization with
proteolipid protein (PLP) peptide and adoptively transferred into
naive mice. So as to carefully evaluate the ability of
.alpha.-VISTA to exacerbate disease, tittered numbers of activated
encephalitogenic T cells were passively transferred into naive
hosts treated with .alpha.-VISTA or control-Ig, and the development
of EAE was monitored. 13F3 was found to significantly accelerate
disease onset, as well as exacerbate disease severity under the
suboptimal T cell transfer dosage. The 13F3-treated group reached
100% disease incidence by day 14, whereas those mice treated with
control antibody did not reach 100% disease incidence during the
experimental duration. The mean disease score was significantly
higher in the 13F3-treated group than the control group throughout
the disease course. Consistent with the higher disease score,
analysis of the central nervous system at the end of disease course
confirmed significantly more IL-17A-producing CD4.sup.+ T cell
infiltration in the 13F3-treated group.
Discussion
[0772] VISTA is as a novel member of the Ig superfamily network,
which exerts immunosuppressive activities on T cells both in vitro
and in vivo and is an important mediator in controlling the
development of autoimmunity and the immune responses to cancer. The
data presented suggests that (a) VISTA is a new member of the Ig
superfamily that contains an Ig-V domain with distant sequence
similarity to PD-L1, (b) when produced as an Ig fusion protein or
overexpressed on artificial APCs, it inhibits both CD4 and
CD8.sup.+ T cell proliferation and cytokine production, (c) VISTA
expression on myeloid APCs is inhibitory for T cell responses in
vitro, (d) overexpression on tumor cells impairs protective
antitumor immunity in vaccinated mice, and (e) antibody-mediated
VISTA blockade exacerbates the development of a T cell-mediated
autoimmune disease, EAE.
[0773] Bioinformatics analysis of the VISTA Ig-V domain suggests
that the B7-butyrophilin family members PD-L1, PD-L2, and MOG, as
well as the non-B7 family CAR and VCBP3 are the closest
evolutionary relatives of VISTA (FIGS. 1A, 1B and 1C). However,
close examination of primary sequence signatures suggests that all
VISTA orthologues share unique and conserved sequence motifs and
that VISTA possibly represents a structurally and functionally
novel member of the Ig superfamily. Specifically, the presence of
four invariant cysteines that are unique to the VISTA ectodomain
(three in the Ig-V domain and one in the stalk) may contribute to
novel structural features that impact its function. Given their
strict invariance, it is plausible that all four VISTA-specific
cysteines participate in disulfide bonds. This observation suggests
several possibilities, including that the four cysteines (a) form
two intramolecular disulfide bonds, (b) form four intermolecular
disulfide bonds at a dimer interface, and (c) form one
intramolecular and two intermolecular disulfide bonds. Any of these
scenarios would represent a novel disulfide bonding pattern and
would lead to unique tertiary and/or quaternary structures relative
to typical Ig superfamily members. In addition, a global sequence
comparison suggests that VISTA is not a member of any known
functional groups within the Ig superfamily.
[0774] The expression pattern of VISTA further distinguishes VISTA
from other B7 family ligands. This data has contrasted mostly with
PD-L1 and PD-L2 because of the higher sequence homology between
these two ligands and VISTA and their similar inhibitory function
on T cell activation. The steady-state expression of VISTA is
selectively expressed on hematopoietic cells and most highly
expressed on both APCs (macrophages and myeloid DCs) and CD4.sup.+
T lymphocytes. In this context, PD-L1 has broad expression on both
hematopoietic and nonhematopoietic cells, whereas PD-L2 is
restricted on DCs and macrophages (Keir, et al. 2006, 2008).
Although both PD-L1 and PD-L2 are up-regulated on APCs upon in
vitro culture and upon activation (Yamazaki, et al. 2002; Liang, et
al. 2003; Keir, et al. 2008), VISTA expression on myeloid cells and
T cells is lost after short-term in vitro culture, regardless of
whether any stimuli were present (FIG. 6). Such loss might reflect
the necessary role of lymphoid tissue microenvironment to maintain
or regulate VISTA expression in vivo. Consistent with this
hypothesis, even at steady-state, VISTA is differentially expressed
at different tissue sites (i.e., higher at mesenteric LN than
peripheral lymphoid tissues and lowest in blood). We speculate that
such different expression levels might reflect the differential
suppressive function of VISTA at particular tissue sites.
[0775] VISTA expression in vivo is highly regulated during active
immune response. Immunization with adjuvant plus antigen (OVA/CFA)
but not adjuvant alone (CFA) in TCR transgenic mice induced a
population of VISTA.sup.hi myeloid APCs within the draining LN
(FIGS. 7A-B). The need for antigen suggests that VISTA
up-regulation on APCs might be a result of T cell activation.
Compared with VISTA, PD-L1 and PD-L2 were also up-regulated on
myeloid APCs in response to immunization but to a much lesser
degree. We speculate that the induction of VISTA.sup.+ myeloid APCs
constitutes a self-regulatory mechanism to curtail an ongoing
immune response. Consistent with this hypothesis, a neutralizing
VISTAmonoclonal antibody enhanced T cell proliferative response in
vitro when stimulated by VISTA-expressing myeloid APCs (FIGS.
25A-25D.).
[0776] In contrast to the expression pattern on myeloid cells,
VISTA expression is diminished on in vivo activated CD4.sup.+ T
cells. This result suggests that VISTA expression on CD4 T cells in
vivo may be regulated by its activation status and cytokine
microenvironment during an active immune response. Such
down-regulation is unique and has not been seen for other
inhibitory B7 family ligands such as PD-L1, PD-L2, and B7-H4.
Although the functional significance of VISTA expression on
CD4.sup.+ T cells is currently unknown, the possibility of reverse
signaling from T cells to APCs during their cognate interaction are
investigated in future studies.
[0777] The inhibitory ligand function of VISTA was delineated by
using the VISTA-Ig fusion protein, APCs expressing VISTA, and
tumors overexpressing VISTA, as well as the neutralizing monoclonal
antibody both in vitro and in vivo. VISTA-overexpressing tumor
could overcome a potent protective immunity in vaccinated hosts.
The strong enhancing effect of VISTAmonoclonal antibody in the EAE
model further validates the hypothesis that VISTA is an inhibitory
ligand in vivo. Similar approaches have been used to characterize
the functions of other B7 family ligands (Sica, et al. 2003; Keir,
et al. 2008). It is important to note that VISTA exerts its
suppressive function by engaging a different receptor than PD-1
(FIGS. 9A-9D). The fact that blockade of the VISTA pathway
exacerbates EAE confirms that its function is not redundant with
PD-L1 or PD-L2. On the contrary, we speculate that VISTA controls
immune response in a manner that is reflected by its unique
structural features, expression pattern, and dynamics.
Identification of its unknown receptor will further shed light on
the mechanisms of VISTA-mediated suppression.
[0778] In summary, VISTA was identified as a novel
immune-suppressive ligand. Expression of VISTA on APCs suppresses T
cell responses by engaging it's yet to be identified
counter-receptor on T cells during cognate interactions between T
cells and APCs. VISTA blockade enhanced T cell-mediated immunity in
an autoimmune disease model, suggesting its unique and nonredundant
role in controlling autoimmunity when compared with other
inhibitory B7 family ligands such as PD-L1 and PD-L2. Its highly
regulated expression pattern at early stages of immune activation
might also indicate a feedback control pathway to down-regulate T
cell immunity and attenuate inflammatory responses. In this regard,
therapeutic intervention of the VISTA inhibitory pathway represents
a novel approach to modulate T cell-mediated immunity for treating
diseases such as viral infection and cancer.
Example 29
The VISTA Pathway as a Target of Immune Intervention in
Autoimmunity
[0779] The purpose of these studies is to determine if soluble
VISTA-Ig proteins can suppress immune responses in vivo. Studies
using a murine VISTA-mIGg2a in vivo showed that therapeutic
treatment as late as day 14 had a beneficial effect on Clinical
Disease Score in EAE. These ongoing, experiments look very exciting
in that we may have identified a new axis in autoimmune disease
intervention (FIG. 26). With this success we have extended our
studies using murine VISTA on a murine IgG1 or IgG2a backbone to
exploit their cytophilic capacity. The Fc fusion constructs of
VISTA in frame with the IgG1 Fc (both wild-type IgG1 and the
existing non-FcR-binding IgG1) have been produced. Each of these
soluble VISTA molecules was tested to determine if they can
suppress EAE and it is shown that both VISTA-IgG1 and VISTA-IgG2a
suppress the development and progression of EAE (FIG. 27). These
results suggest that a dimeric, cytophilic VISTA will have activity
in vivo. Based on these results it is further anticipated that
other multimeric forms of VISTA will possess similar activity. For
example, VISTA may be tetramerized using site specific
biotinylation and complexing with avidin for multimerization. These
multimers may be used to modulate T cell function in vitro and, in
particular, in the context of EAE and other autoimmune,
inflammatory and allergic disorders. Finally, we believe that the
efforts described in this proposal hold substantial promise for the
development of new therapeutic strategies and are of considerable
benefit to the entire community interested in autoimmunity and T
cell function in general.
Example 30
VISTA-Ig Conjugate Reduces EAE Progression
[0780] Experimental Autoimmune Encephalomyelitis (EAE) is a model
of multiple sclerosis. EAE was induced by immunizing mice with 175
.mu.g MOG/CFA and pertussis toxin (PT) 300 ng (day 0, 2). On day
14, 17, and 20, 150 .mu.g VISTA-IgG 2a (n=8) or 150 ug control
IgG2a (n=8) was administered. The data is shown in FIG. 26 as the
mean.+-.SEM. In another experiment, on day 6, mice were treated
with 3 doses per week of 150 .mu.g control IgG1 (n=3), 150 .mu.g
control IgG2a (n=6), 150 .mu.g mVISTA-IgG1 (n=3), or 150 .mu.g
mVISTA IgG2a (n=6) (two weeks in total). The data is shown in FIG.
27 as the mean.+-.SEM. In another experiment, on day 14, mice were
treated with 3 doses per week of PBS (n=6), 100 .mu.g control IgG2a
(n=6), 300 .mu.g control IgG2a (n=6), 100 .mu.g VISTA-IgG2a (n=6),
or 300 .mu.g mVISTA IgG2a (n=6) (two weeks in total). The data is
shown in FIG. 28 as the mean.+-.SEM. Thus, a VISTA-Ig fusion
protein has a therapeutic effect on an inflammatory condition,
e.g., multiple sclerosis.
Example 31
[0781] Analysis of VISTA Expression in Human Cells and Suppression
by VISTA-Ig
[0782] The expression pattern of VISTA and its suppression by
administration of a VISTA-Ig fusion protein was examined in human
cell samples.
Materials and Methods
[0783] Production of VISTA-Ig fusion protein--A fusion protein was
created consisting of amino acids 16-194 from the extracellular IgV
domain of human VISTA and a form of human IgG1 mutated for low
binding of Fc receptors. The VISTA sequence was cloned into the
SpeI-BamHI sites of the vector CDM7B. Protein was produced by
transient transfection of Freestyle CHO cells using Freestyle
transfection reagent and protein-free Freestyle Expression Media
according to manufacturer instructions (Invitrogen). Supernatant
was harvested after 5 days of growth and purified by protein G
affinity columns. Protein was concentrated using 10K MWCO spin
columns (Amicon).
[0784] Cell Preparation--Human apheresis samples were obtained from
unidentified healthy human donors. For culture experiments, blood
was layered onto Lymphoprep (PAA) and isolated by density-gradient
centrifugation. Interface cells were washed twice in PBS, then once
in MACS buffer before undergoing magnetic bead selection with
Miltenyi CD4 Negative selection kit II, CD8 Negative Selection Kit,
or the CD4 Memory T cell selection kit according to manufacturer
instructions. For effector cell isolation, CD4 T cells were
subsequently depleted of CD27.sup.+ cell types with Miltenyi CD27
positive selection beads.
[0785] Culture--T cells were plated at 2.times.10.sup.5 cells per
well in 96-well flat-bottom plates coated with anti-CD3 (clone
OKT3, BioXCell) and either VISTA-Ig or control-Ig (ZZ, R&D
biosystems). Unless otherwise indicated, anti-CD3 was coated at 2.5
.mu.g/ml mixed together with 10 .mu.g/ml (ratio 1:4) VISTA-Ig or
control-Ig protein in PBS at 4.degree. C. overnight. Wells were
washed twice with complete media before adding cells. When
indicated, a titrated amount of anti-CD28 (Miltenyi Biotech) was
included in the coating mix, or 50 ng/ml of IL-2, IL-4, IL-7 or
IL-15 (Peprotech) was added to the culture media. Cultures were
analyzed on day 2 for early activation markers, and on day 5 for
late activation markers or CFSE profiles.
[0786] Flow Cytometry--For staining following culture, cells were
harvested and transferred into V-bottomed 96-well plates. Cells
were washed and stained in HBSS/5% BCS staining buffer containing
antibodies (CD4, CD8, CD25, CD69, CD45RA; BD biosciences) and
near-infrared fixable live-dead dye (Invitrogen). Cells were washed
and fixed with BD fixation buffer before analysis.
[0787] For staining for VISTA expression, whole blood was washed
and stained with PBA buffer (PBS/0.1% BSA/0.1% sodium azide)
containing antibodies for extracellular markers. Antibodies against
CD4, CD8, CD3, CD45RA, CD56, CD11b, CD11c, CD123, HLA-DR, CD14 and
CD16 were purchased from BD biosciences and anti-VISTA was produced
as described herein. To stain FoxP3 intracellularly, Foxp3
Fixation/Permeabilization Concentrate and Diluent kit from
eBiosciences and anti-FoxP3 antibody from BD biosciences were used.
See FIG. 33D.
[0788] Samples were acquired on a LSRII Fortessa (Becton &
Dickinson, San Jose, Calif., USA) with FACSDiva software v6.1.2
(Becton & Dickinson) and analyzed with FlowJo software (Tree
Star, Inc.). Graphs were created using graphed using Prism 5
(GraphPad Software, Inc.)
Results
[0789] The human VISTA protein--A BLAST of the mouse VISTA sequence
against the human genome identifies chromosome 10 open reading
frame 54 (C10orf54 or platelet receptor Gi24 precursor, GENE ID:
64115) with an e-value of 8e-165 and 77% identity. Common with
mouse VISTA, this protein is predicted to encode a type I
transmembrane protein with a single extracellular IgV domain. Human
VISTA is a 311 amino acid (aa) long, consisting of a 32-aa signal
peptide, a 130-aa extracellular IgV domain, 33-aa stalk region,
20-aa transmembrane domain and a long 96-aa cytoplasmic tail. See
amino acid sequence of SEQ ID NO: 16.
[0790] VISTA expression analysis--The expression of VISTA healthy
human tissues was examined by real-time PCR analysis of a cDNA
tissue panel (Origene) FIG. 29A). Similar to mouse tissues, VISTA
was predominantly expressed in haematopoietic tissues or in tissues
that contain significant numbers of haematopoietic tissues. This is
consistent with importance of VISTA in immune related functions.
Interestingly, expression of VISTA was particularly high in human
placenta, which may be indicative of a functional role for VISTA in
maintenance of tolerance to the allogeneic environment of
pregnancy. This pattern of expression was found to follow a similar
trend to that of VISTA's closest homologue PD-L1 (FIG. 29B).
[0791] Next, VISTA protein expression was examined within the
haematopoietic compartment by flow cytometry. PBMCs were isolated
from peripheral blood and stained with the anti-VISTA monoclonal
antibody GA1. VISTA was highly expressed by the majority of
monocytes, dendritic cells and by approximately 20% of CD4 and CD8
T cells (FIG. 30). VISTA expression was observed within both of the
`patrolling` (CD14.sup.dimCD16.sup.+) and `inflammatory`
(CD14.sup.-CD16.sup.+/-) subsets of blood monocytes, and within
both lymphoid and myeloid subsets of dendritic cell.
[0792] Functional effect of VISTA on T cell function--VISTA has
previously been demonstrated to have a negative impact on mouse T
cell immune responses (Wang, et al. (2011) J. Exp. Med. pages
1-16). Whether VISTA had the same role in the human cell-mediated
immune response was examined. An Ig fusion protein was created,
consisting of the extracellular domain of VISTA and the Fc region
of human IgG containing mutations for reduced Fc receptor binding.
10 .mu.g/ml of VISTA-Ig or control Ig was immobilized on plates
along with 2.5 .mu.g/ml of anti-CD3 (OKT3) and then proliferation
was measured by CFSE dilution. VISTA was found to suppress CFSE
dilution of bulk purified CD4 (FIG. 31A) and CD8 (FIG. 31B) T
cells. The suppression by VISTA is comparable to that induced by
PD-L1-Ig (R&D biosystems). Additionally, VISTA-Ig was effective
at suppression of memory (CD45RO.sup.+, FIG. 31C) and effector
(CD27.sup.-, FIG. 31D) subsets. Comparison of mouse VISTA and human
VISTA on human CD4 T cells demonstrated that VISTA is
cross-reactive across species. Titration of human VISTA-Ig and
human VISTA-Ig over different concentrations of OKT3, showed that
higher concentrations of OKT3 can be overcome by higher
concentrations of VISTA (FIG. 32A and 32B).
[0793] To gain some insight into the mechanism of suppression, the
status of cells was examined following activation in the presence
or absence of VISTA-Ig. During 2 days of culture, upregulation by
anti-CD3 of the early activation markers CD25 and CD69 was blocked
by VISTA-Ig (FIGS. 33A & 33B). Similarly, after 5 days of
culture, the shift from expression of CD45RA to CD45RO, indicative
of antigen-experience was prevented (FIG. 33C). VISTA had no affect
on cell viability. Consistent with a block in proliferation, cells
treated with VISTA-Ig had forward and side-scatter profiles similar
to unstimulated cells rather than blasting cells seen with OKT3
alone. To determine if the suppression induced by VISTA is stable,
cells were cultured on anti-CD3 and VISTA-Ig for two days, and then
moved onto anti-CD3 alone for 3 days. This further stimulation was
unable to rescue suppression as shown in FIG. 34A and 34B.
[0794] Next, the effect of VISTA-Ig on cytokine production was
examined. Cells were stimulated with plate-bound OKT3 for 5 days in
the presence of increasing amounts of VISTA-Ig, and then the
concentration of various cytokines was measured in culture
supernatants by cytometric bead array. Only trace levels of IL-2,
IL-4 or IL-6 were detected (<5 pg/ml) and no differences were
observed. However, VISTA-Ig significantly reduced production of
IL-10, TNFalpha and IFN.quadrature. by CD4 (FIG. 35A) and CD8 (FIG.
35B) T cells, and there was a trend towards a modest decrease in
IL-17 production.
[0795] Factors that were able to overcome the VISTA-induced
suppression of T cells were also examined. Anti-CD28 agonistic
antibody provides potent costimulation to T cells, and so titred
into the cultures to challenge VISTA suppression (FIGS. 36A-36C).
Although lower amounts of anti-CD28 were unable to overcome VISTA,
when anti-CD28 was included at a coating concentration of 1
.mu.g/ml VISTA was unable to block proliferation. Similarly, while
low concentrations of VISTA could be overcome by the addition of
cytokines such as IL-2, IL-7 and IL-15, higher concentrations of
VISTA were still suppressive even with a physiologically high
concentration of cytokine at 50 ng/ml.
Example 32
Effect of VISTA-Ig Conjugate the Proliferation of CD4+ T Cells of
Healthy Subjects and Lupus Subjects in a CFSE CD4+ T Cell
Proliferation Assay
Materials Used In Experimental Protocol
Reagents Required:
[0796] 1. Corning.RTM. 96 Well ElNRIA Clear Flat Bottom with lid
Polystyrene High Bind Microplate, with Lid, Sterile (Product
#3361). [0797] 2. BioXCell, anti-human CD3, catalog number:
BE0001-2, clone: OKT3, Species: Mouse IgG2a [0798] 3. R&D,
Recombinant Human IgG1 Fc (control Ig), CF, Human IgG1, catalog
number: 110-HG-100 [0799] 4. Pan T Cell Isolation kit II, catalog
number: 130-091-156 [0800] 5. Envitrogen, LIVE/DEAD.RTM. Fixable
Violet Dead Cell Stain Kit, for 405 nm excitation, catalog number:
L34955 [0801] 6. Sigma, Histopaque-1077, sterile-filtered, density:
1.077 g/mL, catalog number: 10771-500ML [0802] 7. Cellgro, RPMI
1640, catalog number: 10-040-CV, 10% heat inactivated
FES/Penicillin/Streptomycin/50 uM 2-ME, [0803] 1. Fetal Bovine
Serum: HyClone, catalog number: SH30910 03 [0804] 1. BD Cytofix,
fixation buffer, catalog number: 554655 [0805] 8. Cellgro,
Phosphate Buffered Saline (PBS), 1X, sterile without calcium and
magnesium, catalog number: 21-040-CV [0806] 9. Polysciences,
formaldehyde, catalog number: 04018. [0807] 10.Sigma, the Human Ig,
catalog number: G4386-1G, used at a final concentration in 1.25
mg/ml. [0808] 11. Invitrogen, CellTrace CFSE Cell Proliferation
Kit--For Flow cytometry, catalog number. C34554 [0809] 12. Human
VISTA-Ig (Lot#100912, from Freestyle CHO)
Experimental Protocol
[0810] On Day -1 96-well flat plates are coated with anti-CD3
(clone OKT3 2.5 mg/ml)+control Ig or VISTA Ig (10 mg/ml) in 100 ml
PBS per well. Plates are incubated overnight at 4.degree. C. or for
3 hours at 37.degree. C.
[0811] On Day 0: human CD4+ T cells are isolated according to
Miltenyi Biotec's instructions and the cells are labeled with CFSE.
The cells are seed at 200,000 cells per well in the coated 96-well
plates.
[0812] On day 3-4 the cells are harvested and analyzed by CFSE
labeling using flow cytometry to determine proliferation level of
CD4+ cells. In particular, flow cytometry is conducted using the
flow gating strategy contained in FIG. 37.
[0813] The results of the CFSE proliferation assay are contained in
FIG. 38. It can be seen therefrom that VISTA Ig shows the greatest
suppression on human CD4 T cells at 10 ug/ml with both human
control subject and lupus subject when compared to the control Fc
group.
Example 33
Effect of Different Linkers on the In Vitro Potency of VISTA Ig
Proteins
[0814] Human VISTA protein fused to human IgG1 Fc has shown potent
activity in suppressing anti-CD3 induced T cell responses in vitro.
The majority of this data has been generated using a CDM8 derived
construct. Partial amino acid sequence data for this protein is
given in the sequence below. In the sequence the VISTA protein is
highlighted in green, and human IgG1 in yellow. The unshaded
portion of the sequence preceding the huVISTA sequence is a signal
peptide sequence. The unshaded portion of the sequence intervening
the VISTA and human IgG1 sequence and intervening the asterisked
portion of the sequence is a linker peptide comprising 19 amino
acid residues.
[0815] The in vitro suppressive activity of this polypeptide was
assayed using CFSE labeled human T cells which were cultured for 5
days in the presence of 2.5 ug/ml plate-bound anti-CD3 and either
control Ig or the VISTA-Ig. polypeptide in the sequence below. (SEQ
ID NO.:68). The results of this assay are shown in FIG. 39A.
TABLE-US-00004 Sequence 1: huVISTA-IgG1-CDM8-derived. (SEQ ID NO:
68) MSLLFALFLAASLGPVAA*FKVATPYS LYVCPEGQNV TLTCRLLGPV DKGHDVTFYK
TWYRXSXGEV QTCSERRPIR NLTFQDLHLH HGGHQAANTS HDLAQRHGLE SASDHHGNFS
ITMRNLTLLD SGLYCCLVVE IRHHHSEHRV HGAMELQVQT GKDAPSNCVV YPSSSQESEN
ITAA***DPGGGG GRLVPRGFGT GD***PXPXSSDK THT**CPPCPAP DSRVHRQSSS
SPKTKDTLMI SRXPEVTCVV VDVSQEDPEV KFXWYVDGVE MHRXKTKPRE EXXNXXLXMG
XXLTXXQQDW LNXKDYKFKV SNKKQXNPFE KTXSKSKRQT REPXVYNLPP SRXELTKIQV
SLTXXVKXFX PSDXAVEWES NGQPENXYKX TPPVLDSDGS FFLYSKLTVD KSRWQQGNVF
SCSVMHEALH NHYTQKSLSL SPGKGSAGGS GGLNDIFEAQ KIEWHESRGS L
[0816] A second human VISTA-human IgG1 Fc construct was created
using the pFUSE-hIgGlc3-Fc2 vector from Invivitrogen. Similarly, in
the sequence the VISTA protein is highlighted in green, and human
IgG1 in yellow. The unshaded portion of the sequence preceding the
huVISTA sequence is a signal peptide sequence. The unshaded portion
of the sequence intervening the VISTA and human IgG1 sequence and
further intervening the asterisked portion of the sequence is a
linker peptide comprising 19 amino acid residues. (Also, the
different portions of the sequence are also separated by
asterisks).
[0817] The amino acid sequence for this second VISTA Ig fusion
polypeptide is in Sequence 2 shown below.(SEQ ID NO:69) The in
vitro suppressive activity of this polypeptide was again assayed
using CFSE labeled human T cells which were cultured for 5 days in
the presence of 2.5 ug/ml plate-bound anti-CD3 and either control
Ig or said VISTA-Ig. polypeptide in Sequence 2. The results of this
assay are shown in FIG. 39B. Based on the results in FIG. 39B, it
can be seen that the vitro activity of this protein was much less
than the VISTA Ig polypeptide in SEQ ID NO: 68.
TABLE-US-00005 Sequence 2: huVISTA-IgG1-pFUSE derived. Signal
Sequence (SEQ ID NO: 69)
MYRMQLLSCIALSLALVTNS**FKVATPYSLYVCPEGQNVTLTCRLLGPV
DKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTS
HDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRV
HGAMELQV**QTGKDAPSNCVVYPSSSQDSENITAAA***RSISAMVRSV
E***CPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK
VSNKGLPSSIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV
FSCSVMHEALHNHYTQKSLSLSPGK-
[0818] Based on these disparate results it was conjectured that the
differences in immunosuppressive activity of these 2 VISTA Ig
fusions potentially might be explained by sequence variations in
the Fc regions of the VISTA fusion proteins. Accordingly, the Fc
domains of sequences 1 and 2 (yellow) were sequenced and compared.
This sequence comparison as depicted in the alignment below. Upon
inspection, the inventors noted sequence differences, however noted
no mutations that would provide an explanation for the substantial
differences in immunosuppressive activity of these
polypeptides.
TABLE-US-00006 Alignment of Fc: Score = 313 bits (808), Expect =
2e-109, Method: Compositional matrix adjust. Identities = 158/203
(78%), Positives = 164/203 (81%), Gaps = 0/203 (0%) Query 252
PKTKDTLMISRXPEVTCVVVDVSQEDPEVKFXWYVDGVEMHRXKTKPREEXXNXXLXMGX 311 PK
KDTLMISR PEVTCVVVDVS EDPEVKF WYVDGVE+H KTKPREE N + Sbjct 28
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS 87
Query 312
XLTXXQQDWLNXKDYKFKVSNKKQXNPFEKTXSKSKRQTREPXVYNLPPSRXELTKIQVS 371 LT
QDWLN K+YK KVSNK + EKT SK+K Q REP VY LPPSR E+TK QVS Sbjct 88
VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS 147
Query 372
LTXXVKXFXPSDXAVEWESNGQPENXYKXTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS 431 LT
VK F PSD AVEWESNGQPEN YK TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS Sbjct 148
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS 207
Query 432 CSVMHEALHNHYTQKSLSLSPGK 454 (SEQ ID NO: 70)
CSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 76) Sbjct 208
CSVMHEALHNHYTQKSLSLSPGK 230 (SEQ ID NO: 77)
[0819] It was next conjectured that the difference in activity
might be the result of glycosylation differences or perhaps is
attributable to the effects of the size or nature of the linker
intervening the VISTA and Ig domain of the fusion protein.
Particularly, upon sequencing it was observed that the spacer or
linker intervening the VISTA protein and the Fc domain of sequence
1 comprises 19 amino acids of which a fairly high number comprise
flexible glycine residues. By contrast, the linker intervening the
VISTA polypeptide and the IgG1 polypeptide in Sequence 2 (SEQ ID
NO:73 is only 11 amino acids in length and comprises no glycine
residues.
[0820] Based on this observation, it was conjectured that the
inclusion of a more flexible linker might further improve the
activity of VISTA-Ig. With respect thereto, glycine-serine linkers
are used for linking various domains in antibody engineering field
owing to their flexibility and lack of known immunogenicity risk.
However, in the present instance, it was not known whether such a
linker would significantly affect activity. For example, VISTA
possesses a structure similar to some other proteins that do not
require dimerization for activity.
[0821] Based on this hypothesis, the inventors therefore elected to
compare the immunosuppressive activity of the VISTA Ig fusion
polypeptides in Sequence 1 and Sequence 2 with a third VISTA Ig
sequence comprising another, flexible linker, i.e., a
serine-glycine linker. In particular, the linker chosen was
GTSGSSGSGSGGSGSGGGG (SEQ ID NO:71). This sequence was used as a
linker between human VISTA and the pFUSE-hIgGle3-Fc2 Fc domain to
create the VISTA Ig protein contained in Sequence 3 (SEQ ID
NO:72).
TABLE-US-00007 Sequence: 3 huVISTA-IgG1-pFUSE derived with Ser/ Gly
linker. (SEQ ID NO: 72) SIGNAL PEPTIDE START OF VISTA SEQUENCE
MYRMQLLSCIALSLALVTNS***FKVATPYSLYVCPEGQNVTLTCRLLGP
VDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANT
SHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHR
VHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAA***GTSGSSGSGSG
GSGSGGGG***RSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ
DWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSREEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0822] In Sequence 3, the VISTA protein is again highlighted in
green, and human IgG1 in yellow. The unshaded portion of the
sequence preceding the huVISTA sequence again is a signal peptide
sequence. The portion of the sequence intervening the VISTA and
human IgG1 sequence and further intervening the asterisked portion
of the sequence is a linker peptide comprising 19 amino acid
residue of which are serine or glycine amino acid residues. (Also,
the different portions of the sequence are separated by
asterisks).
[0823] As can be seen from the results in FIG. 39C, the VISTA Ig
polypeptide containing this linker had greater immunosuppressive
activity than the VISTA-Ig protein. Specifically, the VISTA Ig
fusion containing the Ser-Gly linker exhibited about 10% more
immunosuppressive activity than the VISTA Ig fusion in Sequence 1,
and about 9-fold more than Sequence 2 (SEQ ID NO:69) Another
VISTA-Ig sequence constructed by the inventors is set forth below
(SEQ ID NO:73). This sequence was used in the MLR experiement and
other hVISTA-Ig experiments described in this application. The
different portions of the sequence from the N-terminus to the
C-terminus are identified below and further are separated by
asterisks in the sequence. [0824] Red=signal peptide Bold (residues
1-44) [0825] Green=vista (residues 45-206) [0826]
Blue=biotinylation acceptor peptide (residues 465-479) [0827]
Purple=linkers (residues residues 207-225 and 458-464) [0828]
Orange=IgG1 Fc (226-457) [0829] Uuderlined=Fc mutations (residues
230, 244, 245, 247, 340, 366, and 368) (Also, the different
portions of the sequence are also separated by asterisks).
TABLE-US-00008 [0829] Extracellular (SEQ ID NO: 73)
MPMGSLQPLATLYLLGMLVASCLGTSMSLLFALFLAASLGPVAA**FKVATPYSLYVCP
EGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGH
QAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVDIRHHHSEHRVHGA
MELQVQTGKDAPSNCVVYPSSSQESENITAA**DPGGGGGRLVPRGFGTGDP**EPKSS
DKTHTCPPCPAPEFEGAPSVFLFPPKPKDLTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISK
AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**GSAGGSG **
GLNDTFEAQKIEWHE**SRGSL Alignment of human IgG1 with vector Fc Query
20 EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF 79
EPKS DKTHTCPPCPAPE G PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF Sbjct 1
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF 60
Query 80
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKT 139
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP PIEKT Sbjct
61 NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT 120
Query 140
ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP 199
ISKAKGQPREPQVYTLPPSR+E+TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP Sbjct
121 ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
180 Query 200 PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
251 (SEQ ID NO: 74)
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSYMHEALHNHYTQKSLSLSPGK (SEQ ID NO:
78) Sbjct 181 PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
232 (SEQ ID NO: 79)
[0830] These results indicate that the incorporation of a linker of
specific length and/or flexibility may significantly potentiate the
immunosuppressive activity of VISTA-Ig fusion proteins, both
monomeric and multimeric VISTA-Ig fusions.
Example 34
Treatment of Mice with mVISTA-Ig Suppresses Disease in Murine Lupus
Models
[0831] The well-characterized mouse strain NZBW-F1 ("BW," females
only) and NZM2410 (NZM male and female) develop multiple symptoms
of the autoimmune disease lupus similar to those seen in humans
with SLE. These include the development of self-reactive
antibodies, immune complex deposition in glomeruli, proteinuria,
increased pro-inflammatory cytokine production and weight loss.
Ultimately the mice succumb to renal failure at less than 1 year of
age. To determine if mVISTA-Ig could suppress a systemic autoimmune
disease, we treated BW mice prophylactically at 8 weeks and BW and
NZM mice therapeutically at 24 weeks with mVISTA-Ig. Treatment with
VISTA-Ig did not elicit any changes in total leukocyte numbers
indicating that this agent does not overtly deplete T cells (data
not shown). Prophylactic treatment with VISTA-Ig prevented both
weight loss and proteinuria and therapeutic treatment reversed
proteinuria in these mice. Results are contained in FIGS. 40A-40D.
Also, similar results were observed in NZM mice treated at 24 weeks
(data not shown).
[0832] As shown in FIGS. 41A-41D hematoxylin and eosin (H&E)
staining was performed on sections of kidney taken when mice became
ill or at 30 weeks of age from 2 NZBW F1 (BW) and 3 NZM mice
receiving either experimental VISTA-IgG2a or control IgG2a. BW
began treatment at 8 weeks and NZM at 24 weeks of age, long after
disease onset. Sections from all 5 VISTA-IgG2a-treated mice showed
minimal to mild glomerulonephritis, no interstitial disease, and no
glomerular scarring (FIG. 40B). In contrast, sections from all 5
mice receiving control IgG2a had evidence of severe, proliferative
glomerulonephritis, with 3/5 demonstrating significant scarring,
including 1 with end-stage kidney disease with obliteration of all
the glomeruli. (FIGS. 41 C, 41D). Interstitial inflammation was
seen in 2/5 mice as well. (data not shown). Gross assessment of
total IgG dsDNA titers did not indicate any impact of VISTA-Ig
treatment; however, it is now clear that some self-specificities in
this murine model are derived from long-lived plasma cells and some
from short-lived plasma cells. Therefore a more thorough analysis
of the impact of VISTA-Ig on all isotypes of anti-SLE antibodies
and the fine specificities of those antibodies needs to be assessed
prior to concluding what impact VISTA-Ig has on anti-elf antibody
titers. As previously described, late treatment of BW and NZM mice
with anti-CD40L, which has no impact on .quadrature.dsDNA antibody
titers, also can ameliorate disease. As such, anti-CD40L and
VISTA-Ig may instead regulate additional processes such as excess T
cell-mediated inflammation and tissue damage at the level of the
kidney. Importantly, regardless of the mechanism these preliminary
results indicate that VISTA-Ig treatment also works in a
therapeutic manner, with administration beginning at 24 weeks
resulting in decreased levels of proteinuria and reduced glomerular
injury compared to IgG2a control treated animals. Thus, VISTA-Ig
can abrogate ongoing immune-mediated damage in established disease,
an effect obviously more relevant for the treatment of human
SLE.
[0833] As shown in the experiments in FIG. 60A and FIG. 60B, whole
blood was collected from NZBWF1 mice aged 20 weeks treated with
PBS, 150 ug control IgG2a, or mVISTA-IgG2a, administered every
other day. The whole blood was stained with fluorescent conjugated
antibodies to indentify the presence and numbers of (a)
inflammatory monocytes and (b) T cells, and the cell populations
were determined by flow cytometric analysis. The results in the
Figure indicated that the treatment did not alter cellular
frequencies of inflammatory monocytes and T cells.
[0834] As shown in the experiments in FIG. 61, IL-17 levels were
further detected in the blood of 20 week NZBWF1 mice treated with
VISTA-IgG2a. The results show that the expression of the
inflammatory cytokine was reduced by the treatment.
[0835] As shown in the experiments in FIGS. 62 and 63 the cytokine
profile of 24 week old NZBWF1 mice treated with the control IgG2a
or VISTA-IgG2a were also compared. The results indicate that
treatment with VISTA-IgG2a reduced or affected the expression of
cytokines associated with inflammation including IL-2, IL-10.
CXCL1, IL-5, IL-4, IL-12 and Il-1-beta in a manner consistent with
a reduction in the inflammatory responses therein. By contrast, ds
DNA antibody levels were statistically unaffected (results not
shown).
[0836] The results indicate that VISTA-Ig therapeutically
intervenes in SLE without affecting antibody levels or immune
complex deposition, indicating that it intervene through a non-B
cell mechanism. Rather, VISTA-Ig enhances the Treg signature, ansd
reduces T cell cytokines in kidneys indicating a direct impact on T
cell activation. Also, the results reveal that VISTa-Ig
administration profoundly reduces myeloid infiltration in the
kidneys which should result in disease resolution.
[0837] Thus, based on the foregoing, VISTA-Ig fusion protein may be
used as a negative regulator of inflammation or autoimmunity or
allergy. As shown, such polypeptides may significantly reduce the
production of IL-10, TNF.alpha. and IFN.gamma. by CD4+ and CD8+ T
cells. This, in turn, should lead to a therapeutic downregulation
of the immune response and provide relief from autoimmune, allergic
or inflammatory disorders.
Example 35
[0838] Use of VISTA-Ig in the Treatment of Respiratory Disorders
such as Asthma.
[0839] Regulatory T cells and tolerance: CD4 Foxp3-expressing Treg
are the best characterized Treg subset and are indispensible for
maintaining tolerance to both self and foreign antigens. Patients
with Foxp3 mutations can present with allergic symptoms7 and the
suppressive activity of Foxp3+ Treg from asthmatic airways is
impaired6. The Foxp3-induced transcriptional program in T cells
confers an ability to suppress activation of neighboring T cells
and antigen-presenting cells (APC). Foxp3-expressing Treg can also
be induced from naive peripheral CD4+ T cells in the presence of
TGF-.beta. and IL-2 and this is further enhanced by all-trans
retinoic acid (ATRA) 8. Induction of Foxp3+ Treg in the gut from
peripheral CD4 T cells is dependent on production of TGF-.beta. and
retinoic acid9. An important role for IL-10-producing Treg, with a
Foxp3+ or Foxp3-phenotype, has also been established in respiratory
tolerance10,11,12. Novel strategies that expand Treg numbers,
increase their specificity for allergen or restore their
suppressive activity in lung tissue therefore hold great promise as
potential disease-modifying immunotherapies in asthmatics.
[0840] The present inventors have developed a range of murine
models of allergic lung inflammation and tolerance and showed that
the CD4 response after allergic sensitization consists of a mixed
Th2+Th17 responsel3. Both allergic sensitization and tolerance
induction are accompanied by increases in the total Foxp3+ CD4
population in lung tissue but not draining lymph node (FIG. 49).
However expression of GARP, a functionally relevant Treg activation
marker14, was upregulated in both lung and lymph node (FIG. 49).
Intriguingly, Treg in the mucosal tissue proliferated in response
to allergen in tolerant mice but failed to do so when inflammation
was present (FIG. 50). This "paralyzed" state of Treg in inflamed
lung was associated with lowered Helios expression (FIG. 51).
Helios is a transcription factor that binds to the Foxp3 promoter
and may be involved in Treg activity15. In addition, priming of
IL-10 and IFN-.gamma.-producing T cells was demonstrated in
tolerant but not sensitized animals.
[0841] Using a monoclonal antibody for VISTA we have shown that
alveolar macrophages have an unusually high baseline expression of
cell surface VISTA compared to other cell types in the lung,
including lung DCs and interstitial macrophages (FIG. 52). This
suggests that the unique environment within the airway maintains
high VISTA expression on alveolar macrophages, which are known to
be suppressive. Inhalation of allergen in the context of both
tolerance and inflammation further increased the expression of
VISTA on airway macrophages, suggesting that immune provocation
creates an environment that promotes delivery of negative signals
to incoming T cells, which can prevent inflammation. Airway
lymphocytes expressed much lower levels of VISTA than alveolar
macrophages. Lymphocyte VISTA expression was increased during
tolerance and less so during inflammation triggered by allergen
(FIG. 52). However, the expression patterns of VISTA after chronic
allergen provocation, when epithelial function is dysregulated, and
the functional role of VISTA in respiratory tolerance are unknown.
The inventors have demonstrated that VISTA can promote conversion
of naive CD4 T cells to Foxp3+ Treg, indicating an important role
for VISTA in peripheral tolerance mechanisms (FIG. 53).
[0842] Therefore, based on the foregoing, as VISTA is a critical
checkpoint regulator of immunity to inhaled antigenic and microbial
material in the lung, VISTA neutralization should alleviate
allergen sensitization, T cell subset development and pulmonary
inflammation after allergen inhalation.
[0843] Also, VISTA-Ig should modulate the development,
differentiation and activity of regulatory T cells during
respiratory tolerance induction and should affect alveolar
macrophages, lung DC, T cells and regulatory T cells and alleviate
respiratory tolerance.
[0844] In the asthmatic lung it is predominantly the Th2 and Th17
components of immunity that mediate chronic inflammation, while Thl
and Treg responses inhibit allergy and promote tolerance.
Inflammation of the lung is thought to reduce barrier function of
epithelium and promote allergic sensitization to multiple
allergens.
[0845] Asthma Animal Models: Neutralization of VISTA Activity
During Tolerance Induction.
[0846] Our data indicate that VISTA is strongly expressed in the
lung, in particular on alveolar macrophages, which are the first
cells to encounter inhaled material, and is upregulated during
respiratory tolerance and inflammation. To confirm the potential of
VISTA-Ig in treating asthma, C57BL/6 mice are rendered tolerant to
inhaled OVA by intranasal challenge with 4 doses of 50 .mu.g OVA13.
Development of lasting tolerance is confirmed by mucosal
sensitization of the animals after 2 weeks with OVA +TNF-alpha (1
.mu.g) followed by rechallenge with OVA and assessment of
inflammatory cells in the airways and characterization of T cell
subsets by intracellular cytokine analysis.
[0847] To determine the role of VISTA in tolerance induction,
groups of mice (n=6) will then be simultaneously tolerised with OVA
while under treatment with 300 .mu.g anti-VISTA 13F3 neutralizing
antibody (i.p. every other day) or control IgG. Development of
active tolerance and presence of allergen-reactive Foxp3+ Treg,
IL-10 secreting T cells and Helios and GARP expression on Treg are
assessed after anti-VISTA treatment. Development of active
tolerance will then be determined as above. To determine whether
VISTA neutralization can break pre-established tolerance, tolerised
animals are treated with anti-VISTA or control IgG, commencing 2
weeks after tolerisation and accompanied by repeated OVA i.n.
challenge (3 times per week). After 2 weeks airway inflammation,
lung Th1/2/17 CD4 cells, and regulatory T cell responses are
determined. The role of VISTA in control of airway hyperreactivity
is determined by repeated OVA challenge of control or anti-VISTA
treated animals followed by measurement of lung resistance and
compliance after aerosolised methacholine inhalation as previously
described.
[0848] Characterization of Airway Homeostasis in VISTA-/- Mice.
[0849] Numbers of airway and lung macrophage/DC, T cells,
neutrophils, eosinophils and B cells are determined in untreated
C57BL/6-VISTA-/- mice and age-matched control, VISTA+/- littermates
by flow cytometry of BAL cells as routinely performed in our
laboratoryl6. Surface expression of MHC class II, CD80/86, CD40,
inhibitory receptors CD200R and PD-1 as well as VISTA, on the
various airway cell populations are assessed by multi-color flow
cytometry. Resting levels of cytokines in BAL supernatants are
determined by Luminex cytokine bead array. Induced secretion of
cytokines from alveolar macrophages, purified from VISTA-/- and
control BAL, will then be determined 24 hours after stimulation
with LPS (1 .mu.g/ml)+IFN-.quadrature. (50 ng/ml). The barrier
function of respiratory epithelium are determined by intranasal
instillation of OVA-Alexa488 labeled allergen, followed 6 hours
later by lavage, extraction of lung tissue cells and flow cytometry
for uptake of allergen by tissue resident cells. Perturbance of
lung homeostasis by inflammatory events results in increased
allergen uptake across the epithelium.
[0850] 2 models of allergic airway disease are used (i) mucosal
sensitization with OVA.+-.TNF-alpha i.n. as described above
followed by repeated challenge with 50 .mu.g OVA, and (ii) Repeated
treatment with house dust mite (HDM, Allergon, 25 .mu.g i.n., 3
times per week as described17. HDM has inherent adjuvant activity
and is the most prominent sensitization observed in asthmatics in
the UK, so may represent a more clinically relevant model. However,
it is difficult to ascertain the allergen specificity of the
responses induced. Acute allergic airway inflammation are induced
in VISTA-/- and control littermates using both models, and
infiltration of inflammatory cells into the airways and lung T cell
cytokine profiles determined as described. Airway hyperreactivity
are assessed by lung function testing as before. Development of
circulating IgE, IgG1, IgG2a and IgA serum responses are measured
by allergen-specific Ig ELISA, or total IgE ELISA, as routinely
used in our laboratory. BAL fluid IgA levels will also be
determined. Finally we will determine whether VISTA downregulates
airway remodeling, which appears after chronic allergen challenge
of the mice when AHR and inflammation are reduced compared to the
acute phase of the disease. VISTA-/- or control mice are sensitized
as above but i.n. challenges will continue for 5 weeks. Airway
inflammation is determined as before and lung sections analyzed for
airway wall thickening, collagen deposition and smooth muscle cell
hyperplasia by histology.
[0851] Regulatory role of VISTA in defined leukocyte subsets in the
lung.
[0852] We are currently developing new mouse strains in which VISTA
is conditionally deleted in defined lineages of haematopoietic
cells. As part of another study, detailed characterization of the
role for VISTA on different cell types in T cell proliferative
responses, suppressive activity of Treg and differentiation of Th1,
Th2, Th17 and CD8 T cells are underway. Preliminary data indicate
that VISTA expressed on Foxp3+ Treg contributes to their
suppressive activity. VISTAflox/flox mice are crossed with animals
expressing the Cre recombinase under the following lineage-specific
promoters: Lck, CD11c, LyzM and Foxp3, in order to target the
mutation to CD4 and CD8 T cells, DCs, myeloid cells and Foxp3+ Treg
respectively. PCR-screened progeny from the resulting colonies are
tested for any abnormalities in resting airway populations as
determined above in VISTA-/- animals and for defective respiratory
tolerance as before. These groups will then be tested for
respiratory tolerance induction using VISTA-Ig fusions.
[0853] Therapeutic targeting of the VISTA pathway in allergic
airway disease.
[0854] VISTA-Ig fusion protein in soluble form is not suppressive
in vitro but inhibits T cell responses when bound to plastic6.
Because soluble VISTA-Ig lacks the binding domain for FcRs, it does
not bind to APC or exert suppressive effects in vivo. Therefore, in
a separately funded project we are developing non-covalent
oligomers of the VISTA extracellular domain using constructs
expressed in E. coli, refolded and purified from inclusion bodies.
Tetramers, pentamers or heptamers of VISTA are tested for
immunosuppressive activity in T cell proliferation and Treg
differentiation assays. Once these reagents become available, we
will test whether targeting the VISTA pathway for therapeutic
intervention is asthma is feasible. Acute allergic airway
inflammation are induced in C57BL/6 mice as described above and
groups of animals are treated with 5-100 .mu.g of selected VISTA
oligomer (or VISTA-Ig as negative control) i.n. alongside allergen
challenges. Airway inflammation and Treg-mediated tolerogenic
responses are determined. If VISTA oligomers inhibit inflammation
or induce tolerance further studies of airway hyperreactivity and
HDM-induced inflammation are performed. Finally, we will delay
VISTA-oligomer treatment until after the acute phase of the disease
to determine if such therapy can resolve established inflammation.
VISTA oligomers are given alongside allergen challenges until the
chronic phase and airway inflammation and remodeling assessed in
control and VISTA-targeted mice.
Example 36
Effect of VISTA on Signaling Pathways
[0855] Experiments were conducted to assess the effect of VISTA on
TCR-induced ERK and other signaling pathway molecules. These
experiments were conducted as modulation of certain signaling
pathways has application in the treatment of cancers and autoimmune
disease. For example, Imatinib used for the treatment of CML is an
illustrative example of an antibody that is clinically effective
because of its impact on signaling pathways that affect cancer.
[0856] In these experiments 24 well plate were coated with 2.5
ug/well of anti-CD3 antibody (2C11) plus either lOug of control IgG
or VISTA-Ig (1:4 ratio), and the wells incubated overnight at 40 C.
The wells were then stimulated at 37.degree. C. with serum-starved
purified murine CD4+ T cells for various times.
[0857] The cells were the harvested and the impact on TCR signaling
cascade assessed at given timepoints via Western blot for
phosphorylated proteins in the TCR signaling pathways, including
Fyn, Lck, ZAP70, LAT, GRB2, Vav, Ras, P38, JNK, ERK1/2. These
experimwents are depicted schematically in FIG. 54.
[0858] The blot in FIG. 55 shows pErk levels at different
timepoints after CD3 stimulation (without VISTA-Ig or control IgG:
activation time course.). Loading controls are contained in FIG.
56.
[0859] As shown by the data in FIG. 57, VISTA inhibits ERK1/2
activation. By contrast, as shown by the data in FIG. 58, VISTA
does not affect pJNK activation. Particularly, the results of these
experiments indicate that after 10 minutes VISTA selectively
suppressed TCR-induced p-ERK. Therefore, VISTA agonists and
antagonists may be used to modulate p-ERK expression and signaling
pathways.
Example 37
Use of VISTA-Ig in the Suppression of MLR
Materials and Methods Used in MLR Experiments
[0860] Method: A) Human MLR was set up in 96 well U bottom plate
using PBMC from healthy Human blood donors. Plates were coated with
purified human or mouse VISTA-Ig proteins over night at 4.degree.
C.
[0861] Stimulator cells were irradiated with 4000 rads In each well
10 5 "Responder" cells were mixed with 10 5 "Stimulator" cells in
the presence of absence of VISTA-Ig
[0862] Suppression of MLR by Human and Murine VISTA-Ig
Constructs
[0863] The results of human and mouse MLR experiments are
respectively contained in 59A and 59(B). In the experiment labeled
(A) human MLR was set up in 96 well U bottom plats using PMBC's
from healthy human donors as described above. The plates were
coated with purified human or mouse VISTA-Ig proteins over night at
4 degrees C. The stimulator cells were irradiated with 400 rads. In
each well 10 5 "Responder cells" were mixed with 10 5 "stimulator
cells" in the presence or absence of human or mouse VISTA-Ig. Cell
proliferation was measured using 3H-thymidine. In the mouse MLR
experiments shown in FIG. 59B the experiments were performed
substantially the same except using mouse splenocytes.
[0864] In these experiments, the hV-Ig (human VISTA-Ig), mV-Ig
(mouse VISTA-Ig) were added to the MLR at the indicated
concentrations shown in FIGS. 59A and 59B. The sequence for the
human VISTA-Ig construct used in these experiments is further
provided below.
[0865] FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRN
LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVDIRHHH
SEHRVHGAMELQVQTGKDAPSNCVVYPSSSQESENITAADPGGGGGRLVPRGFGTGDPEPKSSD
KTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYT
LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO:75)
[0866] Results
[0867] As shown in FIGS. 59A and 59B both the tested recombinant
human VISTA-Ig and mouse VISTA-Ig fusion proteins substantially
suppressed both human and mouse mixed lymphocyte reactions (MLR's).
The results in the Figure indicate that the tested recombinant
human VISTA-Ig fusion protein is more potent than the recombinant
mouse VISTA-Ig fusion protein in suppressing mouse MLR (Experiments
in B). By contrast, the mouse VISTA-Ig fusion protein is more
potent in suppressing human MLR than the mouse MLR These results
further suggest that VISTA-Ig should be well suited for treating or
preventing allergic responses in subjects in need thereof.
[0868] Having fully described the invention and exemplary
embodiments, the invention is further defined by the claims which
follow.
Sequence CWU 1
1
7914795DNAMus musculus 1gagcattcac tctagcgagc gagcggcgtg tacagccggc
tccctgggct cctggagtcc 60cgcttgctcc aagcgcactc cagcagtctc tttctgctct
tgcccggctc gacggcgaca 120tgggtgtccc cgcggtccca gaggccagca
gcccgcgctg gggaaccctg ctccttgcta 180ttttcctggc tgcatccaga
ggtctggtag cagccttcaa ggtcaccact ccatattctc 240tctatgtgtg
tcccgaggga cagaatgcca ccctcacctg caggattctg ggccccgtgt
300ccaaagggca cgatgtgacc atctacaaga cgtggtacct cagctcacga
ggcgaggtcc 360agatgtgcaa agaacaccgg cccatacgca acttcacatt
gcagcacctt cagcaccacg 420gaagccacct gaaagccaac gccagccatg
accagcccca gaagcatggg ctagagctag 480cttctgacca ccacggtaac
ttctctatca ccctgcgcaa tgtgacccca agggacagcg 540gcctctactg
ctgtctagtg atagaattaa aaaaccacca cccagaacaa cggttctacg
600ggtccatgga gctacaggta caggcaggca aaggctcggg gtccacatgc
atggcgtcta 660atgagcagga cagtgacagc atcacggctg cggccctggc
caccggcgcc tgcatcgtgg 720gaatcctctg cctccccctt atcctgctgc
tggtctataa gcagagacag gtggcctctc 780accgccgtgc ccaggagttg
gtgaggatgg acagcagcaa cacccaagga atcgaaaacc 840caggcttcga
gaccactcca cccttccagg ggatgcctga ggccaagacc aggccgccac
900tgtcctatgt ggcccagcgg caaccttcgg agtcaggacg gtacctgctc
tctgacccca 960gcacacctct gtcgcctcca ggccctgggg acgtcttttt
cccatcccta gatccagtcc 1020ctgactcccc taactctgaa gccatctaaa
ccagctgggg aaccatgaac catggtacct 1080gggtcaggga tatgtgcact
tgatctatgg ctggcccttg gacagtcttt taggcactga 1140ctccagcttc
cttgctcctg ctctgagcct agactctgct tttacaagat gcacagaccc
1200tcccctatct ctttcagacg ctacttgggg ggcagggaga agatgttgga
ttgctcatgg 1260ctgttctcaa gatcttggga tgctgagttc tccctagaga
cttgacttcg acagccacag 1320atgtcagatg acctgcatcc tatgaacgtc
cggcttggca agagcctttc ttcatggaaa 1380ccagtagccc ggaggggatg
aggtaggcac cttgccaccc tcccgggaga gagacacaag 1440atgtgagaga
ctcctgctca ctgtgggggt gtggctggcc tgcttgtttg cctgaggatg
1500ctcctctgtt ggactgactc tatccccctg gattctggag cttggctggc
ctatgtccca 1560ccagaggagc atctcagcag ccttccacca gcaacctgag
ggcctgccag cttcgtggct 1620ctgggctctc attacctgta tggccgtcca
cagagctcag tggccagagg ctttgaaaca 1680ggaagtacat gtcaggttca
ggaaccactg tgagctcatt agtgtcttga gcaatgtgag 1740gcctggacca
gtggacacgg agggagggtg gcgagaggat gatggggatg atgaggggaa
1800cacgctccct tcctgtcctt gtcatccacc actaccacta ttcagtgtgg
agcagtggca 1860aaggtgaccg acctccacaa tgtcctagtg atgctggacc
atttctaagt gtgaaagaga 1920tgctattaaa aacagtatgt ggcaatggct
gccaacagct gagtggactg gaggcactgg 1980ctttaaggcc ctggaggtgc
agggcccggt atggggatag ggatgggagt ttcagtgagg 2040gcctagggat
cactccgctt ctgaccactc ttcttctgag cctcacctca gggtgacctt
2100caggcacaca gaagagcttg cccctggtcc gatactactc ttggctctca
tctccagggt 2160ttggcatgac ctgggcacac agggggagtc ttcagaaagg
attttaaagc atgaaaagaa 2220agggtagttc ttgtgaggta gggatgggca
gctgatgttt gagagtgagg agggatacgg 2280ctgggcagat cactctccag
tctctagagg gaaagtagct ctaagtctgg gagagcagca 2340gcccagtggt
accatatgtc ttcttgcagc ttccactggc tgggctgaac tgggcatggg
2400taggaaagct cctgttctgg gcctgcagcc agggagaacc ccattcattc
cctgaggaca 2460gatgggtggg gagagaagag agagtttcag gccgggaagc
agcaataagc tatctgctgg 2520ggacccagac aagttgtctg atgaggtcca
agatgtggga tgccagttat acctggggct 2580tggggatcct tagaggcttt
gtatcatcat cataggagtg tcggggtggc cagggcatca 2640aagccatgac
ccctgtttta tcctcagggt ccactcttct gcaccatcca ttgctctaga
2700tctatgcagt tactatagac agaatgtgtt gttctgtttg gctttgggga
taatggcctg 2760gcgaactgcc agctgttcag tggcagggct gtgaggccag
tcaaagacta gaacccacag 2820accagctgaa cgatgagtat agcctgtccc
ctgggggagc ctgacctgtc tccagcccta 2880agcttcagac ctcaccactc
agatgacttc taagaatttg cctgtgggga cccctgcatg 2940gctgcagctc
cgtggaaagg agaggaggcc cccagcagaa gaaccactcg cttcctgccc
3000agcttcctcc tgtagggctc taagtctctt cttcttggga ccctgcaagc
aaaggcatgt 3060cagcttggtg gtttcctgtt ttgggtgaag ttttgtgtgg
tccgggttct gtctacatcc 3120atgaacttgg ggtgctacca ccttgctgct
gctgtagaga cagctgcagg atcttagggt 3180ggaaaatgga ggtgccctga
ggtgctagcc cttggggcaa aagatggggt ggcaatgaga 3240cacagtgggg
aactgagttc cccaagagga gggaggagcc ctgtagcctc aagggccata
3300ttgggttcct ggtaccagca aaagcctaga gagcgaagtc tgtattttga
ggaggtaatt 3360gatccttacg gaatccatca gaaatttgga gcgggtgctt
tatctatctc tggagggtct 3420ctacctatct ccgatgaagc tctccctggg
cctgggatgg gagaaaccag gaggaaaggt 3480gtctgataaa gcaggggctt
cttgacaagc caaagggcca ctggtagctg ttgtggaccg 3540agctgaccct
gctgaagtat tgtagtgtgc cttggaccaa cttctcaaaa gagcaacccc
3600ggggctaccc tacttctgcc aggaagaggc ggagaagggg ctgagaggcc
tggaaggggc 3660tagctccttc tttgagaact gctccccgga ggacttggag
gaggcggcta ggctacgggc 3720tgctgagggc cctttgtctt tcctaacctg
ggcactgtta ggatgctccc tcctggaaaa 3780ggctttcctg ggtgtgagct
agagcagtgt ccatgccagc gctgaacctg ccatggtggg 3840agctgaacta
aaaatttctc agggaactaa aataggcaaa agaggaactg ggggaggagg
3900gtgccaggca ggatgggggg aagggagggc agtgcaaaag tctcttgaaa
cacagacagc 3960ccagctgagt gccagtccca gatcacagag aatacggctc
atctggctca tgttctgcat 4020gcttgctgct ttaccctggc actttccttc
tccaccatga gtgcgagtcc tgggagtcct 4080gggagggtga ggattaatgc
cagcttggtg agcagatagc tgacagagtc cttgggtaac 4140tggcttgaac
caggacctca ggattccact ctggggatct agctttgtct gggccagtga
4200agatctctat aatggcatta ttgccagggg ataaacattt cactgggttc
tgatctgttg 4260ggtgtggctt cctggaaaat atggtgagag gaattctgct
aaggatacag ttgataagaa 4320agttctgaga ttgattagta atgcctgcct
tggactcagg aagggaagtg gcagtatgaa 4380tgccatgtct taatcatttt
ggttaaaata tgcttcccaa aagatttcca cgtgtgttct 4440tgtttatttg
acatctgtct ccatatcagt cttgaaagcc tttctgtgtg tatatatatg
4500atgtttgcgt gtatatatgt ttttgtgtgt gcatatggaa gtcagaaatc
actgggtgtc 4560ttcctccatt cctttgcaat gtatgttttt ttttttttta
cgatttattt actatatgaa 4620tgttttgcct gaatacatgc ataggtgtca
cgtacatgcc tgctggaacg cttggaactg 4680gagttacagg tggctatgag
ctacagtgtg agcactggga atcaaacctg ggtcttctgc 4740aagagcaaca
aattaaaagt cagctcttaa ctacttgagc tatttttcca actcc 47952309PRTMus
musculus 2Met Gly Val Pro Ala Val Pro Glu Ala Ser Ser Pro Arg Trp
Gly Thr 1 5 10 15 Leu Leu Leu Ala Ile Phe Leu Ala Ala Ser Arg Gly
Leu Val Ala Ala 20 25 30 Phe Lys Val Thr Thr Pro Tyr Ser Leu Tyr
Val Cys Pro Glu Gly Gln 35 40 45 Asn Ala Thr Leu Thr Cys Arg Ile
Leu Gly Pro Val Ser Lys Gly His 50 55 60 Asp Val Thr Ile Tyr Lys
Thr Trp Tyr Leu Ser Ser Arg Gly Glu Val 65 70 75 80 Gln Met Cys Lys
Glu His Arg Pro Ile Arg Asn Phe Thr Leu Gln His 85 90 95 Leu Gln
His His Gly Ser His Leu Lys Ala Asn Ala Ser His Asp Gln 100 105 110
Pro Gln Lys His Gly Leu Glu Leu Ala Ser Asp His His Gly Asn Phe 115
120 125 Ser Ile Thr Leu Arg Asn Val Thr Pro Arg Asp Ser Gly Leu Tyr
Cys 130 135 140 Cys Leu Val Ile Glu Leu Lys Asn His His Pro Glu Gln
Arg Phe Tyr 145 150 155 160 Gly Ser Met Glu Leu Gln Val Gln Ala Gly
Lys Gly Ser Gly Ser Thr 165 170 175 Cys Met Ala Ser Asn Glu Gln Asp
Ser Asp Ser Ile Thr Ala Ala Ala 180 185 190 Leu Ala Thr Gly Ala Cys
Ile Val Gly Ile Leu Cys Leu Pro Leu Ile 195 200 205 Leu Leu Leu Val
Tyr Lys Gln Arg Gln Val Ala Ser His Arg Arg Ala 210 215 220 Gln Glu
Leu Val Arg Met Asp Ser Ser Asn Thr Gln Gly Ile Glu Asn 225 230 235
240 Pro Gly Phe Glu Thr Thr Pro Pro Phe Gln Gly Met Pro Glu Ala Lys
245 250 255 Thr Arg Pro Pro Leu Ser Tyr Val Ala Gln Arg Gln Pro Ser
Glu Ser 260 265 270 Gly Arg Tyr Leu Leu Ser Asp Pro Ser Thr Pro Leu
Ser Pro Pro Gly 275 280 285 Pro Gly Asp Val Phe Phe Pro Ser Leu Asp
Pro Val Pro Asp Ser Pro 290 295 300 Asn Ser Glu Ala Ile 305
34774DNAhomo sapiens 3gggggcgggt gcctggagca cggcgctggg gccgcccgca
gcgctcactc gctcgcactc 60agtcgcggga ggcttccccg cgccggccgc gtcccgcccg
ctccccggca ccagaagttc 120ctctgcgcgt ccgacggcga catgggcgtc
cccacggccc tggaggccgg cagctggcgc 180tggggatccc tgctcttcgc
tctcttcctg gctgcgtccc taggtccggt ggcagccttc 240aaggtcgcca
cgccgtattc cctgtatgtc tgtcccgagg ggcagaacgt caccctcacc
300tgcaggctct tgggccctgt ggacaaaggg cacgatgtga ccttctacaa
gacgtggtac 360cgcagctcga ggggcgaggt gcagacctgc tcagagcgcc
ggcccatccg caacctcacg 420ttccaggacc ttcacctgca ccatggaggc
caccaggctg ccaacaccag ccacgacctg 480gctcagcgcc acgggctgga
gtcggcctcc gaccaccatg gcaacttctc catcaccatg 540cgcaacctga
ccctgctgga tagcggcctc tactgctgcc tggtggtgga gatcaggcac
600caccactcgg agcacagggt ccatggtgcc atgagctgtc aggtgcagac
aggcaaagat 660gcaccatcca actgtgtggt gtacccatcc tcctcccagg
atagtgaaaa catcacggct 720gcagccctgg ctacgggtgc ctgcatcgta
ggaatcctct gcctccccct catcctgctc 780ctggtctaca agcaaaggca
ggcagcctcc aaccgccgtg cccaggagct ggtgcggatg 840gacagcaaca
ttcaagggat tgaaaacccc ggctttgaag cctcaccacc tgcccagggg
900atacccgagg ccaaagtcag gcaccccctg tcctatgtgg cccagcggca
gccttctgag 960tctgggcggc atctgctttc ggagcccagc acccccctgt
ctcctccagg ccccggagac 1020gtcttcttcc catccctgga ccctgtccct
gactctccaa actttgaggt catctagccc 1080agctggggga cagtgggctg
ttgtggctgg gtctggggca ggtgcatttg agccagggct 1140ggctctgtga
gtggcctcct tggcctcggc cctggttccc tccctcctgc tctgggctca
1200gatactgtga catcccagaa gcccagcccc tcaacccctc tggatgctac
atggggatgc 1260tggacggctc agcccctgtt ccaaggattt tggggtgctg
agattctccc ctagagacct 1320gaaattcacc agctacagat gccaaatgac
ttacatctta agaagtctca gaacgtccag 1380cccttcagca gctctcgttc
tgagacatga gccttgggat gtggcagcat cagtgggaca 1440agatggacac
tgggccaccc tcccaggcac cagacacagg gcacggtgga gagacttctc
1500ccccgtggcc gccttggctc ccccgttttg cccgaggctg ctcttctgtc
agacttcctc 1560tttgtaccac agtggctctg gggccaggcc tgcctgccca
ctggccatcg ccaccttccc 1620cagctgcctc ctaccagcag tttctctgaa
gatctgtcaa caggttaagt caatctgggg 1680cttccactgc ctgcattcca
gtccccagag cttggtggtc ccgaaacggg aagtacatat 1740tggggcatgg
tggcctccgt gagcaaatgg tgtcttgggc aatctgaggc caggacagat
1800gttgccccac ccactggaga tggtgctgag ggaggtgggt ggggccttct
gggaaggtga 1860gtggagaggg gcacctgccc cccgccctcc ccatccccta
ctcccactgc tcagcgcggg 1920ccattgcaag ggtgccacac aatgtcttgt
ccaccctggg acacttctga gtatgaagcg 1980ggatgctatt aaaaactaca
tggggaaaca ggtgcaaacc ctggagatgg attgtaagag 2040ccagtttaaa
tctgcactct gctgctcctc ccccaccccc accttccact ccatacaatc
2100tgggcctggt ggagtcttcg cttcagagcc attcggccag gtgcgggtga
tgttcccatc 2160tcctgcttgt gggcatgccc tggctttgtt tttatacaca
taggcaaggt gagtcctctg 2220tggaattgtg attgaaggat tttaaagcag
gggaggagag tagggggcat ctctgtacac 2280tctgggggta aaacagggaa
ggcagtgcct gagcatgggg acaggtgagg tggggctggg 2340cagaccccct
gtagcgttta gcaggatggg ggccccaggt actgtggaga gcatagtcca
2400gcctgggcat ttgtctccta gcagcctaca ctggctctgc tgagctgggc
ctgggtgctg 2460aaagccagga tttggggcta ggcgggaaga tgttcgccca
attgcttggg gggttggggg 2520gatggaaaag gggagcacct ctaggctgcc
tggcagcagt gagccctggg cctgtggcta 2580cagccaggga accccacctg
gacacatggc cctgcttcta agccccccag ttaggcccaa 2640aggaatggtc
cactgagggc ctcctgctct gcctgggctg ggccaggggc tttgaggaga
2700gggtaaacat aggcccggag atggggctga cacctcgagt ggccagaata
tgcccaaacc 2760ccggcttctc ccttgtccct aggcagaggg gggtcccttc
ttttgttccc tctggtcacc 2820acaatgcttg atgccagctg ccataggaag
agggtgctgg ctggccatgg tggcacacac 2880ctgtcctccc agcactttgc
agggctgagg tggaaggacc gcttaagccc aggtgttcaa 2940ggctgctgtg
agctgtgttc gagccactac actccagcct ggggacggag caaaactttg
3000cctcaaaaca aattttaaaa agaaagaaag aaggaaagag ggtatgtttt
tcacaattca 3060tgggggcctg catggcagga gtggggacag gacacctgct
gttcctggag tcgaaggaca 3120agcccacagc ccagattccg gttctcccaa
ctcaggaaga gcatgccctg ccctctgggg 3180aggctggcct ggccccagcc
ctcagctgct gaccttgagg cagagacaac ttctaagaat 3240ttggctgcca
gaccccaggc ctggctgctg ctgtgtggag agggaggcgg cccgcagcag
3300aacagccacc gcacttcctc ctcagcttcc tctggtgcgg ccctgccctc
tcttctctgg 3360acccttttac aactgaacgc atctgggctt cgtggtttcc
tgttttcagc gaaatttact 3420ctgagctccc agttccatct tcatccatgg
ccacaggccc tgcctacaac gcactaggga 3480cgtccctccc tgctgctgct
ggggaggggc aggctgctgg agccgccctc tgagttgccc 3540gggatggtag
tgcctctgat gccagccctg gtggctgtgg gctggggtgc atgggagagc
3600tgggtgcgag aacatggcgc ctccaggggg cgggaggagc actaggggct
ggggcaggag 3660gctcctggag cgctggattc ctggcacagt ctgaggccct
gagagggaaa tccatgcttt 3720taagaactaa ttcattgtta ggagatcaat
caggaattag gggccatctt acctatctcc 3780tgacattcac agtttaatag
agacttcctg cctttattcc ctcccaggga gaggctgaag 3840gaatggaatt
gaaagcacca tttggagggt tttgctgaca cagcggggac tgctcagcac
3900tccctaaaaa cacaccatgg aggccactgg tgactgctgg tgggcaggct
ggccctgcct 3960gggggagtcc gtggcgatgg gcgctggggt ggaggtgcag
gagccccagg acctgctttt 4020caaaagactt ctgcctgacc agagctccca
ctacatgcag tggcccaggg cagaggggct 4080gatacatggc ctttttcagg
gggtgctcct cgcggggtgg acttgggagt gtgcagtggg 4140acagggggct
gcaggggtcc tgccaccacc gagcaccaac ttggcccctg gggtcctgcc
4200tcatgaatga ggccttcccc agggctggcc tgactgtgct gggggctggg
ttaacgtttt 4260ctcagggaac cacaatgcac gaaagaggaa ctggggttgc
taaccaggat gctgggaaca 4320aaggcctctt gaagcccagc cacagcccag
ctgagcatga ggcccagccc atagacggca 4380caggccacct ggcccattcc
ctgggcattc cctgctttgc attgctgctt ctcttcaccc 4440catggaggct
atgtcaccct aactatcctg gaatgtgttg agagggattc tgaatgatca
4500atatagcttg gtgagacagt gccgagatag atagccatgt ctgccttggg
cacgggagag 4560ggaagtggca gcatgcatgc tgtttcttgg ccttttctgt
tagaatactt ggtgctttcc 4620aacacacttt cacatgtgtt gtaacttgtt
tgatccaccc ccttccctga aaatcctggg 4680aggttttatt gctgccattt
aacacagagg gcaatagagg ttctgaaagg tctgtgtctt 4740gtcaaaacaa
gtaaacggtg gaactacgac taaa 47744311PRTHomo sapiens 4Met Gly Val Pro
Thr Ala Leu Glu Ala Gly Ser Trp Arg Trp Gly Ser 1 5 10 15 Leu Leu
Phe Ala Leu Phe Leu Ala Ala Ser Leu Gly Pro Val Ala Ala 20 25 30
Phe Lys Val Ala Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 35
40 45 Asn Val Thr Leu Thr Cys Arg Leu Leu Gly Pro Val Asp Lys Gly
His 50 55 60 Asp Val Thr Phe Tyr Lys Thr Trp Tyr Arg Ser Ser Arg
Gly Glu Val 65 70 75 80 Gln Thr Cys Ser Glu Arg Arg Pro Ile Arg Asn
Leu Thr Phe Gln Asp 85 90 95 Leu His Leu His His Gly Gly His Gln
Ala Ala Asn Thr Ser His Asp 100 105 110 Leu Ala Gln Arg His Gly Leu
Glu Ser Ala Ser Asp His His Gly Asn 115 120 125 Phe Ser Ile Thr Met
Arg Asn Leu Thr Leu Leu Asp Ser Gly Leu Tyr 130 135 140 Cys Cys Leu
Val Val Glu Ile Arg His His His Ser Glu His Arg Val 145 150 155 160
His Gly Ala Met Glu Leu Gln Val Gln Thr Gly Lys Asp Ala Pro Ser 165
170 175 Asn Cys Val Val Tyr Pro Ser Ser Ser Gln Asp Ser Glu Asn Ile
Thr 180 185 190 Ala Ala Ala Leu Ala Thr Gly Ala Cys Ile Val Gly Ile
Leu Cys Leu 195 200 205 Pro Leu Ile Leu Leu Leu Val Tyr Lys Gln Arg
Gln Ala Ala Ser Asn 210 215 220 Arg Arg Ala Gln Glu Leu Val Arg Met
Asp Ser Asn Ile Gln Gly Ile 225 230 235 240 Glu Asn Pro Gly Phe Glu
Ala Ser Pro Pro Ala Gln Gly Ile Pro Glu 245 250 255 Ala Lys Val Arg
His Pro Leu Ser Tyr Val Ala Gln Arg Gln Pro Ser 260 265 270 Glu Ser
Gly Arg His Leu Leu Ser Glu Pro Ser Thr Pro Leu Ser Pro 275 280 285
Pro Gly Pro Gly Asp Val Phe Phe Pro Ser Leu Asp Pro Val Pro Asp 290
295 300 Ser Pro Asn Phe Glu Val Ile 305 310 530PRTArtificial
SequenceConsensus sequence for PD-L3 5Ile Thr Ala Ala Ala Leu Ala
Thr Gly Ala Cys Ile Val Gly Ile Leu 1 5 10 15 Cys Leu Pro Leu Ile
Leu Leu Leu Val Tyr Lys Gln Arg Gln 20 25 30 61316DNAMus Musculus
6ggagtcctcc ccttggagcc tgggaggcct agggagaaag tagttctctt tcggtggcag
60ggttgctgtc gagggcaccg agcaggagga taggtcgaca gagacgagga gttctggctc
120ctcctgcaga catgcaccag cggctgctgg gctcgtccct gggrctcgcc
cccgcgcggg 180ggctctgaat gcctgccgcc gcccccatga gagcaccggc
ctgggctccc gcccctaagc 240ctctgctcgc ggagactgag ccatgtgggc
ctggggctgg gccgctgcag cgctcctctg 300gctacagact gcaggagccg
gggcccggca ggagctcaag aagtctcggc agctgtttgc 360gcgtgtggat
tcccccaata ttaccacgtc caaccgtgag ggattcccag gctccgtcaa
420gcccccggaa gcctctggac ctgagctctc agatgcccac atgacgtggt
tgaactttgt 480ccgacggcca gatgatgggt cctctagaaa acggtgtcgt
ggccgggaca agaagtcgcg 540aggcctctca ggtctcccag ggcccccagg
acctcctggc cctcctggtc cccctggctc 600ccctggtgtg ggcgttaccc
cagaggcctt actgcaggaa tttcaggaga tactgaaaga 660ggccacagaa
cttcgattcc cagggctacc agacacattg ttaccccagg aacccagcca
720acggctggtg gttgaggcct tctactgccg tttgaaaggc cctgtgctgg
tggacaagaa 780gactctggtg gaactgcaag gattccaagc tcctactact
cagggcgcct tcctgcgggg 840atctggcctg agcctgtcct tgggccgatt
cacagcccca gtctctgcca tcttccagtt 900ttctgccagc ctgcacgtgg
accacagtga actgcagggc agaggccggt tgcgtacccg 960ggatatggtc
cgtgttctca tctgtattga gtccttgtgt catcgtcata cgtccctgga
1020ggctgtatca ggtctggaga gcaacagcag ggtcttcaca
gtgcaggttc aggggctgct 1080gcatctacag tctggacagt atgtctctgt
gttcgtggac aacagttctg gggcagtcct 1140caccatccag aacacttcca
gcttctcggg aatgcttttg ggtacctagc ggagctgaag 1200aaacgattgt
ggattgagga accaacacct tgcttcttag aggagctgaa aaggactact
1260cactcccctt ttaatagttt tcatagcaat aaagaactcc aaacttcttc atcgct
13167308PRTMus musculus 7Met Trp Ala Trp Gly Trp Ala Ala Ala Ala
Leu Leu Trp Leu Gln Thr 1 5 10 15 Ala Gly Ala Gly Ala Arg Gln Glu
Leu Lys Lys Ser Arg Gln Leu Phe 20 25 30 Ala Arg Val Asp Ser Pro
Asn Ile Thr Thr Ser Asn Arg Glu Gly Phe 35 40 45 Pro Gly Ser Val
Lys Pro Pro Glu Ala Ser Gly Pro Glu Leu Ser Asp 50 55 60 Ala His
Met Thr Trp Leu Asn Phe Val Arg Arg Pro Asp Asp Gly Ser 65 70 75 80
Ser Arg Lys Arg Cys Arg Gly Arg Asp Lys Lys Ser Arg Gly Leu Ser 85
90 95 Gly Leu Pro Gly Pro Pro Gly Pro Pro Gly Pro Pro Gly Pro Pro
Gly 100 105 110 Ser Pro Gly Val Gly Val Thr Pro Glu Ala Leu Leu Gln
Glu Phe Gln 115 120 125 Glu Ile Leu Lys Glu Ala Thr Glu Leu Arg Phe
Ser Gly Leu Pro Asp 130 135 140 Thr Leu Leu Pro Gln Glu Pro Ser Gln
Arg Leu Val Val Glu Ala Phe 145 150 155 160 Tyr Cys Arg Leu Lys Gly
Pro Val Leu Val Asp Lys Lys Thr Leu Val 165 170 175 Glu Leu Gln Gly
Phe Gln Ala Pro Thr Thr Gln Gly Ala Phe Leu Arg 180 185 190 Gly Ser
Gly Leu Ser Leu Ser Leu Gly Arg Phe Thr Ala Pro Val Ser 195 200 205
Ala Ile Phe Gln Phe Ser Ala Ser Leu His Val Asp His Ser Glu Leu 210
215 220 Gln Gly Arg Gly Arg Leu Arg Thr Arg Asp Met Val Arg Val Leu
Ile 225 230 235 240 Cys Ile Glu Ser Leu Cys His Arg His Thr Ser Leu
Glu Ala Val Ser 245 250 255 Gly Leu Glu Ser Asn Ser Arg Val Phe Thr
Val Gln Val Gln Gly Leu 260 265 270 Leu His Leu Gln Ser Gly Gln Tyr
Val Ser Val Phe Val Asp Asn Ser 275 280 285 Ser Gly Ala Val Leu Thr
Ile Gln Asn Thr Ser Ser Phe Ser Gly Met 290 295 300 Leu Leu Gly Thr
305 81055DNAhomo sapiens 8ctcgccgcgc tgagccgcct cgggacggag
ccatgcggcg ctgggcctgg gccgcggtcg 60tggtccccct cgggccgcag ctcgtgctcc
tcgggggcgt cggggcccgg cgggaggcac 120agaggacgca gcagcctggc
cagcgcgcag atccccccaa cgccaccgcc agcgcgtcct 180cccgcgaggg
gctgcccgag gcccccaagc catcccaggc ctcaggacct gagttctccg
240acgcccacat gacatggctg aactttgtcc ggcggccgga cgacggcgcc
ttaaggaagc 300ggtgcggaag cagggacaag aagccgcggg atctcttcgg
tcccccagga cctccaggtg 360cagaagtgac cgcggagact ctgcttcacg
agtttcagga gctgctgaaa gaggccacgg 420agcgccggtt ctcagggctt
ctggacccgc tgctgcccca gggggcgggc ctgcggctgg 480tgggcgaggc
ctttcactgc cggctgcagg gtccccgccg ggtggacaag cggacgctgg
540tggagctgca tggtttccag gctcctgctg cccaaggtgc cttcctgcga
ggctccggtc 600tgagcctggc ctcgggtcgg ttcacggccc ccgtgtccgg
catcttccag ttctctgcca 660gtctgcacgt ggaccacagt gagctgcagg
gcaaggcccg gctgcgggcc cgggacgtgg 720tgtgtgttct catctgtatt
gagtccctgt gccagcgcca cacgtgcctg gaggccgtct 780caggcctgga
gagcaacagc agggtcttca cgctacaggt gcaggggctg ctgcagctgc
840aggctggaca gtacgcttct gtgtttgtgg acaatggctc cggggccgtc
ctcaccatcc 900aggcgggctc cagcttctcc gggctgctcc tgggcacgtg
agggcgccca ggggggctgg 960cgaggagctg ccgccggatc ccggggaccc
tcctactgat gcccgtggtc accacaataa 1020agagccctcc accctcaaaa
aaaaaaaaaa aaaaa 10559302PRTHomo sapiens 9Met Arg Arg Trp Ala Trp
Ala Ala Val Val Val Leu Leu Gly Pro Gln 1 5 10 15 Leu Val Leu Leu
Gly Gly Val Gly Ala Arg Arg Glu Ala Gln Arg Thr 20 25 30 Gln Gln
Pro Gly Gln Arg Ala Asp Pro Pro Asn Ala Thr Ala Ser Ala 35 40 45
Ser Ser Arg Glu Gly Leu Pro Glu Ala Pro Lys Pro Ser Gln Ala Ser 50
55 60 Gly Pro Glu Phe Ser Asp Ala His Met Thr Trp Leu Asn Phe Val
Arg 65 70 75 80 Arg Pro Asp Asp Gly Ala Leu Arg Lys Arg Cys Gly Ser
Arg Asp Lys 85 90 95 Lys Pro Arg Asp Leu Phe Gly Pro Pro Gly Pro
Pro Gly Ala Glu Val 100 105 110 Thr Ala Glu Thr Leu Leu His Glu Phe
Gln Glu Leu Leu Lys Glu Ala 115 120 125 Thr Glu Arg Arg Phe Ser Gly
Leu Leu Asp Pro Leu Leu Pro Gln Gly 130 135 140 Ala Gly Leu Arg Leu
Val Gly Glu Ala Phe His Cys Arg Leu Gln Gly 145 150 155 160 Pro Arg
Arg Val Asp Lys Arg Thr Leu Val Glu Leu His Gly Phe Gln 165 170 175
Ala Pro Ala Ala Gln Gly Ala Phe Leu Arg Gly Ser Gly Leu Ser Leu 180
185 190 Ala Ser Gly Arg Phe Thr Ala Pro Val Ser Gly Ile Phe Gln Phe
Ser 195 200 205 Ala Ser Leu His Val Asp His Ser Glu Leu Gln Gly Lys
Ala Arg Leu 210 215 220 Arg Ala Arg Asp Val Val Cys Val Leu Ile Cys
Ile Glu Ser Leu Cys 225 230 235 240 Gln Arg His Thr Cys Leu Glu Ala
Val Ser Gly Leu Glu Ser Asn Ser 245 250 255 Arg Val Phe Thr Leu Gln
Val Gln Gly Leu Leu Gln Leu Gln Ala Gly 260 265 270 Gln Tyr Ala Ser
Val Phe Val Asp Asn Gly Ser Gly Ala Val Leu Thr 275 280 285 Ile Gln
Ala Gly Ser Ser Phe Ser Gly Leu Leu Leu Gly Thr 290 295 300
1017PRTArtificial SequenceConsensus sequence for Treg-sTNF 10Ile
Phe Gln Phe Ser Ala Ser Leu His Val Asp His Ser Glu Leu Gln 1 5 10
15 Gly 11112PRTHomo sapiensMISC_FEATURE(1)..(112)PD1L1 Ig-V
domainMISC_FEATURE(1)..(112)PD1L1 Ig-v domain 11Phe Thr Ile Thr Ala
Pro Lys Asp Leu Tyr Val Val Glu Tyr Gly Ser 1 5 10 15 Asn Val Thr
Met Glu Cys Arg Phe Pro Val Glu Arg Glu Leu Asp Leu 20 25 30 Leu
Ala Leu Val Val Tyr Trp Glu Lys Glu Asp Glu Gln Val Ile Gln 35 40
45 Phe Val Ala Gly Glu Glu Asp Leu Lys Pro Gln His Ser Asn Phe Arg
50 55 60 Gly Arg Ala Ser Leu Pro Lys Asp Gln Leu Leu Lys Gly Asn
Ala Ala 65 70 75 80 Leu Gln Ile Thr Asp Val Lys Leu Gln Asp Ala Gly
Val Tyr Cys Cys 85 90 95 Ile Ile Ser Tyr Gly Gly Ala Asp Tyr Lys
Arg Ile Thr Leu Lys Val 100 105 110 1299PRTHomo
sapiensMISC_FEATURE(1)..(99)PD1L2 Ig-V
domainMISC_FEATURE(1)..(99)PD1L2 Ig-v domain 12Phe Thr Val Thr Ala
Pro Lys Glu Val Tyr Thr Val Asp Val Gly Ser 1 5 10 15 Ser Val Ser
Leu Glu Cys Asp Phe Asp Arg Arg Glu Cys Thr Glu Leu 20 25 30 Glu
Gly Ile Arg Ala Ser Leu Gln Lys Val Glu Asn Asp Thr Ser Leu 35 40
45 Gln Ser Glu Arg Ala Thr Leu Leu Glu Glu Gln Leu Pro Leu Gly Lys
50 55 60 Ala Leu Phe His Ile Pro Ser Val Gln Val Arg Asp Ser Gly
Gln Tyr 65 70 75 80 Arg Cys Leu Val Ile Cys Gly Ala Ala Trp Asp Tyr
Lys Tyr Leu Thr 85 90 95 Val Lys Val 13113PRTHomo
sapiensMISC_FEATURE(1)..(113)B7H4 Ig-V
domainMISC_FEATURE(1)..(113)B7H4 Ig-v domain 13His Phe Ile Thr Val
Thr Thr Phe Thr Ser Ala Gly Asn Ile Gly Glu 1 5 10 15 Asp Gly Thr
Leu Ser Cys Thr Phe Glu Pro Asp Ile Lys Leu Asn Gly 20 25 30 Ile
Val Ile Gln Trp Leu Lys Glu Gly Ile Lys Gly Leu Val His Glu 35 40
45 Phe Lys Glu Gly Lys Asp Asp Leu Ser Gln Gln His Glu Met Phe Arg
50 55 60 Gly Arg Thr Ala Val Phe Ala Asp Gln Val Val Val Gly Asn
Ala Ser 65 70 75 80 Leu Arg Leu Lys Asn Val Gln Leu Thr Asp Ala Gly
Thr Tyr Thr Cys 85 90 95 Tyr Ile Arg Thr Ser Lys Gly Lys Gly Asn
Ala Asn Leu Glu Tyr Lys 100 105 110 Thr 14110PRTHomo
sapiensMISC_FEATURE(1)..(110)B7H3 Ig-V
domainMISC_FEATURE(1)..(110)B7H3 Ig-v domain 14Val Glu Val Gln Val
Ser Glu Asp Pro Val Val Ala Leu Val Asp Thr 1 5 10 15 Asp Ala Thr
Leu Arg Cys Ser Phe Ser Pro Glu Pro Gly Phe Ser Leu 20 25 30 Ala
Gln Leu Asn Leu Ile Trp Gln Leu Thr Asp Thr Lys Gln Leu Val 35 40
45 His Ser Phe Thr Glu Gly Arg Asp Gln Gly Ser Ala Tyr Ser Asn Arg
50 55 60 Thr Ala Leu Phe Pro Asp Leu Leu Val Gln Gly Asn Ala Ser
Leu Arg 65 70 75 80 Leu Gln Arg Val Arg Val Thr Asp Glu Gly Ser Tyr
Thr Cys Phe Val 85 90 95 Ser Ile Gln Asp Phe Asp Ser Ala Ala Val
Ser Leu Gln Val 100 105 110 15136PRTHomo
sapiensMISC_FEATURE(1)..(136)VISTA Ig-v domain 15Phe Lys Val Thr
Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 1 5 10 15 Asn Ala
Thr Leu Thr Cys Arg Ile Leu Gly Pro Val Ser Lys Gly His 20 25 30
Asp Val Thr Ile Tyr Lys Thr Trp Tyr Leu Ser Ser Arg Gly Glu Val 35
40 45 Gln Met Cys Lys Glu His Arg Pro Ile Arg Asn Phe Thr Leu Gln
His 50 55 60 Leu Gln His His Gly Ser His Leu Lys Ala Asn Ala Ser
His Asp Gln 65 70 75 80 Pro Gln Lys His Gly Leu Glu Leu Ala Ser Asp
His His Gly Asn Phe 85 90 95 Ser Leu Thr Leu Arg Asn Val Thr Pro
Arg Asp Ser Gly Leu Tyr Cys 100 105 110 Cys Leu Val Ile Glu Leu Lys
Asn His His Pro Glu Gln Arg Phe Tyr 115 120 125 Gly Ser Met Glu Leu
Gln Val Gln 130 135 16311PRTHomo sapiens 16Met Gly Val Pro Thr Ala
Leu Glu Ala Gly Ser Trp Arg Trp Gly Ser 1 5 10 15 Leu Leu Phe Ala
Leu Phe Leu Ala Ala Ser Leu Gly Pro Val Ala Ala 20 25 30 Phe Lys
Val Ala Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 35 40 45
Asn Val Thr Leu Thr Cys Arg Leu Leu Gly Pro Val Asp Lys Gly His 50
55 60 Asp Val Thr Phe Tyr Lys Thr Trp Tyr Arg Ser Ser Arg Gly Glu
Val 65 70 75 80 Gln Thr Cys Ser Glu Arg Arg Pro Ile Arg Asn Leu Thr
Phe Gln Asp 85 90 95 Leu His Leu His His Gly Gly His Gln Ala Ala
Asn Thr Ser His Asp 100 105 110 Leu Ala Gln Arg His Gly Leu Glu Ser
Ala Ser Asp His His Gly Asn 115 120 125 Phe Ser Ile Thr Met Arg Asn
Leu Thr Leu Leu Asp Ser Gly Leu Tyr 130 135 140 Cys Cys Leu Val Val
Glu Ile Arg His His His Ser Glu His Arg Val 145 150 155 160 His Gly
Ala Met Glu Leu Gln Val Gln Thr Gly Lys Asp Ala Pro Ser 165 170 175
Asn Cys Val Val Tyr Pro Ser Ser Ser Gln Asp Ser Glu Asn Ile Thr 180
185 190 Ala Ala Ala Leu Ala Thr Gly Ala Cys Ile Val Gly Ile Leu Cys
Leu 195 200 205 Pro Leu Ile Leu Leu Leu Val Tyr Lys Gln Arg Gln Ala
Ala Ser Asn 210 215 220 Arg Arg Ala Gln Glu Leu Val Arg Met Asp Ser
Asn Ile Gln Gly Ile 225 230 235 240 Glu Asn Pro Gly Phe Glu Ala Ser
Pro Pro Ala Gln Gly Ile Pro Glu 245 250 255 Ala Lys Val Arg His Pro
Leu Ser Tyr Val Ala Gln Arg Gln Pro Ser 260 265 270 Glu Ser Gly Arg
His Leu Leu Ser Glu Pro Ser Thr Pro Leu Ser Pro 275 280 285 Pro Gly
Pro Gly Asp Val Phe Phe Pro Ser Leu Asp Pro Val Pro Asp 290 295 300
Ser Pro Asn Phe Glu Val Ile 305 310 17309PRTmus
musculusMISC_FEATURE(1)..(309)VISTA orthologue 17Met Gly Val Pro
Ala Val Pro Glu Ala Ser Ser Pro Arg Trp Gly Thr 1 5 10 15 Leu Leu
Leu Ala Ile Phe Leu Ala Ala Ser Arg Gly Leu Val Ala Ala 20 25 30
Phe Lys Val Thr Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 35
40 45 Asn Ala Thr Leu Thr Cys Arg Ile Leu Gly Pro Val Ser Lys Gly
His 50 55 60 Asp Val Thr Ile Tyr Lys Thr Trp Tyr Leu Ser Ser Arg
Gly Glu Val 65 70 75 80 Gln Met Cys Lys Glu His Arg Pro Ile Arg Asn
Phe Thr Leu Gln His 85 90 95 Leu Gln His His Gly Ser His Leu Lys
Ala Asn Ala Ser His Asp Gln 100 105 110 Pro Gln Lys His Gly Leu Glu
Leu Ala Ser Asp His His Gly Asn Phe 115 120 125 Ser Ile Thr Leu Arg
Asn Val Thr Pro Arg Asp Ser Gly Leu Tyr Cys 130 135 140 Cys Leu Val
Ile Glu Leu Lys Asn His His Pro Glu Gln Arg Phe Tyr 145 150 155 160
Gly Ser Met Glu Leu Gln Val Gln Ala Gly Lys Gly Ser Gly Ser Thr 165
170 175 Cys Met Ala Ser Asn Glu Gln Asp Ser Asp Ser Ile Thr Ala Ala
Ala 180 185 190 Leu Ala Thr Gly Ala Cys Ile Val Gly Ile Leu Cys Leu
Pro Leu Ile 195 200 205 Leu Leu Leu Val Tyr Lys Gln Arg Gln Val Ala
Ser His Arg Arg Ala 210 215 220 Gln Glu Leu Val Arg Met Asp Ser Ser
Asn Thr Gln Gly Ile Glu Asn 225 230 235 240 Pro Gly Phe Glu Thr Thr
Pro Pro Phe Gln Gly Met Pro Glu Ala Lys 245 250 255 Thr Arg Pro Pro
Leu Ser Tyr Val Ala Gln Arg Gln Pro Ser Glu Ser 260 265 270 Gly Arg
Tyr Leu Leu Ser Asp Pro Ser Thr Pro Leu Ser Pro Pro Gly 275 280 285
Pro Gly Asp Val Phe Phe Pro Ser Leu Asp Pro Val Pro Asp Ser Pro 290
295 300 Asn Ser Glu Ala Ile 305
18312PRTUnknownMISC_FEATURE(1)..(312)Unknown Kangaroo species VISTA
orthologue 18Met Asn Val Pro Thr Ser Val Leu Glu Ser Gly Gly Arg
Arg Trp Gly 1 5 10 15 Pro Leu Leu Leu Ala Phe Phe Leu Ala Ala Ser
Arg Gly Leu Val Ala 20 25 30 Ala Phe Lys Val Ala Thr Pro Tyr Ser
Leu Tyr Val Cys Pro Glu Gly 35 40 45 Glu Asn Ile Thr Leu Ala Cys
Gln Leu Leu Gly Pro Val Pro Lys Gly 50 55 60 His Asp Val Ser Phe
Tyr Lys Thr Trp Phe Arg Ser Ser Arg Gly Glu 65 70 75 80 Val Gln Val
Cys Ser Glu His Arg Pro Ile Arg Asn Val Thr Leu Gln 85 90 95 Asn
Leu His Pro Tyr His Gly Gly His Gln Ala Ser Asn Thr Ser His 100 105
110 Asn Leu Leu Gln Ser His Gly Leu Glu Thr Ala Ser Asp His His Gly
115 120 125 Asn Phe Ser Ile Thr Met Arg Asn Leu Thr Val Gln Asp Gly
Gly Leu 130 135 140 Tyr Cys Cys Leu Val Val Glu Met Arg His Arg His
Ser Glu His Arg 145 150 155 160 Val His Ala Ala Met Glu Leu Gln Val
Gln Lys Gly Lys Asp Ala Pro 165
170 175 Ser Lys Cys Ile Thr Tyr Pro Ser Ser Pro Glu Glu Ser Asp Asn
Ile 180 185 190 Thr Ala Ala Ala Leu Ala Thr Gly Ala Cys Ile Val Gly
Ile Leu Cys 195 200 205 Leu Pro Leu Ile Leu Leu Leu Val Tyr Lys Gln
Arg Gln Val Ala Ser 210 215 220 His Arg Arg Ala Gln Glu Leu Val Arg
Met Asp Ser Ser Pro Gln Gly 225 230 235 240 Ile Glu Asn Pro Gly Phe
Glu Ala Pro Pro Ser Ser Gln Gly Leu Pro 245 250 255 Glu Ala Lys Val
Arg Pro Pro Leu Ser Tyr Met Ala Gln Arg Gln Pro 260 265 270 Ser Glu
Ser Gly Arg His Leu Leu Ser Glu Pro Asn Thr Pro Leu Ser 275 280 285
Pro Pro Gly Pro Gly Asp Val Phe Phe Pro Ser Leu Asp Pro Val Pro 290
295 300 Asp Ser Pro Asn Ser Glu Phe Asn 305 310
19310PRTUnknownMISC_FEATURE(1)..(310)Unknown Dolphin species VISTA
orthologue 19Met Gly Val Pro Pro Val Pro Glu Ala Gly Ser Trp Arg
Arg Gly Pro 1 5 10 15 Val Leu Leu Ala Phe Phe Leu Ala Ala Ser Arg
Gly Leu Val Ala Ala 20 25 30 Phe Lys Val Ala Thr Pro Tyr Ser Leu
Tyr Val Cys Pro Glu Gly Gln 35 40 45 Asn Val Thr Leu Thr Cys Arg
Leu Leu Gly Pro Leu Ala Lys Gly His 50 55 60 Asp Val Thr Phe Tyr
Lys Thr Trp Tyr Arg Ser Ser Arg Gly Glu Val 65 70 75 80 Gln Ala Cys
Ser Glu Arg Arg Pro Ile Arg Asn Leu Thr Phe Gln Asp 85 90 95 Leu
His Leu His His Gly Gly His Gln Ala Asn Ser Ser Gln Asp Leu 100 105
110 Ala Gln Arg His Gly Leu Glu Ser Ala Ser Asp His His Gly Asn Phe
115 120 125 Thr Ile Thr Met Arg Asn Leu Thr Leu Leu Asp Gly Gly Leu
Tyr Cys 130 135 140 Cys Leu Val Val Glu Ile Arg His Arg His Ser Glu
Gln Arg Leu Tyr 145 150 155 160 Gly Ala Met Glu Leu Gln Val Gln Arg
Gly Glu Glu Ala Pro Ser Lys 165 170 175 Cys Thr Val Tyr Pro Pro Ser
Ser Lys Glu Ser Glu Ser Ile Thr Ala 180 185 190 Ala Ala Leu Ala Thr
Ser Ala Cys Ile Val Gly Ile Leu Cys Leu Pro 195 200 205 Leu Ile Leu
Leu Leu Val Tyr Lys Gln Arg Gln Val Ala Ser Asn Arg 210 215 220 Arg
Ala Gln Glu Leu Val Arg Met Asp Ser Asn Thr Gln Gly Ile Glu 225 230
235 240 Asn Pro Gly Phe Glu Thr Ser Pro Pro Ser His Gly Met Pro Glu
Thr 245 250 255 Lys Pro Arg Gln Pro Leu Thr Tyr Met Ala Arg Arg Gln
Pro Ser Glu 260 265 270 Ser Gly Arg His Leu Leu Ser Glu Pro Asn Thr
Pro Leu Ser Pro Pro 275 280 285 Gly Pro Gly Asp Val Phe Phe Pro Ser
Leu Asp Pro Val Pro Asp Ser 290 295 300 Pro Asn Ser Glu Ala Ile 305
310 20288PRTGallus gallusMISC_FEATURE(1)..(288)Vista orthologue
20Gly Gly Thr Ala Ala Phe Leu Val Thr Val Pro Tyr Thr Leu Cys Ile 1
5 10 15 Cys Pro Glu Gly Gln Asn Val Thr Leu Ser Cys Arg Val Ser Gly
Pro 20 25 30 Pro Ala Asp His His Asp Leu Ile Phe Lys Thr Trp Tyr
Phe Ser Asn 35 40 45 Asn Gly Asp Gln Ser Cys Ser Glu Lys Arg His
Val Arg Asn Leu Thr 50 55 60 Glu Lys Glu Leu Arg His Asp Pro Gly
Arg His His Ser Thr Ala Ala 65 70 75 80 Asn Ser Thr Ala Arg Ser Pro
His Gly Ser Leu Ala Ser His His Gly 85 90 95 Val Glu Phe Val Pro
Asp His His Gly Ala Phe His Ile Val Val Met 100 105 110 Asn Leu Thr
Leu Gln Asp Ser Gly Asn Tyr Cys Cys Tyr Ala Met Glu 115 120 125 Thr
Arg Arg Asp His Gly Lys Ala His Thr Leu His Ile Ala His Gly 130 135
140 Phe Val Glu Leu Gln Ile Gln Arg Gly Arg Gly Ser Leu Gln Asn Cys
145 150 155 160 Thr Phe His Thr Ala Thr Ser Lys Asp Ile Thr Ala Ala
Ala Leu Ala 165 170 175 Thr Gly Ala Cys Ile Val Gly Ile Leu Cys Leu
Pro Leu Ile Leu Leu 180 185 190 Leu Ile Tyr Lys Gln Arg Gln Ala Val
Ser His Arg Arg Ala His Glu 195 200 205 Leu Val Arg Met Glu Ser Ser
Ala Gln Gly Ile Glu Asn Pro Val Phe 210 215 220 Glu Ala Leu Pro Ala
Gly Ser Thr Glu Gln Arg Pro Arg Pro Gln Leu 225 230 235 240 Ser Tyr
Leu Gly Gly Arg Gln Leu Ser Glu Ser Gly Arg His Leu Leu 245 250 255
Ser Glu Pro Asn Thr Pro Leu Ser Pro Pro Ala Pro Gly Glu Cys Phe 260
265 270 Phe Pro Thr Leu Asp Pro Val Pro Asp Ser Pro Asn Ser Leu Lys
Ala 275 280 285 21260PRTXenopusMISC_FEATURE(1)..(260)VISTA
orthologue 21Asp Ala Ile Thr Ala Phe Ser Val Ser Ala Leu Tyr Ser
His Ile Thr 1 5 10 15 Cys Pro Glu Gly Gln Asn Val Asn Leu Thr Cys
Thr Val Ser Gly His 20 25 30 Val Ala Asp Lys His Asp Val Leu Phe
Ser Leu Trp His Phe Ser Lys 35 40 45 Asp Lys Asn Ser Asn Cys Leu
Glu Arg Arg His Ile Gln Asn Thr Thr 50 55 60 Glu Arg Asp His Leu
His Lys Glu His Leu Ser His Ser Met His Asn 65 70 75 80 Gly Ala Phe
Gln Ile Thr Leu Thr Asn Val Ser Gln Gln Asp Ser Gly 85 90 95 Gly
Tyr Cys Cys Tyr Val Ile Glu Ala Ser Lys Lys His His Thr Arg 100 105
110 His Tyr Ser Tyr Ile Glu Phe Gln Val Lys Thr Asp Asp Leu Asn Leu
115 120 125 Tyr Thr Cys Met Phe His Ser Pro Thr Glu Gly Asp Asn Ser
Ser Thr 130 135 140 Ala Ala Ala Leu Ala Ile Val Ser Cys Val Ile Gly
Ile Leu Cys Met 145 150 155 160 Pro Leu Leu Leu Phe Leu Val Tyr Lys
Gln Arg Arg Ala Leu Ser His 165 170 175 Arg Arg Ser Tyr His Phe Val
Phe Ile Asp Phe Ser Glu Ala Gln Gly 180 185 190 Ile Glu Asn Pro Val
Phe Asp Asp Pro Pro Pro Ala Asn Val Val Glu 195 200 205 Gln Arg Pro
Arg Leu Ala Phe Met Ala Ser Arg Gln Gln Ser Glu Ser 210 215 220 Asp
Arg His Leu Leu Ser Glu Pro Asn Thr Pro Leu Ser Pro Ser Cys 225 230
235 240 Pro Asn Glu Cys Phe Phe Pro Ser Leu Pro Val Pro Asp Ser Pro
Asp 245 250 255 Pro Gly Asn Val 260 22315PRTTaeniopygia
guttataMISC_FEATURE(1)..(315)VISTA orthologue 22Gly His Pro Ala Thr
Met Gly Thr Ala Ser Pro Arg Pro Gly Leu Leu 1 5 10 15 Leu Ala Ala
Leu Cys Leu Leu Ala Ser His Gly Gly Ala Asp Ala Phe 20 25 30 Leu
Ile Ser Thr Pro Tyr Ser Leu Cys Val Cys Pro Glu Gly Gln Asn 35 40
45 Val Thr Leu Ser Cys Arg Ile Ser Gly Ala Leu Ala Glu Arg His Asp
50 55 60 Leu Leu Tyr Lys Thr Trp Tyr Phe Ser Ser Thr Gly Asp Gln
Ser Cys 65 70 75 80 Ser Asp Lys Arg His Ile Arg Asn Val Thr Asp Lys
Glu Leu Arg His 85 90 95 Asp Leu Gly Arg His His Glu Leu Pro Gly
Asn Ala Ser Gln Lys Pro 100 105 110 Pro Phe Gly Trp Gln Ser Gly His
His Gly Val Glu Leu Val Leu Asp 115 120 125 His His Gly Ala Phe His
Leu Val Val Met Asn Leu Thr Leu Gln Asp 130 135 140 Ser Gly Asn Tyr
Cys Cys Tyr Ala Val Glu Val Arg Arg Glu Gly His 145 150 155 160 Ser
Lys Pro His Thr Val Gln Ala Ala His Gly Phe Val Glu Leu Gln 165 170
175 Ile Gln Arg Gly Glu Pro Cys Ser His Ala Arg Ala Gln Ser Gln Arg
180 185 190 Ala Ala Asp Asp Ile Thr Ala Ala Val Leu Ala Thr Gly Ala
Cys Ile 195 200 205 Val Gly Ile Leu Cys Leu Pro Leu Ile Leu Leu Leu
Ile Tyr Lys Gln 210 215 220 Arg Gln Ala Ala Ser Ser Arg Arg Ala His
Glu Leu Val Arg Met Asp 225 230 235 240 Ser Gly Ala Gln Gly Ile Glu
Asn Pro Val Phe Glu Ala Val Pro Ser 245 250 255 Ala Gly Ala Glu Pro
Arg Pro Arg Ala Gln Leu Ser Tyr Val Ala Ser 260 265 270 Arg Leu Pro
Ser Glu Ser Gly Arg His Leu Leu Ser Glu Pro Ser Thr 275 280 285 Pro
Leu Ser Pro Pro Gly Pro Gly Asp Cys Phe Phe Pro Thr Leu Asp 290 295
300 Pro Val Pro Asp Ser Pro Asn Ser Leu Lys Ala 305 310 315
23274PRTDanio rerioMISC_FEATURE(1)..(274)VISTA orthologue 23Met Asp
Val Phe Arg Ala Val Leu Leu Cys Phe His Val Phe Thr Ala 1 5 10 15
Ile Gln Ala Ser Gly Asp His His Ser Leu Arg Val Ser Val Pro His 20
25 30 Arg Thr Tyr Glu Cys Pro Glu Gly Ala Asp Val Ile Leu Lys Cys
Val 35 40 45 Pro Ser Gly Thr Lys Ala Tyr Pro Gln Asp Thr Phe Trp
Thr Thr Trp 50 55 60 Leu Tyr Thr Pro Arg Ser Gln Asp His Cys Gln
Lys Gly Ala His Pro 65 70 75 80 Arg Lys Ala Asn His Thr Asn Arg Ser
Leu Gly Val Val Tyr Ser Ser 85 90 95 Gly Asp Lys Val Phe Ser Val
Ser Leu Lys Asn Val Lys His Thr Asp 100 105 110 Gln Gly Lys Tyr Cys
Cys Trp Leu Leu Asp Leu His Gly Arg His Lys 115 120 125 Glu Gln Glu
Ala His Asp Phe Met Tyr Leu Ser Val Met Pro Thr Pro 130 135 140 Lys
Asp Ala His Asn Gly Ser Leu Lys Cys Leu Glu Tyr Ser His Thr 145 150
155 160 Ala Ser Asp Asp Val Ala Glu Gly Leu Ala Ile Ala Ala Cys Val
Ala 165 170 175 Phe Val Leu Cys Leu Pro Leu Ile Leu Met Leu Val Tyr
Arg Gln Arg 180 185 190 Gln Thr Val Glu Arg His Arg Arg Ala His Glu
Leu Val Arg Met Asp 195 200 205 Ser Glu Ala Gln Gly His Glu Asn Pro
Val Phe Leu Gly Asp Ser Pro 210 215 220 Glu Pro Lys Met Arg Thr Val
Ser Gln Ile Met Met Arg Gln Pro Ser 225 230 235 240 Glu Thr Gly His
His Leu Leu Ser Glu Pro Gly Thr Pro Phe Ser Pro 245 250 255 Asn Ile
Gln Gly Glu Leu Phe Phe Ser Ala Gln Gly Leu Pro Glu Ser 260 265 270
Asn Ile 24293PRTUnknownMISC_FEATURE(1)..(293)Unknown Fugu species
VISTA orthologue 24Leu Glu Lys Phe Thr Ser Ala His His Thr Lys Gln
Thr Leu Glu Lys 1 5 10 15 Gly Leu Asn Leu Leu Cys Leu Thr Lys Ser
Asn Ala His His Gly His 20 25 30 Pro Ala Met Ser Val Ser Ala Ser
His Leu Tyr Tyr Thr Cys Pro Glu 35 40 45 Gly Ala Asn Ala Thr Leu
Val Cys Asn Gln Arg Gly Gly Ala Leu His 50 55 60 Pro Asn Asp Ser
Leu Trp Arg Leu Trp Phe Phe Thr Pro His Lys Asp 65 70 75 80 Gln His
Cys Thr Lys His Gly Pro Arg Asn Val Thr Phe Lys His Ser 85 90 95
Lys Leu Ser Ser Gly Leu His Phe Gly Ala Thr Gln Glu Asn Phe Trp 100
105 110 Val Gln Leu Gln Asn Val Thr His Ala Asp Gln Gly Arg Tyr Cys
Cys 115 120 125 Ala Ala Leu Glu Ile Glu Ser Ile His His Glu Ala Val
Gln Arg Thr 130 135 140 His Ser His Met Phe Leu Asn Ile Ile Pro Arg
Gly Thr Gly Ser Pro 145 150 155 160 Asn Cys Thr Val Ser Ala Pro Ser
Ala Pro Glu Gly Asn Ala Thr Leu 165 170 175 Cys Thr Val Pro Val Ala
Leu Ala Met Gly Ala Cys Ile Leu Ala Leu 180 185 190 Leu Ser Leu Pro
Leu Ile Leu Leu Leu Val Tyr Arg Gln Arg Gln Ser 195 200 205 Ala Gln
Ser Arg Arg Arg Ala Gln Glu Leu Val Arg Met Asp Ser Glu 210 215 220
Ala His Gly His Glu Asn Pro Val Phe Leu Gly Gly Ser Pro Gln Ile 225
230 235 240 Lys Asn Arg Thr Val Ser Gln Ile Met Ala Arg Gln Ser Ser
Glu Thr 245 250 255 Gly Arg His Leu Leu Ser Glu Pro Gly Thr Pro Leu
Ser Pro Pro Ala 260 265 270 His Gly Asp Val Phe Phe Pro Ala Glu Asp
Thr Ile Phe Glu Thr Pro 275 280 285 Glu Leu Arg Gln Val 290
25159PRTHomo sapiensDOMAIN(1)..(159)Extracellular domain 25Phe Lys
Val Thr Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 1 5 10 15
Asn Ala Thr Leu Thr Cys Arg Ile Leu Gly Pro Val Ser Lys Gly His 20
25 30 Asp Val Thr Ile Tyr Lys Thr Trp Tyr Leu Ser Ser Arg Gly Glu
Val 35 40 45 Gln Met Cys Lys Glu His Arg Pro Ile Arg Asn Phe Thr
Leu Gln His 50 55 60 Leu Gln His His Gly Ser His Leu Lys Ala Asn
Ala Ser His Asp Gln 65 70 75 80 Pro Gln Lys His Gly Leu Glu Leu Ala
Ser Asp His His Gly Asn Phe 85 90 95 Ser Ile Thr Leu Arg Asn Val
Thr Pro Arg Asp Ser Gly Leu Tyr Cys 100 105 110 Cys Leu Val Ile Glu
Leu Lys Asn His His Pro Glu Gln Arg Phe Tyr 115 120 125 Gly Ser Met
Glu Leu Gln Val Gln Ala Gly Lys Gly Ser Gly Ser Thr 130 135 140 Cys
Met Ala Ser Asn Glu Gln Asp Ser Asp Ser Ile Thr Ala Ala 145 150 155
26221PRTHomo sapiensDOMAIN(1)..(221)Extracellular domain 26Phe Thr
Ile Thr Ala Pro Lys Asp Leu Tyr Val Val Glu Tyr Gly Ser 1 5 10 15
Asn Val Thr Met Glu Cys Arg Phe Pro Val Glu Arg Glu Leu Asp Leu 20
25 30 Leu Ala Leu Val Val Tyr Trp Glu Lys Glu Asp Glu Gln Val Ile
Gln 35 40 45 Phe Val Ala Gly Glu Glu Asp Leu Lys Pro Gln His Ser
Asn Phe Arg 50 55 60 Gly Arg Ala Ser Leu Pro Lys Asp Gln Leu Leu
Lys Gly Asn Ala Ala 65 70 75 80 Leu Gln Ile Thr Asp Val Lys Leu Gln
Asp Ala Gly Val Tyr Cys Cys 85 90 95 Ile Ile Ser Tyr Gly Gly Ala
Asp Tyr Lys Arg Ile Thr Leu Lys Val 100 105 110 Asn Ala Pro Tyr Arg
Lys Ile Asn Gln Arg Ile Ser Val Asp Pro Ala 115 120 125 Thr Ser Glu
His Glu Leu Ile Cys Gln Ala Glu Gly Tyr Pro Glu Ala 130 135 140 Glu
Val Ile Trp Thr Asn Ser Asp His Gln Pro Val Ser Gly Lys Arg 145 150
155 160 Ser Val Thr Thr Ser Arg Thr Glu Gly Met Leu Leu Asn Val Thr
Ser 165 170 175 Ser Leu Arg Val Asn Ala Thr Ala Asn Asp Val Phe Tyr
Cys Thr Phe 180 185 190
Trp Arg Ser Gln Pro Gly Gln Asn His Thr Ala Glu Leu Ile Ile Pro 195
200 205 Glu Leu Pro Ala Thr His Pro Pro Gln Asn Arg Thr His 210 215
220 27202PRTHomo sapiensDOMAIN(1)..(202)Extracellular domain 27Leu
Phe Thr Val Thr Ala Pro Lys Glu Val Tyr Thr Val Asp Val Gly 1 5 10
15 Ser Ser Val Ser Leu Glu Cys Asp Phe Asp Arg Arg Glu Cys Thr Glu
20 25 30 Leu Glu Gly Ile Arg Ala Ser Leu Gln Lys Val Glu Asn Asp
Thr Ser 35 40 45 Leu Gln Ser Glu Arg Ala Thr Leu Leu Glu Glu Gln
Leu Pro Leu Gly 50 55 60 Lys Ala Leu Phe His Ile Pro Ser Val Gln
Val Arg Asp Ser Gly Gln 65 70 75 80 Tyr Arg Cys Leu Val Ile Cys Gly
Ala Ala Trp Asp Tyr Lys Tyr Leu 85 90 95 Thr Val Lys Val Lys Ala
Ser Tyr Met Arg Ile Asp Thr Arg Ile Leu 100 105 110 Glu Val Pro Gly
Thr Gly Glu Val Gln Leu Thr Cys Gln Ala Arg Gly 115 120 125 Tyr Pro
Leu Ala Glu Val Ser Trp Gln Asn Val Ser Val Pro Ala Asn 130 135 140
Thr Ser His Ile Arg Thr Pro Glu Gly Leu Tyr Gln Val Thr Ser Val 145
150 155 160 Leu Arg Leu Lys Pro Gln Pro Ser Arg Asn Phe Ser Cys Met
Phe Trp 165 170 175 Asn Ala His Met Lys Glu Leu Thr Ser Ala Ile Ile
Asp Pro Leu Ser 180 185 190 Arg Met Glu Pro Lys Val Pro Arg Thr Trp
195 200 28220PRTHomo sapiensDOMAIN(1)..(220)Extracellular domain
28Val Glu Val Gln Val Ser Glu Asp Pro Val Val Ala Leu Val Asp Thr 1
5 10 15 Asp Ala Thr Leu Phe Cys Ser Phe Ser Pro Glu Pro Gly Phe Ser
Leu 20 25 30 Ala Gln Leu Asn Leu Ile Trp Gln Leu Thr Asp Thr Lys
Gln Leu Val 35 40 45 His Ser Phe Thr Glu Gly Arg Asp Gln Gly Ser
Ala Tyr Ser Asn Arg 50 55 60 Thr Ala Leu Phe Pro Asp Leu Leu Val
Gln Gly Asn Ala Ser Leu Arg 65 70 75 80 Leu Gln Arg Val Arg Val Thr
Asp Glu Gly Ser Tyr Thr Cys Thr Val 85 90 95 Ser Ile Gln Asp Phe
Asp Ser Ala Ala Val Ser Leu Gln Val Ala Ala 100 105 110 Pro Tyr Ser
Lys Pro Ser Met Thr Leu Glu Pro Asn Lys Asp Leu Arg 115 120 125 Pro
Gly Asn Met Val Thr Ile Thr Cys Ser Ser Tyr Gln Gly Tyr Pro 130 135
140 Glu Ala Glu Val Phe Trp Lys Asp Gly Gln Gly Val Pro Leu Thr Gly
145 150 155 160 Asn Val Thr Thr Ser Gln Met Ala Asn Glu Arg Gly Leu
Phe Asp Val 165 170 175 His Ser Val Leu Arg Val Val Leu Gly Ala Asn
Gly Thr Tyr Ser Cys 180 185 190 Leu Val Arg Asn Pro Val Leu Gln Gln
Asp Ala His Gly Ser Val Thr 195 200 205 Ile Thr Gly Gln Pro Leu Thr
Phe Pro Pro Glu Ala 210 215 220 29233PRTHomo
sapiensDOMAIN(1)..(233)Extracellular domain 29Leu Ile Ile Gly Phe
Gly Ile Ser Gly Lys His Phe Ile Thr Val Thr 1 5 10 15 Thr Phe Thr
Ser Ala Gly Asn Ile Gly Glu Asp Gly Thr Leu Ser Cys 20 25 30 Thr
Phe Glu Pro Asp Ile Lys Leu Asn Gly Ile Val Ile Gln Trp Leu 35 40
45 Lys Glu Gly Ile Lys Gly Leu Val His Glu Phe Lys Glu Gly Lys Asp
50 55 60 Asp Leu Ser Gln Gln Met Glu Met Phe Ala Gly Arg Thr Ala
Val Phe 65 70 75 80 Ala Asp Gln Val Val Val Gly Asn Ala Ser Leu Arg
Leu Lys Asn Val 85 90 95 Gln Leu Thr Asp Ala Gly Thr Tyr Thr Cys
Tyr Ile Arg Thr Ser Lys 100 105 110 Gly Lys Gly Asn Ala Asn Leu Glu
Tyr Lys Thr Gly Ala Phe Ser Met 115 120 125 Pro Glu Ile Asn Val Asp
Tyr Asn Ala Ser Ser Glu Ser Leu Arg Cys 130 135 140 Glu Ala Pro Arg
Trp Phe Pro Gln Pro Thr Val Ala Trp Ala Ser Gln 145 150 155 160 Val
Asp Gln Gly Ala Asn Phe Ser Glu Val Ser Asn Thr Ser Phe Glu 165 170
175 Leu Asn Ser Glu Asn Val Thr Met Lys Val Val Ser Val Leu Tyr Asn
180 185 190 Val Thr Ile Asn Asn Thr Tyr Ser Cys Met Ile Glu Asn Asp
Ile Ala 195 200 205 Lys Ala Thr Gly Asp Ile Lys Val Thr Asp Ser Glu
Val Lys Arg Arg 210 215 220 Ser Gln Leu Gln Leu Leu Asn Ser Gly 225
230 30159PRTMus musculusDOMAIN(1)..(159)Extracellular domain 30Phe
Lys Val Thr Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 1 5 10
15 Asn Ala Thr Leu Thr Cys Arg Ile Leu Gly Pro Val Ser Lys Gly His
20 25 30 Asp Val Thr Ile Tyr Lys Thr Trp Tyr Leu Ser Ser Arg Gly
Glu Val 35 40 45 Gln Met Cys Lys Glu His Arg Pro Ile Arg Asn Phe
Thr Leu Gln His 50 55 60 Leu Gln His His Gly Ser His Leu Lys Ala
Asn Ala Ser His Asp Gln 65 70 75 80 Pro Gln Lys His Gly Leu Glu Leu
Ala Ser Asp His His Gly Asn Phe 85 90 95 Ser Ile Thr Leu Arg Asn
Val Thr Pro Arg Asp Ser Gly Leu Tyr Cys 100 105 110 Cys Leu Val Ile
Glu Leu Lys Asn His His Pro Glu Gln Arg Phe Tyr 115 120 125 Gly Ser
Met Glu Leu Gln Val Gln Ala Gly Lys Cys Ser Gly Ser Thr 130 135 140
Cys Met Ala Ser Asn Glu Gln Asp Ser Asp Ser Ile Thr Ala Ala 145 150
155 31149PRTHomo sapiensDOMAIN(1)..(149)Extracellular domain 31Ser
Gly Trp Leu Leu Glu Val Pro Asn Gly Pro Trp Arg Ser Leu Thr 1 5 10
15 Phe Tyr Pro Ala Trp Leu Thr Val Ser Glu Gly Ala Asn Ala Thr Phe
20 25 30 Thr Cys Ser Leu Ser Asn Trp Ser Glu Asp Leu Met Leu Asn
Trp Asn 35 40 45 Arg Leu Ser Pro Ser Asn Gln Thr Glu Lys Gln Ala
Ala Phe Cys Asn 50 55 60 Gly Leu Ser Gln Pro Val Gln Asp Ala Arg
Phe Gln Ile Ile Gln Leu 65 70 75 80 Pro Asn Arg His Asp Phe His Met
Asn Ile Leu Asp Thr Arg Arg Asn 85 90 95 Asp Ser Gly Ile Tyr Leu
Cys Gly Ala Ile Ser Leu Met Pro Lys Ala 100 105 110 Lys Ile Glu Glu
Ser Pro Gly Ala Glu Leu Val Val Thr Glu Arg Ile 115 120 125 Leu Glu
Thr Ser Thr Arg Tyr Pro Ser Pro Ser Pro Lys Pro Glu Glu 130 135 140
Arg Phe Gln Gly Met 145 32126PRTHomo
sapiensDOMAIN(1)..(126)Extracellular domain 32Glu Ala Ile Gln Val
Thr Gln Pro Ser Val Val Leu Ala Ser Ser His 1 5 10 15 Gly Val Ala
Ser Phe Pro Cys Glu Tyr Ser Pro Ser His Asn Thr Asp 20 25 30 Glu
Val Arg Val Thr Val Leu Arg Gln Thr Asn Asp Gln Met Thr Glu 35 40
45 Val Cys Ala Thr Thr Phe Thr Glu Lys Asn Thr Val Gly Phe Leu Asp
50 55 60 Tyr Pro Phe Cys Ser Gly Thr Phe Asn Glu Ser Arg Val Asn
Leu Thr 65 70 75 80 Ile Gln Gly Leu Arg Ala Val Asp Thr Gly Leu Tyr
Leu Cys Lys Val 85 90 95 Glu Leu Met Tyr Pro Pro Pro Tyr Phe Val
Gly Met Gly Asn Gly Thr 100 105 110 Gln Ile Tyr Val Ile Asp Pro Glu
Pro Cys Pro Asp Ser Asp 115 120 125 3371PRTHomo
sapiensDOMAIN(1)..(71)Extracellular domain 33Arg Ser Asn Ala Glu
Phe Asn Cys Asp Gly Asp Phe Asp Asn Glu Thr 1 5 10 15 Val Thr Phe
Arg Leu Trp Asn Leu His Val Asn His Thr Asp Ile Tyr 20 25 30 Phe
Cys Lys Ile Glu Phe Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu 35 40
45 Arg Ser Asn Gly Thr Ile Thr His Ile Lys Glu Lys His Leu Cys His
50 55 60 Thr Gln Ser Ser Pro Lys Leu 65 70 34154PRTHomo
sapiensDOMAIN(1)..(154)Extracellular domain 34Glu Lys Ala Thr Lys
Arg Asn Asp Glu Glu Cys Pro Val Gln Leu Thr 1 5 10 15 Ile Thr Arg
Asn Ser Lys Gln Ser Ala Arg Thr Gly Glu Leu Phe Lys 20 25 30 Ile
Gln Cys Pro Val Lys Tyr Cys Val His Arg Pro Asn Val Thr Trp 35 40
45 Cys Lys His Asn Gly Thr Ile Cys Val Pro Leu Glu Val Ser Pro Gln
50 55 60 Leu Tyr Thr Ser Trp Glu Glu Asn Gln Ser Val Pro Val Phe
Val Leu 65 70 75 80 His Phe Lys Pro Ile His Leu Ser Asp Asn Gly Ser
Tyr Ser Cys Ser 85 90 95 Thr Asn Phe Asn Ser Gln Val Ile Asn Ser
His Ser Val Thr Ile His 100 105 110 Val Arg Glu Arg Thr Gln Asn Ser
Ser Glu His Pro Leu Ile Thr Val 115 120 125 Ser Asp Ile Pro Asp Ala
Thr Asn Ala Ser Gly Pro Ser Thr Met Glu 130 135 140 Glu Arg Pro Gly
Arg Thr Trp Leu Leu Tyr 145 150 35124PRTHomo
sapiensDOMAIN(1)..(124)Extracellular domain 35Glu Ile Asn Gly Ser
Ala Asp His Arg Met Phe Ser Phe His Asn Gly 1 5 10 15 Gly Val Gln
Ile Ser Cys Lys Tyr Pro Glu Thr Val Gln Gln Leu Lys 20 25 30 Met
Arg Leu Phe Arg Glu Arg Glu Val Leu Cys Glu Leu Thr Lys Thr 35 40
45 Lys Gly Ser Gly Asn Ala Val Ser Ile Lys Asn Pro Met Leu Cys Leu
50 55 60 Tyr Met Leu Ser Asn Asn Ser Val Ser Phe Phe Leu Asn Asn
Pro Asp 65 70 75 80 Ser Ser Gln Gly Ser Tyr Tyr Phe Cys Ser Leu Ser
Ile Phe Asp Pro 85 90 95 Pro Pro Phe Gln Glu Arg Asn Leu Ser Gly
Gly Tyr Leu His Ile Tyr 100 105 110 Glu Ser Gln Leu Cys Cys Gln Leu
Lys Leu Trp Leu 115 120 36306PRTMus musculus 36Met Gly Val Pro Asn
Val Pro Glu Ala Ser Ser Pro Arg Trp Gly Thr 1 5 10 15 Leu Ile Leu
Ala Asp Phe Leu Ala Ala Ser Arg Gly Leu Val Ala Ala 20 25 30 Phe
Lys Val Thr Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln 35 40
45 Asn Ala Thr Leu Thr Cys Arg Ile Leu Gly Pro Val Ser Lys Gly His
50 55 60 Asp Val Thr Ile Tyr Lys Thr Trp Tyr Leu Ser Ser Arg Gly
Glu Val 65 70 75 80 Gln Met Cys Lys Glu Glu Arg Pro Ile Arg Asn Phe
Ile Leu Gln His 85 90 95 Leu Gln His His Gly Ser His Leu Lys Ala
Asn Ala Ser His Asp Gln 100 105 110 Pro Gln Lys His Gly Leu Glu Thr
Ala Ser Asp His His Gly Asn Phe 115 120 125 Ser Ile Thr Leu Arg Asn
Val Thr Pro Arg Asp Ser Gly Leu Tyr Cys 130 135 140 Cys Leu Val Ile
Glu Leu Lys Asn His His Pro Lys Gln Arg Phe Tyr 145 150 155 160 Gly
Ser Met Glu Leu Gln Val Gln Ala Gly Lys Gly Ser Gly Thr Asn 165 170
175 Ala Ser Asn Glu Gln Asp Ser Asp Ser Ile Thr Ala Ala Ala Leu Ala
180 185 190 Thr Gly Ala Cys Ile Val Gly Ile Leu Cys Leu Pro Leu Ile
Leu Leu 195 200 205 Leu Val Tyr Lys Gln Arg Gln Val Ala Ser His Arg
Arg Ala Gln Glu 210 215 220 Leu Val Arg Met Asp Ser Ser Asn Thr Gln
Gly Ile Lys Asn Pro Gly 225 230 235 240 Phe Glu Thr Thr Pro Pro Phe
Gln Gly Met Pro Glu Ala Lys Thr Arg 245 250 255 Pro Pro Leu Ser Tyr
Val Ala Gln Arg Gln Pro Ser Glu Ser Gly Arg 260 265 270 Tyr Leu Leu
Ser Asp Pro Ser Thr Pro Leu Ser Pro Pro Gly Pro Gly 275 280 285 Asp
Val Phe Phe Pro Ser Leu Asp Pro Val Pro Asp Ser Asn Ser Glu 290 295
300 Ala Ile 305 37308PRTHomo sapiens 37Met Gly Val Pro Thr Ala Ile
Glu Ala Ser Ser Trp Arg Trp Gly Ser 1 5 10 15 Leu Ile Phe Ala Leu
Phe Leu Ala Ala Ser Leu Gly Pro Val Ala Ala 20 25 30 Phe Lys Val
Ala Thr Pro Tyr Ser Leu Val Val Cys Pro Glu Gly Gln 35 40 45 Asn
Val Thr Leu Thr Cys Arg Leu Leu Gly Pro Val Asp Lys Gly His 50 55
60 Asp Val Thr Phe Tyr Lys Thr Trp Tyr Arg Ser Ser Arg Gly Glu Val
65 70 75 80 Gln Thr Cys Ser Glu Arg Arg Pro Ile Arg Asn Leu Thr Phe
Gln Asp 85 90 95 Leu Lys Leu His His Gly Gly His Gln Ala Ala Asn
Thr Ser His Asp 100 105 110 Leu Ala Gln Arg His Gly Leu Glu Ser Ala
Ser Asp His His Gly Asn 115 120 125 Phe Ser Ile Thr Asn Arg Asn Leu
Thr Leu Leu Asp Ser Gly Leu Tyr 130 135 140 Cys Cys Leu Val Val Glu
Ile Arg His His His Ser Lys His Arg Val 145 150 155 160 His Gly Ala
Met Glu Leu Gln Val Gln Thr Gly Lys Asp Ala Pro Asn 165 170 175 Val
Val Tyr Pro Ser Ser Ser Gln Asp Ser Glu Asn Ile Thr Ala Ala 180 185
190 Ala Leu Ala Thr Gly Ala Cys Ile Val Gly Ile Leu Cys Leu Pro Leu
195 200 205 Ile Leu Leu Leu Val Tyr Lys Gln Arg Gln Ala Ala Ser Asn
Arg Arg 210 215 220 Ala Gln Glu Leu Val Arg Met Asp Ser Asn Ile Gln
Gly Ile Lys Asn 225 230 235 240 Pro Gly Phe Glu Ala Ser Pro Pro Ala
Gln Gly Ile Pro Glu Ala Lys 245 250 255 Val Arg His Pro Leu Ser Tyr
Val Ala Gln Arg Gln Pro Ser Glu Ser 260 265 270 Gly Arg His Leu Leu
Ser Glu Pro Ser Thr Pro Leu Ser Pro Pro Gly 275 280 285 Pro Gly Asp
Val Phe Phe Pro Ser Leu Asp Pro Val Pro Asp Ser Asn 290 295 300 Phe
Glu Val Ile 305 3825DNAArtificial SequenceSynthetic sequence
38gggcacgatg tgaccttcta caaga 253925DNAArtificial SequenceSynthetic
sequence 39cagatgccaa atgacttaca tctta 254025DNAArtificial
SequenceSynthetic sequence 40gagatggatt gtaagagcca gttta
254125DNAArtificial SequenceSynthetic sequence 41gggctttgag
gagagggtaa acata 254225DNAArtificial SequenceSynthetic sequence
42cctatctcct gacattcaca gttta 254325DNAArtificial SequenceSynthetic
sequence 43cagtttaata gagacttcct gcctt 254425DNAArtificial
SequenceSynthetic sequence 44cagggagagg ctgaaggaat ggaat
254525DNAArtificial SequenceSynthetic sequence 45ggaatgtgtt
gagagggatt ctgaa 254625DNAArtificial SequenceSynthetic sequence
46gagagggatt ctgaatgatc aatat 254725DNAArtificial SequenceSynthetic
sequence 47cacagagggc aatagaggtt ctgaa 254825DNAArtificial
SequenceSynthetic sequence 48cagatgccaa atgacttaca tctta
254925DNAArtificial SequenceSynthetic sequence 49gagatggatt
gtaagagcca gttta 255025DNAArtificial SequenceSynthetic sequence
50ggtgagtcct ctgtggaatt gtgat 255125DNAArtificial SequenceSynthetic
sequence 51gggctttgag gagagggtaa acata 255225DNAArtificial
SequenceSynthetic sequence 52cctatctcct gacattcaca gttta
255325DNAArtificial SequenceSynthetic sequence 53cagtttaata
gagacttcct gcctt 255425DNAArtificial SequenceSynthetic sequence
54cagggagagg ctgaaggaat ggaat 255525DNAArtificial SequenceSynthetic
sequence 55ggaatgtgtt gagagggatt ctgaa 255625DNAArtificial
SequenceSynthetic sequence 56gagagggatt ctgaatgatc aatat
255725DNAArtificial SequenceSynthetic sequence 57cacagagggc
aatagaggtt ctgaa 255825DNAArtificial SequenceSynthetic sequence
58acaaagggca cgatgtgacc ttcta 255925DNAArtificial SequenceSynthetic
sequence 59gggcacgatg tgaccttcta caaga 256025DNAArtificial
SequenceSynthetic sequence 60gaccaccatg gcaacttctc catca
256125DNAArtificial SequenceSynthetic sequence 61cagacaggca
aagatgcacc atcca 256225DNAArtificial SequenceSynthetic sequence
62ggcaaagatg caccatccaa ctgtg 256325DNAArtificial SequenceSynthetic
sequence 63ccatccaact gtgtggtgta cccat 256425DNAArtificial
SequenceSynthetic sequence 64ggatggacag caacattcaa gggat
256525DNAArtificial SequenceSynthetic sequence 65gacagcaaca
ttcaagggat tgaaa 256625DNAArtificial SequenceSynthetic sequence
66ccctgtccct gactctccaa acttt 256725DNAArtificial SequenceSynthetic
sequence 67cctgactctc caaactttga ggtca 2568457PRTArtificial
SequencehuVISTA-IgG1-CDM8-derived
constructmisc_feature(61)..(61)Xaa can be any naturally occurring
amino acidmisc_feature(63)..(63)Xaa can be any naturally occurring
amino acidmisc_feature(200)..(200)Xaa can be any naturally
occurring amino acidmisc_feature(202)..(202)Xaa can be any
naturally occurring amino acidmisc_feature(239)..(239)Xaa can be
any naturally occurring amino acidmisc_feature(259)..(259)Xaa can
be any naturally occurring amino acidmisc_feature(270)..(270)Xaa
can be any naturally occurring amino
acidmisc_feature(278)..(279)Xaa can be any naturally occurring
amino acidmisc_feature(281)..(282)Xaa can be any naturally
occurring amino acidmisc_feature(284)..(284)Xaa can be any
naturally occurring amino acidmisc_feature(287)..(288)Xaa can be
any naturally occurring amino acidmisc_feature(291)..(292)Xaa can
be any naturally occurring amino acidmisc_feature(299)..(299)Xaa
can be any naturally occurring amino
acidmisc_feature(312)..(312)Xaa can be any naturally occurring
amino acidmisc_feature(319)..(319)Xaa can be any naturally
occurring amino acidmisc_feature(330)..(330)Xaa can be any
naturally occurring amino acidmisc_feature(339)..(339)Xaa can be
any naturally occurring amino acidmisc_feature(350)..(351)Xaa can
be any naturally occurring amino acidmisc_feature(354)..(354)Xaa
can be any naturally occurring amino
acidmisc_feature(356)..(356)Xaa can be any naturally occurring
amino acidmisc_feature(360)..(360)Xaa can be any naturally
occurring amino acidmisc_feature(373)..(373)Xaa can be any
naturally occurring amino acidmisc_feature(376)..(376)Xaa can be
any naturally occurring amino acid 68Met Ser Leu Leu Phe Ala Leu
Phe Leu Ala Ala Ser Leu Gly Pro Val 1 5 10 15 Ala Ala Phe Lys Val
Ala Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu 20 25 30 Gly Gln Asn
Val Thr Leu Thr Cys Arg Leu Leu Gly Pro Val Asp Lys 35 40 45 Gly
His Asp Val Thr Phe Tyr Lys Thr Trp Tyr Arg Xaa Ser Xaa Gly 50 55
60 Glu Val Gln Thr Cys Ser Glu Arg Arg Pro Ile Arg Asn Leu Thr Phe
65 70 75 80 Gln Asp Leu His Leu His His Gly Gly His Gln Ala Ala Asn
Thr Ser 85 90 95 His Asp Leu Ala Gln Arg His Gly Leu Glu Ser Ala
Ser Asp His His 100 105 110 Gly Asn Phe Ser Ile Thr Met Arg Asn Leu
Thr Leu Leu Asp Ser Gly 115 120 125 Leu Tyr Cys Cys Leu Val Val Glu
Ile Arg His His His Ser Glu His 130 135 140 Arg Val His Gly Ala Met
Glu Leu Gln Val Gln Thr Gly Lys Asp Ala 145 150 155 160 Pro Ser Asn
Cys Val Val Tyr Pro Ser Ser Ser Gln Glu Ser Glu Asn 165 170 175 Ile
Thr Ala Ala Asp Pro Gly Gly Gly Gly Gly Arg Leu Val Pro Arg 180 185
190 Gly Phe Gly Thr Gly Asp Pro Xaa Pro Xaa Ser Ser Asp Lys Thr His
195 200 205 Thr Cys Pro Pro Cys Pro Ala Pro Asp Ser Arg Val His Arg
Gln Ser 210 215 220 Ser Ser Ser Pro Lys Thr Lys Asp Thr Leu Met Ile
Ser Arg Xaa Pro 225 230 235 240 Glu Val Thr Cys Val Val Val Asp Val
Ser Gln Glu Asp Pro Glu Val 245 250 255 Lys Phe Xaa Trp Tyr Val Asp
Gly Val Glu Met His Arg Xaa Lys Thr 260 265 270 Lys Pro Arg Glu Glu
Xaa Xaa Asn Xaa Xaa Leu Xaa Met Gly Xaa Xaa 275 280 285 Leu Thr Xaa
Xaa Gln Gln Asp Trp Leu Asn Xaa Lys Asp Tyr Lys Phe 290 295 300 Lys
Val Ser Asn Lys Lys Gln Xaa Asn Pro Phe Glu Lys Thr Xaa Ser 305 310
315 320 Lys Ser Lys Arg Gln Thr Arg Glu Pro Xaa Val Tyr Asn Leu Pro
Pro 325 330 335 Ser Arg Xaa Glu Leu Thr Lys Ile Gln Val Ser Leu Thr
Xaa Xaa Val 340 345 350 Lys Xaa Phe Xaa Pro Ser Asp Xaa Ala Val Glu
Trp Glu Ser Asn Gly 355 360 365 Gln Pro Glu Asn Xaa Tyr Lys Xaa Thr
Pro Pro Val Leu Asp Ser Asp 370 375 380 Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp 385 390 395 400 Gln Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His 405 410 415 Asn His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Gly Ser 420 425 430
Ala Gly Gly Ser Gly Gly Leu Asn Asp Ile Phe Glu Ala Gln Lys Ile 435
440 445 Glu Trp His Glu Ser Arg Gly Ser Leu 450 455
69415PRTArtificial SequencehuVISTA-IgG1-pFUSE derived construct
69Met Tyr Arg Met Gln Leu Leu Ser Cys Ile Ala Leu Ser Leu Ala Leu 1
5 10 15 Val Thr Asn Ser Phe Lys Val Ala Thr Pro Tyr Ser Leu Tyr Val
Cys 20 25 30 Pro Glu Gly Gln Asn Val Thr Leu Thr Cys Arg Leu Leu
Gly Pro Val 35 40 45 Asp Lys Gly His Asp Val Thr Phe Tyr Lys Thr
Trp Tyr Arg Ser Ser 50 55 60 Arg Gly Glu Val Gln Thr Cys Ser Glu
Arg Arg Pro Ile Arg Asn Leu 65 70 75 80 Thr Phe Gln Asp Leu His Leu
His His Gly Gly His Gln Ala Ala Asn 85 90 95 Thr Ser His Asp Leu
Ala Gln Arg His Gly Leu Glu Ser Ala Ser Asp 100 105 110 His His Gly
Asn Phe Ser Ile Thr Met Arg Asn Leu Thr Leu Leu Asp 115 120 125 Ser
Gly Leu Tyr Cys Cys Leu Val Val Glu Ile Arg His His His Ser 130 135
140 Glu His Arg Val His Gly Ala Met Glu Leu Gln Val Gln Thr Gly Lys
145 150 155 160 Asp Ala Pro Ser Asn Cys Val Val Tyr Pro Ser Ser Ser
Gln Asp Ser 165 170 175 Glu Asn Ile Thr Ala Ala Ala Arg Ser Ile Ser
Ala Met Val Arg Ser 180 185 190 Val Glu Cys Pro Pro Cys Pro Ala Pro
Pro Val Ala Gly Pro Ser Val 195 200 205 Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr 210 215 220 Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu 225 230 235 240 Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 245 250 255
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 260
265 270 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys 275 280 285 Cys Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu
Lys Thr Ile 290 295 300 Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro 305 310 315 320 Pro Ser Arg Glu Glu Met Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu 325 330 335 Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 340 345 350 Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 355 360 365 Asp Gly
Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 370 375 380
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 385
390 395 400 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 405 410 415 70203PRTArtificial SequencehuVISTA-IgG1-CDM8
derived Fc regionmisc_feature(12)..(12)Xaa can be any naturally
occurring amino acidmisc_feature(32)..(32)Xaa can be any naturally
occurring amino acidmisc_feature(43)..(43)Xaa can be any naturally
occurring amino acidmisc_feature(51)..(52)Xaa can be any naturally
occurring amino acidmisc_feature(54)..(55)Xaa can be any naturally
occurring amino acidmisc_feature(57)..(57)Xaa can be any naturally
occurring amino acidmisc_feature(60)..(61)Xaa can be any naturally
occurring amino acidmisc_feature(64)..(65)Xaa can be any naturally
occurring amino acidmisc_feature(72)..(72)Xaa can be any naturally
occurring amino acidmisc_feature(85)..(85)Xaa can be any naturally
occurring amino acidmisc_feature(92)..(92)Xaa can be any naturally
occurring amino acidmisc_feature(103)..(103)Xaa can be any
naturally occurring amino acidmisc_feature(112)..(112)Xaa can be
any naturally occurring amino acidmisc_feature(123)..(124)Xaa can
be any naturally occurring amino acidmisc_feature(127)..(127)Xaa
can be any naturally occurring amino
acidmisc_feature(129)..(129)Xaa can be any naturally occurring
amino acidmisc_feature(133)..(133)Xaa can be any naturally
occurring amino acidmisc_feature(146)..(146)Xaa can be any
naturally occurring amino acidmisc_feature(149)..(149)Xaa can be
any naturally occurring amino acid 70Pro Lys Thr Lys Asp Thr Leu
Met Ile Ser Arg Xaa Pro Glu Val Thr 1 5 10 15 Cys Val Val Val Asp
Val Ser Gln Glu Asp Pro Glu Val Lys Phe Xaa 20 25 30 Trp Tyr Val
Asp Gly Val Glu Met His Arg Xaa Lys Thr Lys Pro Arg 35 40 45 Glu
Glu Xaa Xaa Asn Xaa Xaa Leu Xaa Met Gly Xaa Xaa Leu Thr Xaa 50 55
60 Xaa Gln Gln Asp Trp Leu Asn Xaa Lys Asp Tyr Lys Phe Lys Val Ser
65 70 75 80 Asn Lys Lys Gln Xaa Asn Pro Phe Glu Lys Thr Xaa Ser Lys
Ser Lys 85 90 95 Arg Gln Thr Arg Glu Pro Xaa Val Tyr Asn Leu Pro
Pro Ser Arg Xaa 100 105 110 Glu Leu Thr Lys Ile Gln Val Ser Leu Thr
Xaa Xaa Val Lys Xaa Phe 115 120 125 Xaa Pro Ser Asp Xaa Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu 130 135 140 Asn Xaa Tyr Lys Xaa Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 145 150 155 160 Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 165 170 175 Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 180 185
190 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 195 200
7119PRTArtificial Sequencehuman VISTA and pFUSE-hIgG1e3-Fc2 Fc
linker 71Gly Thr Ser Gly Ser Ser Gly Ser Gly Ser Gly Gly Ser Gly
Ser Gly 1 5 10 15 Gly Gly Gly 72427PRTArtificial
SequencehuVISTA-IgG1-pFUSE derived with Ser/Gly linker 72Met Tyr
Arg Met Gln Leu Leu Ser Cys Ile Ala Leu Ser Leu Ala Leu 1 5 10 15
Val Thr Asn Ser Phe Lys Val Ala Thr Pro Tyr Ser Leu Tyr Val Cys 20
25 30 Pro Glu Gly Gln Asn Val Thr Leu Thr Cys Arg Leu Leu Gly Pro
Val 35 40 45 Asp Lys Gly His Asp Val Thr Phe Tyr Lys Thr Trp Tyr
Arg Ser Ser 50 55 60 Arg Gly Glu Val Gln Thr Cys Ser Glu Arg Arg
Pro Ile Arg Asn Leu 65 70 75 80 Thr Phe Gln Asp Leu His Leu His His
Gly Gly His Gln Ala Ala Asn 85 90 95 Thr Ser His Asp Leu Ala Gln
Arg His Gly Leu Glu Ser Ala Ser Asp 100 105 110 His His Gly Asn Phe
Ser Ile Thr Met Arg Asn Leu Thr Leu Leu Asp 115 120 125 Ser Gly Leu
Tyr Cys Cys Leu Val Val Glu Ile Arg His His His Ser 130 135 140 Glu
His Arg Val His Gly Ala Met Glu Leu Gln Val Gln Thr Gly Lys 145 150
155 160 Asp Ala Pro Ser Asn Cys Val Val Tyr Pro Ser Ser Ser Gln Asp
Ser 165 170 175 Glu Asn Ile Thr Ala Ala Ala Gly Thr Ser Gly Ser Ser
Gly Ser Gly 180 185 190 Ser Gly Gly Ser Gly Ser Gly Gly Gly Gly Arg
Ser Val Glu Cys Pro 195 200 205 Pro Cys Pro Ala Pro Pro Val Ala Gly
Pro Ser Val Phe Leu Phe Pro 210 215 220 Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr 225 230 235 240 Cys Val Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 245 250 255 Trp Tyr
Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 260 265 270
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val 275
280 285 Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser 290 295 300 Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser
Lys Ala Lys 305 310 315 320 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Glu 325 330 335 Glu Met Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe 340 345 350 Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 355 360 365 Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 370 375 380 Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 385 390 395
400 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
405 410 415 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 420 425
73484PRTArtificial SequenceVISTA Ig construct 73Met Pro Met Gly Ser
Leu Gln Pro Leu Ala Thr Leu Tyr Leu Leu Gly 1 5 10
15 Met Leu Val Ala Ser Cys Leu Gly Thr Ser Met Ser Leu Leu Phe Ala
20 25 30 Leu Phe Leu Ala Ala Ser Leu Gly Pro Val Ala Ala Phe Lys
Val Ala 35 40 45 Thr Pro Tyr Ser Leu Tyr Val Cys Pro Glu Gly Gln
Asn Val Thr Leu 50 55 60 Thr Cys Arg Leu Leu Gly Pro Val Asp Lys
Gly His Asp Val Thr Phe 65 70 75 80 Tyr Lys Thr Trp Tyr Arg Ser Ser
Arg Gly Glu Val Gln Thr Cys Ser 85 90 95 Glu Arg Arg Pro Ile Arg
Asn Leu Thr Phe Gln Asp Leu His Leu His 100 105 110 His Gly Gly His
Gln Ala Ala Asn Thr Ser His Asp Leu Ala Gln Arg 115 120 125 His Gly
Leu Glu Ser Ala Ser Asp His His Gly Asn Phe Ser Ile Thr 130 135 140
Met Arg Asn Leu Thr Leu Leu Asp Ser Gly Leu Tyr Cys Cys Leu Val 145
150 155 160 Val Asp Ile Arg His His His Ser Glu His Arg Val His Gly
Ala Met 165 170 175 Glu Leu Gln Val Gln Thr Gly Lys Asp Ala Pro Ser
Asn Cys Val Val 180 185 190 Tyr Pro Ser Ser Ser Gln Glu Ser Glu Asn
Ile Thr Ala Ala Asp Pro 195 200 205 Gly Gly Gly Gly Gly Arg Leu Val
Pro Arg Gly Phe Gly Thr Gly Asp 210 215 220 Pro Glu Pro Lys Ser Ser
Asp Lys Thr His Thr Cys Pro Pro Cys Pro 225 230 235 240 Ala Pro Glu
Phe Glu Gly Ala Pro Ser Val Phe Leu Phe Pro Pro Lys 245 250 255 Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 260 265
270 Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
275 280 285 Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu 290 295 300 Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His 305 310 315 320 Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys 325 330 335 Ala Leu Pro Thr Pro Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln 340 345 350 Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 355 360 365 Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 370 375 380 Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 385 390
395 400 Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu 405 410 415 Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val 420 425 430 Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln 435 440 445 Lys Ser Leu Ser Leu Ser Pro Gly Lys
Gly Ser Ala Gly Gly Ser Gly 450 455 460 Gly Leu Asn Asp Ile Phe Glu
Ala Gln Lys Ile Glu Trp His Glu Ser 465 470 475 480 Arg Gly Ser Leu
74232PRTHomo sapiens 74Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys
Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Phe Glu Gly Ala Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro 20 25 30 Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val 35 40 45 Val Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55 60 Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 65 70 75 80 Tyr
Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 85 90
95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
100 105 110 Leu Pro Thr Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr 130 135 140 Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser 145 150 155 160 Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170 175 Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180 185 190 Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200 205 Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210 215
220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230 75413PRTArtificial
Sequencehuman VISTA-Ig construct 75Phe Lys Val Ala Thr Pro Tyr Ser
Leu Tyr Val Cys Pro Glu Gly Gln 1 5 10 15 Asn Val Thr Leu Thr Cys
Arg Leu Leu Gly Pro Val Asp Lys Gly His 20 25 30 Asp Val Thr Phe
Tyr Lys Thr Trp Tyr Arg Ser Ser Arg Gly Glu Val 35 40 45 Gln Thr
Cys Ser Glu Arg Arg Pro Ile Arg Asn Leu Thr Phe Gln Asp 50 55 60
Leu His Leu His His Gly Gly His Gln Ala Ala Asn Thr Ser His Asp 65
70 75 80 Leu Ala Gln Arg His Gly Leu Glu Ser Ala Ser Asp His His
Gly Asn 85 90 95 Phe Ser Ile Thr Met Arg Asn Leu Thr Leu Leu Asp
Ser Gly Leu Tyr 100 105 110 Cys Cys Leu Val Val Asp Ile Arg His His
His Ser Glu His Arg Val 115 120 125 His Gly Ala Met Glu Leu Gln Val
Gln Thr Gly Lys Asp Ala Pro Ser 130 135 140 Asn Cys Val Val Tyr Pro
Ser Ser Ser Gln Glu Ser Glu Asn Ile Thr 145 150 155 160 Ala Ala Asp
Pro Gly Gly Gly Gly Gly Arg Leu Val Pro Arg Gly Phe 165 170 175 Gly
Thr Gly Asp Pro Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys 180 185
190 Pro Pro Cys Pro Ala Pro Glu Phe Glu Gly Ala Pro Ser Val Phe Leu
195 200 205 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu 210 215 220 Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro Glu Val Lys 225 230 235 240 Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys 245 250 255 Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu 260 265 270 Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 275 280 285 Val Ser Asn
Lys Ala Leu Pro Thr Pro Ile Glu Lys Thr Ile Ser Lys 290 295 300 Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 305 310
315 320 Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys 325 330 335 Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln 340 345 350 Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly 355 360 365 Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln 370 375 380 Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn 385 390 395 400 His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys 405 410 76203PRTArtificial
SequencehuVISTA-IgG1-CDM8 derived and huVISTA-IgG1-pFUSE derived
constructs - Fc region consensusmisc_feature(3)..(3)Xaa can be any
naturally occurring amino acidmisc_feature(12)..(12)Xaa can be any
naturally occurring amino acidmisc_feature(24)..(24)Xaa can be any
naturally occurring amino acidmisc_feature(32)..(32)Xaa can be any
naturally occurring amino acidmisc_feature(40)..(40)Xaa can be any
naturally occurring amino acidmisc_feature(42)..(43)Xaa can be any
naturally occurring amino acidmisc_feature(51)..(52)Xaa can be any
naturally occurring amino acidmisc_feature(54)..(61)Xaa can be any
naturally occurring amino acidmisc_feature(64)..(66)Xaa can be any
naturally occurring amino acidmisc_feature(72)..(72)Xaa can be any
naturally occurring amino acidmisc_feature(74)..(74)Xaa can be any
naturally occurring amino acidmisc_feature(77)..(77)Xaa can be any
naturally occurring amino acidmisc_feature(83)..(88)Xaa can be any
naturally occurring amino acidmisc_feature(92)..(92)Xaa can be any
naturally occurring amino acidmisc_feature(95)..(95)Xaa can be any
naturally occurring amino acidmisc_feature(97)..(97)Xaa can be any
naturally occurring amino acidmisc_feature(99)..(99)Xaa can be any
naturally occurring amino acidmisc_feature(103)..(103)Xaa can be
any naturally occurring amino acidmisc_feature(106)..(106)Xaa can
be any naturally occurring amino acidmisc_feature(112)..(112)Xaa
can be any naturally occurring amino
acidmisc_feature(114)..(114)Xaa can be any naturally occurring
amino acidmisc_feature(117)..(117)Xaa can be any naturally
occurring amino acidmisc_feature(123)..(124)Xaa can be any
naturally occurring amino acidmisc_feature(127)..(127)Xaa can be
any naturally occurring amino acidmisc_feature(129)..(129)Xaa can
be any naturally occurring amino acidmisc_feature(133)..(133)Xaa
can be any naturally occurring amino
acidmisc_feature(146)..(146)Xaa can be any naturally occurring
amino acidmisc_feature(149)..(149)Xaa can be any naturally
occurring amino acid 76Pro Lys Xaa Lys Asp Thr Leu Met Ile Ser Arg
Xaa Pro Glu Val Thr 1 5 10 15 Cys Val Val Val Asp Val Ser Xaa Glu
Asp Pro Glu Val Lys Phe Xaa 20 25 30 Trp Tyr Val Asp Gly Val Glu
Xaa His Xaa Xaa Lys Thr Lys Pro Arg 35 40 45 Glu Glu Xaa Xaa Asn
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Leu Thr Xaa 50 55 60 Xaa Xaa Gln
Asp Trp Leu Asn Xaa Lys Xaa Tyr Lys Xaa Lys Val Ser 65 70 75 80 Asn
Lys Xaa Xaa Xaa Xaa Xaa Xaa Glu Lys Thr Xaa Ser Lys Xaa Lys 85 90
95 Xaa Gln Xaa Arg Glu Pro Xaa Val Tyr Xaa Leu Pro Pro Ser Arg Xaa
100 105 110 Glu Xaa Thr Lys Xaa Gln Val Ser Leu Thr Xaa Xaa Val Lys
Xaa Phe 115 120 125 Xaa Pro Ser Asp Xaa Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu 130 135 140 Asn Xaa Tyr Lys Xaa Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe 145 150 155 160 Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly 165 170 175 Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn His Tyr 180 185 190 Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 195 200 77203PRTArtificial
SequencehuVISTA-IgG1-pFUSE derived construct Fc region 77Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr 1 5 10 15
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 20
25 30 Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg 35 40 45 Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val 50 55 60 Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser 65 70 75 80 Asn Lys Gly Leu Pro Ser Ser Ile Glu
Lys Thr Ile Ser Lys Ala Lys 85 90 95 Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Glu 100 105 110 Glu Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 115 120 125 Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 130 135 140 Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 145 150
155 160 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly 165 170 175 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr 180 185 190 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
195 200 78232PRTArtificial Sequencehuman IgG1 and vector Fc
consensusmisc_feature(5)..(5)Xaa can be any naturally occurring
amino acidmisc_feature(19)..(20)Xaa can be any naturally occurring
amino acidmisc_feature(22)..(22)Xaa can be any naturally occurring
amino acidmisc_feature(115)..(115)Xaa can be any naturally
occurring amino acidmisc_feature(141)..(141)Xaa can be any
naturally occurring amino acidmisc_feature(143)..(143)Xaa can be
any naturally occurring amino acid 78Glu Pro Lys Ser Xaa Asp Lys
Thr His Thr Cys Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Xaa Xaa Gly
Xaa Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25 30 Lys Asp Thr
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35 40 45 Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55
60 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
65 70 75 80 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln 85 90 95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala 100 105 110 Leu Pro Xaa Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Xaa Glu Xaa Thr 130 135 140 Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 145 150 155 160 Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170 175 Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180 185
190 Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
195 200 205 Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys 210 215 220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230
79232PRTArtificial Sequencevector Fc region 79Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25 30 Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35 40
45 Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
50 55 60 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln 65 70 75 80 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln 85 90 95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala 100 105 110 Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Glu Glu Met Thr 130 135 140 Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 145 150 155 160 Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170
175 Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
180 185 190 Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200 205 Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210 215
220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230
* * * * *