U.S. patent application number 15/556587 was filed with the patent office on 2018-02-08 for antibody drug conjugates (adc) that bind to flt3 proteins.
This patent application is currently assigned to AGENSYS, INC.. The applicant listed for this patent is AGENSYS, INC.. Invention is credited to Hector AVINA, Linnette CAPO, Gao LIU, Christine LOWE, Faisal Hayat MALIK, Sung Ju MOON, Nandini RUDRA-GANGULY, Josh SNYDER, Cyrus VIRATA.
Application Number | 20180037657 15/556587 |
Document ID | / |
Family ID | 56879165 |
Filed Date | 2018-02-08 |
United States Patent
Application |
20180037657 |
Kind Code |
A1 |
RUDRA-GANGULY; Nandini ; et
al. |
February 8, 2018 |
ANTIBODY DRUG CONJUGATES (ADC) THAT BIND TO FLT3 PROTEINS
Abstract
Antibody drug conjugates (ADC's) that bind to FLT3 protein and
variants thereof are described herein. FLT3 exhibits a distinct and
limited expression pattern in normal adult tissue(s), and is
aberrantly expressed in the cancers listed in Table I.
Consequently, the ADC's of the invention provide a therapeutic
composition for the treatment of cancer.
Inventors: |
RUDRA-GANGULY; Nandini;
(Santa Monica, CA) ; LOWE; Christine; (Northridge,
CA) ; MALIK; Faisal Hayat; (Cerritos, CA) ;
MOON; Sung Ju; (Santa Monica, CA) ; SNYDER; Josh;
(Santa Monica, CA) ; AVINA; Hector; (Los Angeles,
CA) ; VIRATA; Cyrus; (Mission Hills, CA) ;
CAPO; Linnette; (Sherman Oaks, CA) ; LIU; Gao;
(Culver City, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AGENSYS, INC. |
Santa Monica |
CA |
US |
|
|
Assignee: |
AGENSYS, INC.
Santa Monica
CA
|
Family ID: |
56879165 |
Appl. No.: |
15/556587 |
Filed: |
March 9, 2016 |
PCT Filed: |
March 9, 2016 |
PCT NO: |
PCT/US16/21592 |
371 Date: |
September 7, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62130476 |
Mar 9, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/54 20130101;
C07K 2317/55 20130101; A61K 47/6849 20170801; A61K 47/6803
20170801; A61P 35/02 20180101; C07K 16/30 20130101; C07K 16/2863
20130101; C07K 2317/21 20130101; C07K 2317/73 20130101; C07K
2317/565 20130101; A61K 45/06 20130101; C07K 2317/52 20130101; C07K
2317/622 20130101; C07K 2317/732 20130101; A61K 47/6811 20170801;
A61K 2039/505 20130101; A61P 35/00 20180101; C07K 2317/56
20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; C07K 16/30 20060101 C07K016/30; A61K 47/68 20060101
A61K047/68 |
Claims
1-33. (canceled)
34. An antibody or antigen binding fragment thereof that binds to
FLT-3 comprising a CDRH1 having the amino acid sequence of SEQ ID
NO:23, a CDRH2 having the amino acid sequence of SEQ ID NO:29, a
CDRH3 having the amino acid sequence of SEQ ID NO:32, a CDRL1
having the amino acid sequence of SEQ ID NO: 14, a CDRL2 having the
amino acid sequence of SEQ ID NO: 17, and a CDRL3 having the amino
acid sequence of SEQ ID NO:20, wherein, optionally, the antigen
binding fragment is selected from a group consisting of Fab, Fab',
F(ab')2, Fv, scFv, isolated VH, and isolated VL; wherein,
optionally, the antibody comprises an Fc region that is an IgG
subtype; and wherein, optionally, the antibody comprises an Fc
region that comprises a substitution of a non-natural amino acid at
amino acid position 124 of the heavy chain, and wherein the
non-natural amino acid is para-acetylphenylalanine (pAF).
35. The antibody according to claim 34, wherein the antibody
comprises: (i) a heavy chain variable region consisting of the
amino acid sequence ranging from 1st E to the 123rd S of SEQ ID NO:
11 and a light chain variable region consisting of the amino acid
sequence ranging from 1st D to the 108th R of SEQ ID NO: 10; (ii) a
heavy chain consisting of the amino acid sequence of amino acid
numbers 1 st E to the 452nd G of SEQ ID NO: 11 and a light chain
consisting of the amino acid sequence ranging from the 1st D to the
214th C of SEQ ID NO: 10; (iii) heavy chain consisting of the amino
acid sequence ranging from 1st E to the 453rd K of SEQ ID NO: 11
and a light chain consisting of the amino acid sequence ranging
from 1st D to the 214th C of SEQ ID NO: 10; (iv) a heavy chain
consisting of the amino acid sequence ranging from the 2nd E to the
452rd G of SEQ ID NO: 11, wherein the 1st amino acid of the heavy
chain is pyroglutamate, and a light chain consisting of the amino
acid sequence ranging from the 1st D to the 214th C of SEQ ID NO:
10; (v) a heavy chain variable region consisting of the amino acid
sequence of the heavy chain variable region of an antibody produced
by a Chinese Hamster Ovary (CHO) cell deposited under ATCC
Accession No. PTA-121831 and a light chain variable region
consisting of the amino acid sequence of the light chain of an
antibody produced by a Chinese Hamster Ovary (CHO) deposited under
ATCC. Accession No. PTA-121831; or (vi) a heavy chain consisting of
the amino acid sequence of the heavy chain of an antibody produced
by a Chinese Hamster Ovary (CHO) cell deposited under ATCC.
Accession No. PTA-121836, and a light chain consisting of the amino
acid sequence of the light chain of an antibody produced by a
Chinese Hamster Ovary (CHO) deposited under ATCC. Accession No.
PTA-121836.
36. One or more isolated nucleic acids encoding the antibody or the
antigen-binding fragment according to claim 34.
37. One or more expression vectors comprising the one or more
isolated nucleic acids according to claim 36.
38. A recombinant host cell comprising the one or more expression
vectors according to claim 37.
39. An antibody or an antigen-binding fragment produced by
culturing the recombinant host cell according to claim 38.
40. An antibody drug conjugate comprising the antibody or the
antigen-binding fragment according to claim 34 conjugated to a
therapeutic agent via a linker, (i) wherein, optionally, the
antibody or the antigen-binding fragment binds FLT3 but does not
substantially inhibit the binding of FLT3 to FLT3 ligand (FL); (ii)
wherein, optionally, the linker is a non-cleavable linker, which is
optionally 2-(aminooxy) acetic acid; (iii) wherein, optionally, the
therapeutic agent is (2S,3
S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpropan--
2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-me-
thyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamino)but-
anamido)butanamide; and (iv) wherein, optionally, the antibody drug
conjugate has the following formula: Antibody-(Linker-therapeutic
agent)p, wherein the linker is 2-(aminooxy)acetic acid, wherein the
therapeutic agent is
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide and, and wherein p is selected from the
group consisting of 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9,
2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, and 3.
41. A pharmaceutical composition comprising a therapeutically
effective amount of the antibody drug conjugate according to claim
40, (i) wherein, optionally, the pharmaceutical composition is for
use in therapy including treatment of cancer, wherein, optionally,
(a) the cancer comprises one or more cells that express FLT3 at an
increased level as compared to a non-cancerous cell; or (b) the
cancer is selected from the group consisting of Acute Myeloid
leukemia (AML), Acute Lymphoblastic leukemia (ALL), B-cell
Lymphoblastic leukemia, and Precursor B-cell Lymphoblastic
leukemia, and (ii) wherein, optionally, the pharmaceutical
composition further comprises one or more anti-neoplastic
agents;
42. A method of treating cancer in a subject, comprising
administering to said subject a therapeutically effective amount of
the antibody drug conjugate according to claim 40, wherein,
optionally, the subject is a human subject; and wherein,
optionally, the cancer is selected from the group consisting of
Acute Myeloid leukemia (AML), Acute Lymphoblastic leukemia (ALL),
B-cell Lymphoblastic leukemia, and Precursor B-cell Lymphoblastic
leukemia.
43. A method of treating cancer in a subject, comprising
administering to said subject a therapeutically effective amount of
the pharmaceutical composition according to claim 41, wherein,
optionally, the subject is a human subject; and wherein,
optionally, the cancer is selected from the group consisting of
Acute Myeloid leukemia (AML), Acute Lymphoblastic leukemia (ALL),
B-cell Lymphoblastic leukemia, and Precursor B-cell Lymphoblastic
leukemia.
44. One or more isolated nucleic acids encoding the antibody or the
antigen-binding fragment according to claim 35.
45. An antibody drug conjugate comprising the antibody or the
antigen-binding fragment according to claim 35 conjugated to a
therapeutic agent via a linker, (i) wherein, optionally, the
antibody or the antigen-binding fragment binds FLT3 but does not
substantially inhibit the binding of FLT3 to FLT3 ligand (FL); (ii)
wherein, optionally, the linker is a non-cleavable linker, which is
optionally 2-(aminooxy) acetic acid; (iii) wherein, optionally, the
therapeutic agent is (2S,3
S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpropan--
2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-me-
thyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamino)but-
anamido)butanamide; and (iv) wherein, optionally, the antibody drug
conjugate has the following formula: Antibody-(Linker-therapeutic
agent)p, wherein the linker is 2-(aminooxy)acetic acid, wherein the
therapeutic agent is
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide and, and wherein p is selected from the
group consisting of 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9,
2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, and 3.
46. An antibody drug conjugate comprising the antibody or the
antigen-binding fragment according to claim 39 conjugated to a
therapeutic agent via a linker, (i) wherein, optionally, the
antibody or the antigen-binding fragment binds FLT3 but does not
substantially inhibit the binding of FLT3 to FLT3 ligand (FL); (ii)
wherein, optionally, the linker is a non-cleavable linker, which is
optionally 2-(aminooxy) acetic acid; (iii) wherein, optionally, the
therapeutic agent is (2S,3
S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpropan--
2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-me-
thyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamino)but-
anamido)butanamide; and (iv) wherein, optionally, the antibody drug
conjugate has the following formula: Antibody-(Linker-therapeutic
agent)p, wherein the linker is 2-(aminooxy)acetic acid, wherein the
therapeutic agent is
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide and, and wherein p is selected from the
group consisting of 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9,
2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, and 3.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent
Application No. 62/130,476, filed 9 Mar. 2015. The contents of
which are incorporated by reference in their entirety.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0002] The content of the following submission on ASCII text file
is incorporated herein by reference in its entirety: a computer
readable form (CRF) of the Sequence Listing (file name:
511582009240SeqList.txt, date recorded: Mar. 7, 2016, size: 44,847
bytes).
STATEMENT OF RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED
RESEARCH
[0003] Not applicable.
FIELD OF THE INVENTION
[0004] The invention described herein relates to antibodies,
antigen-binding fragments thereof, and antibody drug conjugates
(ADCs) thereof, that bind proteins, termed FLT3. The invention
further relates to prognostic, prophylactic and therapeutic methods
and compositions useful in the treatment of cancers that express
FLT3.
BACKGROUND OF THE INVENTION
[0005] It is estimated that 1,660,290 men and women (854,790 men
and 805,500 women) were diagnosed with and 580,350 men and women
died of cancer of all sites in 2013. From 2006-2010, the median age
at diagnosis for cancer of all sites was 66 years of age. The
age-adjusted incidence rate was 463.0 per 100,000 men and women per
year. These rates are based on cases diagnosed in 2006-2010 from 18
SEER geographic areas (N.B. SEER=Surveillance, Epidemiology, and
End Results Program, NCI). From 2006-2010, the median age at death
for cancer of all sites was 72 years of age. The age-adjusted death
rate was 176.4 per 100,000 men and women per year. These rates are
based on patients who died in 2006-2010 in the US. The overall
5-year relative survival for 2003-2009 from 18 SEER geographic
areas was 65.8%.
[0006] Leukemias are cancers that start in blood-forming tissue
such as the bone marrow and causes abnormally large numbers of
blood cells to be produced and enter the bloodstream. The major
leukemias are comprised of Acute Lymphoblastic (ALL), Acute Myeloid
(AML), Chronic Lymphocytic (CLL), Chronic Myelogenous (CML), and
Hairy Cell (CLL) Leukemia.
[0007] For these leukemias as a group, it is estimated that 48,610
men and women (27,880 men and 20,730 women) will be diagnosed with
and 23,720 men and women will die of leukemia in 2013. From
2006-2010, the median age at diagnosis for leukemia was 66 years of
age. The age-adjusted incidence rate was 12.8 per 100,000 men and
women per year. These rates are based on cases diagnosed in
2006-2010 from 18 SEER geographic areas. From 2006-2010, the median
age at death for leukemia was 75 years of age. The age-adjusted
death rate was 7.1 per 100,000 men and women per year. These rates
are based on patients who died in 2006-2010 in the US. The overall
5-year relative survival for 2003-2009 from 18 SEER geographic
areas was 56.0%.
[0008] CLL is the second most common type of leukemia in adults and
it usually gets worse slowly. It often occurs during or after
middle age and it rarely occurs in children. Patients with
early-stage CLL are not treated with chemotherapy until they become
symptomatic or display evidence of rapid progression of disease.
Early initiation of chemotherapy has failed to show benefit in CLL
and may even increase mortality. When chemotherapy is initiated,
the nucleoside analogue fludarabine is the most commonly used
first-line therapy in CLL. Combination regimens have shown improved
response rates in several clinical trials and include the
following: Fludarabine, cyclophosphamide, and rituximab (FCR);
Pentostatin, cyclophosphamide, and rituximab (PCR); Fludarabine,
cyclophosphamide, and mitoxantrone (FCM); Cyclophosphamide,
vincristine, and prednisone (CVP); Cyclophosphamide, doxorubicin,
vincristine, and prednisone (CHOP). It is estimated that 15,680 men
and women (9,720 men and 5,960 women) will be diagnosed with and
4,580 men and women will die of chronic lymphocytic leukemia in
2013. From 2006-2010, the median age at diagnosis for chronic
lymphocytic leukemia was 71 years of age. The age-adjusted
incidence rate was 4.3 per 100,000 men and women per year. These
rates are based on cases diagnosed in 2006-2010 from 18 SEER
geographic areas. From 2006-2010, the median age at death for
chronic lymphocytic leukemia was 79 years of age. The age-adjusted
death rate was 1.4 per 100,000 men and women per year. These rates
are based on patients who died in 2006-2010 in the US. The overall
5-year relative survival for 2003-2009 from 18 SEER geographic
areas was 79.2%.
[0009] Acute myeloid leukemia (AML) is the most common type of
acute leukemia among adults. Current treatment of AML should be
sufficiently aggressive to achieve complete remission (CR) because
partial remission offers no substantial survival benefit. Remission
rates in adult AML are inversely related to age, with an expected
remission rate of more than 65% for those younger than 60 years.
Data suggest that once attained, duration of remission may be
shorter in older patients. Patients that express the progenitor
cell antigen CD34 and/or the P-glycoprotein (MDR1 gene product)
have an inferior outcome. Cytogenetic analysis provides some of the
strongest prognostic information available, predicting outcome of
both remission induction and post remission therapy. Cytogenetic
abnormalities that indicate a good prognosis include t(8; 21),
inv(16) or t(16;16), and t(15;17). Normal cytogenetics portends
average-risk AML. Patients with AML that is characterized by
deletions of the long arms or monosomies of chromosomes 5 or 7; by
translocations or inversions of chromosome 3, t(6; 9), t(9; 22); or
by abnormalities of chromosome 11q23 have particularly poor
prognoses with chemotherapy. It is estimated that 14,590 men and
women (7,820 men and 6,770 women) will be diagnosed with and 10,370
men and women will die of acute myeloid leukemia in 2013. From
2006-2010, the median age at diagnosis for acute myeloid leukemia
was 67 years of age. The age-adjusted incidence rate was 3.7 per
100,000 men and women per year. These rates are based on cases
diagnosed in 2006-2010 from 18 SEER geographic areas. From
2006-2010, the median age at death for acute myeloid leukemia was
72 years of age. The age-adjusted death rate was 2.8 per 100,000
men and women per year. These rates are based on patients who died
in 2006-2010 in the US. The overall 5-year relative survival for
2003-2009 from 18 SEER geographic areas was 24.2%. Note, all
general cancer information was obtained from the NCI website
(www.cancer.gov) and all statistics are based on SEER incidence and
NCHS mortality statistics found within: Howlader N., et. al., SEER
Cancer Statistics Review, 1975-2010, National Cancer Institute.
Bethesda, Md., http://seer.cancer.gov/csr/1975_2010/, based on
November 2012 SEER data submission, posted to the SEER web site,
2013.
[0010] Acute lymphblastic leukemia ("ALL") represents a group of
B/T-precursor-stage lymphoid cell malignancies arising from genetic
alterations that block lymphoid differentiation and drive aberrant
cell proliferation and survival. Remarkable strides have been made
in the past several decades in treating childhood ALL, with five
(5) year survival rates now approaching 90%. However up to 20% of
children will be refractory to treatment or relapse following
treatment and the event free survival rate for these patients
remains poor. It also remains challenging to treat adult patients
with ALL, with a high relapse rate even after significant progress
in modern chemotherapy. In recent decades rapid improvements in the
results of treatment of ALL have been achieved, which is mainly
based on intensification and optimization of chemotherapy,
risk-adapted use of stem-cell transplantation, as well as
individualized and targeted therapy including monoclonal
antibodies. Using next-generation sequencing, additional mutations
affecting normal lymphopoiesis and the significance of cooperating
mutations, as well as epigenetic alterations are being evaluated.
The data obtained in this way will aid in the evaluation of
prognosis in the individual patient but, importantly, also in
incorporating targeted therapy appropriate for the mutational
abnormality.
[0011] Further, the therapeutic utility of monoclonal antibodies
(mAbs) (G. Kohler and C. Milstein, Nature 256:495-497 (1975)) is
being realized. Monoclonal antibodies have now been approved as
therapies in transplantation, cancer, infectious disease,
cardiovascular disease and inflammation. Different isotypes have
different effector functions. Such differences in function are
reflected in distinct 3-dimensional structures for the various
immunoglobulin isotypes (P. M. Alzari et al., Annual Rev. Immunol.,
6:555-580 (1988)).
[0012] Because mice are convenient for immunization and recognize
most human antigens as foreign, mAbs against human targets with
therapeutic potential have typically been of murine origin.
However, murine mAbs have inherent disadvantages as human
therapeutics. They require more frequent dosing as mAbs have a
shorter circulating half-life in humans than human antibodies. More
critically, the repeated administration of murine antibodies to the
human immune system causes the human immune system to respond by
recognizing the mouse protein as a foreign and generating a human
anti-mouse antibody (HAMA) response. Such a HAMA response may
result in allergic reaction and the rapid clearing of the murine
antibody from the system thereby rendering the treatment by murine
antibody useless. To avoid such affects, attempts to create human
immune systems within mice have been attempted.
[0013] Initial attempts hoped to create transgenic mice capable of
responding to antigens with antibodies having human sequences (See
Bruggemann et al., Proc. Nat'l. Acad. Sci. USA 86:6709-6713
(1989)), but were limited by the amount of DNA that could be stably
maintained by available cloning vehicles. The use of yeast
artificial chromosome (YAC) cloning vectors led the way to
introducing large germline fragments of human Ig locus into
transgenic mammals. Essentially a majority of the human V, D, and J
region genes arranged with the same spacing found in the human
genome and the human constant regions were introduced into mice
using YACs. One such transgenic mouse strain is known as
XenoMouse.RTM. mice and is commercially available from Amgen
Fremont, Inc. (Fremont Calif.), formerly Abgenix, Inc.
[0014] Additionally, antibodies can be prepared using VelocImmune
transgenic mice into which genomic sequences bearing endogenous
mouse variable segments at the immunoglobulin heavy chain (VH, DH,
and JH segments) and/or kappa light chain (VK and JK) loci have
been replaced, in whole or in part, with human genomic sequences
bearing unrearranged germline variable segments of the human
immunoglobulin heavy chain (VH, DH, and JH) and/or kappa light
chain (VK and JK) loci (Regeneron, Tarrytown, N.Y.). See, for
example, U.S. Pat. Nos. 6,586,251, 6,596,541, 7,105,348, 6,528,313,
6,638,768, and 6,528,314.
SUMMARY OF THE INVENTION
[0015] The invention provides antibodies, antigen-binding
fragments, and antibody drug conjugates (ADCs) thereof that bind to
FLT3 proteins and polypeptide fragments of FLT3 proteins. In some
embodiments, the invention comprises fully human antibodies
conjugated with a therapeutic agent. In certain embodiments, there
is a proviso that the entire nucleic acid sequence of FIGS. 2A
and/or 2B is not encoded and/or the entire amino acid sequence of
FIGS. 3A and/or 3B is not prepared. In certain embodiments, the
entire nucleic acid sequence of FIGS. 2A and/or 2B is encoded
and/or the entire amino acid sequence of FIGS. 3A and/or 3B is
prepared, either of which are in respective human unit dose
forms.
[0016] The invention further provides various immunogenic or
therapeutic compositions, such as antibody drug conjugates, and
strategies for treating cancers that express FLT3 such as cancers
of tissues listed in Table I (e.g., AML, ALL, including B-cell
lymphoblastic leukemia and precursor B-cell lymphoblastic
leukemia).
BRIEF DESCRIPTION OF THE FIGURES
[0017] FIG. 1. The cDNA and amino acid sequence of FLT3 is shown in
FIG. 1. The start methionine is underlined. The open reading frame
extends from nucleic acid 67-3048 including the stop codon.
[0018] FIG. 2A. The cDNA and amino acid sequence of CHv62.21 heavy
chain. Double-underlined is the heavy chain variable region, and
underlined is the heavy chain human IgG1 constant region.
[0019] FIG. 2B. The cDNA and amino acid sequence of CHv62.21 light
chain and CHv62.21pAF light chain. Double-underlined is the light
chain variable region, underlined is the human kappa constant
region.
[0020] FIG. 2C. The cDNA and amino acid sequence of CHv62.21 heavy
chain modified with insertion of a non-natural amino acid. Marked
with a X is the location of the amber codon for insertion of the
non-natural amino acid ("nnAA") para-acetylphenylalanine (pAF) at
nucleic acid residue 371. Double-underlined is the heavy chain
variable region, and underlined is the heavy chain human IgG1
constant region.
[0021] FIG. 3A. The amino acid sequence of CHv62.21 heavy chain.
Double-underlined is the heavy chain variable region, and
underlined is the human IgG1 constant region.
[0022] FIG. 3B. The amino acid sequence of CHv62.21 light chain and
CHv62.21pAF light chain. Double-underlined is the light chain
variable region, and underlined is the human kappa constant
region.
[0023] FIG. 3C. The amino acid sequence of CHv62.21 heavy chain.
Amino acid position 124, marked with an X is location of the amber
codon for insertion of the non-natural amino acid ("nnAA")
para-acetylphenylalanine (pAF). Double-underlined is the heavy
chain variable region, and underlined is the human IgG1 constant
region.
[0024] FIG. 4A. Alignment of CHv62.21 heavy chain to human Ig
germline.
[0025] FIG. 4B. Alignment of CHv62.21 light chain to human Ig
germline.
[0026] FIG. 5. Efficacy and Dose Titration Study of
CHv62.21pAF-AGL-0182-30 in the subcutaneously established xenograft
model of human B myelomonocytic leukemia cell line MV4-11 implanted
in CB17/SCID mice.
[0027] FIG. 6. Efficacy Study of CHv62.21pAF-AGL-0182-30 (ADC) and
CHv62.21pAF (AGS62P) (naked antibody) in subcutaneously established
xenograft model of human B myelomonocytic leukemia cell line MV4-11
implanted in CB17 SCID mice.
[0028] FIG. 7. CHv62.21 and CHv62.21pAF does not Mediate Antibody
Dependent Cytotoxicity Activity (ADCC) in vitro EOL-1, SEM, and
Raji (left to right in the figure). Assay details: 1) E:T=100:1; 2)
Antibody concentration=2.5 .mu.g/mL; 3) Incubation time: 4H; 4)
Isotype control mAb & ADC: AGS91.1-L363-pAF,
AGS91.88-pAF-AGSL-0182-30; 5) Positive control: Rituximab targeting
Raji cells.
[0029] FIG. 8. CHv62.21 Shows Non-Ligand Blocking Activity. FLT3
ligand blocker Mab (1b37.1) which is compared with CHv62.21 in a
ligand binding assay confirms CHv62.21 Mab is a non ligand
blocker.
[0030] FIG. 9. CHv62.21 Does not Interfere with FL Mediated Cell
Proliferation.
[0031] FIG. 10. Cytotoxic Activity of a 1 b37.1 FLT3 Ligand
Blocking Mab is reduced in the presence of FL. FIG. 10(A).
Evaluation of the In-vitro cytotoxicity of v62-1b21.1-AGL-0129-08
with and without human FLT3 ligand (hFL) on RS-4-11 cells. FIG.
10(B). Evaluation of the In-vitro cytotoxicity of
v62-1b37.1-AGL-0129-08 with and without human FLT3 ligand (hFL) on
RS-4-11 cells.
[0032] FIG. 11. FLT3 Ligand Does Not Interfere with
CHv62.21pAF-AGL-0182-30 Mediated Cytotoxicity in MOLM-13 cells.
FIG. 11(A). Evaluation of the binding of biotinylated CHv62.21pAF
and v62-1b37.1 in the presence of human FLT3 Ligand on MOLM-13
cells. FIG. 11(B). Evaluation of the In-vitro cytotoxicity of
CHv62.21pAF-AGL-0182-30 with and without human FLT3 Ligand on
MOLM-13 cells.
[0033] FIG. 12. In vitro Stability of CHv62.21pAF-AGL-0182-30. FIG.
12(A). Evaluation of Stability of CHv62.21pAF-AGL-0182-30 in Human
Serum. FIG. 12(B). Evaluation of Stability of CHv62-AGL-0301-20 in
Human Serum.
[0034] FIG. 13. Efficacy Study of CHv62.21pAF-AGL-0182-30 (ADC) and
CHv62.21pAF (naked antibody) in the subcutaneously established
xenograft model of human B myelomonocytic leukemia cell line MV4-11
implanted in CB17 SCID mice using multiple dose regime.
[0035] FIG. 14. Efficacy of CHv62.21pAF-AGL-0182-30 in the
subcutaneously established SEM-xcl xenograft model.
DETAILED DESCRIPTION OF THE INVENTION
Outline of Sections
[0036] I.) Definitions
[0037] II.) FLT3 Antibodies
[0038] III.) Antibody Drug Conjugates Generally [0039] III(A).
Maytansinoids [0040] III(B). Auristatins and dolostatins [0041]
III(C). Calicheamicin [0042] III(D). Other Cytotoxic Agents
[0043] IV.) Antibody Drug Conjugates which Bind FLT3
[0044] V.) Linker Units
[0045] VI.) The Stretcher Unit
[0046] VII.) The Amino Acid Unit
[0047] VIII.) The Spacer Unit
[0048] IX.) The Drug Unit
[0049] X.) Drug Loading
[0050] XI.) Methods of Determining Cytotoxic effect of ADCs
[0051] XII.) Treatment of Cancer(s) Expressing FLT3
[0052] XIII.) FLT3 as a Target for Antibody-based Therapy
[0053] XIV.) FLT3 ADC Cocktails
[0054] XV.) Combination Therapy
[0055] XVI.) Kits/Articles of Manufacture
I.) Definitions
[0056] Unless otherwise defined, all terms of art, notations and
other scientific terms or terminology used herein are intended to
have the meanings commonly understood by those of skill in the art
to which this invention pertains. In some cases, terms with
commonly understood meanings are defined herein for clarity and/or
for ready reference, and the inclusion of such definitions herein
should not necessarily be construed to represent a substantial
difference over what is generally understood in the art. Many of
the techniques and procedures described or referenced herein are
well understood and commonly employed using conventional
methodology by those skilled in the art, such as, for example, the
widely utilized molecular cloning methodologies described in
Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd.
Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y. As appropriate, procedures involving the use of
commercially available kits and reagents are generally carried out
in accordance with manufacturer defined protocols and/or parameters
unless otherwise noted.
[0057] When a trade name is used herein, reference to the trade
name also refers to the product formulation, the generic drug, and
the active pharmaceutical ingredient(s) of the trade name product,
unless otherwise indicated by context.
[0058] The terms "advanced cancer", "locally advanced cancer",
"advanced disease" and "locally advanced disease" mean cancers that
have extended through the relevant tissue capsule, and are meant to
include stage C disease under the American Urological Association
(AUA) system, stage C1-C2 disease under the Whitmore-Jewett system,
and stage T3-T4 and N+ disease under the TNM (tumor, node,
metastasis) system. In general, surgery is not recommended for
patients with locally advanced disease, and these patients have
substantially less favorable outcomes compared to patients having
clinically localized (organ-confined) cancer.
[0059] The term "alkyl," by itself or as part of another term,
refers to a saturated C.sub.1-C.sub.12 hydrocarbon containing
normal, secondary, tertiary or cyclic carbon atoms. Particular
alkyl groups are those having 1 to 8 carbon atoms, 1 to 6 carbon
atoms, or 1 to 4 carbon atoms. Examples of alkyl groups include,
but are not limited to: methyl (Me), ethyl (Et), n-propyl,
isopropyl, butyl, isobutyl, sec-butyl, tert-butyl (tBu), n-pentyl,
isopentyl, tert-pentyl, and n-hexyl, isohexyl. In some embodiments,
an alkyl group has normal, secondary, or tertiary carbon atoms and
does not have cyclic carbon atoms.
[0060] The term "alkenyl," by itself or as part of another term,
refers to a C.sub.2-C.sub.12 hydrocarbon containing normal,
secondary, tertiary or cyclic carbon atoms with at least one site
of unsaturation, i.e., a carbon-carbon, sp.sup.2 double bond.
Particular alkenyl groups are those having 2 to 8 carbon atoms, 2
to 6 carbon atoms, or 2 to 4 carbon atoms. Examples include, but
are not limited to: vinyl (--CH.dbd.CH.sub.2), allyl
(--CH.sub.2CH.sub.2.dbd.CH.sub.2), cyclopentenyl
(--C.sub.5H.sub.7), and 5-hexenyl
(--CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.dbd.CH.sub.2). In some
embodiments, an alkenyl group has normal, secondary, or tertiary
carbon atoms and does not have cyclic carbon atoms.
[0061] The term "alkynyl," by itself or as part of another term,
refers to a C.sub.2-C.sub.12 hydrocarbon containing normal,
secondary, tertiary or cyclic carbon atoms with at least one site
of unsaturation, i.e., a carbon-carbon, sp triple bond. Particular
alkynyl groups are those having 2 to 8 carbon atoms, 2 to 6 carbon
atoms, or 2 to 4 carbon atoms. Examples include, but are not
limited to: ethynyl (--C.ident.CH) and 2-propynyl
(--CH.sub.2C.ident.CH). In some embodiments, an alkynyl group has
normal, secondary, or tertiary carbon atoms and does not have
cyclic carbon atoms.
[0062] The term "alkoxy" refers to an --O-alkyl group, where the O
is the point of attachment to the rest of the molecule, and alkyl
is as defined above.
[0063] The term "heterocycloalkyl" refers to a monocyclic, or
fused, bridged, or spiro polycyclic ring structure that is
saturated or partially saturated and has from 3 to 12 ring atoms
per ring structure selected from carbon atoms and up to three
heteroatoms selected from nitrogen, oxygen, and sulfur. Particular
heterocycloalkyl groups are those having from 3 to 8 ring atoms or
from 5 to 7 ring atoms per ring structure. The ring structure may
optionally contain up to two oxo groups on carbon or sulfur ring
members. Illustrative entities, in the form of properly bonded
moieties, include:
##STR00001##
[0064] The term "heteroaryl" refers to a monocyclic, fused
bicyclic, or fused polycyclic aromatic heterocycle (ring structure
having ring atoms selected from carbon atoms and up to four
heteroatoms selected from nitrogen, oxygen, and sulfur) having from
3 to 12 ring atoms per heterocycle. Particular heteroaryl groups
are those having from 3 to 8 ring atoms or from 5 to 7 ring atoms
per ring structure. Illustrative examples of heteroaryl groups
include the following entities, in the form of properly bonded
moieties:
##STR00002##
[0065] The terms "heterocycle," "heterocyclic," or "heterocyclyl"
as used herein encompass both the "heterocycloalkyl" and
"heteroaryl" moieties as defined above.
[0066] Those skilled in the art will recognize that the species of
heterocyclyl, heteroaryl and heterocycloalkyl groups listed or
illustrated above are not exhaustive, and that additional species
within the scope of these defined terms may also be selected.
[0067] The term "halogen" represents chlorine, fluorine, bromine,
or iodine. The term "halo" represents chloro, fluoro, bromo, or
iodo.
[0068] The term "substituted" means that the specified group or
moiety bears one or more substituents. The term "unsubstituted"
means that the specified group bears no substituents. The term
"optionally substituted" means that the specified group is
unsubstituted or substituted by one or more substituents. Where the
term "substituted" is used to describe a structural system, the
substitution is meant to occur at any valency-allowed position on
the system.
[0069] Any formula given herein is intended to represent compounds
having structures depicted by the structural formula as well as
certain variations or forms. In particular, compounds of any
formula given herein may have asymmetric centers and therefore
exist in different enantiomeric forms. All optical isomers and
stereoisomers of the compounds of the general formula, and mixtures
thereof, are considered within the scope of the formula. Thus, any
formula given herein is intended to represent a racemate, one or
more enantiomeric forms, one or more diastereomeric forms, one or
more atropisomeric forms, and mixtures thereof. Furthermore,
certain structures may exist as geometric isomers (i.e., cis and
trans isomers), as tautomers, or as atropisomers. Additionally, any
formula given herein is intended to refer also to any one of
hydrates, solvates, and amorphous and polymorphic forms of such
compounds, and mixtures thereof, even if such forms are not listed
explicitly. In some embodiments, the solvent is water and the
solvates are hydrates.
[0070] Any formula given herein is also intended to represent
unlabeled forms as well as isotopically labeled forms of the
compounds. Isotopically labeled compounds have structures depicted
by the formulas given herein except that one or more atoms are
replaced by an atom having a selected atomic mass or mass number.
Examples of isotopes that can be incorporated into compounds
described herein include isotopes of hydrogen, carbon, nitrogen,
oxygen, phosphorous, fluorine, chlorine, and iodine, such as
.sup.2H, .sup.3H, .sup.11C, .sup.13C, .sup.14C, .sup.15N, .sup.18O,
.sup.17O, .sup.31P, .sup.32P, .sup.35S, .sup.18F, .sup.36Cl, and
.sup.125I, respectively. Such isotopically labeled compounds are
useful in metabolic studies (preferably with .sup.14C), reaction
kinetic studies (with, for example .sup.2H or .sup.3H), detection
or imaging techniques [such as positron emission tomography (PET)
or single-photon emission computed tomography (SPECT)] including
drug or substrate tissue distribution assays, or in radioactive
treatment of patients. In particular, an .sup.18F or .sup.11C
labeled compound may be particularly preferred for PET or SPECT
studies. Further, substitution with heavier isotopes such as
deuterium (i.e., .sup.2H) may afford certain therapeutic advantages
resulting from greater metabolic stability, for example increased
in vivo half-life or reduced dosage requirements. Isotopically
labeled compounds described herein and prodrugs thereof can
generally be prepared by carrying out the procedures disclosed in
the schemes or in the examples and preparations described below by
substituting a readily available isotopically labeled reagent for a
non-isotopically labeled reagent.
[0071] When referring to any formula given herein, the selection of
a particular moiety from a list of possible species for a specified
variable is not intended to define the same choice of the species
for the variable appearing elsewhere. In other words, where a
variable appears more than once, the choice of the species from a
specified list is independent of the choice of the species for the
same variable elsewhere in the formula, unless stated
otherwise.
[0072] The nomenclature "C.sub.i-j" with j>i, when applied
herein to a class of substituents, is meant to refer to embodiments
of any of the compositions, uses, or methods described herein for
which each and every one of the number of carbon members, from i to
j including i and j, is independently realized. By way of example,
the term C.sub.1-3 refers independently to embodiments that have
one carbon member (C.sub.1), embodiments that have two carbon
members (C.sub.2), and embodiments that have three carbon members
(C.sub.3).
[0073] The term C.sub.n-malkyl refers to an aliphatic chain,
whether straight or branched, with a total number N of carbon
members in the chain that satisfies n.ltoreq.N.ltoreq.m, with
m>n.
[0074] Chemical names listed herein were generated using
AutoNOM.TM. software. If there is a discrepancy between a chemical
structure and the name listed for that structure, the structure
prevails.
[0075] According to the foregoing interpretive considerations on
assignments and nomenclature, it is understood that explicit
reference herein to a set implies, where chemically meaningful and
unless indicated otherwise, independent reference to embodiments of
such set, and reference to each and every one of the possible
embodiments of subsets of the set referred to explicitly.
[0076] "Altering the native glycosylation pattern" is intended for
purposes herein to mean deleting one or more carbohydrate moieties
found in native sequence FLT3 (either by removing the underlying
glycosylation site or by deleting the glycosylation by chemical
and/or enzymatic means), and/or adding one or more glycosylation
sites that are not present in the native sequence FLT3, wherein the
"native glycosylation pattern" refers to the natural
post-translational glycosylation pattern resulting from a
particular combination of FLT-3 sequence, cell type, and growth
conditions used. In addition, the phrase includes qualitative
changes in the glycosylation of the native proteins, involving a
change in the nature and proportions of the various carbohydrate
moieties present.
[0077] The term "analog" refers to a molecule which is structurally
similar or shares similar or corresponding attributes with another
molecule (e.g. a FLT3-related protein). For example, an analog of a
FLT3 protein can be specifically bound by an antibody or T cell
that specifically binds to FLT3.
[0078] The term "antibody" is used in the broadest sense unless
clearly indicated otherwise. Therefore, an "antibody" can be
naturally occurring or man-made such as monoclonal antibodies
produced by conventional hybridoma or transgenic mice technology.
FLT3 antibodies comprise monoclonal and polyclonal antibodies as
well as fragments containing the antigen-binding domain and/or one
or more complementarity determining regions of these antibodies. As
used herein, the term "antibody" refers to any form of antibody or
fragment thereof that specifically binds FLT3 and/or exhibits the
desired biological activity and specifically covers monoclonal
antibodies (including full length monoclonal antibodies),
polyclonal antibodies, multispecific antibodies (e.g., bispecific
antibodies), and antibody fragments so long as they specifically
bind FLT3 and/or exhibit the desired biological activity. Any
specific antibody can be used in the methods and compositions
provided herein. Thus, in one embodiment the term "antibody"
encompasses a molecule comprising at least one variable region from
a light chain immunoglobulin molecule and at least one variable
region from a heavy chain molecule that in combination form a
specific binding site for the target antigen. In one embodiment,
the antibody is an IgG antibody. For example, the antibody is a
IgG1, IgG2, IgG3, or IgG4 antibody. The antibodies useful in the
present methods and compositions can be generated in cell culture,
in phage, or in various animals, including but not limited to cows,
rabbits, goats, mice, rats, hamsters, guinea pigs, sheep, dogs,
cats, monkeys, chimpanzees, and apes. Therefore, in one embodiment,
an antibody of the present invention is a mammalian antibody. Phage
techniques can be used to isolate an initial antibody or to
generate variants with altered specificity or avidity
characteristics. Such techniques are routine and well known in the
art. In one embodiment, the antibody is produced by recombinant
means known in the art. For example, a recombinant antibody can be
produced by transfecting a host cell with a vector comprising a DNA
sequence encoding the antibody. One or more vectors can be used to
transfect the DNA sequence expressing at least one VL and at least
one VH region in the host cell. Exemplary descriptions of
recombinant means of antibody generation and production include
Delves, ANTIBODY PRODUCTION: ESSENTIAL TECHNIQUES (Wiley, 1997);
Shephard, et al., MONOCLONAL ANTIBODIES (Oxford University Press,
2000); Goding, MONOCLONAL ANTIBODIES: PRINCIPLES AND PRACTICE
(Academic Press, 1993); and CURRENT PROTOCOLS IN IMMUNOLOGY (John
Wiley & Sons, most recent edition). An antibody of the present
invention can be modified by recombinant means to increase efficacy
of the antibody in mediating the desired function. Thus, it is
within the scope of the invention that antibodies can be modified
by substitutions using recombinant means. Typically, the
substitutions will be conservative substitutions. For example, at
least one amino acid in the constant region of the antibody can be
replaced with a different residue. See, e.g., U.S. Pat. No.
5,624,821, U.S. Pat. No. 6,194,551, Application No. WO 9958572; and
Angal, et al., Mol. Immunol. 30: 105-08 (1993). The modification in
amino acids includes deletions, additions, and substitutions of
amino acids. In some cases, such changes are made to reduce
undesired activities, e.g., complement-dependent cytotoxicity.
Frequently, the antibodies are labeled by joining, either
covalently or non-covalently, a substance which provides for a
detectable signal. A wide variety of labels and conjugation
techniques are known and are reported extensively in both the
scientific and patent literature. These antibodies can be screened
for binding to normal or defective FLT3. See e.g., ANTIBODY
ENGINEERING: A PRACTICAL APPROACH (Oxford University Press, 1996).
Suitable antibodies with the desired biologic activities can be
identified using the following in vitro assays including but not
limited to: proliferation, migration, adhesion, soft agar growth,
angiogenesis, cell-cell communication, apoptosis, transport, signal
transduction, and the following in vivo assays such as the
inhibition of tumor growth. The antibodies provided herein can also
be useful in diagnostic applications. As capture or
non-neutralizing antibodies, they can be screened for the ability
to bind to the specific antigen without inhibiting the
receptor-binding or biological activity of the antigen. As
neutralizing antibodies, the antibodies can be useful in
competitive binding assays. They can also be used to quantify the
FLT3 or its receptor.
[0079] The term "antigen-binding fragment" or "antibody fragment"
of an antibody (or simply "antibody portion"), as used herein,
refers to one or more fragments of a FLT3 antibody that retain the
ability to specifically bind to an antigen (e.g., FLT3 and
variants; see, FIG. 1). It has been shown that the antigen-binding
function of an antibody can be performed by fragments of a
full-length antibody. Examples of binding fragments encompassed
within the term "antigen-binding fragment" of an antibody include
(i) a Fab fragment, a monovalent fragment consisting of the
V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; (ii) a F(ab').sub.2
fragment, a bivalent fragment comprising two Fab fragments linked
by a disulfide bridge at the hinge region; (iii) a Fd fragment
consisting of the V.sub.H and C.sub.H1 domains; (iv) a Fv fragment
consisting of the V.sub.L and V.sub.H domains of a single arm of an
antibody, (v) a dAb fragment (Ward et al., (1989) Nature
341:544-546), which consists of a V.sub.H domain; and (vi) an
isolated complementarily determining region (CDR). Furthermore,
although the two domains of the Fv fragment, V.sub.L and V.sub.H,
are coded for by separate genes, they can be joined, using
recombinant methods, by a synthetic linker that enables them to be
made as a single protein chain in which the V.sub.L and V.sub.H
regions pair to form monovalent molecules (known as single chain Fv
(scFv); see e.g., Bird et al. (1988) Science 242:423-426; and
Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such
single chain antibodies are also intended to be encompassed within
the term "antigen-binding fragment" of an antibody. These antibody
fragments are obtained using conventional techniques known to those
with skill in the art, and the fragments are screened for utility
in the same manner as are intact antibodies.
[0080] The term "Fc", as used herein, refers to a region comprising
a hinge region, CH.sub.2 and/or CH.sub.3 domains.
[0081] As used herein, any form of the "antigen" can be used to
generate an antibody that is specific for FLT3. Thus, the eliciting
antigen may be a single epitope, multiple epitopes, or the entire
protein alone or in combination with one or more immunogenicity
enhancing agents known in the art. The eliciting antigen may be an
isolated full-length protein, a cell surface protein (e.g.,
immunizing with cells transfected with at least a portion of the
antigen), or a soluble protein (e.g., immunizing with only the
extracellular domain portion of the protein). The antigen may be
produced in a genetically modified cell. The DNA encoding the
antigen may be genomic or non-genomic (e.g., cDNA) and encodes at
least a portion of the extracellular domain. As used herein, the
term "portion", in the context of an antigen, refers to the minimal
number of amino acids or nucleic acids, as appropriate, to
constitute an immunogenic epitope of the antigen of interest. Any
genetic vectors suitable for transformation of the cells of
interest may be employed, including but not limited to adenoviral
vectors, plasmids, and non-viral vectors, such as cationic lipids.
In one embodiment, the antibody of the methods and compositions
herein specifically bind at least a portion of the extracellular
domain of the FLT3 of interest.
[0082] The antibodies or antigen binding fragments thereof provided
herein may constitute or be part of a "bioactive agent." As used
herein, the term "bioactive agent" refers to any synthetic or
naturally occurring compound that binds the antigen and/or enhances
or mediates a desired biological effect to enhance cell-killing
toxins. In one embodiment, the binding fragments useful in the
present invention are biologically active fragments. As used
herein, the term "biologically active" refers to an antibody or
antibody fragment that is capable of binding the desired antigenic
epitope and directly or indirectly exerting a biologic effect.
Direct effects include, but are not limited to the modulation,
stimulation, and/or inhibition of a growth signal, the modulation,
stimulation, and/or inhibition of an anti-apoptotic signal, the
modulation, stimulation, and/or inhibition of an apoptotic or
necrotic signal, modulation, stimulation, and/or inhibition the
ADCC cascade, and modulation, stimulation, and/or inhibition the
CDC cascade.
[0083] The binding affinity of the antigen binding protein is
determined by the association constant (Ka) and the dissociation
constant (Kd) (KD=Kd/Ka). The binding affinity may be measured by
BIACORE for example, by capture of the test antibody onto a
protein-A coated sensor surface and flowing FLT3 over this surface.
Alternatively, the binding affinity can be measured by FORTEBIO for
example, with the test antibody receptor captured onto a protein-A
coated needle and flowing FLT3 over this surface. One of skill in
the art can identify other suitable assays known in the art to
measure binding affinity.
[0084] The term "specifically binds", as used herein in relation to
antigen binding, proteins means that the antigen binding protein
binds to the FLT3 as well as a discrete domain, or discrete amino
acid sequence, within FLT3 with no or insignificant binding to
other (for example, unrelated) proteins. This term, however, does
not exclude the fact that the antibodies or binding fragments
thereof may also be cross-reactive with closely related molecules.
The antibodies and fragments thereof as well as antibody drug
conjugates comprising these described herein may specifically bind
to FLT3, with at least 2, 5, 10, 50, 100, or 1000-fold greater
affinity than they bind to closely related molecules.
[0085] The binding of any of the antibodies disclosed herein, in
whatever form, e.g. in an antibody drug conjugate, to FLT3 could be
expected to block some or all of FL binding to FLT3. However,
herein are anti-FLT3 antibodies that do not substantially inihibit
FL binding to FLT3. In order to "substantially inhibit" binding,
one would expect a detectable amount of a decrease in binding
beyond a de minimus change; a small change in binding that is
equivalent to no more than a de minimus amount of binding as would
be expected in random protein protein interactions or in
nonspecific antibody-antigen interactions is not encompassed.
Measuring whether an antibody substantially inhibits binding of
another molecule to the target antigen can be accomplished using a
biophysical measurement or a functional measurement by methods that
are known in the art. For example, the interaction of the two
proteins can be measured directly in a physical binding assay (for
example, see Example 14, infra), or indirectly via a functional
assay that measures downstream effects of the protein interactions,
such as signaling through a receptor or the subsequent cellular
effects such as growth or inhibition of growth of a cell. Thus, the
anti-FLT3 antibodies disclosed herein that do not substantially
inhibit binding of FL to FLT3 do not cause a significant reduction
in FL binding to FLT3, and signaling of FL binding through FLT3 is
detectable.
[0086] "Bispecific" antibodies are also useful in the present
methods and compositions. As used herein, the term "bispecific
antibody" refers to an antibody, typically a monoclonal antibody,
having binding specificities for at least two different antigenic
epitopes. In one embodiment, the epitopes are from the same
antigen. In another embodiment, the epitopes are from two different
antigens. Methods for making bispecific antibodies are known in the
art. For example, bispecific antibodies can be produced
recombinantly using the co-expression of two immunoglobulin heavy
chain/light chain pairs. See, e.g., Milstein et al., Nature
305:537-39 (1983). Alternatively, bispecific antibodies can be
prepared using chemical linkage. See, e.g., Brennan, et al.,
Science 229:81 (1985). Bispecific antibodies include bispecific
antibody fragments. See, e.g., Hollinger, et al., Proc. Natl. Acad.
Sci. U.S.A. 90:6444-48 (1993), Gruber, et al., J. Immunol. 152:5368
(1994).
[0087] The monoclonal antibodies described herein specifically
include "chimeric" antibodies in which a portion of the heavy
and/or light chain is identical with or homologous to corresponding
sequences in antibodies derived from a particular species or
belonging to a particular antibody class or subclass, while the
remainder of the chain(s) is identical with or homologous to
corresponding sequences in antibodies derived from another species
or belonging to another antibody class or subclass, as well as
fragments of such antibodies, so long as they specifically bind the
target antigen and/or exhibit the desired biological activity (U.S.
Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA
81: 6851-6855 (1984)).
[0088] As used herein, the terms "cancer," "neoplasm," and "tumor,"
are used interchangeably and in either the singular or plural form,
refer to cells that have undergone a malignant transformation that
makes them pathological to the host organism. Primary cancer cells
(that is, cells obtained from near the site of malignant
transformation) can be readily distinguished from non-cancerous
cells by well-established techniques, particularly histological
examination. The definition of a cancer cell, as used herein,
includes not only a primary cancer cell, but any cell derived from
a cancer cell ancestor. This includes metastasized cancer cells,
and in vitro cultures and cell lines derived from cancer cells.
When referring to a type of cancer that normally manifests as a
solid tumor, a "clinically detectable" tumor is one that is
detectable on the basis of tumor mass; e.g., by procedures such as
CAT scan, MR imaging, X-ray, ultrasound or palpation, and/or which
is detectable because of the expression of one or more
cancer-specific antigens in a sample obtainable from a patient.
Tumors may be hematopoietic tumor, for example, tumors of blood
cells or the like, meaning liquid tumors. Specific examples of
clinical conditions based on such a tumor include leukemia such as
chronic myelocytic leukemia or acute myelocytic leukemia; myeloma
such as multiple myeloma; lymphoma and the like.
[0089] The term "therapeutic agent" refers to all agents that
provide a therapeutic benefit and/or are therapeutically effective
as defined herein. A therapeutic agent may, for example, reverse,
ameliorate, alleviate, inhibit or limit the progress of, or lessen
the severity of, a disease, disorder, or condition, or affect or
improve or ameliorate one or more symptoms of disease, such as
cancer. Such an agent may be cytotoxic or cytostatic. The term
includes, but is not limited to, chemotherapeutic agents,
anti-neoplastic agents and "Drug Unit" agents as defined
herein.
[0090] The term "anti-neoplastic agent" refers to all agents that
provide a therapeutic benefit and/or are therapeutically effective,
as defined herein, in the treatment of a neoplasm or cancer.
[0091] In some embodiments employing any of the antibody drug
conjugates and pharmaceutical compositions thereof as disclosed
herein, the antibody drug conjugate comprising a therapeutic agent,
and pharmaceutical compositions thereof, are also effective at
treating a precancer or at least one pre-neoplastic cell, for
example preventing malignant transformation to a cancerous cell. In
other embodiments, the one or more anti-neoplastic agents are also
effective at treating a precancer or at least one pre-neoplastic
cell, for example preventing malignant transformation to a
cancerous cell.
[0092] The term "Chemotherapeutic Agent" refers to all chemical
compounds that are effective in inhibiting tumor growth.
Non-limiting examples of chemotherapeutic agents include alkylating
agents; for example, nitrogen mustards, ethyleneimine compounds and
alkyl sulphonates; antimetabolites, for example, folic acid, purine
or pyrimidine antagonists; mitotic inhibitors, for example,
anti-tubulin agents such as vinca alkaloids, auristatins and
derivatives of podophyllotoxin; cytotoxic antibiotics; compounds
that damage or interfere with DNA expression or replication, for
example, DNA minor groove binders; and growth factor receptor
antagonists. In addition, chemotherapeutic agents include cytotoxic
agents (as defined herein), antibodies, biological molecules and
small molecules.
[0093] The term "compound" refers to and encompasses the chemical
compound itself as well as, whether explicitly stated or not, and
unless the context makes clear that the following are to be
excluded: amorphous and crystalline forms of the compound,
including polymorphic forms, where these forms may be part of a
mixture or in isolation; free acid and free base forms of the
compound, which are typically the forms shown in the structures
provided herein; isomers of the compound, which refers to optical
isomers, and tautomeric isomers, where optical isomers include
enantiomers and diastereomers, chiral isomers and non-chiral
isomers, and the optical isomers include isolated optical isomers
as well as mixtures of optical isomers including racemic and
non-racemic mixtures; where an isomer may be in isolated form or in
a mixture with one or more other isomers; isotopes of the compound,
including deuterium- and tritium-containing compounds, and
including compounds containing radioisotopes, including
therapeutically- and diagnostically-effective radioisotopes;
multimeric forms of the compound, including dimeric, trimeric, etc.
forms; salts of the compound, preferably pharmaceutically
acceptable salts, including acid addition salts and base addition
salts, including salts having organic counterions and inorganic
counterions, and including zwitterionic forms, where if a compound
is associated with two or more counterions, the two or more
counterions may be the same or different; and solvates of the
compound, including hemisolvates, monosolvates, disolvates, etc.,
including organic solvates and inorganic solvates, said inorganic
solvates including hydrates; where if a compound is associated with
two or more solvent molecules, the two or more solvent molecules
may be the same or different. In some instances, reference made
herein to a compound of the invention will include an explicit
reference to one or of the above forms, e.g., salts and/or
solvates; however, this reference is for emphasis only, and is not
to be construed as excluding other of the above forms as identified
above.
[0094] The terms "complementarity determining region," and "CDR,"
are known in the art to refer to non-contiguous sequences of amino
acids within antibody variable regions, which confer antigen
specificity and binding affinity. In general, there are three (3)
CDRs in each heavy chain variable region (CDR-H1, CDR-H2, CDR-H3)
and three (3) CDRs in each light chain variable region (CDR-L1,
CDR-L2, CDR-L3).
[0095] The precise amino acid sequence boundaries of a given CDR
can be readily determined using any of a number of well-known
schemes, including those described by Kabat et al. (1991),
"Sequences of Proteins of Immunological Interest," 5th Ed. Public
Health Service, National Institutes of Health, Bethesda, Md.
("Kabat" numbering scheme), Al-Lazikani et al., (1997) JMB 273,
927-948 ("Chothia" numbering scheme), MacCallum et al., J. Mol.
Biol. 262:732-745 (1996), "Antibody-antigen interactions: Contact
analysis and binding site topography," J. Mol. Biol. 262, 732-745."
(Contact" numbering scheme), Lefranc M P et al., "IMGT unique
numbering for immunoglobulin and T cell receptor variable domains
and Ig superfamily V-like domains," Dev Comp Immunol, 2003 January;
27(1):55-77 ("IMGT" numbering scheme), and Honegger A and Plickthun
A, "Yet another numbering scheme for immunoglobulin variable
domains: an automatic modeling and analysis tool," J Mol Biol, 2001
Jun. 8; 309(3):657-70, (AHo numbering scheme).
[0096] The boundaries of a given CDR may vary depending on the
scheme used for identification. For example, the Kabat scheme is
based structural alignments, while the Chothia scheme is based on
structural information. Numbering for both the Kabat and Chothia
schemes is based upon the most common antibody region sequence
lengths, with insertions accommodated by insertion letters, for
example, "30a," and deletions appearing in some antibodies. The two
schemes place certain insertions and deletions ("indels") at
different positions, resulting in differential numbering. The
Contact scheme is based on analysis of complex crystal structures
and is similar in many respects to the Chothia numbering scheme.
Table V, infra, lists the positions of CDR-L1, CDR-L2, CDR-L3 and
CDR-H1, CDR-H2, CDR-H3 as identified by the Kabat, Chothia, and
Contact schemes, respectively. For CDR-H1, residue numbering is
given listed using both the Kabat and Chothia numbering
schemes.
[0097] Thus, unless otherwise specified, the terms "CDR" and
"complementary determining region" of a given antibody or region
thereof, such as a variable region, as well as individual CDRs
(e.g., "CDR-H1, CDR-H2) of the antibody or region thereof, should
be understood to encompass the complementary determining region as
defined by any of the known schemes described herein above. In some
instances, the scheme for identification of a particular CDR or
CDRs is specified, such as the CDR as defined by the Kabat,
Chothia, or Contact method. In other cases, the particular amino
acid sequence of a CDR is given. See, for example Table V.
[0098] As used herein, the term "conservative substitution" refers
to substitutions of amino acids and/or amino acid sequences that
are known to those of skill in this art and may be made generally
without altering the biological activity of the resulting molecule.
Those of skill in this art recognize that, in general, single amino
acid substitutions in non-essential regions of a polypeptide do not
substantially alter biological activity (see, e.g., Watson, et al.,
MOLECULAR BIOLOGY OF THE GENE, The Benjamin/Cummings Pub. Co., p.
224 (4th Edition 1987)). Such exemplary substitutions are
preferably made in accordance with those set forth in Table II and
Table(s) III(a-b). For example, such changes include substituting
any of isoleucine (I), valine (V), and leucine (L) for any other of
these hydrophobic amino acids; aspartic acid (D) for glutamic acid
(E) and vice versa; glutamine (Q) for asparagine (N) and vice
versa; and serine (S) for threonine (T) and vice versa. Other
substitutions can also be considered conservative, depending on the
environment of the particular amino acid and its role in the
three-dimensional structure of the protein. For example, glycine
(G) and alanine (A) can frequently be interchangeable, as can
alanine (A) and valine (V). Methionine (M), which is relatively
hydrophobic, can frequently be interchanged with leucine and
isoleucine, and sometimes with valine. Lysine (K) and arginine (R)
are frequently interchangeable in locations in which the
significant feature of the amino acid residue is its charge and the
differing pK's of these two amino acid residues are not
significant. Still other changes can be considered "conservative"
in particular environments (see, e.g. Table III(a) herein; pages
13-15 "Biochemistry" 2nd ED. Lubert Stryer ed (Stanford
University); Henikoff et al., PNAS 1992 Vol 89 10915-10919; Lei et
al., J Biol Chem 1995 May 19; 270(20):11882-6). Other substitutions
are also permissible and may be determined empirically or in accord
with known conservative substitutions.
[0099] The term "cytotoxic agent" refers to a substance that
inhibits or prevents the expression activity of cells, function of
cells and/or causes destruction of cells. The term is intended to
include radioactive isotopes, chemotherapeutic agents, and toxins
such as small molecule toxins or enzymatically active toxins of
bacterial, fungal, plant or animal origin, including fragments
and/or variants thereof. Examples of cytotoxic agents include, but
are not limited to auristatins (e.g., auristatin E, auristatin F,
MMAE and MMAF), auromycins, maytansinoids, ricin, ricin A-chain,
combrestatin, duocarmycins, dolastatins, doxorubicin, daunorubicin,
taxols, cisplatin, cc1065, ethidium bromide, mitomycin, etoposide,
tenoposide, vincristine, vinblastine, colchicine, dihydroxy
anthracin dione, actinomycin, diphtheria toxin, Pseudomonas
exotoxin (PE) A, PE40, abrin, abrin A chain, modeccin A chain,
alpha-sarcin, gelonin, mitogellin, retstrictocin, phenomycin,
enomycin, curicin, crotin, calicheamicin, Sapaonaria officinalis
inhibitor, and glucocorticoid and other chemotherapeutic agents, as
well as radioisotopes such as At.sup.211, I.sup.131, I.sup.125,
Y.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153, Bi.sup.212 or
.sup.213, P.sup.32, radioactive isotopes of Lu including
Lu.sup.177, and toxins of the instant invention denoted
AGD-0182.
[0100] Antibodies, including antibodies of the invention, may also
be conjugated to any of the aforementioned cytotoxic agents and
also to an anti-cancer pro-drug activating enzyme capable of
converting the pro-drug to its active form.
[0101] As used herein, the term "diabodies" refers to small
antibody fragments with two antigen-binding sites, which fragments
comprise a heavy chain variable domain (V.sub.H) connected to a
light chain variable domain (V.sub.L) in the same polypeptide chain
(V.sub.H--V.sub.L). By using a linker that is too short to allow
pairing between the two domains on the same chain, the domains are
forced to pair with the complementary domains of another chain and
create two antigen-binding sites. Diabodies are described more
fully in, e.g., EP 404,097; WO 93/11161; and Hollinger et al.,
Proc. Natl. Acad. Sci. USA 90:6444-48 (1993).
[0102] The term "deplete," in the context of the effect of a FLT3
binding agent on FLT3-expressing cells, refers to a reduction in
the number of or elimination of the FLT3-expressing cells. For the
purposes of the present invention, FLT3, a.k.a., Fms like tyrosine
kinase 3 receptor, also known as Flk2 (fetal liver kinase 2), STK1
(stem cell tyrosine kinase 1) and CD135, is a member of the type
III receptor tyrosine kinases (RTKs). Human FLT3 encodes an RTK of
993 amino acids in length, which comprises membrane-bound receptor
with five immunoglobulin-like extracellular domains and two
intracellular tyrosine kinase domains (TKD) linked by a
kinase-insert domain (Stirewalt D L et al; Nat Rev Cancer;
650-665(2003). Human FLT3 gene (Gene ID No.: 2322 (National Center
for Biotechnology Information)) is located on chromosome 13q12 and
share 85% amino acid sequence homology with mouse FLT3 (Rosnet O et
al; Oncogene 8:173-179 (1993). FLT3 is expressed in normal myeloid
and lymphoid progenitor cells and by the leukemic cells of 70-90%
of AML patients (Carow, C. E et al; Blood 87: 1089-1096 (1996);
Rosnet O et al; Leukemia 10:238-248 (1996) and also in ALL.
[0103] The term "gene product" is used herein to indicate a
peptide/protein or mRNA. For example, a "gene product of the
invention" is sometimes referred to herein as a "cancer amino acid
sequence", "cancer protein", "protein of a cancer listed in Table
I", a "cancer mRNA", "mRNA of a cancer listed in Table I", etc. In
one embodiment, the cancer protein is encoded by a nucleic acid of
FIG. 1. The cancer protein can be a fragment, or alternatively, be
the full-length protein encoded by nucleic acids of FIG. 1. In one
embodiment, a cancer amino acid sequence is used to determine
sequence identity or similarity. In another embodiment, the
sequences are naturally occurring allelic variants of a protein
encoded by a nucleic acid of FIG. 1. In another embodiment, the
sequences are sequence variants as further described herein.
[0104] "Heteroconjugate" antibodies are useful in the present
methods and compositions. As used herein, the term "heteroconjugate
antibody" refers to two covalently joined antibodies. Such
antibodies can be prepared using known methods in synthetic protein
chemistry, including using crosslinking agents. See, e.g., U.S.
Pat. No. 4,676,980.
[0105] The term "homolog" refers to a molecule which exhibits
homology to another molecule, by for example, having sequences of
chemical residues that are the same or similar at corresponding
positions.
[0106] The term "identical" or "sequence identity" indicates the
degree of identity between two nucleic acid or two amino acid
sequences when optimally aligned and compared with appropriate
insertions or deletions.
[0107] The "percent identity" between two sequences is a function
of the number of identical positions shared by the sequences (i.e.,
% identity=number of identical positions/total number of positions
times 100), taking into account the number of gaps, and the length
of each gap, which need to be introduced for optimal alignment of
the two sequences. The comparison of sequences and determination of
percent identity between two sequences can be accomplished using a
mathematical algorithm, as described below.
[0108] The percent identity between two nucleotide sequences can be
determined using the GAP program in the GCG software package, using
a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80
and a length weight of 1, 2, 3, 4, 5, or 6. The percent identity
between two nucleotide or amino acid sequences can also be
determined using the algorithm of Meyers, et al., Comput. Appi.
Biosci., 4:11-17 (1988), which has been incorporated into the ALIGN
program (version 2.0), using a PAM120 weight residue table, a gap
length penalty of 12 and a gap penalty of 4. In addition, the
percent identity between two amino acid sequences can be determined
using the Needleman, et al., J. Mol. Biol. 48:444-453 (1970)
algorithm which has been incorporated into the GAP program in the
GCG software package, using either a Blossum 62 matrix or a PAM250
matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length
weight of 1, 2, 3, 4, 5, or 6.
[0109] By way of example, a polynucleotide sequence may be
identical to a reference polynucleotide sequence that is 100%
identical to the reference sequence, or it may include up to a
certain integer number of nucleotide alterations as compared to the
reference sequence, such as at least 50, 60, 70, 75, 80, 85, 90,
95, 98, or 99% identical. Such alterations are selected from at
least one nucleotide deletion, substitution, including transition
and transversion, or insertion, and wherein said alterations may
occur at the 5' or 3' terminal positions of the reference
nucleotide sequence or anywhere between those terminal positions,
interspersed either individually among the nucleotides in the
reference sequence or in one or more contiguous groups within the
reference sequence. The number of nucleotide alterations is
determined by multiplying the total number of nucleotides in the
reference polynucleotide sequence as described herein by the
numerical percent of the respective percent identity (divided by
100) and subtracting that product from said total number of
nucleotides in the reference polynucleotide sequence, or:
n.sub.n.ltoreq.x.sub.n-(x.sub.ny), wherein n.sub.n is the number of
nucleotide alterations, x.sub.n is the total number of nucleotides
in the reference polynucleotide sequence as described herein (see
the nucleic acid sequences in the "Sequence Listing" for exemplary
reference polynucleotides sequences), and y is 0.50 for 50%, 0.60
for 60%, 0.70 for 70%, 0.75 for 75%, 0.80 for 80%, 0.85 for 85%,
0.90 for 90%, 0.95 for 95%, 0.98 for 98%, 0.99 for 99% or 1.00 for
100%, is the symbol for the multiplication operator, and wherein
any non-integer product of x.sub.n and y is rounded down to the
nearest integer prior to subtracting it from x.sub.n.
[0110] Similarly, a polypeptide sequence may be identical to a
polypeptide reference sequence as described herein (see the amino
acid sequences in the "Sequence Listing" for exemplary reference
polypeptide sequences), that is 100% identical, or it may include
up to a certain integer number of amino acid alterations as
compared to the reference sequence such that the % identity is less
than 100%, such as at least 50, 60, 70, 75, 80, 85, 90, 95, 98, or
99% identical. Such alterations are selected from the group
consisting of at least one amino acid deletion, substitution,
including conservative and non-conservative substitution, or
insertion, and wherein said alterations may occur at the amino- or
carboxy-terminal positions of the reference polypeptide sequence or
anywhere between those terminal positions, interspersed either
individually among the amino acids in the reference sequence or in
one or more contiguous groups within the reference sequence. The
number of amino acid alterations for a given % identity is
determined by multiplying the total number of amino acids in the
polypeptide sequence encoded by the polypeptide reference sequence
by the numerical percent of the respective percent identity
(divided by 100) and then subtracting that product from said total
number of amino acids in the polypeptide reference sequence as
described herein (see, for example SEQ ID NOs:1-21), or:
n.sub.a.ltoreq.x.sub.a-(x.sub.ay), wherein n.sub.a is the number of
amino acid alterations, x.sub.a is the total number of amino acids
in the reference polypeptide sequence, and y is, 0.50 for 50%, 0.60
for 60%, 0.70 for 70%, 0.75 for 75%, 0.80 for 80%, 0.85 for 85%,
0.90 for 90%, 0.95 for 95%, 0.98 for 98%, 0.99 for 99%, or 1.00 for
100%, is the symbol for the multiplication operator, and wherein
any non-integer product of x.sub.a and y is rounded down to the
nearest integer prior to subtracting it from x.sub.a.
[0111] The percent identity may be determined across the length of
the sequence. As defined herein the term "over 75% identical"
includes over 75%, 80%, 85%, 95% and 99% identity as well as all
discrete values, and discrete subranges, with in this range.
[0112] In one embodiment, the antibody provided herein is a "human
antibody." As used herein, the term "human antibody" refers to an
antibody in which essentially the entire sequences of the light
chain and heavy chain sequences, including the complementary
determining regions (CDRs), are from human genes. In one
embodiment, human monoclonal antibodies are prepared by the trioma
technique, the human B-cell technique (see, e.g., Kozbor, et al.,
Immunol. Today 4: 72 (1983), EBV transformation technique (see,
e.g., Cole et al. MONOCLONAL ANTIBODIES AND CANCER THERAPY 77-96
(1985)), or using phage display (see, e.g., Marks et al., J. Mol.
Biol. 222:581 (1991)). In a specific embodiment, the human antibody
is generated in a transgenic mouse. Techniques for making such
partially to fully human antibodies are known in the art and any
such techniques can be used. According to one particularly
preferred embodiment, fully human antibody sequences are made in a
transgenic mouse engineered to express human heavy and light chain
antibody genes. An exemplary description of preparing transgenic
mice that produce human antibodies found in Application No. WO
02/43478 and U.S. Pat. No. 6,657,103 (Abgenix) and its progeny. B
cells from transgenic mice that produce the desired antibody can
then be fused to make hybridoma cell lines for continuous
production of the antibody. See, e.g., U.S. Pat. Nos. 5,569,825;
5,625,126; 5,633,425; 5,661,016; and 5,545,806; and Jakobovits,
Adv. Drug Del. Rev. 31:33-42 (1998); Green, et al., J. Exp. Med.
188:483-95 (1998).
[0113] As used herein, the term "humanized antibody" refers to
forms of antibodies that contain sequences from non-human (e.g.,
murine) antibodies as well as human antibodies. Such antibodies are
chimeric antibodies which contain minimal sequence derived from
non-human immunoglobulin. In general, the humanized antibody will
comprise substantially all of at least one, and typically two,
variable domains, in which all or substantially all of the
hypervariable loops correspond to those of a non-human
immunoglobulin and all or substantially all of the FR regions are
those of a human immunoglobulin sequence. The humanized antibody
optionally also will comprise at least a portion of an
immunoglobulin constant region (Fc), typically that of a human
immunoglobulin. See e.g., Cabilly U.S. Pat. No. 4,816,567; Queen et
al. (1989) Proc. Nat'l Acad. Sci. USA 86:10029-10033; and ANTIBODY
ENGINEERING: A PRACTICAL APPROACH (Oxford University Press
1996).
[0114] The terms "inhibit" or "inhibition of" as used herein means
to reduce by a measurable amount, or to prevent entirely.
[0115] The phrases "isolated" or "biologically pure" refer to
material which is substantially or essentially free from components
which normally accompany the material as it is found in its native
state. Thus, isolated peptides in accordance with the invention
preferably do not contain materials normally associated with the
peptides in their in situ environment. For example, a
polynucleotide is said to be "isolated" when it is substantially
separated from contaminant polynucleotides that correspond or are
complementary to genes other than the FLT3 genes or that encode
polypeptides other than FLT3 gene product or fragments thereof. A
skilled artisan can readily employ nucleic acid isolation
procedures to obtain an isolated FLT3 polynucleotide. A protein is
said to be "isolated," for example, when physical, mechanical or
chemical methods are employed to remove the FLT3 proteins from
cellular constituents that are normally associated with the
protein. A skilled artisan can readily employ standard purification
methods to obtain an isolated FLT3 protein. Alternatively, an
isolated protein can be prepared by chemical means.
[0116] Suitable "labels" include radionuclides, enzymes,
substrates, cofactors, inhibitors, fluorescent moieties,
chemiluminescent moieties, magnetic particles, and the like.
Patents teaching the use of such labels include U.S. Pat. Nos.
3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149;
and 4,366,241. In addition, the antibodies provided herein can be
useful as the antigen-binding component of fluorobodies. See e.g.,
Zeytun et al., Nat. Biotechnol. 21:1473-79 (2003).
[0117] The term "mammal" refers to any organism classified as a
mammal, including mice, rats, rabbits, dogs, cats, cows, horses and
humans. In one embodiment of the invention, the mammal is a mouse.
In another embodiment of the invention, the mammal is a human.
[0118] The terms "metastatic cancer" and "metastatic disease" mean
cancers that have spread to regional lymph nodes or to distant
sites, and are meant to include stage D disease under the AUA
system and stage T.times.N.times.M+ under the TNM system.
[0119] The term "modified", as used herein refers to the presence
of a change to a natural amino acid, a non-natural amino acid, a
natural amino acid polypepetide or a non-natural amino acid
polypeptide. Such changes, or modifications, may be obtained by
post synthesis modifications of natural amino acids, non-natural
amino acids, natural amino acid polypepetide or a non-natural amino
acid polypeptide, or by co-translation, or by post-translational
modifications of a natural amino acid, a non-natural amino acid, a
natural amino acid polypepetide or a non-natural amino acid
polypeptide.
[0120] The term "modulator" or "test compound" or "drug candidate"
or grammatical equivalents as used herein describe any molecule,
e.g., protein, oligopeptide, small organic molecule,
polysaccharide, polynucleotide, etc., to be tested for the capacity
to directly or indirectly alter the cancer phenotype or the
expression of a cancer sequence, e.g., a nucleic acid or protein
sequences, or effects of cancer sequences (e.g., signaling, gene
expression, protein interaction, etc.) In one aspect, a modulator
will neutralize the effect of a cancer protein of the invention. By
"neutralize" is meant that an activity of a protein is inhibited or
blocked, along with the consequent effect on the cell. In another
aspect, a modulator will neutralize the effect of a gene, and its
corresponding protein, of the invention by normalizing levels of
said protein. In preferred embodiments, modulators alter expression
profiles, or expression profile nucleic acids or proteins provided
herein, or downstream effector pathways. In one embodiment, the
modulator suppresses a cancer phenotype, e.g. to a normal tissue
fingerprint. In another embodiment, a modulator induced a cancer
phenotype. Generally, a plurality of assay mixtures is run in
parallel with different agent concentrations to obtain a
differential response to the various concentrations. Typically, one
of these concentrations serves as a negative control, i.e., at zero
concentration or below the level of detection.
[0121] Modulators, drug candidates, or test compounds encompass
numerous chemical classes, though typically they are organic
molecules, preferably small organic compounds having a molecular
weight of more than 100 and less than about 2,500 Daltons.
Preferred small molecules are less than 2000, or less than 1500 or
less than 1000 or less than 500 D. Candidate agents comprise
functional groups necessary for structural interaction with
proteins, particularly hydrogen bonding, and typically include at
least an amine, carbonyl, hydroxyl or carboxyl group, preferably at
least two of the functional chemical groups. The candidate agents
often comprise cyclical carbon or heterocyclic structures and/or
aromatic or polyaromatic structures substituted with one or more of
the above functional groups. Modulators also comprise biomolecules
such as peptides, saccharides, fatty acids, steroids, purines,
pyrimidines, derivatives, structural analogs or combinations
thereof. Particularly preferred are peptides. One class of
modulators are peptides, for example of from about five to about 35
amino acids, with from about five to about 20 amino acids being
preferred, and from about 7 to about 15 being particularly
preferred. Preferably, the cancer modulatory protein is soluble,
includes a non-transmembrane region, and/or, has an N-terminal Cys
to aid in solubility. In one embodiment, the C-terminus of the
fragment is kept as a free acid and the N-terminus is a free amine
to aid in coupling, i.e., to cysteine. In one embodiment, a cancer
protein of the invention is conjugated to an immunogenic agent as
discussed herein. In one embodiment, the cancer protein is
conjugated to BSA. The peptides of the invention, e.g., of
preferred lengths, can be linked to each other or to other amino
acids to create a longer peptide/protein. The modulatory peptides
can be digests of naturally occurring proteins as is outlined
above, random peptides, or "biased" random peptides. In a preferred
embodiment, peptide/protein-based modulators are antibodies, and
fragments thereof, as defined herein.
[0122] The term "monoclonal antibody", as used herein, refers to an
antibody obtained from a population of substantially homogeneous
antibodies, i.e., the individual antibodies comprising the
population are identical except for possible naturally occurring
mutations that may be present in minor amounts. Monoclonal
antibodies are highly specific, being directed against a single
antigenic epitope. In contrast, conventional (polyclonal) antibody
preparations typically include a multitude of antibodies directed
against (or specific for) different epitopes. In one embodiment,
the polyclonal antibody contains a plurality of monoclonal
antibodies with different epitope specificities, affinities, or
avidities within a single antigen that contains multiple antigenic
epitopes. The modifier "monoclonal" indicates the character of the
antibody as being obtained from a substantially homogeneous
population of antibodies, and is not to be construed as requiring
production of the antibody by any particular method. For example,
the monoclonal antibodies to be used in accordance with the present
invention may be made by the hybridoma method first described by
Kohler et al., Nature 256: 495 (1975), or may be made by
recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The
"monoclonal antibodies" may also be isolated from phage antibody
libraries using the techniques described in Clackson et al., Nature
352: 624-628 (1991) and Marks et al., J. Mol. Biol. 222: 581-597
(1991), for example. These monoclonal antibodies will usually bind
with at least a Kd of about 1 .mu.M, more usually at least about
300 nM, typically at least about 30 nM, preferably at least about
10 nM, more preferably at least about 3 nM or better, usually
determined by ELISA.
[0123] The term "monoclonal antibody", as used herein, refers to an
antibody obtained from a population of substantially homogeneous
antibodies, i.e., the individual antibodies comprising the
population are identical except for possible naturally occurring
mutations that may be present in minor amounts. Monoclonal
antibodies are highly specific, being directed against a single
antigenic epitope. In contrast, conventional (polyclonal) antibody
preparations typically include a multitude of antibodies directed
against (or specific for) different epitopes. In one embodiment,
the polyclonal antibody contains a plurality of monoclonal
antibodies with different epitope specificities, affinities, or
avidities within a single antigen that contains multiple antigenic
epitopes. The modifier "monoclonal" indicates the character of the
antibody as being obtained from a substantially homogeneous
population of antibodies, and is not to be construed as requiring
production of the antibody by any particular method. For example,
the monoclonal antibodies to be used in accordance with the present
invention may be made by the hybridoma method first described by
Kohler et al., Nature 256: 495 (1975), or may be made by
recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The
"monoclonal antibodies" may also be isolated from phage antibody
libraries using the techniques described in Clackson et al., Nature
352: 624-628 (1991) and Marks et al., J. Mol. Biol. 222: 581-597
(1991), for example. These monoclonal antibodies will usually bind
with at least a Kd of about 1 .mu.M, more usually at least about
300 nM, typically at least about 30 nM, preferably at least about
10 nM, more preferably at least about 3 nM or better, usually
determined by ELISA.
[0124] A "non-natural amino acid" or otherwise written as "nnAA"
refers to an amino acid that is not one of the twenty (20) common
amino acids or pyrolysine or selenocysteine. Other terms that may
by used synonymously with the term nnAA is "non-naturall encoded
amino acid", "unnatural amino acid", "non-naturally occurring amino
acid". Additionally, the term nnAA includes, but is not limited to,
amino acids which do not occur naturally and may be obtained
synthetically or may be obtained by modification of non-natural
amino acids. For example, for the purposes of this invention,
para-acetylphenylalanine is considered a nnAA.
[0125] The term "para-acetylphenylalanine" or "pAF" means
3-(4-acetylphenyl)-2-aminopropanoic acid as denoted by the
following chemical structure:
##STR00003##
[0126] A "pharmaceutical excipient" comprises a material such as an
adjuvant, a carrier, pH-adjusting and buffering agents, tonicity
adjusting agents, wetting agents, preservative, and the like.
[0127] "Pharmaceutically acceptable" refers to a non-toxic, inert,
and/or composition that is physiologically compatible with humans
or other mammals.
[0128] The term "polynucleotide" means a polymeric form of
nucleotides of at least 10 bases or base pairs in length, either
ribonucleotides or deoxynucleotides or a modified form of either
type of nucleotide, and is meant to include single and double
stranded forms of DNA and/or RNA. In the art, this term if often
used interchangeably with "oligonucleotide". A polynucleotide can
comprise a nucleotide sequence disclosed herein wherein thymidine
(T), as shown for example in FIG. 1, can also be uracil (U); this
definition pertains to the differences between the chemical
structures of DNA and RNA, in particular the observation that one
of the four major bases in RNA is uracil (U) instead of thymidine
(T).
[0129] The term "polypeptide" means a polymer of at least about 4,
5, 6, 7, or 8 amino acids. Throughout the specification, standard
three letter (See, Table III) or single letter designations for
amino acids are used. In the art, this term is often used
interchangeably with "peptide" or "protein".
[0130] A "recombinant" DNA or RNA molecule is a DNA or RNA molecule
that has been subjected to molecular manipulation in vitro.
[0131] As used herein, the term "single-chain Fv" or "scFv" or
"single chain" antibody refers to antibody fragments comprising the
V.sub.H and V.sub.L domains of antibody, wherein these domains are
present in a single polypeptide chain. Generally, the Fv
polypeptide further comprises a polypeptide linker between the
V.sub.H and V.sub.L domains which enables the sFv to form the
desired structure for antigen binding. For a review of sFv, see
Pluckthun, THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES, vol. 113,
Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315
(1994).
[0132] As used herein, the terms "specific", "specifically binds"
and "binds specifically" refer to the selective binding of the
antibody to the target antigen epitope. Antibodies can be tested
for specificity of binding by comparing binding to appropriate
antigen to binding to irrelevant antigen or antigen mixture under a
given set of conditions. If the antibody binds to the appropriate
antigen at least 2, 5, 7, and preferably 10 times more than to
irrelevant antigen or antigen mixture then it is considered to be
specific. In one embodiment, a specific antibody is one that only
binds the FLT3 antigen, but does not bind to the irrelevent
antigen. In another embodiment, a specific antibody is one that
binds human FLT3 antigen but does not bind a non-human FLT3 antigen
with 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 99% or greater amino acid homology with the FLT3 antigen. In
another embodiment, a specific antibody is one that binds human
FLT3 antigen but does not bind a non-human FLT3 antigen with 70%,
75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or
greater percent identity with the amino acid sequence of the FLT3
antigen. In another embodiment, a specific antibody is one that
binds human FLT3 antigen and binds murine FLT3 antigen, but with a
higher degree of binding the human antigen. In another embodiment,
a specific antibody is one that binds human FLT3 antigen and binds
primate FLT3 antigen, but with a higher degree of binding the human
antigen. In another embodiment, the specific antibody binds to
human FLT3 antigen and any non-human FLT3 antigen, but with a
higher degree of binding the human antigen or any combination
thereof.
[0133] As used herein "to treat" or "therapeutic" and grammatically
related terms, refer to any improvement of any consequence of
disease, such as prolonged survival, less morbidity, and/or a
lessening of side effects which are the byproducts of an
alternative therapeutic modality; as is readily appreciated in the
art, full eradication of disease is a preferred but albeit not a
requirement for a treatment act.
[0134] The term "variant" refers to a molecule that exhibits a
variation from a described type or norm, such as a protein that has
one or more different amino acid residues in the corresponding
position(s) of a specifically described protein (e.g. the FLT3
protein shown in FIG. 1.) An analog is an example of a variant
protein. Splice isoforms and single nucleotides polymorphisms
(SNPs) are further examples of variants.
[0135] The "FLT3 proteins" and/or "FLT3 related proteins" of the
invention include those specifically identified herein (see, FIG.
1), as well as allelic variants, conservative substitution
variants, analogs and homologs that can be isolated/generated and
characterized without undue experimentation following the methods
outlined herein or readily available in the art. Fusion proteins
that combine parts of different FLT3 proteins or fragments thereof,
as well as fusion proteins of a FLT3 protein and a heterologous
polypeptide are also included. Such FLT3 proteins are collectively
referred to as the FLT3-related proteins, the proteins of the
invention, or FLT3. The term "FLT3-related protein" refers to a
polypeptide fragment or a FLT3 protein sequence of 4, 5, 6, 7, 8,
9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
or more than 25 amino acids; or, at least 30, 35, 40, 45, 50, 55,
60, 65, 70, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135,
140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200,
225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525,
550, 575, 600, 625, 650, 675, 700, 725, 750, 775, 800, 825, 850,
875, 900, 925, 930, 935, 940, 945, 950, 955, 960, 965, 970, 975,
980, 985, 990, 991, 992, or 993 or more amino acids.
II.) FLT3 Antibodies
[0136] Another aspect of the invention provides antibodies that
bind to FLT3-related proteins (See FIG. 1). In one embodiment, the
antibody that binds to FLT3-related proteins is an antibody that
specifically binds to FLT3 protein comprising amino acid sequence
of SEQ ID NO.: 2. The antibody that specifically binds to FLT3
protein comprising amino acid sequence of SEQ ID NO.: 2 includes
antibodies that can bind to other FLT3-related proteins. For
example, antibodies that bind FLT3 protein comprising amino acid
sequence of SEQ ID NO.: 2 can bind FLT3-related proteins such as
FLT3 variants and the homologs or analogs thereof.
[0137] FLT3 antibodies of the invention are particularly useful in
cancer (see, e.g., Table I), forprognostic assays, imaging,
diagnostic, and therapeutic methodologies. In one embodiment is a
FLT3 binding assay disclosed herein for use in detection of cancer,
for example, in an immunoassay. Similarly, such antibodies are
useful (e.g. when combined with a therapeutic agent, in an ADC, in
the treatment, and/or prognosis of acute myeloid leukemia ("AML")
and acute lymphoblastic leukemia (ALL), and other cancers, to the
extent FLT3 is also expressed or overexpressed in these other
cancers. Moreover, intracellularly expressed antibodies (e.g.,
single chain antibodies) are therapeutically useful in treating
cancers in which the expression of FLT3 is involved, such as
advanced or metastatic AML or ALL cancers or other advanced or
metastatic cancers.
[0138] Various methods for the preparation of antibodies,
specifically monoclonal antibodies, are well known in the art. For
example, antibodies can be prepared by immunizing a suitable
mammalian host using a FLT3-related protein, peptide, or fragment,
in isolated or immunoconjugated form (Antibodies: A Laboratory
Manual, CSH Press, Eds., Harlow, and Lane (1988); Harlow,
Antibodies, Cold Spring Harbor Press, NY (1989)). In addition,
fusion proteins of FLT3 can also be used, such as a FLT3 GST-fusion
protein. In a particular embodiment, a GST fusion protein
comprising all or most of the amino acid sequence of FIG. 1 is
produced, and then used as an immunogen to generate appropriate
antibodies. In another embodiment, a FLT3-related protein is
synthesized and used as an immunogen.
[0139] In addition, naked DNA immunization techniques known in the
art are used (with or without purified FLT3-related protein or FLT3
expressing cells) to generate an immune response to the encoded
immunogen (for review, see Donnelly et al., 1997, Ann. Rev.
Immunol. 15: 617-648).
[0140] The amino acid sequence of a FLT3 protein as shown in FIG. 1
can be analyzed to select specific regions of the FLT3 protein for
generating antibodies. For example, hydrophobicity and
hydrophilicity analyses of a FLT3 amino acid sequence are used to
identify hydrophilic regions in the FLT3 structure. Regions of a
FLT3 protein that show immunogenic structure, as well as other
regions and domains, can readily be identified using various other
methods known in the art, such as Chou-Fasman, Gamier-Robson,
Kyte-Doolittle, Eisenberg, Karplus-Schultz or Jameson-Wolf
analysis. Hydrophilicity profiles can be generated using the method
of Hopp, T. P. and Woods, K. R., 1981, Proc. Natl. Acad. Sci.
U.S.A. 78:3824-3828. Hydropathicity profiles can be generated using
the method of Kyte, J. and Doolittle, R. F., 1982, J. Mol. Biol.
157:105-132. Percent (%) Accessible Residues profiles can be
generated using the method of Janin J., 1979, Nature 277:491-492.
Average Flexibility profiles can be generated using the method of
Bhaskaran R., Ponnuswamy P. K., 1988, Int. J. Pept. Protein Res.
32:242-255. Beta-turn profiles can be generated using the method of
Deleage, G., Roux B., 1987, Protein Engineering 1:289-294. Thus,
each region identified by any of these programs or methods is
within the scope of the present invention. Preferred methods for
the generation of FLT3 antibodies are further illustrated by way of
the examples provided herein. Methods for preparing a protein or
polypeptide for use as an immunogen are well known in the art. Also
well known in the art are methods for preparing immunogenic
conjugates of a protein with a carrier, such as BSA, KLH or other
carrier protein. In some circumstances, direct conjugation using,
for example, carbodiimide reagents are used; in other instances
linking reagents such as those supplied by Pierce Chemical Co.,
Rockford, Ill., are effective. Administration of a FLT3 immunogen
is often conducted by injection over a suitable time period and
with use of a suitable adjuvant, as is understood in the art.
During the immunization schedule, titers of antibodies can be taken
to determine adequacy of antibody formation.
[0141] FLT3 monoclonal antibodies can be produced by various means
well known in the art. For example, immortalized cell lines that
secrete a desired monoclonal antibody are prepared using the
standard hybridoma technology of Kohler and Milstein or
modifications that immortalize antibody-producing B cells, as is
generally known. Immortalized cell lines that secrete the desired
antibodies are screened by immunoassay in which the antigen is a
FLT3-related protein. When the appropriate immortalized cell
culture is identified, the cells can be expanded and antibodies
produced either from in vitro cultures or from ascites fluid.
[0142] The antibodies or fragments of the invention can also be
produced by recombinant means. Regions that bind specifically to
the desired regions of a FLT3 protein can also be produced in the
context of chimeric or complementarity-determining region (CDR)
grafted antibodies of multiple species origin. Humanized or human
FLT3 antibodies can also be produced, and are preferred for use in
therapeutic contexts. Methods for humanizing murine and other
non-human antibodies, by substituting one or more of the non-human
antibody CDRs for corresponding human antibody sequences, are well
known (see for example, Jones et al., 1986, Nature 321: 522-525;
Riechmann et al., 1988, Nature 332: 323-327; Verhoeyen et al.,
1988, Science 239: 1534-1536). See also, Carter et al., 1993, Proc.
Natl. Acad. Sci. USA 89: 4285 and Sims et al., 1993, J. Immunol.
151: 2296.
[0143] In a preferred embodiment, human monoclonal antibodies of
the invention can be prepared using VelocImmune mice into which
genomic sequences bearing endogenous mouse variable segments at the
immunoglobulin heavy chain (VH, DH, and JH segments) and/or kappa
light chain (VK and JK) loci have been replaced, in whole or in
part, with human genomic sequences bearing unrearranged germline
variable segments of the human immunoglobulin heavy chain (VH, DH,
and JH) and/or kappa light chain (VK and JK) loci (Regeneron,
Tarrytown, N.Y.). See, for example, U.S. Pat. Nos. 6,586,251,
6,596,541, 7,105,348, 6,528,313, 6,638,768, and 6,528,314.
[0144] In addition, human antibodies of the invention can be
generated using the HuMAb mouse (Medarex, Inc.) which contains
human immunoglobulin gene miniloci that encode unrearranged human
heavy (mu and gamma) and kappa light chain immunoglobulin
sequences, together with targeted mutations that inactivate the
endogenous mu and kappa chain loci (see e.g., Lonberg, et al.
(1994) Nature 368(6474): 856-859).
[0145] In another embodiment, fully human antibodies of the
invention can be raised using a mouse that carries human
immunoglobulin sequences on transgenes and transchomosomes, such as
a mouse that carries a human heavy chain transgene and a human
light chain transchromosome. Such mice, referred to herein as "KM
mice", such mice are described in Tomizuka et al. (2000) Proc.
Natl. Acad. Sci. USA 97:722-727 and PCT Publication WO 02/43478 to
Tomizuka, et al.
[0146] Human monoclonal antibodies of the invention can also be
prepared using phage display methods for screening libraries of
human immunoglobulin genes. Such phage display methods for
isolating human antibodies are established in the art. See for
example: U.S. Pat. Nos. 5,223,409; 5,403,484; and U.S. Pat. No.
5,571,698 to Ladner et al.; U.S. Pat. Nos. 5,427,908 and 5,580,717
to Dower et al.; U.S. Pat. Nos. 5,969,108 and 6,172,197 to
McCafferty et al.; and U.S. Pat. Nos. 5,885,793; 6,521,404;
6,544,731; 6,555,313; 6,582,915 and 6,593,081 to Griffiths et
al.
[0147] Human monoclonal antibodies of the invention can also be
prepared using SCID mice into which human immune cells have been
reconstituted such that a human antibody response can be generated
upon immunization. Such mice are described in, for example, U.S.
Pat. Nos. 5,476,996 and 5,698,767 to Wilson, et al.
[0148] Additionally, human antibodes of the present invention can
be made with techniques using transgenic mice, inactivated for
antibody production, engineered with human heavy and light chains
loci referred to as Xenomouse (Amgen Fremont, Inc., formerly
Abgenix, Inc.). An exemplary descritption of preparing transgenic
mice that produce human antibodies can be found in U.S. Pat. No.
6,657,103. See, also, U.S. Pat. Nos. 5,569,825; 5,625,126;
5,633,425; 5,661,016; and 5,545,806; and Mendez, et. al. Nature
Genetics, 15: 146-156 (1998); Kellerman, S. A. & Green, L. L.,
Curr. Opin. Biotechnol 13, 593-597 (2002).
[0149] Any of the methods of production above result in antibodies
that have a certain ability to bind FLT3, or homologs or fragments
or polypeptide sequences having 85, 90, 91, 92, 93, 94, 95, 96, 9,
98, or 99% sequence identity to FLT3. The binding affinity
(K.sub.D) of the antibodies, binding fragments thereof, and
antibody drug conjugates comprising the same for FLT3 may be 1 mM
or less, 100 nM or less, 10 nM or less, 2 nM or less or 1 nM or
less. Alternatively, the K.sub.D may be between 5 and 10 nM; or
between 1 and 2 nM. The K.sub.D may be between 1 micromolar and 500
micromolar or between 500 micromolar and 1 nM.
[0150] The binding affinity of the antigen binding protein is
determined by the association constant (Ka) and the dissociation
constant (Kd) (KD=Kd/Ka). The binding affinity may be measured by
BIACORE for example, by capture of the test antibody onto a
protein-A coated sensor surface and flowing FLT3 over this surface.
Alternatively, the binding affinity can be measured by FORTEBIO for
example, with the test antibody receptor captured onto a protein-A
coated needle and flowing FLT3 over this surface. One of skill in
the art can identify other suitable assays known in the art to
measure binding affinity.
[0151] The term "specifically binds", as used herein in relation to
antigen binding, proteins means that the antigen binding protein
binds to the FLT3 as well as a discrete domain, or discrete amino
acid sequence, within FLT3 with no or insignificant binding to
other (for example, unrelated) proteins. This term, however, does
not exclude the fact that the antibodies or binding fragments
thereof may also be cross-reactive with closely related molecules.
The antibodies and fragments thereof as well as antibody drug
conjugates comprising these described herein may specifically bind
to FLT3, with at least 2, 5, 10, 50, 100, or 1000-fold greater
affinity than they bind to closely related molecules.
[0152] In a preferred embodiment, an FLT3 MAbs of the invention
comprises heavy and light chain variable regions of an antibody
designated CHv62.21 produced by a Chinese Hamster Ovary (CHO) cell
deposited under the American Type Culture Collection (ATCC)
Accession No.: PTA-121831 (See, FIGS. 3A and/or 3B), or heavy and
light variable regions comprising amino acid sequences that are
homologous to the amino acid sequences of the heavy and light chain
variable regions of CHv62.21, and wherein the antibodies retain the
desired functional properties of the FLT3 MAbs of the invention.
The heavy chain variable region of CHv62.21 consists of the amino
acid sequence ranging from 1.sup.st residue (E) to the 123.sup.th
residue (S) residue of SEQ ID NO: 9, and the light chain variable
region of CHv62.21 consists of the amino acid sequence ranging from
1.sup.st residue (D) to the 108.sup.th residue (R) residue of SEQ
ID NO: 10. The CDR1-3 (Kabat) of heavy chain variable region of
CHv62.21 consists of the amino acid sequence ranging from 31-35,
from 50-65, and from 95-102 of SEQ ID NO: 9 respectively, and the
CDR1-3 (Kabat or Chothia) of the light chain variable region of
CHv62.21 consists of the amino acid sequence ranging from 24-34,
from 50-56, and from 89-97 of SEQ ID NO: 10 respectively (See, FIG.
4 and Table V). As the constant region of the antibody of the
invention, any subclass of constant region can be chosen. In one
embodiment, human IgG1 constant region as the heavy chain constant
region and human Ig kappa constant region as the light chain
constant region can be used.
[0153] For example, the invention provides an isolated monoclonal
antibody, or antigen binding portion thereof, comprising a heavy
chain variable region and a light chain variable region,
wherein:
[0154] (a) the heavy chain variable region comprises an amino acid
sequence that is at least 80% identical to heavy chain variable
region amino acid sequence set forth in FIGS. 3A and/or 3B; and
[0155] (b) the light chain variable region comprises an amino acid
sequence that is at least 80% identical to the light chain variable
region amino acid sequence set forth in FIGS. 3A and/or 3B.
[0156] In other embodiments, the V.sub.H and/or V.sub.L amino acid
sequences are 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98% or 99% identical to the V.sub.H and V.sub.L
sequences set forth in FIGS. 3A and/or 3B. The disclosure herein
also provides for polynucleotides or nucleic acids encoding a or b,
or the VH or VL sequences set forth in FIGS. 3A and/or 3B, as well
as polynucleotides or nucleic acids that are 85%, 86%, 87%, 88%,
89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% percent
identical to these.
[0157] In another embodiment, the invention provides an isolated
monoclonal antibody, or antigen binding portion thereof, comprising
a humanized heavy chain variable region and a humanized light chain
variable region, wherein:
[0158] (a) the heavy chain variable region comprises
complementarity determining regions (CDRs) having the amino acid
sequences of the heavy chain variable region CDRs set forth in
FIGS. 3A and/or 3B;
[0159] (b) the light chain variable region comprises CDRs having
the amino acid sequences of the light chain variable region CDRs
set forth in FIGS. 3A and/or 3B.
[0160] Engineered antibodies of the invention include those in
which modifications have been made to framework residues within
V.sub.H and/or V.sub.L (e.g. to improve the properties of the
antibody). Typically such framework modifications are made to
decrease the immunogenicity of the antibody. For example, one
approach is to "backmutate" one or more framework residues to the
corresponding germline sequence. More specifically, an antibody
that has undergone somatic mutation may contain framework residues
that differ from the germline sequence from which the antibody is
derived. Such residues can be identified by comparing the antibody
framework sequences to the germline sequences from which the
antibody is derived. To return the framework region sequences to
their germline configuration, the somatic mutations can be
"backmutated" to the germline sequence by, for example,
site-directed mutagenesis or PCR-mediated mutagenesis (e.g.,
"backmutated" from leucine to methionine). Such "backmutated"
antibodies are also intended to be encompassed by the
invention.
[0161] Another type of framework modification involves mutating one
or more residues within the framework region, or even within one or
more CDR regions, to remove T-cell epitopes to thereby reduce the
potential immunogenicity of the antibody. This approach is also
referred to as "deimmunization" and is described in further detail
in U.S. Patent Publication No. 2003/0153043 by Carr, et al.
[0162] In addition or alternative to modifications made within the
framework or CDR regions, antibodies of the invention may be
engineered to include modifications within the Fc region, typically
to alter one or more functional properties of the antibody, such as
serum half-life, complement fixation, Fc receptor binding, and/or
antigen-dependent cellular cytotoxicity. Furthermore, a FLT3 MAb of
the invention may be chemically modified (e.g., one or more
chemical moieties can be attached to the antibody) or be modified
to alter its glycosylation, again to alter one or more functional
properties of the MAb. Each of these embodiments is described in
further detail below.
[0163] In one embodiment, the hinge region of CH1 is modified such
that the number of cysteine residues in the hinge region is
altered, e.g., increased or decreased. This approach is described
further in U.S. Pat. No. 5,677,425 by Bodmer, et al. The number of
cysteine residues in the hinge region of CH1 is altered to, for
example, facilitate assembly of the light and heavy chains or to
increase or decrease the stability of the FLT3 MAb.
[0164] In another embodiment, the Fc hinge region of an antibody is
mutated to decrease the biological half life of the FLT3 MAb. More
specifically, one or more amino acid mutations are introduced into
the CH2-CH3 domain interface region of the Fc-hinge fragment such
that the antibody has impaired Staphylococcyl protein A (SpA)
binding relative to native Fc-hinge domain SpA binding. This
approach is described in further detail in U.S. Pat. No. 6,165,745
by Ward, et al.
[0165] In another embodiment, the FLT3 MAb is modified to increase
its biological half life. Various approaches are possible. For
example, mutations can be introduced as described in U.S. Pat. No.
6,277,375 to Ward. Alternatively, to increase the biological half
life, the antibody can be altered within the CH1 or CL region to
contain a salvage receptor binding epitope taken from two loops of
a CH2 domain of an Fc region of an IgG, as described in U.S. Pat.
Nos. 5,869,046 and 6,121,022 by Presta et al.
[0166] In yet other embodiments, the Fc region is altered by
replacing at least one amino acid residue with a different amino
acid residue to alter the effector function(s) of the FLT3 MAb. For
example, one or more amino acids selected from amino acid specific
residues can be replaced with a different amino acid residue such
that the antibody has an altered affinity for an effector ligand
but retains the antigen-binding ability of the parent antibody. The
effector ligand to which affinity is altered can be, for example,
an Fc receptor or the C1 component of complement. This approach is
described in further detail in U.S. Pat. Nos. 5,624,821 and
5,648,260, both by Winter, et al.
[0167] In another embodiment, heavy chain is altered by replacing
at least one amino acid residue with non-natural amino acid through
the ReCODE technology developed by Ambrx (La Jolla, Calif.). One
example of non-natural amino acid is para-acetylphenylalanine.
[0168] Reactivity of FLT3 antibodies with a FLT3-related protein
can be established by a number of well known means, including
Western blot, immunoprecipitation, ELISA, and FACS analyses using,
as appropriate, FLT3-related proteins, FLT3-expressing cells or
extracts thereof. A FLT3 antibody or fragment thereof can be
labeled with a detectable marker or conjugated to a second
molecule. Suitable detectable markers include, but are not limited
to, a radioisotope, a fluorescent compound, a bioluminescent
compound, chemiluminescent compound, a metal chelator or an enzyme.
Further, bi-specific antibodies specific for two or more FLT3
epitopes are generated using methods generally known in the art.
Homodimeric antibodies can also be generated by cross-linking
techniques known in the art (e.g., Wolff et al., Cancer Res. 53:
2560-2565).
[0169] In yet another preferred embodiment, the FLT3 MAb of the
invention is an antibody comprising heavy and light chain of an
antibody designated CHv62.21. The heavy chain of CHv62.21 consists
of the amino acid sequence ranging from 1.sup.st residue (E) to the
453.sup.rd residue (K) of SEQ ID NO: 9 and the light chain of
CHv62.21 consists of amino acid sequence ranging from 1.sup.st
residue (D) to the 214.sup.th residue (C) of SEQ ID NO: 10
sequence. The sequence of which is set forth in FIGS. 2A and/or 2B
and FIGS. 3A and/or 3B. In a preferred embodiment, CHv62.21 is
modified with a non-natural amino acid ("nnAA") and conjugated to a
cytotoxic agent. In one embodiment, the nnAA is pAF. In a preferred
embodiment, the cytotoxic agent is specifically conjugated at the
nnAA.
[0170] In yet another embodiment, the FLT3 MAb of the invention is
produced by the method of producing an antibody or antigen binding
fragment comprising culturing a host cell to allow expression of
antibody or antigen binding fragment, wherein the host cell is
selected from the group consisting of the following (a) to (c):
[0171] (a) a host cell transfected with an expression vector
comprising a polynucleotide comprising a base sequence encoding a
heavy chain variable region consisting of the amino acid sequence
ranging from the 1st E to the 123.sup.rd S of SEQ ID NO: 9 and a
polynucleotide comprising a base sequence encoding a light chain
variable region consisting of the amino acid sequence ranging from
the 1st D to the 108th R of SEQ ID NO: 10; [0172] (b) a host cell
transfected with an expression vector comprising a polynucleotide
comprising a base sequence encoding a heavy chain variable region
consisting of the amino acid sequence ranging from the 1st E to the
123.sup.rd S of SEQ ID NO: 9 and an expression vector comprising a
polynucleotide comprising a base sequence encoding a light chain
variable region consisting of the amino acid sequence ranging from
the 1st D to the 108th R SEQ ID NO: 10; and [0173] (c) a host cell
transfected with an expression vector comprising a polynucleotide
comprising a base sequence encoding a heavy chain variable region
consisting of the amino acid sequence ranging from the 1st E to the
123.sup.rd S of SEQ ID NO: 9 and a host cell transfected with an
expression vector comprising a polynucleotide comprising a base
sequence encoding a light chain variable region consisting of the
amino acid sequence ranging from the 1st D to the 108th R of SEQ ID
NO: 10.
[0174] In yet another embodiment, the FLT3 MAb of the invention is
produced by the method of producing an antibody comprising
culturing a host cell to allow expression of antibody, wherein the
host cell is selected from the group consisting of the following
(a) to (c): [0175] (a) a host cell transformed with an expression
vector comprising a polynucleotide comprising a base sequence
encoding a heavy chain consisting of the amino acid sequence
ranging from the 1st E to the 453.sup.rd K of SEQ ID NO: 9 and a
polynucleotide comprising a base sequence encoding a light chain
consisting of the amino acid sequence ranging from the 1st D to the
214th C of SEQ ID NO: 10; [0176] (b) a host cell transformed with
an expression vector comprising a polynucleotide comprising a base
sequence encoding a heavy chain consisting of the amino acid
sequence ranging from the 1st E to the 453.sup.rd K of SEQ ID NO: 9
and an expression vector comprising a polynucleotide comprising a
base sequence encoding a light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO: 10;
and (c) a host cell transformed with an expression vector
comprising a polynucleotide comprising a base sequence encoding a
heavy chain consisting of the amino acid sequence ranging from the
1st E to the 453th K of SEQ ID NO: 9 and a host cell transformed
with an expression vector comprising a polynucleotide comprising a
base sequence encoding a light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO:
10.
[0177] The Chinese Hamster Ovary (CHO) cell producing the antibody
designated CHv62.21 was sent (via Federal Express) to the American
Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108
on 9 Dec. 2014 and assigned Accession number PTA-121831.
[0178] Alternatively, or additionally, in another embodiment of the
invention, the MAbs which bind FLT3, in this case, the MAb CHv62.21
may undergo post-translational modifications as known in the art.
Examples of post-translational modifications include, but are not
limited to, chemical modifications, such as disulfide bonds,
oligosaccharides, N-terminal pyroglutamate formation, C-terminal
lysine processing, deamidation, isomerization, oxidation,
glycation, peptide bond cleavage, non-reductible cross-linking,
truncation and others known in the art. See, Liu, et. al.,
Heterogeneity of Monoclonal Antibodies, J. Pharma. Sci. vol. 97,
no. 7, pp. 2426-2447 (July 2008). Other types of modifications
include noncovalent interaction, conformational heterogeneity, and
aggregation. Id.
[0179] In a further embodiment, the CHv62.21 MAb comprises a
cyclization of the N-terminal heavy chain Glutamate at residue 1 to
Pyro-Glutamate. One of skill in the art will understand and
appreciate that such cyclization is understood to occur
spontaneously. See, Dick, et. al., Determination of the Origin of
the N-Terminal Pyro-Glutamtate Variation in Monoclonal Antibodies
Using Model Peptides, Biotechnology and Bioengineering, vol. 97,
no. 3, pp 544-553 (Jun. 15, 2007).
[0180] Additionally or alternatively, amino acids of the CHv62.21
MAb may undergo further post-translational modifications including,
but not limited to, deamidation, isomerization, glycation, and/or
oxidation. The polypeptides of the invention, or the fragments
thereof, may undergo additional post-translational modifications,
including glycosylation, for example N-linked or O-linked
glycosylation sites that are well known in the art. As previous
described, changes may be made in the amino acid sequence of the
polypeptide or process conditions (such as changes in culture,
purification, and/or storage conditions) to preclude or minimize
such alterations, or to facilitate them in circumstances where such
processing is beneficial. Moreover, such preparations may comprise
polypeptides that have varying levels of more than one type of
processing related modification(s), for example, a polypeptide may
have some, most, or substantially all of a C-terminal lysine
removed and/or some, most, or substantially all of an N-terminal
amino acid converted to pyroglutamatic acid (for example, the
polypeptides shown in FIGS. 2A and/or 2B or FIGS. 3A and/or 3B or
in the consensus sequences or antigen-binding fragments). Process
conditions such as varying buffer composition and temperature can
have significant effects on the extent of such modifications.
[0181] In a further embodiment, the CHv62.21 MAb comprises a
truncation of the C-terminal heavy chain Lysine at residue 453 of
SEQ ID NO: 9.
[0182] In a further embodiment, the CHv62.21 MAb comprises an
addition of glycosylation(s) to the heavy chain Asparagine at
residue 303 including, but not limited to, GO (Asialo-, agalacto,
afucosylated bi-antennary complex-type N-glycan; GOF (Asialo-,
agalacto, core-fucosylated bi-antennary complex-type N-glycan);
Mannose-5 (N-linked Oligomannose-5); G1F (Asialo-, monogalacto,
core-fucosylated bi-antennary complex-type N-glycan); G2 (Asialo-,
bigalacto, afucosylated bi-antennary complex-type N-glycan); G2F
(Asialo-. bigalacto, core-fucosylated bi-antennary complex-type
N-glycan); A1 (monosialylated, biantennary N-linked
oligosaccharide, Neu5Acid); and/or A2 (Disialylated, biantennary
N-linked oligosaccharaide Neu5Acid).
[0183] Additionally, or alternatively in another embodiment, the
CHv62.21 MAb comprises the addition of glycation(s) to to one or
more Serine residues of the light chain. Generally, glycation
results from the nonenzymatic reaction between reducing sugars and
the N-terminal primary amine or the amine group of lysine side
chains. One of skill in the art will understand and appreciate that
glycation can mask the positive charge on the N-terminal primary
amino acid group or the side chain of lysine residues, which will
make the antibody more acidic.
[0184] The amino acid sequence of the polypeptides of the invention
may be verified by any means known in the art (for example, mass
spectrometry) and may be identical to the sequences disclosed
herein (See, FIGS. 2A and/or 2B and FIGS. 3A and/or 3B) or may
differ from those sequences at one or more amino acid residues as a
result of post-translational modification processing. By way of
non-limiting example, on all or a portion of the substantially
homogenous polypeptides, a C-terminal amino acid from either the
light chain or heavy chain may be removed, by proteolytic
processing or other processing that occurs during culture.
Similarly, N-terminal amino acids may be absent, for eample, one
(1), two (2), three (3), four (4), or five (5) N-terminal amino
acids may be absent.
[0185] In another embodiment, the the heavy chain variable region
of CHv62.21 MAb is selected from the group consisting of an amino
acid sequence ranging from residue 1 (E) to residue 123 (S) of SEQ
ID NO: 9 and an amino acid sequence ranging from residue 1 (E) to
residue 123 (S) of SEQ ID NO: 9 wherein the N-terminal residue 1
(E) is converted to pyroglutamic acid.
[0186] In another embodiment, the the heavy chain of CHv62.21 MAb
is selected from the group consisting of an amino acid sequence
ranging from residue 1 (E) to residue 453 (K) of SEQ ID NO: 9, an
amino acid sequence ranging from residue 1 (E) to residue 453 (K)
of SEQ ID NO: 9 wherein the N-terminal residue 1 (E) is converted
to pyroglutamic acid, an amino acid sequence ranging from residue 1
(E) to residue 453 (K) of SEQ ID NO: 9 wherein the C-terminal
residue 453 (K) is removed, and an amino acid sequence ranging from
residue 1 (E) to residue 453 (K) of SEQ ID NO: 9 wherein the
N-terminal residue 1 (E) is converted to pyroglutamic acid and the
C-terminal residue 453 (K) is removed.
[0187] In another embodiment, the CHv62.21 MAb or antigen-binding
fragment thereof is a recombinantly-produced mixture of proteins
obtained by expression in a host cell, wherein the heavy chain
variable region of the antibody or antigen-binding fragment thereof
is selected from the group consisting of an amino acid sequence
ranging from residue 1 (E) to residue 123 (S) of SEQ ID NO: 9 and
an amino acid sequence ranging from residue 1 (E) to residue 123
(S) of SEQ ID NO: 9 wherein the N-terminal residue 1 (E) is
converted to pyroglutamic acid.
[0188] In another embodiment, the CHv62.21 MAb is a
recombinantly-produced mixture of proteins obtained by expression
in a host cell, wherein the heavy chain of the antibody is selected
from the group consisting of an amino acid sequence ranging from
residue 1 (E) to residue 453 (K) of SEQ ID NO: 9, an amino acid
sequence ranging from residue 1 (E) to residue 453 (K) of SEQ ID
NO: 9 wherein the N-terminal residue 1 (E) is converted to
pyroglutamic acid, an amino acid sequence ranging from residue 1
(E) to residue 453 (K) of SEQ ID NO: 9 wherein the C-terminal
residue 453 (K) is removed, and an amino acid sequence ranging from
residue 1 (E) to residue 453 (K) of SEQ ID NO: 9 wherein the
N-terminal residue 1 (E) is converted to pyroglutamic acid and the
C-terminal residue 453 (K) is removed.
[0189] In another embodiment, the CHv62.21 MAb comprises the heavy
chain consisting of the amino acid sequence ranging from the 1st E
to the 453.sup.rd K of SEQ ID NO: 9 wherein 1st E is modified to
pyro-glutamate and the light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO:
10.
[0190] In another embodiment, the CHv62.21 MAb comprises the heavy
chain consisting of the amino acid sequence ranging from the 1st E
to the 453.sup.rd K of SEQ ID NO: 9 and the light chain consisting
of the amino acid sequence ranging from the 1st D to the 214th C of
SEQ ID NO: 10.
[0191] In another embodiment, the CHv62.21 MAb comprises the heavy
chain consisting of the amino acid sequence ranging from the 1st E
to the 453.sup.rd K of SEQ ID NO: 9 wherein the 1st E is modified
to pyro-glutamate and the C-terminal residue 453.sup.rd K is
removed and the light chain consisting of the amino acid sequence
ranging from the 1st D to the 214th C of SEQ ID NO: 10.
[0192] In another embodiment, the CHv62.21 MAb comprises the heavy
chain consisting of the amino acid sequence ranging from the 1st E
to the 453.sup.rd K of SEQ ID NO: 9 wherein the C-terminal residue
453.sup.rd K is removed and the light chain consisting of the amino
acid sequence ranging from the 1st D to the 214th C of SEQ ID NO:
10.
[0193] In a further preferred embodiment of the invention, the FLT3
MAbs of the invention, and specifically, the MAb denoted CHv62.21
is modified with a non-natural amino acid ("nnAA") in the heavy
chain. In a preferred embodiment, an amber codon is located at
amino acid position 124 of SEQ ID NO: 11 for insertion of a nnAA
denoted para-acetylphenylalanine (FIG. 3C). Modified CHv62.21 is
denoted CHv62.21pAF for the purposes of this invention.
[0194] Accordingly, in a preferred embodiment of the invention,
CHv62.21pAF comprises the following:
[0195] A heavy chain variable region consists of the amino acid
sequence ranging from 1.sup.st residue (E) to the 123.sup.th
residue (S) residue of SEQ ID NO: 11, and a light chain variable
region consists of the amino acid sequence ranging from 1.sup.st
residue (D) to the 108.sup.th residue (R) residue of SEQ ID NO: 10.
The CDR1-3 (Kabat) of heavy chain variable region consists of the
amino acid sequence ranging from 31-35, from 50-65, and from 95-102
of SEQ ID NO: 11 respectively, and the CDR1-3 (Kabat or Chothia) of
the light chain variable region consists of the amino acid sequence
ranging from from 24-34, from 50-56, and from 89-97 of SEQ ID NO:
10 respectively (See, FIG. 3B, FIG. 3C and Table V).
[0196] A heavy chain consisting of the amino acid sequence ranging
from 1.sup.st residue (E) to the 453.sup.rd residue (K) of SEQ ID
NO: 11 with a nnAA of para-acetylphenylalanine inserted at residue
124 of SEQ ID NO: 11 and a light chain of CHv62.21 consisting of
amino acid sequence ranging from 1.sup.st residue (D) to the
214.sup.th residue (C) of SEQ ID NO: 10. The sequences of which is
set forth in FIGS. 2B and/or 2C and FIGS. 3B and/or 3C. In a
preferred embodiment, CHv62.21pAF is conjugated to a cytotoxic
agent.
[0197] In yet another embodiment, the FLT3 MAb of the invention is
produced by the method of producing an antibody or antigen binding
fragment comprising culturing a host cell to allow expression of
antibody or antigen binding fragment, wherein the host cell is
selected from the group consisting of the following (a) to (c):
[0198] (a) a host cell transfected with an expression vector
comprising a polynucleotide comprising a base sequence encoding a
heavy chain variable region consisting of the amino acid sequence
ranging from the 1st E to the 123.sup.rd S of SEQ ID NO: 11 and a
polynucleotide comprising a base sequence encoding a light chain
variable region comprising the amino acid sequence ranging from the
1st D to the 108th R SEQ ID NO: 10; [0199] (b) a host cell
transfected with an expression vector comprising a polynucleotide
comprising a base sequence encoding a heavy chain variable region
consisting of the amino acid sequence ranging from the 1st E to the
123.sup.rd S of SEQ ID NO: 11 and an expression vector comprising a
polynucleotide comprising a base sequence encoding a light chain
variable region comprising the amino acid sequence ranging from the
1st D to the 108th R SEQ ID NO: 10; and [0200] (c) a host cell
transfected with an expression vector comprising a polynucleotide
comprising a base sequence encoding a heavy chain variable region
consisting of the amino acid sequence ranging from the 1st E to the
123.sup.rd S of SEQ ID NO: 11 and a host cell transfected with an
expression vector comprising a polynucleotide comprising a base
sequence encoding a light chain variable region comprising the
amino acid sequence ranging from the 1st D to the 108th R of SEQ ID
NO: 10.
[0201] In yet another embodiment, the FLT3 MAb of the invention is
produced by the method of producing an antibody comprising
culturing a host cell to allow expression of antibody, wherein the
host cell is selected from the group consisting of the following
(a) to (c): [0202] (a) a host cell transformed with an expression
vector comprising a polynucleotide comprising a base sequence
encoding a heavy chain consisting of the amino acid sequence
ranging from the 1st E to the 453.sup.rd K of SEQ ID NO: 11 and a
polynucleotide comprising a base sequence encoding a light chain
consisting of the amino acid sequence ranging from the 1st D to the
214th C of SEQ ID NO: 10; [0203] (b) a host cell transformed with
an expression vector comprising a polynucleotide comprising a base
sequence encoding a heavy chain consisting of the amino acid
sequence ranging from the 1st E to the 453.sup.rd K of SEQ ID NO:
11 and an expression vector comprising a polynucleotide comprising
a base sequence encoding a light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO: 10;
and (c) a host cell transformed with an expression vector
comprising a polynucleotide comprising a base sequence encoding a
heavy chain consisting of the amino acid sequence ranging from the
1st E to the 453rd K of SEQ ID NO: 11 and a host cell transformed
with an expression vector comprising a polynucleotide comprising a
base sequence encoding a light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO:
10;
[0204] In yet another embodiment, the FLT3 MAb of the invention is
produced by the method of producing an antibody comprising
culturing a host cell to allow expression of antibody, wherein the
host cell is selected from the group consisting of the following
(a) to (d): [0205] (a) a host cell transformed with an expression
vector comprising a polynucleotide comprising a base sequence
encoding a heavy chain consisting of the amino acid sequence
ranging from the 1st E to the 453.sup.rd K of SEQ ID NO: 11 and a
polynucleotide comprising a base sequence encoding a light chain
consisting of the amino acid sequence ranging from the 1st D to the
214th C of SEQ ID NO: 10; [0206] (b) a host cell transformed with
an expression vector comprising a polynucleotide comprising a base
sequence encoding a heavy chain consisting of the amino acid
sequence ranging from the 1st E to the 453.sup.rd K of SEQ ID NO:
11 and an expression vector comprising a polynucleotide comprising
a base sequence encoding a light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO: 10;
(c) a host cell transformed with an expression vector comprising a
polynucleotide comprising a base sequence encoding a heavy chain
consisting of the amino acid sequence ranging from the 1st E to the
453rd K of SEQ ID NO: 11 and a host cell transformed with an
expression vector comprising a polynucleotide comprising a base
sequence encoding a light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO: 10;
and [0207] (d) a host cell transformed with an expression vector
comprising a polynucleotide comprising a base sequence encoding a
heavy chain consisting of the amino acid sequence ranging from the
1.sup.st E to the 452.sup.rd G of SEQ ID NO: 11 wherein the
1.sup.st E is modified to pyroglutamate and the light chain
consisting of the amino acid sequence ranging from the 1.sup.st D
to the 214.sup.th C of SEQ ID NO: 10.
[0208] In another embodiment, the the heavy chain variable region
of CHv62.21pAF MAb is selected from the group consisting of an
amino acid sequence ranging from residue 1 (E) to residue 123 (S)
of SEQ ID NO: 11 and an amino acid sequence ranging from residue 1
(E) to residue 123 (S) of SEQ ID NO: 11 wherein the N-terminal
residue 1 (E) is converted to pyroglutamic acid.
[0209] In another embodiment, the the heavy chain of CHv62.21pAF
MAb is selected from the group consisting of an amino acid sequence
ranging from residue 1 (E) to residue 453 (K) of SEQ ID NO: 11, an
amino acid sequence ranging from residue 1 (E) to residue 453 (K)
of SEQ ID NO: 11 wherein the N-terminal residue 1 (E) is converted
to pyroglutamic acid, an amino acid sequence ranging from residue 1
(E) to residue 453 (K) of SEQ ID NO: 11 wherein the C-terminal
residue 453 (K) is removed, and an amino acid sequence ranging from
residue 1 (E) to residue 453 (K) of SEQ ID NO: 11 wherein the
N-terminal residue 1 (E) is converted to pyroglutamic acid and the
C-terminal residue 453 (K) is removed.
[0210] In another embodiment, the CHv62.21pAF MAb or
antigen-binding fragment thereof is a recombinantly-produced
mixture of proteins obtained by expression in a host cell, wherein
the heavy chain variable region of the antibody or antigen-binding
fragment thereof is selected from the group consisting of an amino
acid sequence ranging from residue 1 (E) to residue 123 (S) of SEQ
ID NO: 11 and an amino acid sequence residue 1 (E) to residue 123
(S) of SEQ ID NO: 11 wherein the N-terminal residue 1 (E) is
converted to pyroglutamic acid.
[0211] In another embodiment, the CHv62.21pAF MAb is a
recombinantly-produced mixture of proteins obtained by expression
in a host cell, wherein the heavy chain is selected from the group
consisting of an amino acid sequence ranging from residue 1 (E) to
residue 453 (K) of SEQ ID NO: 11, an amino acid sequence ranging
from residue 1 (E) to residue 453 (K) of SEQ ID NO: 11 wherein the
N-terminal residue 1 (E) is converted to pyroglutamic acid, an
amino acid sequence ranging from residue 1 (E) to residue 453 (K)
of SEQ ID NO: 11 wherein the C-terminal residue 453 (K) is removed,
and an amino acid sequence ranging from residue 1 (E) to residue
453 (K) of SEQ ID NO: 11 wherein the N-terminal residue 1 (E) is
converted to pyroglutamic acid and the C-terminal residue 453 (K)
is removed.
[0212] In another embodiment, the CHv62.21pAF MAb comprises the
heavy chain consisting of the amino acid sequence ranging from the
1st E to the 453.sup.rd K of SEQ ID NO: 11 and the light chain
consisting of the amino acid sequence ranging from the 1st D to the
214th C of SEQ ID NO: 10.
[0213] In another embodiment, the CHv62.21pAF MAb comprises the
heavy chain consisting of the amino acid sequence ranging from the
1st E to the 453.sup.rd K of SEQ ID NO: 11 wherein the 1st E is
modified to pyro-glutamate and the light chain consisting of the
amino acid sequence ranging from the 1st D to the 214th C of SEQ ID
NO: 10.
[0214] In another embodiment, the CHv62.21pAF MAb comprises the
heavy chain consisting of the amino acid sequence ranging from the
1st E to the 453.sup.rd K of SEQ ID NO: 11 wherein the 1st E is
modified to pyro-glutamate and the C-terminal residue 453.sup.rd K
is removed and the light chain consisting of the amino acid
sequence ranging from the 1st D to the 214th C of SEQ ID NO:
10.
[0215] In another embodiment, the CHv62.21pAF MAb comprises the
heavy chain consisting of the amino acid sequence ranging from the
1st E to the 453.sup.rd K of SEQ ID NO: 11 wherein the C-terminal
residue 453.sup.rd K is removed and the light chain consisting of
the amino acid sequence ranging from the 1st D to the 214th C of
SEQ ID NO: 10.
[0216] The Chinese Hamster Ovary (CHO) cell producing the antibody
designated CHv62.21pAF was sent (via Federal Express) to the
American Type Culture Collection (ATCC), P.O. Box 1549, Manassas,
Va. 20108 on 9 Dec. 2014 and assigned Accession number
PTA-121836.
III.) Antibody-Drug Conjugates Generally
[0217] In another aspect, the invention provides antibody-drug
conjugates (ADCs), comprising an antibody conjugated to a
therapeutic agent. The therapeutic agent maybe a cytotoxic agent, a
cytostatic agent, a chemotherapeutic agent, a drug, a growth
inhibitory agent, a toxin (e.g., an enzymatically active toxin of
bacterial, fungal, plant, or animal origin, or fragments thereof),
or a radioactive isotope (i.e., a radioconjugate). In another
aspect, the invention further provides methods of using the ADCs.
In one aspect, an ADC comprises any of the above FLT3 MAbs
covalently attached or attached via oxime bond to a cytotoxic agent
or a detectable agent.
[0218] The use of antibody-drug conjugates for the local delivery
of cytotoxic or cytostatic agents, i.e. drugs to kill or inhibit
tumor cells in the treatment of cancer (Syrigos and Epenetos (1999)
Anticancer Research 19:605-614; Niculescu-Duvaz and Springer (1997)
Adv. Drg Del. Rev. 26:151-172; U.S. Pat. No. 4,975,278) allows
targeted delivery of the drug moiety to tumors, and intracellular
accumulation therein, where systemic administration of these
unconjugated drug agents may result in unacceptable levels of
toxicity to normal cells as well as the tumor cells sought to be
eliminated (Baldwin et al., (1986) Lancet pp. (Mar. 15,
1986):603-05; Thorpe, (1985) "Antibody Carriers Of Cytotoxic Agents
In Cancer Therapy: A Review," in Monoclonal Antibodies '84:
Biological And Clinical Applications, A. Pinchera et al. (ed.s),
pp. 475-506). Maximal efficacy with minimal toxicity is sought
thereby. Both polyclonal antibodies and monoclonal antibodies have
been reported as useful in these strategies (Rowland et al., (1986)
Cancer Immunol. Immunother., 21:183-87). Drugs used in these
methods include daunomycin, doxorubicin, methotrexate, and
vindesine (Rowland et al., (1986) supra). Toxins used in
antibody-toxin conjugates include bacterial toxins such as
diphtheria toxin, plant toxins such as ricin, small molecule toxins
such as geldanamycin (Mandler et al (2000) Jour. of the Nat. Cancer
Inst. 92(19):1573-1581; Mandler et al (2000) Bioorganic & Med.
Chem. Letters 10:1025-1028; Mandler et al (2002) Bioconjugate Chem.
13:786-791), maytansinoids (EP 1391213; Liu et al., (1996) Proc.
Natl. Acad. Sci. USA 93:8618-8623), and calicheamicin (Lode et al
(1998) Cancer Res. 58:2928; Hinman et al (1993) Cancer Res.
53:3336-3342). The toxins may affect their cytotoxic and cytostatic
effects by mechanisms including tubulin binding, DNA binding, or
topoisomerase inhibition. Some cytotoxic drugs tend to be inactive
or less active when conjugated to large antibodies or protein
receptor ligands.
[0219] Examples of antibody drug conjugates are, ZEVALIN.RTM.
(ibritumomab tiuxetan, Biogen/Idec) which is an
antibody-radioisotope conjugate composed of a murine IgG1 kappa
monoclonal antibody directed against the CD20 antigen found on the
surface of normal and malignant B lymphocytes and .sup.111In or
.sup.90Y radioisotope bound by a thiourea linker-chelator (Wiseman
et al (2000) Eur. Jour. Nucl. Med. 27(7):766-77; Wiseman et al
(2002) Blood 99(12):4336-42; Witzig et al (2002) J. Clin. Oncol.
20(10):2453-63; Witzig et al (2002) J. Clin. Oncol.
20(15):3262-69).
[0220] Also, MYLOTARG.TM. (gemtuzumab ozogamicin, Wyeth
Pharmaceuticals), an antibody drug conjugate composed of a hu CD33
antibody linked to calicheamicin, was approved in 2000 for the
treatment of acute myeloid leukemia by injection (Drugs of the
Future (2000) 25(7):686; U.S. Pat. Nos. 4,970,198; 5,079,233;
5,585,089; 5,606,040; 5,693,762; 5,739,116; 5,767,285;
5,773,001).
[0221] Additionally, Anti-human FLT3 antibodies have been assessed
earlier as potential therapeutics for myeloid leukemia. For
example, IMC-EB 10, an antibody against FLT3 was developed by
Imclone. This antibody is a ligand blocker which inhibits FLT3
mediated activation of downstream kinases (MAPK, Akt and StatS).
The antibody also inhibits proliferation of leukemic cells in
vitro; and is known to act via antibody dependent cellular toxicity
(ADCC). EB 10 has caused prolonged survival of the leukemic
xenografts when treated alone and in combination with methotrexate
(See, WO2009/155015 and US2011/0008355). This antibody was also
evaluated in human clinical trials (NCT00887926), but terminated
due to lack of efficacy. See also, EB 10 conjugated to MMAF was
developed by ImClone (See, Proc Amer Assoc Cancer Res, Volume 46,
2005).
[0222] It is known in the art that agonistic antibodies developed
against FLT3 can enhance the proliferation and/differentiation of
primitive hematpoietic cells. (See, WO 95/27062)
[0223] In addition to biologics, numerous small molecule inhibitors
have been developed and tested in human clinical trials. Most of
these inhibitors target FLT3 and other kinases and thus are not
specific to FLT3 kinase itself. In most cases, these inhibitors
target FLT3-ITD and possibly FLT-TKD. Accordingly, none are
available to target wild type FLT3 alone. The small molecule
inhibitors that are known to have entered human clinical trials
are:
[0224] Midostaurin or PKC-412 (Novartis), Quizartinib or AC220
(Ambit), Nexavar (Onyx/Bayer), AZD1152 or Barasertib (Astrazeneca),
Crenolinib (Arog), Plexxicon (Daichii Sankyo), and ASP2215
(Astellas). Generally, most human clinical trials are still
ongoing. In most cases, thrombocytopenia, neutropenia, anemia have
been observed as side effects.
[0225] In addition, Cantuzumab mertansine (Immunogen, Inc.), an
antibody drug conjugate composed of the huC242 antibody linked via
the disulfide linker SPP to the maytansinoid drug moiety, DM1, is
advancing into Phase II trials for the treatment of cancers that
express CanAg, such as colon, pancreatic, gastric, and others.
[0226] Additionally, MLN-2704 (Millennium Pharm., BZL Biologics,
Immunogen Inc.), an antibody drug conjugate composed of the
anti-prostate specific membrane antigen (PSMA) monoclonal antibody
linked to the maytansinoid drug moiety, DM1, is under development
for the potential treatment of prostate tumors.
[0227] Finally, the auristatin peptides, auristatin E (AE) and
monomethylauristatin (MMAE), synthetic analogs of dolastatin, were
conjugated to chimeric monoclonal antibodies cBR96 (specific to
Lewis Y on carcinomas) and cAC10 (specific to CD30 on hematological
malignancies) (Doronina et al (2003) Nature Biotechnology
21(7):778-784).
[0228] The CD30 MAb conjugated to MMAE is now commercially
available as ADCETRIS (Seattle Genetics, Bothell, Wash.). ADCETRIS
(brentuximab vedotin) is a CD-30 directed antibody drug conjugate
consisting of three components: 1) the chimeric IgG1 antibody
denoted cAC10, specific for human CD30, 2) the microtubule
disrupting agent MMAE, and 3) a protease-cleavable linker that
covalently attaches MMAE to caC10. See, ADCENTRIS prescribing
information.
[0229] Further, therapeutic agents including but not limited to
chemotherapeutic agents useful in the generation of ADCs are
described herein. Enzymatically active toxins and fragments thereof
that can be used include diphtheria A chain, nonbinding active
fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas
aeruginosa), ricin A chain, abrin A chain, modeccin A chain,
alpha-sarcin, Aleurites fordii proteins, dianthin proteins,
Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica
charantia inhibitor, curcin, crotin, sapaonaria officinalis
inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin,
and the tricothecenes. See, e.g., WO 93/21232 published Oct. 28,
1993. A variety of radionuclides are available for the production
of radioconjugated antibodies. Examples include .sup.212Bi,
.sup.131I, .sup.131In, .sup.90Y, and .sup.186Re. Conjugates of the
antibody and cytotoxic agent are made using a variety of
bifunctional protein-coupling agents such as
N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP),
iminothiolane (IT), bifunctional derivatives of imidoesters (such
as dimethyl adipimidate HCl), active esters (such as disuccinimidyl
suberate), aldehydes (such as glutaraldehyde), bis-azido compounds
(such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium
derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine),
diisocyanates (such as toluene 2,6-diisocyanate), and bis-active
fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For
example, a ricin immunotoxin can be prepared as described in
Vitetta et al (1987) Science, 238:1098. Carbon-14-labeled
1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
(MX-DTPA) is an exemplary chelating agent for conjugation of
radionucleotide to the antibody (WO94/11026).
[0230] Conjugates of an antibody and one or more small molecule
toxins, such as a calicheamicin, maytansinoids, dolastatins,
auristatins, a trichothecene, and CC1065, and the derivatives of
these toxins that have toxin activity, are also contemplated
herein.
[0231] III(A). Maytansinoids
[0232] Maytansine compounds suitable for use as maytansinoid drug
moieties are well known in the art, and can be isolated from
natural sources according to known methods, produced using genetic
engineering techniques (see Yu et al (2002) PNAS 99:7968-7973), or
maytansinol and maytansinol analogues prepared synthetically
according to known methods.
[0233] Exemplary maytansinoid drug moieties include those having a
modified aromatic ring, such as: C-19-dechloro (U.S. Pat. No.
4,256,746) (prepared by lithium aluminum hydride reduction of
ansamytocin P2); C-20-hydroxy (or C-20-demethyl)+/-C-19-dechloro
(U.S. Pat. Nos. 4,361,650 and 4,307,016) (prepared by demethylation
using Streptomyces or Actinomyces or dechlorination using LAH); and
C-20-demethoxy, C-20-acyloxy (--OCOR), +/-dechloro (U.S. Pat. No.
4,294,757) (prepared by acylation using acyl chlorides). and those
having modifications at other positions
[0234] Exemplary maytansinoid drug moieties also include those
having modifications such as: C-9-SH (U.S. Pat. No. 4,424,219)
(prepared by the reaction of maytansinol with H.sub.2S or
P.sub.2S.sub.5); C-14-alkoxymethyl(demethoxy/CH.sub.2OR)(U.S. Pat.
No. 4,331,598); C-14-hydroxymethyl or acyloxymethyl (CH.sub.2OH or
CH.sub.2OAc) (U.S. Pat. No. 4,450,254) (prepared from Nocardia);
C-15-hydroxy/acyloxy (U.S. Pat. No. 4,364,866) (prepared by the
conversion of maytansinol by Streptomyces); C-15-methoxy (U.S. Pat.
Nos. 4,313,946 and 4,315,929) (isolated from Trewia nudlflora);
C-18-N-demethyl (U.S. Pat. Nos. 4,362,663 and 4,322,348) (prepared
by the demethylation of maytansinol by Streptomyces); and 4,5-deoxy
(U.S. Pat. No. 4,371,533) (prepared by the titanium trichloride/LAH
reduction of maytansinol).
[0235] ADCs containing maytansinoids, methods of making same, and
their therapeutic use are disclosed, for example, in U.S. Pat. Nos.
5,208,020; 5,416,064; 6,441,163 and European Patent EP 0 425 235 B
1, the disclosures of which are hereby expressly incorporated by
reference. Liu et al., Proc. Natl. Acad. Sci. USA 93:8618-8623
(1996) described ADCs comprising a maytansinoid designated DM1
linked to the monoclonal antibody C242 directed against human
colorectal cancer. The conjugate was found to be highly cytotoxic
towards cultured colon cancer cells, and showed antitumor activity
in an in vivo tumor growth assay. Chari et al., Cancer Research
52:127-131 (1992) describe ADCs in which a maytansinoid was
conjugated via a disulfide linker to the murine antibody A7 binding
to an antigen on human colon cancer cell lines, or to another
murine monoclonal antibody TA. 1 that binds the HER-2/neu oncogene.
The cytotoxicity of the TA. 1-maytansonoid conjugate was tested in
vitro on the human breast cancer cell line SK-BR-3, which expresses
3.times.10.sup.5 HER-2 surface antigens per cell. The drug
conjugate achieved a degree of cytotoxicity similar to the free
maytansinoid drug, which could be increased by increasing the
number of maytansinoid molecules per antibody molecule. The
A7-maytansinoid conjugate showed low systemic cytotoxicity in
mice.
[0236] III(B). Auristatins and dolastatins
[0237] In some embodiments, the ADC comprises an antibody of the
invention conjugated to dolastatins or dolostatin peptidic analogs
and derivatives, the auristatins (U.S. Pat. Nos. 5,635,483;
5,780,588). Dolastatins and auristatins have been shown to
interfere with microtubule dynamics, GTP hydrolysis, and nuclear
and cellular division (Woyke et al (2001) Antimicrob. Agents and
Chemother. 45(12):3580-3584) and have anticancer (U.S. Pat. No.
5,663,149) and antifungal activity (Pettit et al (1998) Antimicrob.
Agents Chemother. 42:2961-2965). The dolastatin or auristatin drug
moiety may be attached to the antibody through the N (amino)
terminus or the C (carboxyl) terminus of the peptidic drug moiety
(WO 02/088172).
[0238] Exemplary auristatin embodiments include the N-terminus
linked monomethylauristatin drug moieties DE and DF, disclosed in
"Senter et al, Proceedings of the American Association for Cancer
Research, Volume 45, Abstract Number 623, presented Mar. 28, 2004
and described in United States Patent Publication No. 2005/0238649,
the disclosure of which is expressly incorporated by reference in
its entirety.
[0239] Typically, peptide-based drug moieties can be prepared by
forming a peptide bond between two or more amino acids and/or
peptide fragments. Such peptide bonds can be prepared, for example,
according to the liquid phase synthesis method (see E. Schrider and
K. Lubke, "The Peptides", volume 1, pp 76-136, 1965, Academic
Press) that is well known in the field of peptide chemistry. The
auristatin/dolastatin drug moieties may be prepared according to
the methods of: U.S. Pat. No. 5,635,483; U.S. Pat. No. 5,780,588;
Pettit et al (1989) J. Am. Chem. Soc. 111:5463-5465; Pettit et al
(1998) Anti-Cancer Drug Design 13:243-277; Pettit, G. R., et al.
Synthesis, 1996, 719-725; Pettit et al (1996) J. Chem. Soc. Perkin
Trans. 1 5:859-863; and Doronina (2003) Nat Biotechnol
21(7):778-784.
[0240] III(C). Calicheamicin
[0241] In other embodiments, the ADC comprises an antibody of the
invention conjugated to one or more calicheamicin molecules. The
calicheamicin families of antibiotics are capable of producing
double-stranded DNA breaks at sub-picomolar concentrations. For the
preparation of conjugates of the calicheamicin family, see U.S.
Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701,
5,770,710, 5,773,001, 5,877,296 (all to American Cyanamid Company).
Structural analogues of calicheamicin which may be used include,
but are not limited to, .gamma..sub.1.sup.I, .alpha..sub.2.sup.I,
.alpha..sub.3.sup.I, N-acetyl-.gamma..sub.1.sup.I, PSAG and
.theta..sup.I.sub.1 (Hinman et al., Cancer Research 53:3336-3342
(1993), Lode et al., Cancer Research 58:2925-2928 (1998) and the
aforementioned U.S. patents to American Cyanamid). Another
anti-tumor drug that the antibody can be conjugated is QFA which is
an antifolate. Both calicheamicin and QFA have intracellular sites
of action and do not readily cross the plasma membrane. Therefore,
cellular uptake of these agents through antibody mediated
internalization greatly enhances their cytotoxic effects.
[0242] III(D). Other Cytotoxic Agents
[0243] Other antitumor agents that can be conjugated to the
antibodies of the invention include BCNU, streptozoicin,
vincristine and 5-fluorouracil, the family of agents known
collectively LL-E33288 complex described in U.S. Pat. Nos.
5,053,394, 5,770,710, as well as esperamicins (U.S. Pat. No.
5,877,296).
[0244] Enzymatically active toxins and fragments thereof which can
be used include diphtheria A chain, nonbinding active fragments of
diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa),
ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin,
Aleurites fordii proteins, dianthin proteins, Phytolaca americana
proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor,
curcin, crotin, sapaonaria officinalis inhibitor, gelonin,
mitogellin, restrictocin, phenomycin, enomycin and the
tricothecenes. See, for example, WO 93/21232 (published Oct. 28,
1993).
[0245] The present invention further contemplates an ADC formed
between an antibody and a compound with nucleolytic activity (e.g.,
a ribonuclease or a DNA endonuclease such as a deoxyribonuclease;
DNase).
[0246] For selective destruction of the tumor, the antibody may
comprise a highly radioactive atom. A variety of radioactive
isotopes are available for the production of radioconjugated
antibodies. Examples include At.sup.211, I.sup.131, I.sup.125,
Y.sup.90, Re.sup.186, Re.sup.88, Sm.sup.53, Bi.sup.212, P.sup.32,
Pb.sup.212 and radioactive isotopes of Lu. When the conjugate is
used for detection, it may comprise a radioactive atom for
scintigraphic studies, for example tc.sup.99m or I.sup.123, or a
spin label for nuclear magnetic resonance (NMR) imaging (also known
as magnetic resonance imaging, mri), such as iodine-123 again,
iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15,
oxygen-17, gadolinium, manganese or iron.
[0247] The radio- or other labels may be incorporated in the
conjugate in known ways. For example, the peptide may be
biosynthesized or may be synthesized by chemical amino acid
synthesis using suitable amino acid precursors involving, for
example, fluorine-19 in place of hydrogen. Labels such as
tc.sup.99m or I.sup.123, Re.sup.186, Re.sup.188 and In.sup.111 can
be attached via a cysteine residue in the peptide. Yttrium-90 can
be attached via a lysine residue. The IODOGEN method (Fraker et al
(1978) Biochem. Biophys. Res. Commun. 80: 49-57 can be used to
incorporate iodine-123. "Monoclonal Antibodies in
Immunoscintigraphy" (Chatal, CRC Press 1989) describes other
methods in detail.
IV.) Antibody-Drug Conjugate Compounds which Bind FLT3
[0248] The present invention provides, inter alia, antibody-drug
conjugate compounds for targeted delivery of therapeutic agents.
The inventors have made the discovery that the antibody-drug
conjugate compounds have potent cytotoxic and/or cytostatic
activity against cells expressing FLT3.
[0249] Such antibody drug conjugates do not block binding of FL to
FLT3, such that FL can signal through FLT3 even when antibody is
bound. Such antibodies demonstrate cytotoxic activity that is not
reduced in the presence of FL (where an anti-FLT3 antibody drug
conjugate that does block FL binding to FLT3 exhibits reduced
cytoxicity in the presence of FL. In preferred embodiments, the
anti-FLT3 drug conjugates described herein do not substantially
inhibit binding of FL to FLT3.
[0250] The antibody-drug conjugate compounds comprise an Antibody
unit covalently linked to at least one Drug unit. The Drug units
can be covalently linked directly to the Antibody unit or via a
Linker unit (-LU-).
[0251] In some embodiments, the antibody drug conjugate compound
has the following formula:
L-(LU-D).sub.p (I)
[0252] or a pharmaceutically acceptable salt or solvate thereof;
wherein: [0253] L is the Antibody unit, e.g., FLT3 MAb of the
present invention, such as CHv62.21 or CHv62.21pAF, and [0254]
(LU-D) is a Linker unit-Drug unit moiety, wherein: [0255] LU- is a
Linker unit, and [0256] -D is a drug unit having cytostatic or
cytotoxic activity against a target cell; and [0257] p ranges from
1 to 20.
[0258] In some embodiments, p ranges from 1 to 10, 1 to 9, 1 to 8,
1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some
embodiments, p ranges from 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6,
2 to 5, 2 to 4 or 2 to 3. In other embodiments, p is 1, 2, 3, 4, 5
or 6. In some embodiments, p is 2 or 4. In some embodiments, p is
an integer. In other embodiments p is measured as an average drug
to antibody ratio and can be an ineger or a non-integer.
[0259] In some embodiments, the antibody drug conjugate compound
has the following formula:
L-(A.sub.a-W.sub.w--Y.sub.y-D).sub.p (II)
[0260] or a pharmaceutically acceptable salt or solvate thereof,
wherein: [0261] L is the Antibody unit, e.g., FLT3 MAb, such as
CHv62.21 or CHv62.21pAF; and [0262] -A.sub.a-W.sub.w--Y.sub.y-- is
a Linker unit (LU), wherein: [0263] -A- is a Stretcher unit, [0264]
a is 0 or 1 or 2 or 3, [0265] each --W-- is independently an Amino
Acid unit, [0266] w is an integer ranging from 0 to 12, [0267]
--Y-- is a self-immolative spacer unit, [0268] y is 0, 1 or 2;
[0269] -D is a drug units having cytostatic or cytotoxic activity
against the target cell; and [0270] p is an integer from 1 to
20.
[0271] In some embodiments, a is 0 or 1, w is 0 or 1, and y is 0, 1
or 2. In some embodiments, a is 0 or 1, w is 0 or 1, and y is 0 or
1. In some embodiments, p ranges from 1 to 10, 1 to 9, 1 to 8, 1 to
7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some embodiments,
p ranges from 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4 or 2 to 3. In
other embodiments, p is 1, 2, 3, 4, 5 or 6. In some embodiments, p
is 2 or 4. In some embodiments, when w is not zero, y is 1 or 2. In
some embodiments, when w is 1 to 12, y is 1 or 2. In some
embodiments, w is 2 to 12 and y is 1 or 2. In some embodiments, a
is 1 and w and y are 0.
[0272] For compositions comprising a plurality of antibodies, the
drug loading is represented by p, the average number of drug
molecules per Antibody. Drug loading may range from 1 to 20 drugs
(D) per Antibody. The average number of drugs per antibody in
preparation of conjugation reactions may be characterized by
conventional means such as mass spectroscopy, ELISA assay, and
HPLC. The quantitative distribution of Antibody-Drug-Conjugates in
terms of p may also be determined. In some instances, separation,
purification, and characterization of homogeneous
Antibody-Drug-conjugates where p is a certain value from
Antibody-Drug-Conjugates with other drug loadings may be achieved
by means such as reverse phase HPLC or electrophoresis. In
exemplary embodiments, p is from 2 to 8.
[0273] The generation of Antibody-drug conjugate compounds can be
accomplished by any technique known to the skilled artisan.
Briefly, the Antibody-drug conjugate compounds comprise FLT3 MAbs
of the invention as the Antibody unit, a drug, and optionally a
linker that joins the drug and the binding agent. In a preferred
embodiment, the Antibody is FLT3 MAb comprising heavy and light
chain variable regions of an antibody designated CHv62.21 described
above. In a more preferred embodiment, the Antibody is FLT3 MAb
comprising heavy and light chain of an antibody designated
CHv62.21pAF described above (See, Formula (I)).
[0274] A number of different reactions are available for covalent
attachment of drugs and/or linkers to binding agents. This is often
accomplished by reaction of the amino acid residues of the binding
agent, e.g., antibody molecule, including the amine groups of
lysine, the free carboxylic acid groups of glutamic and aspartic
acid, the sulfhydryl groups of cysteine and the various moieties of
the aromatic amino acids. One of the most commonly used
non-specific methods of covalent attachment is the carbodiimide
reaction to link a carboxy (or amino) group of a compound to amino
(or carboxy) groups of the antibody. Additionally, bifunctional
agents such as dialdehydes or imidoesters have been used to link
the amino group of a compound to amino groups of an antibody
molecule. Also available for attachment of drugs to binding agents
is the Schiff base reaction. This method involves the periodate
oxidation of a drug that contains glycol or hydroxy groups, thus
forming an aldehyde which is then reacted with the binding agent.
Attachment occurs via formation of a Schiff base with amino groups
of the binding agent. Isothiocyanates can also be used as coupling
agents for covalently attaching drugs to binding agents. Other
techniques are known to the skilled artisan and within the scope of
the present invention.
[0275] In certain embodiments, an intermediate, which is the
precursor of the linker, is reacted with the drug under appropriate
conditions. In certain embodiments, reactive groups are used on the
drug and/or the intermediate. The product of the reaction between
the drug and the intermediate, or the derivatized drug, is
subsequently reacted with the FLT3 MAb under appropriate
conditions.
V.) Linker Units
[0276] Typically, the antibody-drug conjugate compounds comprise a
Linker unit between the drug unit and the antibody unit. In some
embodiments, the linker is cleavable under intracellular
conditions, such that cleavage of the linker releases the drug unit
from the antibody in the intracellular environment. In yet other
embodiments, the linker unit is not cleavable and the drug is
released, for example, by antibody degradation.
[0277] In some embodiments, the linker is cleavable by a cleaving
agent that is present in the intracellular environment (e.g.,
within a lysosome or endosome or caveolea). The linker can be,
e.g., a peptidyl linker that is cleaved by an intracellular
peptidase or protease enzyme, including, but not limited to, a
lysosomal or endosomal protease. The linker can also be cleaved by
a cleaving agent that is present in the extracellular environment
(e.g. in the vicinity to the cellular membrane or tissue space).
The linker can be, e.g., a peptidyl linker that is cleaved by an
extracellular peptidase or protease enzyme, including, but not
limited to, a cathepsin family enzymes or matrix
metalloproteinases). In some embodiments, the peptidyl linker is at
least two amino acids long or at least three amino acids long. In a
preferred embodiment, the peptidyl linker contains at least one
amino-oxy acid unit (Ambrx, Inc., La Jolla, Calif.). Cleaving
agents can include those agents known in the art (see, e.g.,
Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123 and U.S.
Pat. No. 6,214,345). One advantage of using intracellular
proteolytic release of the therapeutic agent is that the agent is
typically attenuated when conjugated and the serum stabilities of
the conjugates are typically high.
[0278] In other embodiments, the cleavable linker is pH-sensitive,
i.e., sensitive to hydrolysis at certain pH values. Typically, the
pH-sensitive linker hydrolyzable under acidic conditions. For
example, an acid-labile linker that is hydrolyzable in the lysosome
(e.g., an oxime, hydrazone, semicarbazone, thiosemicarbazone,
cis-aconitic amide, orthoester, acetal, ketal, or the like) can be
used. (See, e.g., U.S. Pat. Nos. 5,122,368; 5,824,805; 5,622,929;
Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123; Neville
et al., 1989, Biol. Chem. 264:14653-14661.) Such linkers are
relatively stable under neutral pH conditions, such as those in the
blood, but are unstable or less stable at below pH 5.5 or 5.0, the
approximate pH of the lysosome. In certain embodiments, the
hydrolyzable linker is a thioether linker (such as, e.g., a
thioether attached to the therapeutic agent via an acylhydrazone
bond (see, e.g., U.S. Pat. No. 5,622,929).
[0279] In yet other embodiments, the linker is cleavable under
reducing conditions known in the art. (See, e.g., Thorpe et al.,
1987, Cancer Res. 47:5924-5931; Wawrzynczak et al., In
Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy
of Cancer (C. W. Vogel ed., Oxford U. Press, 1987. See also U.S.
Pat. No. 4,880,935.). The linker can also be cleaved under reducing
conditions found intra-cellularly (or extra-cellularly). For
example, in a preferred embodiment, the specific linker N--O bond
may be formally reduced and broken to result in a cleavage of the
linker.
[0280] In yet other embodiments, the linker unit is not cleavable
and the drug is released by antibody degradation. (See PCT
Publication No. WO2012/166560 (Ambrx, Inc.) incorporated by
reference herein in its entirety and for all purposes).
[0281] In other, non-mutually exclusive embodiments, the linker
promotes cellular internalization as known in the art.
[0282] A variety of exemplary linkers that can be used with the
present compositions and methods are described in WO 2004/010957,
U.S. Publication No. 2006/0074008, U.S. Publication No.
20050238649, and U.S. Publication No. 2006/0024317 (each of which
is incorporated by reference herein in its entirety and for all
purposes).
[0283] In a preferred embodiment, the LU of the present invention
is denoted AGL and is commonly known as 2-(aminooxy)acetic acid or
C.sub.2H.sub.5NO.sub.3.
VI.) The Stretcher Unit
[0284] The Stretcher unit (A), when present, is capable of linking
an Antibody unit to an Amino Acid unit (--W--), if present, to a
Spacer unit (--Y--), if present; or to a Drug unit (-D). Useful
functional groups that can be present on a FLT3 MAb (e.g. CHv62.21
or CHv62.21pAF), either naturally or via chemical manipulation
include, but are not limited to, keto, aldehyde, sulfhydryl, amino,
hydroxyl, the anomeric hydroxyl group of a carbohydrate, and
carboxyl. Suitable functional groups are keto, aldehyde,
sulfhydryl, and amino. In one example, the keto group is on a
non-natural amino acid (nnAA) incorporated into the Mab of the
invention. In a further example, the aldehyde group is on a nnAA
incorporated into the Mab of the invention. In another example,
sulfhydryl groups can be generated by reduction of the
intramolecular disulfide bonds of a FLT3 MAb. In another
embodiment, sulfhydryl groups can be generated by reaction of an
amino group of a lysine moiety of a FLT3 MAb with 2-iminothiolane
(Traut's reagent) or other sulfhydryl generating reagents. In
certain embodiments, the FLT3 MAb is a recombinant antibody and is
engineered to carry one or more lysines. In certain other
embodiments, the recombinant FLT3 MAb is engineered to carry
additional sulfhydryl groups, e.g., additional cysteines.
[0285] In one embodiment, the Stretcher unit forms an oxime bond
with a keto group of the Antibody unit. The keto group is present
on a nnAA incorporated in the MAb.
[0286] It is to be understood from all the exemplary embodiments
that even where not denoted expressly, from 1 to 20 drug moieties
can be linked to an Antibody (p=1-20).
[0287] The Amino Acid Unit
[0288] The Amino Acid unit (--W--), when present, links the
Stretcher unit to the Spacer unit if the Spacer unit is present,
links the Stretcher unit to the Drug moiety if the Spacer unit is
absent, and links the Antibody unit to the Drug unit if the
Stretcher unit and Spacer unit are absent.
[0289] Ww- can be, for example, a monopeptide, dipeptide,
tripeptide, tetrapeptide, pentapeptide, hexapeptide, heptapeptide,
octapeptide, nonapeptide, decapeptide, undecapeptide or
dodecapeptide unit. Each --W-- unit independently has the formula
denoted below in the square brackets, and w is an integer ranging
from 0 to 12:
##STR00004##
[0290] wherein R19 includes but is not limited to hydrogen, methyl,
isopropyl, isobutyl, sec-butyl, benzyl, p-hydroxybenzyl, --CH2OH,
--CH(OH)CH3, --CH2CH2SCH3, --CH2CONH2, --CH2COOH, --CH2CH2CONH2,
--CH2CH2COOH, --(CH2)3NHC(.dbd.NH)NH2, --(CH2)3NH2,
--(CH2)3NHCOCH3, --(CH2)3NHCHO, --(CH2)4NHC(.dbd.NH)NH2,
--(CH2)4NH2, --(CH2)4NHCOCH3, --(CH.sub.2).sub.4NHCHO,
--(CH.sub.2).sub.3NHCONH.sub.2, --(CH.sub.2).sub.4NHCONH.sub.2,
--CH.sub.2CH.sub.2CH(OH)CH.sub.2NH.sub.2, 2-pyridylmethyl-,
3-pyridylmethyl-, 4-pyridylmethyl-, phenyl, cyclohexyl. For further
reference, see (US2014/0072586 & WO2012/047724, which are fully
incorporated by reference herein).
[0291] In certain embodiments, the Amino Acid unit can comprise
natural amino acids. In other embodiments, the Amino Acid unit can
comprise non-natural amino acids.
[0292] In some embodiments, the Amino Acid unit can be
enzymatically cleaved by one or more enzymes, including a cancer or
tumor-associated protease, to liberate the Drug unit (-D), which in
one embodiment is protonated in vivo upon release to provide a Drug
(D).
[0293] In one aspect of the Amino Acid unit, the Amino Acid unit is
valine-citrulline (vc or val-cit). In another aspect, the Amino
Acid unit is phenylalanine-lysine (i.e., fk). In yet another aspect
of the Amino Acid unit, the Amino Acid unit is
N-methylvaline-citrulline.
VII.) The Spacer Unit
[0294] The Spacer unit (--Y--), when present, links an Amino Acid
unit to the Drug unit when an Amino Acid unit is present.
Alternately, the Spacer unit links the Stretcher unit to the Drug
unit when the Amino Acid unit is absent. The Spacer unit also links
the Drug unit to the Antibody unit when both the Amino Acid unit
and Stretcher unit are absent. Spacer units are of two general
types: non self-immolative or self-immolative. Examples of possible
spacers of the invention are known in the art. See, Toki et al.,
2002, J. Org. Chem. 67:1866-1872 and Nature Biotechnology
21(7):778-784).
[0295] Other examples of self-immolative spacers include, but are
not limited to, aromatic compounds that are electronically similar
to the PAB group such as 2-aminoimidazol-5-methanol derivatives
(Hay et al., 1999, Bioorg. Med. Chem. Lett. 9:2237) and ortho or
para-aminobenzylacetals. Spacers can be used that undergo
cyclization upon amide bond hydrolysis, such as substituted and
unsubstituted 4-aminobutyric acid amides (Rodrigues et al., 1995,
Chemistry Biology 2:223), appropriately substituted bicyclo[2.2.1]
and bicyclo[2.2.2] ring systems (Storm et al., 1972, J. Amer. Chem.
Soc. 94:5815) and 2-aminophenylpropionic acid amides (Amsberry et
al., 1990, J. Org. Chem. 55:5867). Elimination of amine-containing
drugs that are substituted at the a-position of glycine (Kingsbury
et al., 1984, J. Med. Chem. 27:1447) are also examples of
self-immolative spacers.
VIII.) The Drug Unit
[0296] The Drug Unit (D) can be any therapeutic agent. For example,
the Drug Unit may be a moiety that is cytotoxic, cytostatic or
immunomodulatory (e.g., immunosuppressive) or chemotherapeutic
agent. D is a Drug unit (moiety) having an atom that can form a
bond with the Spacer unit (if present), with the Amino Acid unit
(if present), with the Stretcher unit (if present) or with the
Antibody unit. In some embodiments, the Drug unit D has a nitrogen
atom that can form a bond with the Spacer unit (if used). As used
herein, the terms "Drug unit" and "Drug moiety" are synonymous and
used interchangeably.
[0297] Useful classes of cytotoxic or immunomodulatory agents
include, for example, antitubulin agents, DNA minor groove binders,
DNA replication inhibitors, and alkylating agents. In some
embodiments, the Drug is an auristatin, such as auristatin E (also
known in the art as a derivative of dolastatin-10) or a derivative
thereof. Other typical auristatins include AFP, MMAF, and MMAE. The
synthesis and structure of exemplary auristatins are described in
U.S. Pat. Nos. 6,323,315; 6,239,104; 6,034,065; 5,780,588;
5,665,860; 5,663,149; 5,635,483; 5,599,902; 5,554,725; 5,530,097;
5,521,284; 5,504,191; 5,410,024; 5,138,036; 5,076,973; 4,986,988;
4,978,744; 4,879,278; 4,816,444; and 4,486,414, each of which is
incorporated by reference herein in its entirety and for all
purposes.
[0298] In some embodiments, the Drug Unit is a calicheamicin,
camptothecin, a maytansinoid, or an anthracycline. In some
embodiments the drug is a taxane, a topoisomerase inhibitor, a
vinca alkaloid, or the like.
[0299] In some typical embodiments, suitable cytotoxic agents
include, for example, DNA minor groove binders (e.g., enediynes and
lexitropsins, a CBI compound; see also U.S. Pat. No. 6,130,237),
duocarmycins, taxanes (e.g., paclitaxel and docetaxel), puromycins,
and vinca alkaloids. Other cytotoxic agents include, for example,
CC-1065, SN-38, topotecan, morpholino-doxorubicin, rhizoxin,
cyanomorpholino-doxorubicin, echinomycin, combretastatin,
netropsin, epothilone A and B, estramustine, cryptophysins,
cemadotin, maytansinoids, discodermolide, eleutherobin, and
mitoxantrone.
[0300] In some embodiments, the Drug is an anti-tubulin agent.
Examples of anti-tubulin agents include, auristatins, taxanes
(e.g., Taxol.RTM. (paclitaxel), Taxotere.RTM. (docetaxel)), T67
(Tularik) and vinca alkyloids (e.g., vincristine, vinblastine,
vindesine, and vinorelbine). Other antitubulin agents include, for
example, baccatin derivatives, taxane analogs (e.g., epothilone A
and B), nocodazole, colchicine and colcimid, estramustine,
cryptophycins, cemadotin, maytansinoids, combretastatins,
discodermolide, and eleutherobin.
[0301] In certain embodiments, the cytotoxic agent is a
maytansinoid, another group of anti-tubulin agents. For example, in
specific embodiments, the maytansinoid is maytansine or DM-1
(ImmunoGen, Inc.; see also Chari et al., 1992, Cancer Res.
52:127-131).
[0302] In certain embodiments, the cytotoxic or cytostatic agent is
a dolastatin. In certain embodiments, the cytotoxic or cytostatic
agent is of the auristatin class.
[0303] In a further embodiment, Drug Units are novel
dolaproine-dolaisoleuine peptide analogs. Thus, provided herein are
compounds of Formula (I):
##STR00005## [0304] wherein [0305] R.sup.1 and R.sup.2 are each
independently --H or alkyl; [0306] X is --O--, --NR.sup.z--, --S--,
or is absent; [0307] wherein R.sup.z is --H or alkyl; [0308]
R.sup.3 is a group of the formula:
[0308] ##STR00006## [0309] wherein R.sup.15 and R.sup.16 are each
independently --H, --OH, --NH.sub.2, --SH, --N.sub.3, alkyl,
alkenyl, alkynyl, -alkyl-OH, -alkyl-NH.sub.2, -alkyl-SH, or
-alkyl-N.sub.3; [0310] R.sup.4 is a group of the formula:
[0310] ##STR00007## [0311] wherein R.sup.17 and R.sup.18 are each
independently --H, --OH, --NH.sub.2, --SH, --N.sub.3, --CO.sub.2H,
alkyl, alkenyl, alkynyl, -alkyl-OH, -alkyl-NH.sub.2, -alkyl-SH,
-alkyl-N.sub.3 or -alkyl-CO.sub.2H [0312] R.sup.5 is sec-butyl or
isobutyl; [0313] R.sup.6 is --H or alkyl; [0314] R.sup.7 and
R.sup.8 are each independently --H, alkyl, --CO.sub.2R.sup.a,
CONR.sup.bR.sup.c, substituted or unsubstituted phenyl, or
substituted or unsubstituted heterocyclic ring; [0315] wherein
R.sup.a is --H or alkyl; [0316] R.sup.b and R.sup.c are each
independently H or alkyl; [0317] R.sup.9 is --H or alkyl; or
R.sup.9 is taken together with R.sup.4 and the atoms to which they
are attached to form a substituted or unsubstituted
heterocycloalkyl ring; [0318] R.sup.10 is --H or alkyl; [0319]
R.sup.11 is --H or alkyl; [0320] R.sup.12 is --H or alkyl; [0321]
R.sup.13 is --H or alkyl; and [0322] R.sup.14 is --H, --OH or
alkyl; [0323] provided that when X is absent and R.sup.5, R.sup.16,
R.sup.17 and R.sup.18 are each methyl, then R.sup.8 is not
substituted or unsubstituted phenyl, or substituted or
unsubstituted heterocyclic ring; [0324] or a pharmaceutically
acceptable salt thereof.
[0325] In some embodiments, R.sup.1 and R.sup.2 are each
independently --H or alkyl, for example C.sub.1-6alkyl In some
embodiments, R.sup.1 and R.sup.2 are each independently --H or
methyl. In some embodiments, R.sup.1 and R.sup.2 are each
independently alkyl. In some embodiments, R.sup.1 and R.sup.2 are
both methyl. In some embodiments, R.sup.1 and R.sup.2 are both
--H.
[0326] In some embodiments, X is absent. In other embodiments, X is
--O--. In some embodiments, R.sup.1 and R.sup.2 are each
independently alkyl, and X is absent. In some embodiments, R.sup.1
and R.sup.2 are both methyl, and X is absent. In other embodiments,
R.sup.1 and R.sup.2 are both --H, and X is --O--. In some
embodiments, X is --NR.sup.z--, wherein R.sup.z is --H or alkyl. In
some embodiments, R.sup.z is --H. In some embodiments, X is R.sup.z
is alkyl, for example C.sub.1-6alkyl or methyl.
[0327] In certain embodiments, R.sup.3 is
##STR00008##
wherein R.sup.15 and R.sup.16 are each independently --H, --OH,
--NH.sub.2, --SH, --N.sub.3, alkyl, alkenyl, alkynyl, -alkyl-OH,
-alkyl-NH.sub.2, -alkyl-SH, or -alkyl-N.sub.3. In still other
embodiments, R.sup.15 and R.sup.16 are each independently --H,
alkyl, --(CH.sub.2).sub.0-6C.ident.CH,
--(CH.sub.2).sub.0-6CH.dbd.CH.sub.2, --(CH.sub.2).sub.0-6OH,
--(CH.sub.2).sub.0-6NH.sub.2, --(CH.sub.2).sub.0-6SH, or
--(CH.sub.2).sub.0-6N.sub.3. In some embodiments, R.sup.15 and
R.sup.16 are each independently --H, --OH, or alkyl. In some
embodiments, R.sup.15 and R.sup.16 are each independently --H,
--OH, or methyl. In some embodiments, R.sup.5 is --OH and R.sup.16
is hydrogen. In some embodiments, R.sup.5 is --OH and R.sup.16 is
methyl.
[0328] In certain embodiments, R.sup.3 is in the R stereochemical
configuration relative to the remainder of the molecule. In other
embodiments, R.sup.3 is in the S stereochemical configuration
relative to the remainder of the molecule. In certain embodiments,
the R.sup.3 group itself contains one or more chiral centers, and
those stereocenters are each independently in the R or S
configuration.
[0329] In certain embodiments, R.sup.4 is
##STR00009##
wherein R.sup.17 and R.sup.18 are each independently --H, --OH,
--NH.sub.2, --SH, --N.sub.3, --CO.sub.2H, alkyl, alkenyl, alkynyl,
-alkyl-OH, -alkyl-NH.sub.2, -alkyl-SH, -alkyl-N.sub.3 or
-alkyl-CO.sub.2H. In other embodiments, R.sup.4 is
##STR00010##
wherein R.sup.17 is --H, --OH, --NH.sub.2, --SH, --N.sub.3,
--CO.sub.2H, alkyl, alkenyl, alkynyl, -alkyl-OH, -alkyl-NH.sub.2,
-alkyl-SH, -alkyl-N.sub.3 or -alkyl-CO.sub.2H, and R.sup.18 is --H,
--OH, --NH.sub.2, --SH, --N.sub.3, --CO.sub.2H, alkenyl, alkynyl,
-alkyl-OH, -alkyl-NH.sub.2, -alkyl-SH, -alkyl-N.sub.3 or
-alkyl-CO.sub.2H. In still other embodiments, R.sup.17 and R.sup.18
are each independently --H, alkyl, --(CH.sub.2).sub.0-6C.ident.CH,
--(CH.sub.2).sub.0-6CH.dbd.CH.sub.2, --(CH.sub.2).sub.0-6OH,
--(CH.sub.2).sub.0-6NH.sub.2, --(CH.sub.2).sub.0-6SH, or
--(CH.sub.2).sub.0-6N.sub.3. In some embodiments, R.sup.17 and
R.sup.18 are each independently --H, --OH, --NH.sub.2, --SH,
--N.sub.3, --CO.sub.2H, alkyl, -alkyl-NH.sub.2, or -alkyl-N.sub.3.
In some embodiments, R.sup.17 and R.sup.18 are each independently
--H, --OH, --NH.sub.2, --SH, --N.sub.3, --CO.sub.2H, methyl,
--CH.sub.2NH.sub.2, or --CH.sub.2N.sub.3.
[0330] In certain embodiments, R.sup.4 is taken together with
R.sup.9 and the atoms to which they are attached to form a
substituted or unsubstituted heterocycloalkyl ring. In certain
embodiments, R.sup.4 is taken together with R.sup.9 and the atoms
to which they are attached to form a 5- to 7-member
heterocycloalkyl ring, which may be unsubstituted or substituted
with one or more groups selected from --OH, --NH.sub.2, --SH, and
--N.sub.3. In certain embodiments, the heterocycloalkyl ring is a
pyrrolidine ring, which may be unsubstituted or substituted with
one or more groups selected from --OH, --NH.sub.2, --SH, and
--N.sub.3.
[0331] In certain embodiments, R.sup.4 is in the R stereochemical
configuration relative to the remainder of the molecule. In other
embodiments, R.sup.4 is in the S stereochemical configuration
relative to the remainder of the molecule. In certain embodiments,
the R.sup.4 group itself contains one or more chiral centers, and
those stereocenters are each independently in the R or S
configuration.
[0332] In certain embodiments, R.sup.5 is sec-butyl. In other
embodiments, R.sup.5 is isobutyl. In certain embodiments, R.sup.5
is in the R stereochemical configuration relative to the remainder
of the molecule. In other embodiments, R.sup.5 is in the S
stereochemical configuration relative to the remainder of the
molecule. In some embodiments, the chiral center within the R.sup.5
group is in the R configuration, and in other embodiments, that
center is in the S configuration.
[0333] In certain embodiments, R.sup.6 is --H. In other
embodiments, R.sup.6 is alkyl, for example C.sub.1-8alkyl,
C.sub.1-4alkyl, methyl, or ethyl.
[0334] In some embodiments, R.sup.7 and R.sup.8 are each
independently is --H, alkyl, --CO.sub.2R.sup.a or
--CONR.sup.bR.sup.c; wherein R.sup.a is --H or alkyl, for example
C.sub.1-6alkyl or methyl; and R.sup.b and R.sup.c are each
independently --H or alkyl, for example C.sub.1-6alkyl or
methyl.
[0335] In certain embodiments, R.sup.7 and R.sup.8 are each
independently is substituted or unsubstituted phenyl or substituted
or unsubstituted heterocyclic ring, wherein the phenyl or
heterocyclic ring may be substituted with one or more groups
selected from halo, oxo, hydroxy, amino, alkyl, and alkoxy. In
certain other embodiments, R.sup.7 is unsubstituted 3- to 8-member
heterocyclic ring. In certain other embodiments, R.sup.7 is
substituted 3- to 8-member heterocyclic ring. In certain other
embodiments, R.sup.8 is phenyl which is optionally subsutituted
with halo.
[0336] In certain embodiments, R.sup.7 is in the R stereochemical
configuration relative to the remainder of the molecule. In other
embodiments, R.sup.7 is in the S stereochemical configuration
relative to the remainder of the molecule.
[0337] In certain embodiments, R.sup.8 is in the R stereochemical
configuration relative to the remainder of the molecule. In other
embodiments, R.sup.8 is in the S stereochemical configuration
relative to the remainder of the molecule.
[0338] In some embodiments, R.sup.7 is
--CO.sub.2R.sup.a--CONR.sup.bR.sup.c; tetrazolyl or thiazolyl,
wherein R.sup.a is --H or alkyl, for example C.sub.1-6alkyl or
methyl; and R.sup.b and R.sup.c are each independently --H or
alkyl, for example C.sub.1-6alkyl or methyl; and R.sup.8 is phenyl
which is optionally substituted with halo.
[0339] In some embodiments, R.sup.9 is --H. In other embodiments,
R.sup.9 is alkyl, for example C.sub.1-8alkyl, C.sub.1-4alkyl,
methyl, or ethyl. In some embodiments, R.sup.9 is --H or methyl. In
some embodiments, R.sup.9 is methyl.
[0340] In some embodiments, R.sup.10 is --H. In other embodiments,
R.sup.10 is alkyl, for example C.sub.1-8alkyl, C.sub.1-4alkyl,
methyl, or ethyl. In some embodiments, R.sup.10 is --H or methyl.
In some embodiments, R.sup.10 is methyl.
[0341] In some embodiments, R.sup.11 is --H. In other embodiments,
R.sup.11 is alkyl, for example C.sub.1-8alkyl, C.sub.1-4alkyl,
methyl, or ethyl. In some embodiments, R.sup.11 is --H or methyl.
In some embodiments, R.sup.11 is methyl.
[0342] In some embodiments, R.sup.12 is --H. In other embodiments,
R.sup.12 is alkyl, for example C.sub.1-8alkyl, C.sub.1-4alkyl,
methyl, or ethyl. In some embodiments, R.sup.12 is --H or methyl.
In some embodiments, R.sup.12 is methyl.
[0343] In some embodiments, R.sup.13 is --H. In other embodiments,
R.sup.13 is alkyl, for example C.sub.1-8alkyl, C.sub.1-4alkyl,
methyl, or ethyl. In some embodiments, R.sup.13 is --H or methyl.
In some embodiments, R.sup.13 is methyl.
[0344] In some embodiments, R.sup.14 is --H. In some embodiments,
R.sup.14 is alkyl, for example C.sub.1-6alkyl, methyl, or ethyl. In
some embodiments, R.sup.14 is --OH.
[0345] In certain embodiments, R.sup.14 is in the R stereochemical
configuration relative to the remainder of the molecule. In other
embodiments, R.sup.14 is in the S stereochemical configuration
relative to the remainder of the molecule.
[0346] In some embodiments, R.sup.7 is --CO.sub.2R.sup.a, wherein
R.sup.a is --H or alkyl, for example C.sub.1-6alkyl or methyl;
R.sup.8 is phenyl; and R.sup.14 is --H. In some embodiments,
R.sup.7 is --CONR.sup.bR.sup.c, wherein R.sup.b and R.sup.c are
each independently --H or alkyl, for example C.sub.1-6alkyl or
methyl; R.sup.8 is phenyl; and R.sup.14 is --H. In some
embodiments, R.sup.7 is alkyl, for example C.sub.1-6alkyl or
methyl; R.sup.8 is phenyl; and R.sup.14 is --OH. In some
embodiments, R.sup.7 is methyl, R.sup.8 is phenyl, and R.sup.14 is
--OH. In some embodiments, R.sup.7 and R.sup.14 are both --H, and
R.sup.8 is pyridinyl, piperidinyl, unsubstituted phenyl, or phenyl
substituted with halo, for example fluoro, chloro, or bromo. In
some embodiments, R.sup.7 is --CO.sub.2R.sup.a, wherein R.sup.a is
--H or alkyl, for example C.sub.1-6alkyl or methyl; R.sup.8 is --H
or alkyl, for example C.sub.1-6alkyl or methyl; and R.sup.14 is
alkyl, for example C.sub.1-6alkyl, methyl, or ethyl. In some
embodiments, R.sup.7 is --CO.sub.2R.sup.a, wherein R.sup.a is --H
or alkyl, for example C.sub.1-6alkyl or methyl; R.sup.8 is --H or
alkyl, for example C.sub.1-6alkyl or methyl; and R.sup.14 is
--OH.
[0347] In certain embodiments, [0348] R.sup.1 and R.sup.2 are each
independently --H or C.sub.1-6alkyl; [0349] X is --O-- or is
absent; [0350] R.sup.3 is
[0350] ##STR00011## wherein R.sup.15 and R.sup.16 are each
independently --H, --OH, or C.sub.1-6alkyl; [0351] R.sup.4 is
[0351] ##STR00012## wherein R.sup.17 is --OH, --NH.sub.2, --SH,
--N.sub.3, --CO.sub.2H, --C.sub.1-6alkyl-NH.sub.2, alkynyl,
alkenyl, or --C.sub.1-6alkyl-N.sub.3; and R.sup.18 is --H or
C.sub.1-6alkyl; [0352] R.sup.5 is sec-butyl; [0353] R.sup.6 is --H;
[0354] R.sup.7 is --H, C.sub.1-6alkyl, --CO.sub.2R.sup.a,
--CONR.sup.bR.sup.c, tetrazolyl or thiazolyl; wherein R.sup.a is
--H or C.sub.1-6alkyl; and [0355] R.sup.b and R.sup.c are each --H
or C.sub.1-6alkyl; [0356] R.sup.8 is --H, C.sub.1-6alkyl,
substituted or unsubstituted phenyl or substituted or unsubstituted
heterocyclic ring; [0357] R.sup.9 is --H; [0358] R.sup.10,
R.sup.11, R.sup.12, and R.sup.13 are each independently
C.sub.1-6alkyl; and [0359] R.sup.14 is --H, C.sub.1-6alkyl or
--OH.
[0360] In certain embodiments, [0361] R.sup.1 and R.sup.2 are each
independently --H or methyl; [0362] X is --O-- or is absent; [0363]
R.sup.3 is
[0363] ##STR00013## wherein R.sup.15 and R.sup.16 are each
independently --H, --OH, or methyl; [0364] R.sup.4 is
[0364] ##STR00014## wherein R.sup.17 is --OH, --NH.sub.2, --SH,
--N.sub.3, --CO.sub.2H, aminomethyl, alkynyl, alkenyl, or
azidomethyl; and R.sup.18 is --H or methyl; [0365] R.sup.5 is
sec-butyl; [0366] R.sup.6 is --H; [0367] R.sup.7 is --H, methyl,
--CO.sub.2R.sup.a, or --CONR.sup.bR.sup.c; wherein R.sup.a is --H
or methyl; and R.sup.b and R.sup.c are each --H or methyl; [0368]
R.sup.8 is --H, methyl, ethyl, pyridinyl, piperidinyl,
unsubstituted phenyl, phenyl substituted with halo; [0369] R.sup.9
is --H; [0370] R.sup.10, R.sup.11, R.sup.12, and R.sup.13 are each
methyl; and [0371] R.sup.14 is --H, methyl or --OH.
[0372] In certain embodiments, [0373] R.sup.1 and R.sup.2 are each
independently --H or C.sub.1-6alkyl; [0374] X is absent; [0375]
R.sup.3 is
[0375] ##STR00015## wherein R.sup.15 and R.sup.16 are each
independently --H, --OH, or C.sub.1-6alkyl; [0376] R.sup.4 is
[0376] ##STR00016## wherein R.sup.17 is --N.sub.3, and R.sup.18 is
--H or methyl; [0377] R.sup.5 is sec-butyl; [0378] R.sup.6 is --H;
[0379] R.sup.7 is --H, C.sub.1-6alkyl, --CO.sub.2R.sup.a,
--CONR.sup.bR.sup.c, tetrazolyl or thiazolyl; wherein R.sup.a is
--H or C.sub.1-6alkyl; and [0380] R.sup.b and R.sup.c are each --H
or C.sub.1-6alkyl; [0381] R.sup.8 is --H, C.sub.1-6alkyl,
substituted or unsubstituted phenyl or substituted or unsubstituted
heterocyclic ring; [0382] R.sup.9 is --H; [0383] R.sup.10,
R.sup.11, R.sup.12, and R.sup.13 are each independently
C.sub.1-6alkyl; and [0384] R.sup.14 is --H, C.sub.1-6alkyl or
--OH.
[0385] In certain embodiments, [0386] R.sup.1 and R.sup.2 are each
independently --H or C.sub.1-6alkyl; [0387] X is --O--; [0388]
R.sup.3 is
[0388] ##STR00017## wherein R.sup.15 and R.sup.16 are each
independently --H, --OH, or C_-6alkyl; [0389] R.sup.4 is
[0389] ##STR00018## [0390] wherein R.sup.17 is --N.sub.3, and
R.sup.1 is --H or methyl; [0391] R.sup.5 is sec-butyl; [0392]
R.sup.6 is --H; [0393] R.sup.7 is --H, C.sub.1-6alkyl,
--CO.sub.2R.sup.a, --CONR.sup.bR.sup.c, tetrazolyl or thiazolyl;
wherein R.sup.a is --H or C.sub.1-6alkyl; and [0394] R.sup.b and
R.sup.c are each --H or C.sub.1-6alkyl; [0395] R.sup.8 is --H,
C.sub.1-6alkyl, substituted or unsubstituted phenyl or substituted
or unsubstituted heterocyclic ring; [0396] R.sup.9 is --H; [0397]
R.sup.10, R.sup.11, R.sup.12, and R.sup.13 are each independently
C.sub.1-6alkyl; and [0398] R.sup.14 is --H, C.sub.1-6alkyl or
--OH.
[0399] In some embodiments of Formula (I), wherein, [0400] R.sup.1
and R.sup.2 are each methyl; [0401] X is absent; [0402] R.sup.3 is
a group of the formula:
[0402] ##STR00019## [0403] wherein R.sup.15 and R.sup.16 are each
methyl; [0404] R.sup.4 is a group of the formula:
[0404] ##STR00020## [0405] wherein R.sup.17 is --N.sub.3,
--NH.sub.2, --OH, --SH, and R.sup.18 is --H or methyl; [0406]
R.sup.5 is sec-butyl; [0407] R.sup.6 is --H; [0408] R.sup.7 is
--CO.sub.2R.sup.a or CONR.sup.bR.sup.c, [0409] wherein R.sup.a is
--H or C.sub.1-6alkyl; [0410] R.sup.b and R.sup.c are each
independently H or C.sub.1-6alkyl; [0411] R.sup.8 is phenyl; [0412]
R.sup.9 is --H; [0413] R.sup.10, R.sup.11, R.sup.12, and R.sup.13
are each independently methyl; and [0414] R.sup.14 is --H.
[0415] In some embodiments of Formula (I), wherein, [0416] R.sup.1
and R.sup.2 are each --H; [0417] X is --O--; [0418] R.sup.3 is a
group of the formula:
[0418] ##STR00021## [0419] wherein R.sup.15 and R.sup.16 are each
methyl; [0420] R.sup.4 is a group of the formula:
[0420] ##STR00022## [0421] wherein R.sup.17 is --N.sub.3, and
R.sup.18 is --H or methyl; [0422] R.sup.5 is sec-butyl; [0423]
R.sup.6 is --H; [0424] R.sup.7 is --CO.sub.2R.sup.a or
CONR.sup.bR.sup.c, [0425] wherein R.sup.a is --H or C.sub.1-6alkyl;
[0426] R.sup.b and R.sup.c are each independently H or
C.sub.1-6alkyl; [0427] R.sup.8 is phenyl; [0428] R.sup.9 is --H;
[0429] R.sup.10, R.sup.11, R.sup.12, and R.sup.13 are each
independently methyl; and [0430] R.sup.14 is --H.
[0431] It is to be understood that any variable group definition
provided herein can be used in combination with any other variable
group definition provided herein, such that all possible
combinations and permutations of variable groups provided herein,
where chemically feasible, are contemplated.
[0432] In certain embodiments, compounds of Formula (I) are
selected from the group consisting of: [0433] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((S)-2-(dimethylamino)-3-methylb-
utanamido)-3-hydroxy-N-methylpropanamido)-3-methoxy-5-methylheptanoyl)pyrr-
olidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0434] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3R)-2-((S)-2-(dimethylamino)-3-met-
hylbutanamido)-3-hydroxy-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)p-
yrrolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0435]
(S)-2-(dimethylamino)-N--((S)-3-hydroxy-1-(((3R,4S,5S)-3-methoxy-1-((S)-2-
-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-((2-(pyridin-2-yl)ethyl)amino)propyl)-
pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)(methyl)amino)-1-oxopropan-2-yl-
)-3-methylbutanamide; [0436]
(2S,3R)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-3-hydroxy-N-((3R,4S,-
5S)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-((2-(pyridin-2--
yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-methyl-
butanamide; [0437]
(2S)-2-(dimethylamino)-N-((2S)-3-hydroxy-1-(((3R,4S,5S)-3-methoxy-1-((2S)-
-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-((2-(piperidin-2-yl)ethyl)amino)pro-
pyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)(methyl)amino)-1-oxopropan--
2-yl)-3-methylbutanamide; [0438]
(2S,3R)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-3-hydroxy-N-((3R,4S,-
5S)-3-methoxy-1-((2S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-((2-(piperidin-
-2-yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-met-
hylbutanamide; [0439] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-2-((S)-2-(dimethylamin-
o)-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyr-
rolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0440] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-3-amino-2-((S)-2-(dimethylamino)-3-
-methylbutanamido)-N-methylpropanamido)-3-methoxy-5-methylheptanoyl)pyrrol-
idin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0441]
(S)--N--((S)-3-amino-1-(((3R,4S,5S)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-
-2-methyl-3-oxo-3-((2-(pyridin-2-yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5--
methyl-1-oxoheptan-4-yl)(methyl)amino)-1-oxopropan-2-yl)-2-(dimethylamino)-
-3-methylbutanamide; [0442] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-3-azido-2-((S)-2-(dimethylamino)-3-
-methylbutanamido)-N-methylpropanamido)-3-methoxy-5-methylheptanoyl)pyrrol-
idin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0443] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-4-azido-2-((S)-2-(dimethylamino)-3-
-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyrroli-
din-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate; [0444]
(S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-4-amino-2-((S)-2-(dimethylamino)-3-
-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyrroli-
din-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate; [0445]
(S)-2-((S)-2-(aminooxy)-3-methylbutanamido)-N-((3R,4S,5S)-3-methoxy-1-((S-
)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-((2-(pyridin-2-yl)ethyl)amino)prop-
yl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N,3-dimethylbutanamide;
[0446]
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((S)-2-(dimethylamino)-3-hy-
droxypropanamido)-N,3-dimethylbutanamido)-3-methoxy-5-methylheptanoyl)pyrr-
olidin-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalanine; [0447]
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((2S,3R)-2-(dimethylamino)-3-hydro-
xybutanamido)-N,3-dimethylbutanamido)-3-methoxy-5-methylheptanoyl)pyrrolid-
in-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalanine; [0448]
(S)-2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-2-((S)-2-(dimethyl-
amino)-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl-
)pyrrolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoic
acid; [0449]
(S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-pheny-
lpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-meth-
oxy-5-methyl-1-oxoheptan-4-yl)-2-((2S,3R)-2-(dimethylamino)-3-hydroxybutan-
amido)-N,3-dimethylbutanamide; [0450]
(S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpropan-
-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-m-
ethyl-1-oxoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-hydroxypropanamido)-N,3-
-dimethylbutanamide; [0451] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((R)-2-((S)-2-(dimethylamino)-3-methylb-
utanamido)-3-mercapto-N-methylpropanamido)-3-methoxy-5-methylheptanoyl)pyr-
rolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0452]
(S)-2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((R)-2-((S)-2-(dimethylamino)-3-met-
hylbutanamido)-3-mercapto-N-methylpropanamido)-3-methoxy-5-methylheptanoyl-
)pyrrolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoic
acid; [0453]
(S)-2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((S)-2-(dimethylamino-
)-3-methylbutanamido)-3-hydroxy-N-methylpropanamido)-3-methoxy-5-methylhep-
tanoyl)pyrrolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoic
acid; [0454]
(S)-2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3R)-2-((S)-2-(dimethylamino)-3-
-methylbutanamido)-3-hydroxy-N-methylbutanamido)-3-methoxy-5-methylheptano-
yl)pyrrolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoic
acid; [0455] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((S)-2-(dimethylamino)-3-hydroxy-
propanamido)-N,3-dimethylbutanamido)-3-methoxy-5-methylheptanoyl)pyrrolidi-
n-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate; [0456]
(S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((2S,3R)-2-(dimethylamino)-3-hyd-
roxybutanamido)-N,3-dimethylbutanamido)-3-methoxy-5-methylheptanoyl)pyrrol-
idin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0457] (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-amino-2-((S)-2-(dimethylamin-
o)-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyr-
rolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate;
[0458]
(S)-2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-amino-2-((S)-2-(dimethyl-
amino)-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl-
)pyrrolidin-2-yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoic
acid; [0459]
(2S,3S)-3-azido-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3-
R,4S,5S)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(phenethyl-
amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-methylbutanamid-
e; [0460]
(2S,3S)-3-azido-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-(-
(3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)ami-
no)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-o-
xoheptan-4-yl)-N-methylbutanamide; [0461]
(2S,3S)-3-azido-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-((4-chlorophenethyl)ami-
no)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-o-
xoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-methylbutana-
mide; [0462]
(2S,3S)-3-azido-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-((2-chlorophenethyl)ami-
no)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-o-
xoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-methylbutana-
mide; [0463]
(2S,3S)-3-amino-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S-
)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(phenethylamino)p-
ropyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-methylbutanamide;
[0464]
(2S,3S)-3-amino-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3-
R,4S,5S)-1-((S)-2-((1R,2R)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)amino-
)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-oxo-
heptan-4-yl)-N-methylbutanamide; [0465]
(2S,3S)-3-amino-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-((4-chlorophenethyl)ami-
no)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-o-
xoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-methylbutana-
mide; [0466]
(2S,3S)-3-amino-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-((2-chlorophenethyl)ami-
no)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-o-
xoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-methylbutana-
mide; [0467]
(S)-4-amino-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S)-3--
methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(phenethylamino)propy-
l)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-methylbutanamide;
[0468]
(S)-4-amino-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S)-1--
((S)-2-((1R,2R)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)amino)-1-methoxy-
-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-oxoheptan-4-yl-
)-N-methylbutanamide; [0469]
(S)-4-amino-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-((4-chlorophenethyl)amino)--
1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-oxohe-
ptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-methylbutanamide-
; [0470]
(S)-4-amino-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-((2-chlorophenethyl-
)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-
-1-oxoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-methylbu-
tanamide; [0471] methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((S)-2-(dimethylamino)-3-methylbut-
anamido)-N-methylpent-4-ynamido)-3-methoxy-5-methylheptanoyl)pyrrolidin-2--
yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0472]
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-2-((S)-2-(dimethylamino)-3-methylbutan-
amido)-N-methylbutanamide; [0473]
(2S,3S)-3-azido-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S-
)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-((2-(pyridin-2-yl-
)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-methylbu-
tanamide; [0474]
(2S,3S)-3-azido-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-(tert-butylamin-
o)-1-oxo-3-phenylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrroli-
din-1-yl)-3-methoxy-5-methyl-1-oxoheptan-4-yl)-2-((S)-2-(dimethylamino)-3--
methylbutanamido)-N-methylbutanamide; [0475] methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-2-((S)-2-(dimethylamino)-
-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyrro-
lidin-2-yl)-3-methoxy-2-methylpropanoyl)-L-valinate; [0476] methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-6-amino-2-((S)-2-(dimethylamino)-3-m-
ethylbutanamido)-N-methylhexanamido)-3-methoxy-5-methylheptanoyl)pyrrolidi-
n-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0477]
methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,4S)-4-azido-1-(dimethyl-L-valyl)-N-m-
ethylpyrrolidine-2-carboxamido)-3-methoxy-5-methylheptanoyl)pyrrolidin-2-y-
l)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0478]
(S)-3-((S)-2-(dimethylamino)-3-methylbutanamido)-4-(((3R,4S,5S)-3-methoxy-
-1-((S)-2-((1R,2R)-1-methoxy-3-(((S)-1-methoxy-1-oxo-3-phenylpropan-2-yl)a-
mino)-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-yl)(met-
hyl)amino)-4-oxobutanoic acid; [0479]
(2S,3R)-2-((S)-2-(dimethylamino)-3-methylbutanamido)-3-hydroxy-N-((3R,4S,-
5S)-1-((S)-2-((1R,2R)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)amino)-1-m-
ethoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-5-methyl-1-oxohepta-
n-4-yl)-N-methylbutanamide; [0480] methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-2-((S)-2-(dimethylamino)-3-methylbut-
anamido)-N,3-dimethylbutanamido)-3-methoxy-5-methylheptanoyl)pyrrolidin-2--
yl)-3-methoxy-2-methylpropanoyl)-L-serinate; [0481] methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-2-((S)-2-(dimethylamino)-
-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyrro-
lidin-2-yl)-3-methoxy-2-methylpropanoyl)-L-isoleucinate; [0482]
(2S,3S)-3-amino-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-p-
henylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3--
methoxy-5-methyl-1-oxoheptan-4-yl)-2-((S)-2-(dimethylamino)-3-methylbutana-
mido)-N-methylbutanamide; [0483]
(2S,3S)-3-amino-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-(tert-butylamin-
o)-1-oxo-3-phenylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrroli-
din-1-yl)-3-methoxy-5-methyl-1-oxoheptan-4-yl)-2-((S)-2-(dimethylamino)-3--
methylbutanamido)-N-methylbutanamide; [0484] methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((S)-3-azido-N-methyl-2-((S)-3-methyl-2-(-
methylamino)butanamido)propanamido)-3-methoxy-5-methylheptanoyl)pyrrolidin-
-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0485]
methyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-N-methyl-2-((S)-3-methyl-
-2-(methylamino)butanamido)butanamido)-3-methoxy-5-methylheptanoyl)pyrroli-
din-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0486]
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide; [0487]
((2S,3S)-3-azido-N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-(tert-butylami-
no)-1-oxo-3-phenylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrol-
idin-1-yl)-3-methoxy-5-methyl-1-oxoheptan-4-yl)-N-methyl-2-((S)-3-methyl-2-
-(methylamino)butanamido)butanamide; [0488] tert-butyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-N-methyl-2-((S)-3-methyl-
-2-(methylamino)butanamido)butanamido)-3-methoxy-5-methylheptanoyl)pyrroli-
din-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0489]
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-N-methyl-2-((S)-3-methyl-
-2-(methylamino)butanamido)butanamido)-3-methoxy-5-methylheptanoyl)pyrroli-
din-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalanine; [0490]
tert-butyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-2-((S)-2-(dimethylamino)-
-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyrro-
lidin-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0491]
(2S,3S)-3-azido-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S-
)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(((S)-2-phenyl-1--
(1H-tetrazol-5-yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-
-4-yl)-N-methylbutanamide; [0492]
(2S,3S)-3-azido-N-((3R,4S,5S)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-met-
hyl-3-oxo-3-(((S)-2-phenyl-1-(1H-tetrazol-5-yl)ethyl)amino)propyl)pyrrolid-
in-1-yl)-5-methyl-1-oxoheptan-4-yl)-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide; [0493]
(2S,3S)-3-azido-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S-
)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(((S)-2-phenyl-1--
(thiazol-2-yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-y-
l)-N-methylbutanamide; [0494] tert-butyl
((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-amino-2-((S)-2-(dimethylamino)-
-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl)pyrro-
lidin-2-yl)-3-methoxy-2-methylpropanoyl)-L-phenylalaninate; [0495]
(2S,3S)-3-amino-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S-
)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(((S)-2-phenyl-1--
(1H-tetrazol-5-yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-
-4-yl)-N-methylbutanamide; and [0496]
(2S,3S)-3-amino-2-((S)-2-(dimethylamino)-3-methylbutanamido)-N-((3R,4S,5S-
)-3-methoxy-1-((S)-2-((1R,2R)-1-methoxy-2-methyl-3-oxo-3-(((S)-2-phenyl-1--
(thiazol-2-yl)ethyl)amino)propyl)pyrrolidin-1-yl)-5-methyl-1-oxoheptan-4-y-
l)-N-methylbutanamide;
[0497] and pharmaceutically acceptable salts thereof.
[0498] Also provided herein are pharmaceutically acceptable salts
of the compounds of Formula (I), preferably of those described
above and the specific compounds exemplified herein, pharmaceutical
compositions comprising such salts, and methods of using such
salts.
[0499] A "pharmaceutically acceptable salt" is intended to mean a
salt of a free acid or base of a compound represented herein that
is non-toxic, biologically tolerable, or otherwise biologically
suitable for administration to the subject. See, generally, S. M.
Berge, et al. "Pharmaceutical Salts," J. Pharm. Sci. 1977, 66,
1-19. Preferred pharmaceutically acceptable salts are those that
are pharmacologically effective and suitable for contact with the
tissues of subjects without undue toxicity, irritation, or allergic
response. A compound described herein may possess a sufficiently
acidic group, a sufficiently basic group, or both types of
functional groups, and accordingly react with a number of inorganic
or organic bases, and inorganic and organic acids, to form a
pharmaceutically acceptable salt. Examples of pharmaceutically
acceptable salts include acid addition salts such as sulfates,
pyrosulfates, bisulfates, sulfites, bisulfites, phosphates,
monohydrogen-phosphates, dihydrogenphosphates, metaphosphates,
pyrophosphates, chlorides, bromides, iodides, acetates,
propionates, decanoates, caprylates, acrylates, formates,
isobutyrates, caproates, heptanoates, propiolates, oxalates,
malonates, succinates, suberates, sebacates, fumarates, maleates,
butyne-1,4-dioates, hexyne-1,6-dioates, benzoates, chlorobenzoates,
methylbenzoates, dinitrobenzoates, hydroxybenzoates,
methoxybenzoates, phthalates, sulfonates, methylsulfonates,
propylsulfonates, besylates, xylenesulfonates,
naphthalene-1-sulfonates, naphthalene-2-sulfonates, phenylacetates,
phenylpropionates, phenylbutyrates, citrates, lactates,
y-hydroxybutyrates, glycolates, tartrates, and mandelates, and
salts with inorganic bases such as sodium, potassium, magnesium,
calcium, aluminum, and the like or organic bases such as
methylamine, ethylamine, ethanolamine, lysine, ornithine, and the
like, salts with various amino acids or amino acid derivatives such
as acetylleucine and the like, ammonium salts, etc.
[0500] For treatment purposes, pharmaceutical compositions
comprising compounds described herein may further comprise one or
more pharmaceutically-acceptable excipients. A
pharmaceutically-acceptable excipient is a substance that is
non-toxic and otherwise biologically suitable for administration to
a subject. Such excipients facilitate formulation and
administration of a compound described herein and are compatible
with the active ingredient. Examples of pharmaceutically-acceptable
excipients include stabilizers, lubricants, surfactants, diluents,
anti-oxidants, binders, coloring agents, emulsifiers, or
taste-modifying agents. In preferred embodiments, pharmaceutical
compositions are sterile compositions.
[0501] The pharmaceutical compositions described herein may be
formulated as solutions, emulsions, suspensions, or dispersions in
suitable pharmaceutical solvents or carriers, or as pills, tablets,
lozenges, suppositories, powders for reconstitution, or capsules
along with solid carriers according to conventional methods known
in the art for preparation of various dosage forms. For topical
applications, the compounds described herein are preferably
formulated as creams or ointments or a similar vehicle suitable for
topical administration. The pharmaceutical compositions and
compounds described herein may be administered in the inventive
methods by a suitable route of delivery, e.g., oral, nasal,
parenteral, rectal, topical, ocular, or by inhalation.
[0502] The term "treat" or "treating" as used herein is intended to
refer to administration of a compound described herein to a subject
for the purpose of creating a therapeutic benefit. Treating
includes reversing, ameliorating, alleviating, inhibiting the
progress of, or lessening the severity of, a disease, disorder, or
condition, or one or more symptoms of cancer. The term "subject"
refers to a mammalian patient in need of such treatment, such as a
human.
[0503] In treatment methods provided herein, "an effective amount"
means an amount or dose sufficient to generally bring about the
desired therapeutic benefit in subjects needing such treatment.
Furthermore, the term "therapeutically effective amount" means any
amount which, as compared to a corresponding subject who has not
received such amount, results in, but is not limited to, healing,
prevention, or amelioration of a disease, disorder, or side effect,
or a decrease in the rate of advancement of a disease or disorder.
The term also includes within its scope amounts effective to
enhance normal physiological function as well as amounts effective
to cause a physiological function in a subject, e.g. a human, which
enhances or aids in the therapeutic effect of a second
pharmaceutical agent. Effective amounts, including therapeutically
effective amounts, or doses of the compounds described herein may
be ascertained by routine methods, such as modeling, dose
escalation or clinical trials, taking into account routine factors,
e.g., the mode or route of administration or drug delivery, the
pharmacokinetics of the agent, the severity and course of the
infection, the subject's health status, condition, and weight, and
the judgment of the treating physician. An exemplary dose for the
antibody drug conjugates disclosed herein is in the range of about
1 ug to 2 mg of active compound per kilogram of subject's body
weight per day, preferably about 0.05 to 100 mg/kg/day, or about 1
to 35 mg/kg/day, or about 0.1 to 10 mg/kg/day. The total dosage may
be given in single or divided dosage units (e.g., BID, TID,
QID).
[0504] The compounds described herein may be used in pharmaceutical
compositions or methods in combination with additional active
ingredients in the treatment of cancer. The additional active
ingredients may be administered separately from a compound
described herein or may be included with a compound described
herein in a pharmaceutical composition provided herein. For
example, additional active ingredients are those that are known or
discovered to be effective in treating cancer, including those
active against another target associated with cancer, such as but
not limited to, Velcade, Rituximab, Methotrexate, Herceptin,
Vincristine, Prednisone, Irinotecan, or the like, or a combination
thereof. Such a combination may serve to increase efficacy,
decrease one or more side effects, or decrease the required dose of
a disclosed compound.
[0505] Compounds of Formula (I) will now be described by reference
to illustrative synthetic schemes for their general preparation
below and the specific examples that follow. Artisans will
recognize that, to obtain the various compounds herein, starting
materials may be suitably selected so that the ultimately desired
substituents will be carried through the reaction scheme with or
without protection as appropriate to yield the desired product.
Alternatively, it may be necessary or desirable to employ, in the
place of the ultimately desired substituent, a suitable group that
may be carried through the reaction scheme and replaced as
appropriate with the desired substituent. In addition, one of skill
in the art will recognize that protecting groups may be used to
protect certain functional groups (amino, carboxy, or side chain
groups) from reaction conditions, and that such groups are removed
under standard conditions when appropriate. Each of the reactions
depicted in Scheme A is preferably run at a temperature from about
room temperature to the reflux temperature of the organic solvent
used. Unless otherwise specified, the variables are as defined
above in reference to Formula (I).
##STR00023##
[0506] Referring to Scheme A, the preparation of compounds of
Formula (I) begins with a protected acid form of dolaisoleuine
(Dil) labeled (A) (see Pettit et al. (1994) J. Org. Chem.
59:1796-1800). Compound (A) is depicted with a tert-butyl ester
protecting group, but one of skill in the art may select an
appropriate replacement. Coupling with a nitrogen-protected valine
or isoleucine derivative (B), where PG is a suitable amino
protecting group such as a Boc (t-butoxycarbonyl) or
fluorenylmethyloxycarbonyl (Fmoc) group, is effected under standard
peptide coupling conditions. For example, reactions are run in the
presence of diethyl cyanophosphonate (DEPC), PyBrOP, PyBOP, BOP,
diisopropylcarbodiimide (DIC), dicyclohexylcarbodiimide (DCC),
1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (EDCI),
1-hydroxybenzotriazole (HOBt), 1-hydroxy-7-aza-benzotriazole
(HOAt), HBTU (O-benzotriazol-1-yl-N,N,N',N'-tetramethyluronium
hexafluorophosphate), HATU
(O-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium
hexafluorophosphate), and the like, or a combination thereof.
Reactions are typically run in the presence of a tertiary amine
base, such as diisopropylethylamine. Suitable solvents include
dichloromethane, N,N-dimethylformamide (DMF), dimethyl sulfoxide
(DMSO), ethyl acetate and the like. The amino protecting group on
resultant dipeptide (C) is removed by deprotection under suitable
conditions. For example, where PG is a Boc group, compound (C) is
treated with trifluoroacetic acid to form free amine (D). Where PG
is an Fmoc group, compound (C) is treated with piperidine or
diethylamine to yield compound (D). Compound (D) is then coupled to
amino acid derivative (E), in protected form if necessary, under
peptide coupling conditions as described above, to generate
tripeptide (F). Treatment with acid removes the carboxy protecting
group to provide free acid (G).
##STR00024##
[0507] Referring to Scheme B, the amino-protected dolaproine (Dap)
designated as (H) (see Pettit et al. (1994) J. Org. Chem.
59:6287-6295) is coupled with amine (J) (which is prepared using
methods known to one in the art) under peptide coupling conditions
as described above. Resulting dipeptide (K) is deprotected as
discussed for Scheme A to provide compound (L).
##STR00025##
[0508] Referring to Scheme C, acid (G) and amine (L) are coupled
under peptide coupling conditions as discussed above to provide
compounds of Formula (I). Where the result of the reaction is a
protected form of Formula (I), suitable deprotection conditions are
employed to give the target compound.
[0509] Also provided herein is a pharmaceutical composition
comprising an effective amount of at least one compound of Formula
(I), or a pharmaceutically acceptable salt thereof, and a
pharmaceutically acceptable excipient.
[0510] Also provided herein is a method of treating a subject
suffering from or diagnosed with cancer, comprising administering
to a subject in need of such treatment an effective amount of at
least one compound of Formula (I), or a pharmaceutically acceptable
salt thereof.
[0511] Also provided herein is use of at least one compound of
Formula (I), or a pharmaceutically acceptable salt thereof, for
treatment of cancer in a subject in need of such treatment.
[0512] Also provided herein is use of at least one compound of
Formula (I), or a pharmaceutically acceptable salt thereof, in the
manufacture of a medicament for treatment of cancer in a subject in
need of such treatment.
[0513] Also provided herein is a kit containing at least one
compound of Formula (I), or a pharmaceutically acceptable salt
thereof, for use in treating cancer in a subject in need of such
treatment, and instructions for use.
[0514] Also provided herein is an article of manufacture comprising
at least one compound of Formula (I), or a pharmaceutically
acceptable salt thereof, for use in treating cancer in a subject in
need of such treatment.
[0515] Also provided herein are antibody drug conjugates (ADCs)
wherein a compound of Formula (I) is conjugated to an Antibody.
[0516] Exemplary ADCs utilizing Formula (I) have the following
structures wherein "L" or "mAb-s-" represents a FLT3 MAb designated
CHv62.21 set forth herein.
[0517] Additionally, further exemplary ADCs utilizing Formula (I)
have the following structures wherein "L" or "mAb-s-" represents a
FLT3 MAb designated CHv62.21pAF set forth herein.
[0518] In a preferred embodiment, compounds of Formula (I) comprise
Drug Units comprising the compound denoted
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide.
[0519] In a preferred embodiment, compounds of Formula (I) comprise
Drug Units comprising the compound set forth below as Formula
(II):
##STR00026##
IX.) Drug Loading
[0520] Drug loading is represented by p and is the average number
of Drug moieties per antibody in a molecule. Drug loading may range
from 1 to 20 drug moieties (D) per antibody. ADCs of the invention
include collections of antibodies conjugated with a range of drug
moieties, from 1 to 20. The average number of drug moieties per
antibody in preparations of ADC from conjugation reactions may be
characterized by conventional means such as mass spectroscopy and,
ELISA assay. The quantitative distribution of ADC in terms of p may
also be determined. In some instances, separation, purification,
and characterization of homogeneous ADC where p is a certain value
from ADC with other drug loadings may be achieved by means such as
electrophoresis.
[0521] For some antibody-drug conjugates, p may be limited by the
number of attachment sites on the antibody. For example, where the
attachment is a cysteine thiol, an antibody may have only one or
several cysteine thiol groups, or may have only one or several
sufficiently reactive thiol groups through which a linker may be
attached. In certain embodiments, higher drug loading, e.g. p>5,
may cause aggregation, insolubility, toxicity, or loss of cellular
permeability of certain antibody-drug conjugates. In certain
embodiments, the drug loading for an ADC of the invention ranges
from 1 to about 8; from about 2 to about 6; from about 3 to about
5; from about 3 to about 4; from about 3.1 to about 3.9; from about
3.2 to about 3.8; from about 3.2 to about 3.7; from about 3.2 to
about 3.6; from about 3.3 to about 3.8; or from about 3.3 to about
3.7. Indeed, it has been shown that for certain ADCs, the optimal
ratio of drug moieties per antibody may be less than 8, and may be
about 2 to about 5.
[0522] In certain embodiments, fewer than the theoretical maximum
of drug moieties are conjugated to an antibody during a conjugation
reaction. An antibody may contain, for example, lysine residues
that do not react with the drug-linker intermediate or linker
reagent, as discussed below. Generally, antibodies do not contain
many free and reactive cysteine thiol groups which may be linked to
a drug moiety; indeed most cysteine thiol residues in antibodies
exist as disulfide bridges. In certain embodiments, an antibody may
be reduced with a reducing agent such as dithiothreitol (DTT) or
tricarbonylethylphosphine (TCEP), under partial or total reducing
conditions, to generate reactive cysteine thiol groups. In certain
embodiments, an antibody is subjected to denaturing conditions to
reveal reactive nucleophilic groups such as lysine or cysteine.
[0523] The loading (drug/antibody ratio) of an ADC may be
controlled in different ways, e.g., by: (i) limiting the molar
excess of drug-linker intermediate or linker reagent relative to
antibody, (ii) limiting the conjugation reaction time or
temperature, (iii) partial or limiting reductive conditions for
cysteine thiol modification, (iv) engineering by recombinant
techniques the amino acid sequence of the antibody such that the
number and position of cysteine residues is modified for control of
the number and/or position of linker-drug attachements (such as
thioMab or thioFab prepared as disclosed herein and in
WO2006/034488 (herein incorporated by reference in its
entirety)).
[0524] It is to be understood that where more than one nucleophilic
group reacts with a drug-linker intermediate or linker reagent
followed by drug moiety reagent, then the resulting product is a
mixture of ADC compounds with a distribution of one or more drug
moieties attached to an antibody. The average number of drugs per
antibody may be calculated from the mixture by a dual ELISA
antibody assay, which is specific for antibody and specific for the
drug. Individual ADC molecules may be identified in the mixture by
mass spectroscopy and separated by HPLC, e.g. hydrophobic
interaction chromatography (see, e.g., Hamblett, K. J., et al.
"Effect of drug loading on the pharmacology, pharmacokinetics, and
toxicity of an anti-CD30 antibody-drug conjugate," Abstract No.
624, American Association for Cancer Research, 2004 Annual Meeting,
Mar. 27-31, 2004, Proceedings of the AACR, Volume 45, March 2004;
Alley, S. C., et al. "Controlling the location of drug attachment
in antibody-drug conjugates," Abstract No. 627, American
Association for Cancer Research, 2004 Annual Meeting, Mar. 27-31,
2004, Proceedings of the AACR, Volume 45, March 2004). In certain
embodiments, a homogeneous ADC with a single loading value may be
isolated from the conjugation mixture by electrophoresis or
chromatography.
X.) Methods of Determining Cytotoxic Effect of ADCs
[0525] Methods of determining whether a Drug or Antibody-Drug
conjugate exerts a cytostatic and/or cytotoxic effect on a cell are
known. Generally, the cytotoxic or cytostatic activity of an
Antibody Drug conjugate can be measured by: exposing mammalian
cells expressing a target protein of the Antibody Drug conjugate in
a cell culture medium; culturing the cells for a period from about
6 hours to about 5 days; and measuring cell viability. Cell-based
in vitro assays can be used to measure viability (proliferation),
cytotoxicity, and induction of apoptosis (caspase activation) of
the Antibody Drug conjugate.
[0526] For determining whether an Antibody Drug conjugate exerts a
cytostatic effect, a thymidine incorporation assay may be used. For
example, cancer cells expressing a target antigen at a density of
5,000 cells/well of a 96-well plated can be cultured for a 72-hour
period and exposed to 0.5 .mu.Ci of .sup.3H-thymidine during the
final 8 hours of the 72-hour period. The incorporation of
.sup.3H-thymidine into cells of the culture is measured in the
presence and absence of the Antibody Drug conjugate.
[0527] For determining cytotoxicity, necrosis or apoptosis
(programmed cell death) can be measured. Necrosis is typically
accompanied by increased permeability of the plasma membrane;
swelling of the cell, and rupture of the plasma membrane. Apoptosis
is typically characterized by membrane blebbing, condensation of
cytoplasm, and the activation of endogenous endonucleases.
Determination of any of these effects on cancer cells indicates
that a Antibody Drug conjugate is useful in the treatment of
cancers.
[0528] Cell viability can be measured by determining in a cell the
uptake of a dye such as neutral red, trypan blue, or ALAMAR.TM.
blue (see, e.g., Page et al., 1993, Intl. J. Oncology 3:473-476).
In such an assay, the cells are incubated in media containing the
dye, the cells are washed, and the remaining dye, reflecting
cellular uptake of the dye, is measured spectrophotometrically. The
protein-binding dye sulforhodamine B (SRB) can also be used to
measure cytoxicity (Skehan et al., 1990, J. Natl. Cancer Inst.
82:1107-12).
[0529] Alternatively, a tetrazolium salt, such as MTT, is used in a
quantitative colorimetric assay for mammalian cell survival and
proliferation by detecting living, but not dead, cells (see, e.g.,
Mosmann, 1983, J. Immunol. Methods 65:55-63).
[0530] Apoptosis can be quantitated by measuring, for example, DNA
fragmentation.
[0531] Commercial photometric methods for the quantitative in vitro
determination of DNA fragmentation are available. Examples of such
assays, including TUNEL (which detects incorporation of labeled
nucleotides in fragmented DNA) and ELISA-based assays, are
described in Biochemica, 1999, no. 2, pp. 34-37 (Roche Molecular
Biochemicals).
[0532] Apoptosis can also be determined by measuring morphological
changes in a cell. For example, as with necrosis, loss of plasma
membrane integrity can be determined by measuring uptake of certain
dyes (e.g., a fluorescent dye such as, for example, acridine orange
or ethidium bromide). A method for measuring apoptotic cell number
has been described by Duke and Cohen, Current Protocols in
Immunology (Coligan et al. eds., 1992, pp. 3.17.1-3.17.16). Cells
also can be labeled with a DNA dye (e.g., acridine orange, ethidium
bromide, or propidium iodide) and the cells observed for chromatin
condensation and margination along the inner nuclear membrane.
Other morphological changes that can be measured to determine
apoptosis include, e.g., cytoplasmic condensation, increased
membrane blebbing, and cellular shrinkage.
[0533] The presence of apoptotic cells can be measured in both the
attached and "floating" compartments of the cultures. For example,
both compartments can be collected by removing the supernatant,
trypsinizing the attached cells, combining the preparations
following a centrifugation wash step (e.g., 10 minutes at 2000
rpm), and detecting apoptosis (e.g., by measuring DNA
fragmentation). (See, e.g., Piazza et al., 1995, Cancer Research
55:3110-16).
[0534] In vivo, the effect of a FLT3 therapeutic composition can be
evaluated in a suitable animal model. For example, xenogenic cancer
models can be used, wherein cancer explants or passaged xenograft
tissues are introduced into immune compromised animals, such as
nude or SCID mice (Klein et al., 1997, Nature Medicine 3: 402-408).
For example, PCT Patent Application WO98/16628 and U.S. Pat. No.
6,107,540 describe various xenograft models of human prostate
cancer capable of recapitulating the development of primary tumors,
micrometastasis, and the formation of osteoblastic metastases
characteristic of late stage disease. Efficacy can be predicted
using assays that measure inhibition of tumor formation, tumor
regression or metastasis, and the like.
[0535] In vivo assays that evaluate the promotion of apoptosis are
useful in evaluating therapeutic compositions. In one embodiment,
xenografts from tumor bearing mice treated with the therapeutic
composition can be examined for the presence of apoptotic foci and
compared to untreated control xenograft-bearing mice. The extent to
which apoptotic foci are found in the tumors of the treated mice
provides an indication of the therapeutic efficacy of the
composition.
[0536] The therapeutic compositions used in the practice of the
foregoing methods can be formulated into pharmaceutical
compositions comprising a carrier suitable for the desired delivery
method. Suitable carriers include any material that when combined
with the therapeutic composition retains the anti-tumor function of
the therapeutic composition and is generally non-reactive with the
patient's immune system. Examples include, but are not limited to,
any of a number of standard pharmaceutical carriers such as sterile
phosphate buffered saline solutions, bacteriostatic water, and the
like (see, generally, Remington's Pharmaceutical Sciences 16th
Edition, A. Osal., Ed., 1980).
[0537] Therapeutic formulations can be solubilized and administered
via any route capable of delivering the therapeutic composition to
the tumor site. Potentially effective routes of administration
include, but are not limited to, intravenous, parenteral,
intraperitoneal, intramuscular, intratumor, intradermal,
intraorgan, orthotopic, and the like. A preferred formulation for
intravenous injection comprises the therapeutic composition in a
solution of preserved bacteriostatic water, sterile unpreserved
water, and/or diluted in polyvinylchloride or polyethylene bags
containing 0.9% sterile Sodium Chloride for Injection, USP.
Therapeutic protein preparations can be lyophilized and stored as
sterile powders, preferably under vacuum, and then reconstituted in
bacteriostatic water (containing for example, benzyl alcohol
preservative) or in sterile water prior to injection.
[0538] Dosages and administration protocols for the treatment of
cancers using the foregoing methods will vary with the method and
the target cancer, and will generally depend on a number of other
factors appreciated in the art.
[0539] In one embodiment, the pharmaceutical composition of the
present invention may comprise more than one species of ADC of the
invention due to modification of CHv62.21 MAb or CHv62.21pAF MAb.
For example, the present invention includes a pharmaceutical
composition comprising the ADC of the invention, wherein the
CHv62.21 MAb is an antibody lacking heavy chain C-terminal lysine,
an antibody having N-terminal post-translational modification, an
antibody lacking heavy chain C-terminal lysine and having
N-terminal post-translational modification, and/or an antibody
having heavy chain C-terminal lysine and not having N-terminal
post-translational modification.
[0540] For example, a pharmaceutical composition of the present
invention includes an pharmaceutical composition comprising two or
more species of the ADC of the invention, wherein CHv62.21 MAb of
the ADC is selected from the group of the following 1) to 4):
[0541] 1) CHv62.21 MAb comprising a heavy chain consisting of the
amino acid sequence ranging from residue 1 (E) to residue 453 (K)
of SEQ ID NO: 9 and a light chain consisting of the amino acid
sequence ranging from residue 1 (D) to residue 214 (C) of SEQ ID
NO: 10; [0542] 2) CHv62.21 MAb comprising a heavy chain consisting
of the amino acid sequence ranging from residue 1 (E) to residue
453 (K) of SEQ ID NO: 9 wherein the N-terminal residue 1 (E) is
converted to pyroglutamic acid and a light chain consisting of the
amino acid sequence ranging from residue 1 (D) to residue 214 (C)
of SEQ ID NO: 10; [0543] 3) CHv62.21 MAb comprising a heavy chain
consisting of the amino acid sequence ranging from residue 1 (Q) to
residue 453 (K) of SEQ ID NO: 9 wherein the C-terminal residue 453
(K) is removed and a light chain consisting of the amino acid
sequence ranging from residue 1 (D) to residue 214 (C) of SEQ ID
NO: 10; and [0544] 4) CHv62.21 MAb comprising a heavy chain
consisting of the amino acid sequence ranging from residue 1 (E) to
residue 453 (K) of SEQ ID NO: 9 wherein the N-terminal residue 1
(E) is converted to pyroglutamic acid and the C-terminal residue
453 (K) is removed and a light chain consisting of the amino acid
sequence ranging from residue 1 (D) to residue 214 (C) of SEQ ID
NO: 10.
[0545] In one embodiment, a pharmaceutical composition of the
present invention includes an pharmaceutical composition comprising
CHv62.21 MAb comprising a heavy chain consisting of the amino acid
sequence ranging from residue 1 (E) to residue 453 (K) of SEQ ID
NO: 9 and a light chain consisting of the amino acid sequence
ranging from residue 1 (D) to residue 214 (C) of SEQ ID NO: 10 and
CHv62.21 MAb comprising a heavy chain consisting of the amino acid
sequence ranging from residue 1 (Q) to residue 453 (K) of SEQ ID
NO: 9 wherein the C-terminal residue 453 (K) is removed and a light
chain consisting of the amino acid sequence ranging from residue 1
(D) to residue 214 (C) of SEQ ID NO: 10.
[0546] In one embodiment, a pharmaceutical composition of the
present invention includes an pharmaceutical composition comprising
CHv62.21 MAb comprising a heavy chain consisting of the amino acid
sequence ranging from residue 1 (Q) to residue 453 (K) of SEQ ID
NO: 9 wherein the C-terminal residue 453 (K) is removed and a light
chain consisting of the amino acid sequence ranging from residue 1
(D) to residue 214 (C) of SEQ ID NO: 10 and CHv62.21 MAb comprising
a heavy chain consisting of the amino acid sequence ranging from
residue 1 (E) to residue 453 (K) of SEQ ID NO: 9 wherein the
N-terminal residue 1 (E) is converted to pyroglutamic acid and the
C-terminal residue 453 (K) is removed and a light chain consisting
of the amino acid sequence ranging from residue 1 (D) to residue
214 (C) of SEQ ID NO: 10.
[0547] In a preferred embodiment, a pharmaceutical composition of
the present invention includes an pharmaceutical composition
comprising two or more species of the ADC of the invention, wherein
CHv62.21pAF MAb of the ADC is selected from the group of the
following 1) to 4): [0548] 1) CHv62.21pAF MAb comprising a heavy
chain consisting of the amino acid sequence ranging from residue 1
(E) to residue 453 (K) of SEQ ID NO: 11 and a light chain
consisting of the amino acid sequence ranging from residue 1 (D) to
residue 214 (C) of SEQ ID NO: 10; [0549] 2) CHv62.21pAF MAb
comprising a heavy chain consisting of the amino acid sequence
ranging from residue 1 (E) to residue 453 (K) of SEQ ID NO: 11
wherein the N-terminal residue 1 (E) is converted to pyroglutamic
acid and a light chain consisting of the amino acid sequence
ranging from residue 1 (D) to residue 214 (C) of SEQ ID NO: 10;
[0550] 3) CHv62.21pAF MAb comprising a heavy chain consisting of
the amino acid sequence ranging from residue 1 (Q) to residue 453
(K) of SEQ ID NO: 11 wherein the C-terminal residue 443 (T) is
removed and a light chain consisting of the amino acid sequence
ranging from residue 1 (D) to residue 214 (C) of SEQ ID NO: 10; and
[0551] 4) CHv62.21pAF MAb comprising a heavy chain consisting of
the amino acid sequence ranging from residue 1 (E) to residue 453
(K) of SEQ ID NO: 11 wherein the N-terminal residue 1 (E) is
converted to pyroglutamic acid and the C-terminal residue 443 (T)
is removed and a light chain consisting of the amino acid sequence
ranging from residue 1 (D) to residue 214 (C) of SEQ ID NO: 10.
[0552] In one embodiment, a pharmaceutical composition of the
present invention includes an pharmaceutical composition comprising
CHv62.21pAF MAb comprising a heavy chain consisting of the amino
acid sequence ranging from residue 1 (E) to residue 453 (K) of SEQ
ID NO: 11 and a light chain consisting of the amino acid sequence
ranging from residue 1 (D) to residue 214 (C) of SEQ ID NO: 10 and
CHv62.21pAF MAb comprising a heavy chain consisting of the amino
acid sequence ranging from residue 1 (Q) to residue 453 (K) of SEQ
ID NO: 11 wherein the C-terminal residue 443 (T) is removed and a
light chain consisting of the amino acid sequence ranging from
residue 1 (D) to residue 214 (C) of SEQ ID NO: 10.
[0553] In one embodiment, a pharmaceutical composition of the
present invention includes an pharmaceutical composition comprising
CHv62.21pAF MAb comprising a heavy chain consisting of the amino
acid sequence ranging from residue 1 (Q) to residue 453 (K) of SEQ
ID NO: 11 wherein the C-terminal residue 443 (T) is removed and a
light chain consisting of the amino acid sequence ranging from
residue 1 (D) to residue 214 (C) of SEQ ID NO: 10 and CHv62.21pAF
MAb comprising a heavy chain consisting of the amino acid sequence
ranging from residue 1 (E) to residue 453 (K) of SEQ ID NO: 11
wherein the N-terminal residue 1 (E) is converted to pyroglutamic
acid and the C-terminal residue 443 (T) is removed and a light
chain consisting of the amino acid sequence ranging from residue 1
(D) to residue 214 (C) of SEQ ID NO: 10.
XI.) Treatment of Cancer(s) Expressing FLT3
[0554] The identification of FLT3 as a protein that is normally
expressed in a restricted set of tissues or cells, but which is
also expressed in cancers such as those listed in Table I, opens a
number of therapeutic approaches to the treatment of such
cancers.
[0555] Of note, targeted antitumor therapies have been useful even
when the targeted protein is expressed on normal tissues or cells,
even vital normal organ tissues. A vital organ is one that is
necessary to sustain life, such as the heart or colon. A non-vital
organ is one that can be removed whereupon the individual is still
able to survive. Examples of non-vital organs are ovary, breast,
and prostate.
[0556] Expression of a target protein in normal tissue, even vital
normal tissue, does not defeat the utility of a targeting agent for
the protein as a therapeutic for certain tumors in which the
protein is also overexpressed. For example, expression in vital
organs is not in and of itself detrimental. In addition, organs
regarded as dispensible, such as the prostate and ovary, can be
removed without affecting mortality. Finally, some vital organs are
not affected by normal organ expression because of an
immunoprivilege. Immunoprivileged organs are organs that are
protected from blood by a blood-organ barrier and thus are not
accessible to immunotherapy. Examples of immunoprivileged organs
are the brain and testis.
[0557] Accordingly, therapeutic approaches that inhibit the
activity of a FLT3 protein are useful for patients suffering from a
cancer that expresses FLT3 (such as, for example, those cancers set
forth in Table I). These therapeutic approaches generally fall into
three classes. The first class modulates FLT3 function as it
relates to tumor cell growth leading to inhibition or retardation
of tumor cell growth or inducing its killing. The second class
comprises various methods for inhibiting the binding or association
of a FLT3 protein with its binding partner or with other proteins.
The third class comprises a variety of methods for inhibiting the
transcription of a FLT3 gene or translation of FLT3 mRNA.
[0558] Accordingly, Cancer patients can be evaluated for the
presence and level of FLT3 expression, preferably using
immunohistochemical assessments of tumor tissue, quantitative FLT3
imaging, or other techniques that reliably indicate the presence
and degree of FLT3 expression. Immunohistochemical analysis of
tumor biopsies or surgical specimens is preferred for this purpose,
if applicable. Methods for immunohistochemical analysis of tumor
tissues are well known in the art.
XIII.) FLT3 as a Target for Antibody-Based Therapy
[0559] FLT3 is an attractive target for antibody-based therapeutic
strategies. A number of antibody strategies are known in the art
for targeting both extracellular and intracellular molecules (see,
e.g., complement and ADCC mediated killing as well as the use of
intrabodies). Because FLT3 is expressed by cancer cells of various
lineages relative to corresponding normal cells, systemic
administration of FLT3-immunoreactive compositions are prepared
that exhibit excellent sensitivity without toxic, non-specific
and/or non-target effects caused by binding of the immunoreactive
composition to non-target organs and tissues. Antibodies
specifically reactive with domains of FLT3 are useful to treat
FLT3-expressing cancers systemically, preferably as antibody drug
conjugates (i.e. ADCs) wherein the conjugate is with a toxin or
therapeutic agent.
[0560] Those skilled in the art understand that antibodies can be
used to specifically target and bind immunogenic molecules such as
an immunogenic region of a FLT3 sequence shown in FIG. 1. In
addition, skilled artisans understand that it is routine to
conjugate antibodies to cytotoxic agents (see, e.g., Slevers et al.
Blood 93:11 3678-3684 (Jun. 1, 1999)). When cytotoxic and/or
therapeutic agents are delivered directly to cells, such as by
conjugating them to antibodies specific for a molecule expressed by
that cell (e.g. FLT3), the cytotoxic agent will exert its known
biological effect (i.e. cytotoxicity) on those cells.
[0561] A wide variety of compositions and methods for using
antibody-cytotoxic agent conjugates to kill cells are known in the
art. In the context of cancers, typical methods entail
administering to an mammal having a tumor a biologically effective
amount of a conjugate comprising a selected cytotoxic and/or
therapeutic agent linked to a targeting agent (e.g. a FLT3 MAb,
preferably CHv62.21 or CHv62.21pAF) that binds to an antigen (e.g.
FLT3) expressed, accessible to binding or localized on the cell
surfaces. A typical embodiment is a method of delivering a
cytotoxic and/or therapeutic agent to a cell expressing FLT3,
comprising conjugating the cytotoxic agent to an antibody that
immunospecifically binds to a FLT3 epitope, and, exposing the cell
to the antibody drug conjugate (ADC). Another illustrative
embodiment is a method of treating an individual suspected of
suffering from metastasized cancer, comprising a step of
administering parenterally to said individual a pharmaceutical
composition comprising a therapeutically effective amount of an
antibody conjugated to a cytotoxic and/or therapeutic agent.
[0562] Cancer immunotherapy using FLT3 antibodies can be done in
accordance with various approaches that have been successfully
employed in the treatment of other types of cancer, including but
not limited to colon cancer (Arlen et al., 1998, Crit. Rev.
Immunol. 18:133-138), multiple myeloma (Ozaki et al., 1997, Blood
90:3179-3186, Tsunenari et al., 1997, Blood 90:2437-2444), gastric
cancer (Kasprzyk et al., 1992, Cancer Res. 52:2771-2776), B-cell
lymphoma (Funakoshi et al., 1996, J. Immunother. Emphasis Tumor
Immunol. 19:93-101), leukemia (Zhong et al., 1996, Leuk. Res.
20:581-589), colorectal cancer (Moun et al., 1994, Cancer Res.
54:6160-6166; Velders et al., 1995, Cancer Res. 55:4398-4403), and
breast cancer (Shepard et al., 1991, J. Clin. Immunol. 11:117-127).
Some therapeutic approaches involve conjugation of naked antibody
to a toxin or radioisotope, such as the conjugation of Y.sup.91 or
I.sup.131 to anti-CD20 antibodies (e.g., Zevalin.TM., IDEC
Pharmaceuticals Corp. or Bexxar.TM., Coulter Pharmaceuticals)
respectively, while others involve co-administration of antibodies
and other therapeutic agents, such as Herceptin.TM. (trastuzu MAb)
with paclitaxel (Genentech, Inc.). In a preferred embodiment, the
antibodies will be conjugated a cytotoxic agent, supra, preferably
an aurastatin derivative designated MMAE (Seattle Genetics).
[0563] Although FLT3 antibody therapy is useful for all stages of
cancer, antibody therapy can be particularly appropriate in
advanced or metastatic cancers. Treatment with the antibody therapy
of the invention is indicated for patients who have received one or
more rounds of chemotherapy. Alternatively, antibody therapy of the
invention is combined with a chemotherapeutic or radiation regimen
for patients who have not received chemotherapeutic treatment.
Additionally, antibody therapy can enable the use of reduced
dosages of concomitant chemotherapy, particularly for patients who
do not tolerate the toxicity of the chemotherapeutic agent very
well. Fan et al. (Cancer Res. 53:4637-4642, 1993), Prewett et al.
(International J. of Onco. 9:217-224, 1996), and Hancock et al.
(Cancer Res. 51:4575-4580, 1991) describe the use of various
antibodies together with chemotherapeutic agents.
[0564] FLT3 monoclonal antibodies that treat the cancers set forth
in Table I include those that initiate a potent immune response
against the tumor or those that are directly cytotoxic. In this
regard, FLT3 monoclonal antibodies (MAbs) can elicit tumor cell
lysis by either complement-mediated or antibody-dependent cell
cytotoxicity (ADCC) mechanisms, both of which require an intact Fc
portion of the immunoglobulin molecule for interaction with
effector cell Fc receptor sites on complement proteins. In
addition, FLT3 MAbs that exert a direct biological effect on tumor
growth are useful to treat cancers that express FLT3. Mechanisms by
which directly cytotoxic MAbs act include: inhibition of cell
growth, modulation of cellular differentiation, modulation of tumor
angiogenesis factor profiles, and the induction of apoptosis. The
mechanism(s) by which a particular FLT3 MAb exerts an anti-tumor
effect is evaluated using any number of in vitro assays that
evaluate cell death such as ADCC, complement-mediated cell lysis,
and so forth, as is generally known in the art.
[0565] Accordingly, preferred monoclonal antibodies used in the
therapeutic methods of the invention are those that are either
fully human and that bind specifically to the target FLT3 antigen
with high affinity.
XIV.) FLT3 ADC Cocktails
[0566] Therapeutic methods of the invention contemplate the
administration of single FLT3 ADCs as well as combinations, or
cocktails, of different MAbs (i.e. FLT3 MAbs or Mabs that bind
another protein). Such MAb cocktails can have certain advantages
inasmuch as they contain MAbs that target different epitopes,
exploit different effector mechanisms or combine directly cytotoxic
MAbs with MAbs that rely on immune effector functionality. Such
MAbs in combination can exhibit synergistic therapeutic effects. In
addition, FLT3 MAbs can be administered concomitantly with other
therapeutic modalities, including but not limited to various
chemotherapeutic and biologic agents, androgen-blockers, immune
modulators (e.g., IL-2, GM-CSF), surgery or radiation. In a
preferred embodiment, the FLT3 MAbs are administered in conjugated
form.
[0567] FLT3 ADC formulations are administered via any route capable
of delivering the antibodies to a tumor cell. Routes of
administration include, but are not limited to, intravenous,
intraperitoneal, intramuscular, intratumor, intradermal, and the
like. Treatment generally involves repeated administration of the
FLT3 ADC preparation, via an acceptable route of administration
such as intravenous injection (IV), typically at a dose in the
range, including but not limited to, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6,
0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 mg/kg
body weight. In general, doses in the range of 10-1000 mg MAb per
week are effective and well tolerated.
[0568] Based on clinical experience with the Herceptin.RTM.
(Trastuzumab) in the treatment of metastatic breast cancer, an
initial loading dose of approximately 4 mg/kg patient body weight
IV, followed by weekly doses of about 2 mg/kg IV of the MAb
preparation represents an acceptable dosing regimen. Preferably,
the initial loading dose is administered as a 90-minute or longer
infusion. The periodic maintenance dose is administered as a 30
minute or longer infusion, provided the initial dose was well
tolerated. As appreciated by those of skill in the art, various
factors can influence the ideal dose regimen in a particular case.
Such factors include, for example, the binding affinity and half
life of the MAbs used, the degree of FLT3 expression in the
patient, the extent of circulating shed FLT3 antigen, the desired
steady-state antibody concentration level, frequency of treatment,
and the influence of chemotherapeutic or other agents used in
combination with the treatment method of the invention, as well as
the health status of a particular patient.
[0569] Optionally, patients should be evaluated for the levels of
FLT3 in a given sample (e.g. the levels of circulating FLT3 antigen
and/or FLT3 expressing cells) in order to assist in the
determination of the most effective dosing regimen, etc. Such
evaluations are also used for monitoring purposes throughout
therapy, and are useful to gauge therapeutic success in combination
with the evaluation of other parameters (for example, urine
cytology and/or ImmunoCyt levels in bladder cancer therapy, or by
analogy, serum PSA levels in prostate cancer therapy).
[0570] An object of the present invention is to provide FLT3 ADCs,
which inhibit or retard the growth of tumor cells expressing FLT3.
A further object of this invention is to provide methods to inhibit
angiogenesis and other biological functions and thereby reduce
tumor growth in mammals, preferably humans, using such FLT3 ADCs,
and in particular using such FLT3 ADCs combined with other drugs or
immunologically active treatments.
XV.) Combination Therapy
[0571] In one embodiment, there is synergy when tumors, including
human tumors, are treated with FLT3 ADCs in conjunction with
chemotherapeutic agents or radiation or combinations thereof. In
other words, the inhibition of tumor growth by a FLT3 ADC is
enhanced more than expected when combined with chemotherapeutic
agents or radiation or combinations thereof. Synergy may be shown,
for example, by greater inhibition of tumor growth with combined
treatment than would be expected from a treatment of only FLT3 ADC
or the additive effect of treatment with a FLT3 ADC and a
chemotherapeutic agent or radiation. Preferably, synergy is
demonstrated by remission of the cancer where remission is not
expected from treatment either from a FLT3 ADC or with treatment
using an additive combination of a FLT3 ADC and a chemotherapeutic
agent or radiation.
[0572] The method for inhibiting growth of tumor cells using a FLT3
ADC and a combination of chemotherapy or radiation or both
comprises administering the FLT3 ADC before, during, or after
commencing chemotherapy or radiation therapy, as well as any
combination thereof (i.e. before and during, before and after,
during and after, or before, during, and after commencing the
chemotherapy and/or radiation therapy). For example, the FLT3 ADC
is typically administered between 1 and 60 days, preferably between
3 and 40 days, more preferably between 5 and 12 days before
commencing radiation therapy and/or chemotherapy. However,
depending on the treatment protocol and the specific patient needs,
the method is performed in a manner that will provide the most
efficacious treatment and ultimately prolong the life of the
patient.
[0573] The administration of chemotherapeutic agents can be
accomplished in a variety of ways including systemically by the
parenteral and enteral routes. In one embodiment, the FLT3 ADCs and
the chemotherapeutic agent are administered as separate molecules.
Particular examples of chemotherapeutic agents or chemotherapy
include cisplatin, dacarbazine (DTIC), dactinomycin,
mechlorethamine (nitrogen mustard), streptozocin, cyclophosphamide,
carmustine (BCNU), lomustine (CCNU), doxorubicin (adriamycin),
daunorubicin, procarbazine, mitomycin, cytarabine, etoposide,
methotrexate, 5-fluorouracil, vinblastine, vincristine, bleomycin,
paclitaxel (taxol), docetaxel (taxotere), aldesleukin,
asparaginase, busulfan, carboplatin, cladribine, dacarbazine,
floxuridine, fludarabine, hydroxyurea, ifosfamide, interferon
alpha, leuprolide, megestrol, melphalan, mercaptopurine,
plicamycin, mitotane, pegaspargase, pentostatin, pipobroman,
plicamycin, streptozocin, tamoxifen, teniposide, testolactone,
thioguanine, thiotepa, uracil mustard, vinorelbine, gemcitabine,
chlorambucil, taxol and combinations thereof.
[0574] The source of radiation, used in combination with a FLT3
ADC, can be either external or internal to the patient being
treated. When the source is external to the patient, the therapy is
known as external beam radiation therapy (EBRT). When the source of
radiation is internal to the patient, the treatment is called
brachytherapy (BT).
[0575] The above described therapeutic regimens may be further
combined with additional cancer treating agents and/or regimes, for
example additional chemotherapy, cancer vaccines, signal
transduction inhibitors, agents useful in treating abnormal cell
growth or cancer, antibodies (e.g. Anti-CTLA-4 antibodies as
described in WO/2005/092380 (Pfizer)) or other ligands that inhibit
tumor growth by binding to IGF-1R, and cytokines.
[0576] When the mammal is subjected to additional chemotherapy,
chemotherapeutic agents described above may be used. Additionally,
growth factor inhibitors, biological response modifiers,
anti-hormonal therapy, selective estrogen receptor modulators
(SERMs), angiogenesis inhibitors, and anti-androgens may be used.
For example, anti-hormones, for example anti-estrogens such as
Nolvadex (tamoxifen) or, anti-androgens such as Casodex
(4'-cyano-3-(4-fluorophenylsulphonyl)-2-hydroxy-2-methyl-3-'-(tri-
fluoromethyl)propionanilide) may be used.
[0577] The above therapeutic approaches can be combined with any
one of a wide variety of surgical, chemotherapy or radiation
therapy regimens. The therapeutic approaches of the invention can
enable the use of reduced dosages of chemotherapy (or other
therapies) and/or less frequent administration, an advantage for
all patients and particularly for those that do not tolerate the
toxicity of the chemotherapeutic agent well.
XVI.) Kits/Articles of Manufacture
[0578] For use in the laboratory, prognostic, prophylactic,
diagnostic and therapeutic applications described herein, kits are
within the scope of the invention. Such kits can comprise a
carrier, package, or container that is compartmentalized to receive
one or more containers such as vials, tubes, and the like, each of
the container(s) comprising one of the separate elements to be used
in the method, along with a label or insert comprising instructions
for use, such as a use described herein. For example, the
container(s) can comprise an antibody that is or can be detectably
labeled. Kits can comprise a container comprising a Drug Unit. The
kit can include all or part of the amino acid sequences in FIGS.
2A, 2B and/or 2C, or FIGS. 3A, 3B and/or 3C or analogs thereof, or
a nucleic acid molecule that encodes such amino acid sequences.
[0579] The kit of the invention will typically comprise the
container described above and one or more other containers
associated therewith that comprise materials desirable from a
commercial and user standpoint, including buffers, diluents,
filters, needles, syringes; carrier, package, container, vial
and/or tube labels listing contents and/or instructions for use,
and package inserts with instructions for use.
[0580] A label can be present on or with the container to indicate
that the composition is used for a specific therapy or
non-therapeutic application, such as a prognostic, prophylactic,
diagnostic or laboratory application, and can also indicate
directions for either in vivo or in vitro use, such as those
described herein. Directions and or other information can also be
included on an insert(s) or label(s) which is included with or on
the kit. The label can be on or associated with the container. A
label a can be on a container when letters, numbers or other
characters forming the label are molded or etched into the
container itself; a label can be associated with a container when
it is present within a receptacle or carrier that also holds the
container, e.g., as a package insert. The label can indicate that
the composition is used for diagnosing, treating, prophylaxing or
prognosing a condition, such as a cancer of a tissue set forth in
Table I.
[0581] The terms "kit" and "article of manufacture" can be used as
synonyms.
[0582] In another embodiment of the invention, an article(s) of
manufacture containing compositions, such as antibody(s), or
antibody drug conjugates (ADCs) e.g., materials useful for the
diagnosis, prognosis, prophylaxis and/or treatment of cancers of
tissues such as those set forth in Table I is provided. The article
of manufacture typically comprises at least one container and at
least one label. Suitable containers include, for example, bottles,
vials, syringes, and test tubes. The containers can be formed from
a variety of materials such as glass, metal or plastic. The
container can hold amino acid sequence(s), small molecule(s),
nucleic acid sequence(s), cell population(s) and/or antibody(s). In
another embodiment a container comprises an antibody, binding
fragment thereof or specific binding protein for use in evaluating
protein expression of FLT3 in cells and tissues, or for relevant
laboratory, prognostic, diagnostic, prophylactic and therapeutic
purposes; indications and/or directions for such uses can be
included on or with such container, as can reagents and other
compositions or tools used for these purposes.
[0583] The container can alternatively hold a composition that is
effective for treating, diagnosis, prognosing or prophylaxing a
condition and can have a sterile access port (for example the
container can be an intravenous solution bag or a vial having a
stopper pierceable by a hypodermic injection needle). The active
agents in the composition can be an antibody capable of
specifically binding FLT3 or an antibody drug conjugate
specifically binding to FLT3.
[0584] The article of manufacture can further comprise a second
container comprising a pharmaceutically-acceptable buffer, such as
phosphate-buffered saline, Ringer's solution and/or dextrose
solution. It can further include other materials desirable from a
commercial and user standpoint, including other buffers, diluents,
filters, stirrers, needles, syringes, and/or package inserts with
indications and/or instructions for use.
[0585] Further embodiments of the disclosure herein include the
embodiments described in the following clauses:
[0586] Clause 1 is an embodiment of an antibody, wherein the
antibody comprises a CDRH1 having the amino acid sequence of SEQ ID
NO:23, a CDRH2 having the amino acid sequence of SEQ ID NO:29, a
CDRH3 having the amino acid sequence of SEQ ID NO:32, a CDRL1
having the amino acid sequence of SEQ ID NO: 14, a CDRL2 having the
amino acid sequence of SEQ ID NO: 17, and a CDRL3 having the amino
acid sequence of SEQ ID NO:20. In an alternative embodiment, the
antibody comprises the CDRs as determined by the Chothia method as
shown in Table V. In another alternative embodiment, the antibody
comprises the CDRs as determined by the Contact method as shown in
Table V.
[0587] Clause 2 is a further embodiment, wherein the antibody is an
antibody according to clause 1, and wherein the antibody comprises
a heavy chain variable region consisting of the amino acid sequence
ranging from 1.sup.st E to the 123.sup.rd S of SEQ ID NO: 11 and
comprises a light chain variable region consisting of the amino
acid sequence ranging from 1.sup.st D to the 108.sup.th R of SEQ ID
NO: 10.
[0588] Clause 3 is a further embodiment, wherein the antibody is an
antibody according to any one of the preceding clauses, and wherein
the antibody comprises a heavy chain variable region consisting of
the amino acid sequence of the heavy chain variable region of an
antibody produced by a Chinese Hamster Ovary (CHO) cell deposited
under ATCC Accession No. PTA-121831 and comprises a light chain
variable region consisting of the amino acid sequence of the light
chain of an antibody produced by a Chinese Hamster Ovary (CHO)
deposited under ATCC. Accession No. PTA-121831; or wherein the
antibody comprises a heavy chain variable region consisting of the
amino acid sequence of the heavy chain variable region of an
antibody produced by a Chinese Hamster Ovary (CHO) cell deposited
under ATCC Accession No. PTA-121836 and comprises a light chain
variable region consisting of the amino acid sequence of the light
chain of an antibody produced by a Chinese Hamster Ovary (CHO)
deposited under ATCC. Accession No. PTA-121836.
[0589] Clause 4 is a further embodiment, wherein the antibody is an
antibody according to any one of the preceding clauses, and wherein
the antibody comprises an Fc region that is an IgG subtype.
[0590] Clause 5 is a further embodiment, wherein the antibody is an
antibody according to the preceding clause, and wherein the Fc
region comprises a substitution of a non-natural amino acid at
amino acid position 124 of the heavy chain, and wherein the
non-natural amino acid is para-acetylphenylalanine (pAF).
[0591] Clause 6 is a further embodiment, wherein the antibody is an
antibody according to any one of the preceding clauses, and wherein
the antibody comprises a heavy chain consisting of the amino acid
sequence of amino acid numbers 1 to 452 of SEQ ID NO: 11 and
comprises a light chain consisting of the amino acid sequence
ranging from the 1.sup.st D to the 214th SEQ ID NO: 10. In an
alternative embodiment of Clause 6, the antibody is an antibody
according to clause 1 or clause 2, wherein the antibody comprises a
heavy chain consisting of the amino acid sequence of amino acid
numbers 1 to 452 of SEQ ID NO: 11 and comprises a light chain
consisting of the amino acid sequence ranging from the 1.sup.st D
to the 214th SEQ ID NO: 10.
[0592] Clause 7 is a further embodiment, wherein the antibody is an
antibody according to any one of the preceding clauses, and wherein
the antibody comprises a heavy chain consisting of the amino acid
sequence ranging from 1.sup.st E to the 453.sup.rd K of SEQ ID NO:
11 and comprises a light chain consisting of the amino acid
sequence ranging from 1.sup.st D to the 214.sup.th C of SEQ ID NO:
10. In an alternative embodiment of Clause 7, the antibody is an
antibody according to clause 1 or clause 2, wherein the antibody
comprises a heavy chain consisting of the amino acid sequence
ranging from 1.sup.st E to the 453.sup.rd K of SEQ ID NO: 11 and
comprises a light chain consisting of the amino acid sequence
ranging from 1.sup.st D to the 214.sup.th C of SEQ ID NO: 10.
[0593] Clause 8 is a further embodiment, wherein the antibody is an
antibody according to any of the preceding clauses, and wherein the
antibody comprises a heavy chain consisting of the amino acid
sequence of the heavy chain of an antibody produced by a Chinese
Hamster Ovary (CHO) cell deposited under American Type Culture
Collection (ATCC) Accession No. PTA-121831, and comprises a light
chain consisting of the amino acid sequence of the light chain of
an antibody produced by a Chinese Hamster Ovary (CHO) cell
deposited under ATCC Accession No. PTA-121831. An alternative
embodiment of clause 8 is an antibody according to clause 5,
wherein the antibody comprises a heavy chain consisting of the
amino acid sequence of the heavy chain of an antibody produced by a
Chinese Hamster Ovary (CHO) cell deposited under American Type
Culture Collection (ATCC) Accession No. PTA-121831, and comprises a
light chain consisting of the amino acid sequence of the light
chain of an antibody produced by a Chinese Hamster Ovary (CHO) cell
deposited under ATCC Accession No. PTA-121831.
[0594] Clause 9 is a further embodiment, wherein the antibody is an
antibody of any of the preceding clauses, and wherein the antibody
comprises a heavy chain consisting of the amino acid sequence of
the heavy chain of an antibody produced by a Chinese Hamster Ovary
(CHO) cell deposited under ATCC. Accession No. PTA-121836, and
comprises a light chain consisting of the amino acid sequence of
the light chain of an antibody produced by a Chinese Hamster Ovary
(CHO) deposited under ATCC. Accession No. PTA-121836. An
alternative embodiment of clause 9 is an antibody of any one of
clauses 1 to 5, wherein the antibody comprises a heavy chain
consisting of the amino acid sequence of the heavy chain of an
antibody produced by a Chinese Hamster Ovary (CHO) cell deposited
under ATCC. Accession No. PTA-121836, and comprises a light chain
consisting of the amino acid sequence of the light chain of an
antibody produced by a Chinese Hamster Ovary (CHO) deposited under
ATCC. Accession No. PTA-121836.
[0595] Clause 10 is a further embodiment wherein the antibody is an
antibody according to any one of the preceding clauses, and wherein
the 1.sup.st E of the heavy chain variable region or the heavy
chain is substituted with pyroglutamate.
[0596] Clause 11 is a further embodiment wherein the antibody is an
antibody according to any of clauses 1-5, and wherein the antibody
comprises a heavy chain consisting of the amino acid sequence
ranging from the 1.sup.st E to the 452.sup.rd G of SEQ ID NO: 11,
and wherein the 1.sup.st E of the heavy chain variable region or
the heavy chain is modified to pyroglutamate, and wherein the
antibody comprises a light chain consisting of the amino acid
sequence ranging from the 1.sup.st D to the 214.sup.th C of SEQ ID
NO: 10. An alternative embodiment of clause 11 is an antibody of
any one of clauses 1 to 6, wherein the antibody comprises a heavy
chain consisting of the amino acid sequence ranging from the
I.sup.st E to the 452.sup.rd G of SEQ ID NO: 11, and wherein the
1.sup.st E of the heavy chain variable region or the heavy chain is
modified to pyroglutamate, and wherein the antibody comprises a
light chain consisting of the amino acid sequence ranging from the
1.sup.st D to the 214w C of SEQ ID NO: 10.
[0597] Clause 12 is a further embodiment that is an antigen binding
fragment comprising the CDRs of the antibodies according to any one
of the preceding clauses, and wherein the antigen-binding fragment
binds FLT-3.
[0598] Clause 13 is a further embodiment which is the
antigen-binding fragment according to the preceding clause, wherein
the antigen-binding fragment is selected from the group consisting
of Fab, Fab', F(ab').sub.2, Fv, scFv, isolated VH, and isolated
VL.
[0599] Clause 14 is an antibody comprising the antigen-binding
fragment according to clause 12 or clause 13.
[0600] Clause 15 is a further embodiment which is an antibody which
has 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
sequence identity to the antibody according to any of the preceding
clauses 1 to 10 or 14, and wherein the antibody comprises the CDRs
of the antibody according to any of the preceding clauses.
[0601] Clause 16 is a further embodiment which is an antibody
according to clause 15 that binds FLT3 with the same affinity as
the corresponding antibody of clause 15, and does not substantially
inhibit FL binding to FLT3.
[0602] Clause 17 is a further embodiment which is one or more
isolated nucleic acids encoding the antibody according to any one
of clauses 1 to 10 or 14.
[0603] Clause 18 is a further embodiment which is one or more
isolated nucleic acids encoding the antibody or fragments of
clauses 12 or 13.
[0604] Clause 19 is a further embodiment of the nucleic acids of
clause 17 or 18 which has 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, or 99% sequence identity to the nucleic acids of the
corresponding clauses.
[0605] Clause 20 is a further embodiment which is one or more
expression vectors comprising the one or more isolated nucleic
acids according to clause 17 or clause 18 or clause 19. In one
embodiment of clause 20, there is one expression vector that
expresses the heavy and light chain of an antibody of any of the
preceding clauses. In a further embodiment, the expression vector
of clause 20 comprises two promoters. In an alternative embodiment,
the expression vector of clause 20 comprises one promoter. In a
different embodiment of clause 20, there are two expression
vectors, one of which expresses the heavy chain, and the other of
which expresses the light chain. In a further embodiment, each
expression vector of clause 20 comprises the same promoter. In a
still further embodiment, each expression vector of clause 20
comprises a different promoter.
[0606] Clause 21 is a further embodiment which is a recombinant
host cell comprising the one or more expression vectors according
to the preceding clause, clause 20.
[0607] Clause 22 is a further embodiment which is an antibody
produced by culturing the recombinant host cell of the preceding
clause, clause 21.
[0608] Clause 23 is a further embodiment which is an antibody drug
conjugate comprising the antibody of the preceding clause, clause
22, and a therapeutic agent.
[0609] Clause 24 is an embodiment that is an antibody drug
conjugate that comprises an antibody that binds FLT3 and a
therapeutic agent, wherein the antibody drug conjugate does not
substantially inhibit the binding of FLT3 to FLT3 ligand (FL).
[0610] Clause 25 is a further embodiment that is the antibody drug
conjugate of clause 23 or clause 24, further comprising a linker
joining the antibody and the therapeutic agent.
[0611] Clause 26 is a further embodiment, which is an antibody drug
conjugate of clause 25, wherein the linker is a non-cleavable
linker.
[0612] Clause 27 is a further embodiment which is the antibody drug
conjugate of clause 26, wherein the linker is 2-(aminooxy)acetic
acid.
[0613] Clause 28 is a further embodiment which is the antibody drug
conjugate of any one of clauses 23 to 27, wherein the therapeutic
agent is a cytotoxic or cytostatic agent.
[0614] Clause 29 is a further embodiment which is the antibody drug
conjugate of any one of clauses 23 to 28, wherein the therapeutic
agent is
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-pheny-
lpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-meth-
oxy-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methyla-
mino)butanamido)butanamide.
[0615] Clause 30 is a further embodiment which is an antibody drug
conjugate, wherein the antibody drug conjugate is any one of
clauses 23 to 29, and wherein the antibody drug conjugate has the
following formula:
Antibody-(Linker-therapeutic agent)p,
wherein the linker is 2-(aminooxy)acetic acid, and wherein the
therapeutic agent is
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide and wherein p is selected from the group
consisting of 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2,
2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, and 3.
[0616] Clause 31 is a further embodiment which is an antibody drug
conjugate of clause 30, wherein p is selected from the group
consisting of 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2,
2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, and 3.
[0617] Clause 32 is a further embodiment which is an antibody drug
conjugate of clause 31, wherein p is selected from the group
consisting of 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4,
2.5.
[0618] Clause 33 is a further embodiment which is an antibody drug
conjugate of clause 32, wherein p is selected from the group
consisting of 1.8, 1.9, and 2.
[0619] Clause 34 is a further embodiment that is a pharmaceutical
composition, wherein the pharmaceutical composition comprises a
therapeutically effective amount of the antibody drug conjugate of
any of clauses 23 to 33.
[0620] Clause 35 is a further embodiment which is the
pharmaceutical composition of clause 34, for use in therapy.
[0621] Clause 36 is a further embodiment that is a pharmaceutical
composition, wherein the pharmaceutical composition is according to
the preceding clause, clause 35, wherein the use in therapy is the
treatment of cancer.
[0622] Clause 37 is a further embodiment that is a pharmaceutical
composition, wherein the pharmaceutical composition is according to
any one of clauses 34 to 36, in combination with one or more
anti-neoplastic agents.
[0623] Clause 38 is a further embodiment that is a method of
treating cancer in a subject, wherein the method of treating cancer
in a subject comprises administering to said subject a
therapeutically effective amount of an antibody drug conjugate
according to any of claims 23 to 33, or a pharmaceutical
composition thereof. Another embodiment of clause 37 is an
embodiment that is a method of treating cancer in a subject,
wherein the method of treating cancer in a subject comprises
administering to said subject a therapeutically effective amount of
a pharmaceutical composition according to any one of claims 33 to
37.
[0624] Clause 39 is a further embodiment that is a pharmaceutical
composition according to any one of clauses 33 to 37, or the method
according to clause 38, wherein the cancer comprises one or more
cells that express FLT3 at an increased level as compared to a
non-cancerous cell.
EXAMPLES
[0625] Various aspects of the invention are further described and
illustrated by way of the several examples that follow, none of
which is intended to limit the scope of the invention.
Example 1
The FLT3 Antigen
[0626] FLT3, Fms like tyrosine kinase 3 receptor, also known as
Flk2 (fetal liver kinase 2), STK1 (stem cell tyrosine kinase 1) and
CD135, is a member of the type III receptor tyrosine kinases
(RTKs). Human FLT3 encodes an RTK of 993 amino acids in length,
which comprises membrane-bound receptor with five
immunoglobulin-like extracellular domains and two intracellular
tyrosine kinase domains (TKD) linked by a kinase-insert domain
(Stirewalt D L et al; Nat Rev Cancer; 650-665(2003). Human FLT3
gene (Gene ID No.: 2322 (National Center for Biotechnology
Information)) is located on chromosome 13q12 and share 85% amino
acid sequence homology with mouse FLT3 (Rosnet O et al; Oncogene
8:173-179 (1993). FLT3 is expressed in normal myeloid and lymphoid
progenitor cells and by the leukemic cells of 70-90% of AML
patients (Carow, C. E et al; Blood 87: 1089-1096 (1996); Rosnet O
et al; Leukemia 10:238-248 (1996) and also in ALL. FLT3 is known to
be involved in the proliferation, differentiation and apoptosis of
hematopoietic cells. Many hematopoietic cells produce FLT3 ligand
(FLT3L), which promotes receptor dimerization and activation, thus
inducing signaling cascade via PI3kinase and MAPK pathways
(Stirewalt D L et al; Nat Rev Cancer; 650-665(2003). Approximately,
30% of AML patients harbor FLT3 internal-tandem duplication (ITD)
mutations that drive constitutive activation of the receptors and
downstream signaling cascade, associated with poor disease outcome
(Gunawardane R N et al; Mom Cancer Ther 12:438-447 (2013). For
exemplary embodiments of the FLT3 antigen, see FIG. 1.
Example 2
Generation of FLT3 Monoclonal Antibodies (MAbs)
[0627] In one embodiment, therapeutic Monoclonal Antibodies
("MAbs") to FLT3 comprise those that react with epitopes specific
for FLT3 that would bind to FLT3 expressed on cells. Immunogens for
generation of such MAbs include those designed to encode or contain
the extracellular domains or the entire FLT3 protein sequence,
regions predicted to contain functional motifs, and regions of FLT3
predicted to be antigenic by computer analysis of the amino acid
sequence. Immunogens include peptides, recombinant proteins and
cells (which endogenously express FLT3 or that have been engineered
to express FLT3).
[0628] MAbs to FLT3 were generated using VelocImmune.RTM.
technology (Regeneron, Tarrytown, N.Y.) wherein genetically
engineered mice make antibodies that have fully human variable
regions and mouse constant regions. The MAb designated v62-1b21
(also known as AGS62.21) was generated after immunizing
VelocImmune.RTM. mice with recombinant human FLT3 protein. The FLT3
MAb, v62-1b21 specifically binds to Flt3 protein and Flt3
expressing cells (recombinant and endogenous).
[0629] After selection, v62-1b21 (naturally produced by a hybridoma
cell line) was converted to a CHO expressed fully human native
antibody by combining the human variable sequences from the
VelocImmune.RTM. antibody (See, Example 3--Expression of CHv62.21
using Recombinant DNA Methods) but with human constant regions
incorporating a non-natural amino acid at position 124 on the heavy
chain, according to the ReCODE technology developed by Ambrx (La
Jolla, Calif.) (See, Example 4--Expression of Human CHv62.21pAF
Using Recombinant DNA Methods).
[0630] DNA coding sequences for v62-1b21 was determined after
isolating mRNA from the v62-1b21 producing hybridoma cells.
Anti-F1t3, v62-1b21 heavy and light chain variable nucleic acid
sequences were derived from the hybridoma cells using the following
protocol. v62-1b21 secreting hybridoma cells were lysed with Trizol
reagent (Life Technologies, Gibco BRL). Total RNA was purified and
first strand cDNA was generated from total RNA with oligo (dT)12-18
priming using the Gibco-BRL Superscript Pre-amplification system.
First strand cDNA was then amplified using human immunoglobulin
variable heavy chain primers, and human immunoglobulin variable
light chain primers. PCR products were sequenced and the variable
heavy and light chain regions determined.
[0631] The nucleic acid and amino acid sequences of the variable
heavy and light chain regions are listed in FIGS. 2A and/or 2B and
FIGS. 3A and/or 3B. Alignment of CHv62.21 MAb to human Ig germline
is set forth in FIG. 4A-4B.
Example 3
Expression of CHv62.21 Using Recombinant DNA Methods
[0632] To express CHv62.21 MAb recombinantly in transfected cells,
v62.21 hybridoma MAb variable heavy and light chain sequences were
cloned upstream of the human heavy chain IgG and human light chain
IgK constant regions respectively. The complete CHv62.21 MAb human
heavy chain and light chain cassettes were cloned downstream of the
CMV promoter/enhancer in a cloning vector. The recombinant CHv62.21
MAb expressing construct was transfected into CHO cells for stable
expression in the Lonza GS system (Lonza, Basel, Switzerland). The
CHv62.21 MAb secreted from recombinant CHO cells was purified and
evaluated for binding to cell surface FLT3 by flow cytometry.
Results show that the recombinant CHv62.21 antibody expressed in
CHO cells binds to FLT3 on the cell surface.
[0633] Results further show that the recombinantly expressed
CHv62.21 expressed in CHO cells binds FLT3 similarly to the v62.21
purified from hybridoma. The CHv62.21 MAb secreted from recombinant
cells is also evaluated for binding to FLT3 recombinant protein by
ELISA. Binding of CHv62.21 to FLT3 protein is identical between MAb
material derived from CHO and from hybridoma cells.
[0634] The Chinese Hamster Ovary (CHO) cell producing an antibody
designated CHv62.21 was sent (via Federal Express) to the American
Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108
on 9 Dec. 2014 and assigned Accession number PTA-121831.
[0635] The nucleic acid and amino acid sequences of the variable
heavy and light chain regions are listed in FIGS. 2A and/or 2B and
FIGS. 3A and/or 3B.
[0636] As a result of experimental analysis, using methods known in
the art (e.g. protease digestion, LCMS analysis, etc.), amino acid
modification(s) of the CHv62.21 MAb derived from CHO cells, showed
that the deletion of lysine at the C terminal of the heavy chain
occurs in most of purified CHv62.21 MAb and pyroglutamylation at
the N terminal of the heavy chain and deletion of lysine at the C
terminal of the heavy chain occur in a part of purified CHv62.21
MAb.
Example 4
Expression of Human CHv62.21pAF Using Recombinant DNA Methods
[0637] To express CHv62.21pAF recombinantly in transfected cells,
v62-1b21 hybridoma MAb variable heavy and light chain sequences
were cloned upstream of the human heavy chain IgG and human light
chain IgK constant regions respectively. The complete CHv62.21 MAb
human heavy chain and light chain cassettes were cloned downstream
of the CMV promoter/enhancer in a cloning vector. The recombinant
CHv62.21 MAb expressing construct was then transfected into CHO
pAFsupl-4E2 cells (Ambrx, La Jolla, Calif.), which stably express
the amber suppressor tRNA and pAF-specific aminoacyl tRNA
synthetase, for generation of stable clones. The stable clones
produce CHv62.21pAF by incorporation of pAF into the MAb. The
stable clones were subjected to gene amplification followed by
subcloning. The CHv62.21pAF secreted from the stable subclone was
purified and evaluated for binding to cell surface FLT3 by flow
cytometry. Results show that the recombinant CHv62.21pAF antibody
expressed from the CHO cells binds to FLT3 on the cell surface.
[0638] The Chinese Hamster Ovary (CHO) cell producing an antibody
designated CHv62.21pAF was sent (via Federal Express) to the
American Type Culture Collection (ATCC), P.O. Box 1549, Manassas,
Va. 20108 on 9 Dec. 2014 and assigned Accession number
PTA-121836.
[0639] The nucleic acid and amino acid sequences of the variable
heavy and light chain regions are listed in FIGS. 2C and/or 2B and
FIGS. 3C and/or 3B.
[0640] As a result of experimental analysis, using methods known in
the art (e.g. protease digestion, LCMS analysis, etc.), amino acid
modification(s) of the CHv62.21pAF MAb derived from CHO cells,
showed that the deletion of lysine at the C terminal of the heavy
chain occurs in most of purified CHv62.21 pAF MAb and
pyroglutamylation at the N terminal of the heavy chain and deletion
of lysine at the C terminal of the heavy chain occur in a part of
purified CHv62.21 pAF MAb.
Example 5
Generation of Linker Unit AGL
[0641] In a preferred embodiment, the Linker Unit of the present
invention, denoted AGL, is used to link a FLT3 MAb of the present
invention, preferably CHv62.21pAF, with a Drug Unit of the present
invention, preferably AGD-0182 is commonly known as
2-(aminooxy)acetic acid (Chem-Impex International, Inc., Wood Dale,
Ill.).
[0642] In a further embodiment, the AGL Linker Unit of the present
invention has the following formula:
##STR00027##
Example 6
Generation and Synthesis of AGD-0182 Drug Unit
[0643] The Drug Unit set forth in Formula (II) was generated using
the following process. First, to a stirred 23.degree. C. suspension
of Boc-Dap-OH dicyclohexylamine (10.0 g, 21.3 mmol) and
H-Phe-NH.sub.2HCl salt (6.42 g, 32.0 mmol) in CH.sub.2Cl.sub.2
(20.0 mL) was added DIEA (11.0 g, 14.9 mL, 85.3 mmol) followed by
the addition of DEPC (5.19 g, 4.80 mL, 0.032 mol). After 10 h,
analysis by LCMS showed the reaction was complete. The crude
reaction was washed with H.sub.2O (25 mL.times.2), followed by
brine (25 mL.times.2). The organic fraction was dried over a pad of
magnesium sulfate, filtered and concentrated in vacuo. The crude
orange oil was purified by flash chromatography (silica gel 40
.mu.m, 60 .ANG., size) using 2% to 10% methanol in CH.sub.2Cl.sub.2
as the eluent. A total of 7.25 g of Boc-Dap-Phe-NH.sub.2 (16.7
mmol, 78%) was obtained as a yellow oil. LCMS RT=1.28 min (Method
B); ESI-MS m/z 434.19 [M+H].sup.+.
[0644] Second, to a stirred 23.degree. C. suspension of
Boc-Dap-Phe-NH.sub.2 (7.25 g, 16.7 mmol) in CH.sub.2Cl.sub.2 (10
mL) was added TFA (10 mL). After 5 h, analysis by LCMS showed the
reaction was complete. The volatile organics were evaporated in
vacuo to give crude product, which was used without further
purification. A total of 6.00 g of H-Dap-Phe-NH.sub.2 was obtained
as an orange solid (13.4 mmol, 80%). LCMS RT=0.691 min (Method B);
ESI-MS m/z 334.17 [M+H].sup.+.
[0645] Then to a stirred 23.degree. C. suspension of
Fmoc-MeVal-Abu(3-N.sub.3)-Dil-OH TFA salt (456 mg, 0.586 mmol) and
H-Dap-Phe-NH.sub.2 TFA salt (457 mg, 1.02 mmol) in DMF (10 mL) was
added DIEA (0.350 g, 0.500 mL, 2.74 mmol) followed by the addition
of HATU (0.520 g, 1.37 mmol). After 10 h, analysis by LCMS showed
the reaction was complete. The crude reaction was purified by
preparatory RP-HPLC with a Phenomenex Gemini NX-C18 10.mu. 110
.ANG. column (150.times.30 mm) using 10% to 90% MeCN in 0.1%
aqueous formic acid as the eluent. A total of 526 mg of
Fmoc-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 was obtained as the
formic acid salt (0.513 mmol, 75%). LCMS RT=1.81 min (Method B);
ESI-MS m/z 980.39 [M+H].sup.+.
[0646] Finally, to a stirred 23.degree. C. solution of
Fmoc-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 (525 mg, 0.513 mmol)
in acetonitrile (10 mL) was added piperidine (5 mL). After 2 h,
analysis by LCMS showed the reaction was complete. To the crude
reaction solution was added hexanes (15 mL.times.3). The
acetonitrile layer was concentrated in vacuo. The crude oil was
purified by preparatory RP-HPLC with a Phenomenex Gemini NX-C18
10.mu. 110 .ANG. column (150.times.30 mm) using 5% to 95% MeCN in
0.1% aqueous TFA as the eluent. A total of 354 mg of the title
compound was obtained as the TFA salt (0.406 mmol, 79%). LCMS
RT=1.15 min (Method B); ESI-MS m/z 758.24 [M+H].sup.+; HRMS m/z
758.4915 [C.sub.38H.sub.63N.sub.9O.sub.7+H].sup.+.
[0647] The foregoing synthesis generated the following Drug Unit
denoted
(2S,3S)--N-((3R,4S,5S)-1-((S)-2-((1R,2R)-3-(((S)-1-amino-1-oxo-3-phenylpr-
opan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-3-methoxy-
-5-methyl-1-oxoheptan-4-yl)-3-azido-N-methyl-2-((S)-3-methyl-2-(methylamin-
o)butanamido)butanamide, which is set forth as Formula (II):
##STR00028##
Example 7
Synthesis of Drug Linker AGL and AGD-0182 Drug Unit
[0648] Synthesis of the AGL Linker Unit and the AGD-0182 Drug Unit
was completed in the following manner.
[0649] Method A is described using the following procedures and
protocols:
[0650] 0-0.50 min: isocratic 80 water/10 acetonitrile/10 1% formic
acid in water; 0.50-3.50 min: linear gradient 80 water/10
acetonitrile/10 1% formic acid in water to 0 water/90
acetonitrile/10 1% formic acid in water; 3.50-3.99 min isocratic 0
water/90 acetonitrile/10 1% formic acid in water; 3.99-4.00 min
linear gradient 0 water/90 acetonitrile/10 1% formic acid in water
to 80 water/10 acetonitrile/10 1% formic acid in water.
[0651] Method B is described using the following procedures and
protocols:
[0652] 0-0.50 min: isocratic 85 water/5 acetonitrile/10 1% formic
acid in water; 0.50-1.60 min: linear gradient 85 water/5
acetonitrile/10 1% formic acid in water to 0 water/98
acetonitrile/2 1% formic acid in water; 1.60-1.80 min isocratic 0
water/98 acetonitrile/2 1% formic acid in water; 1.80-1.90 min
linear gradient 0 water/98 acetonitrile/2 1% formic acid in water
to 85 water/5 acetonitrile/10 1% formic acid in water; 1.90-2.00
min isocratic 85 water/5 acetonitrile/10 1% formic acid in
water.
[0653] Using the above methods, the synthesis is as follows:
[0654] To a stirred 23.degree. C. suspension of Boc-Dap-OH
dicyclohexylamine (10.0 g, 21.3 mmol) and H-Phe-NH.sub.2HCl salt
(6.42 g, 32.0 mmol) in CH.sub.2Cl.sub.2 (20.0 mL) was added DIEA
(11.0 g, 14.9 mL, 85.3 mmol) followed by the addition of DEPC (5.19
g, 4.80 mL, 0.032 mol). After 10 h, analysis by LCMS showed the
reaction was complete. The crude reaction was washed with H.sub.2O
(25 mL.times.2), followed by brine (25 mL.times.2). The organic
fraction was dried over a pad of magnesium sulfate, filtered and
concentrated in vacuo. The crude orange oil was purified by flash
chromatography (silica gel 40 .mu.m, 60 .ANG., size) using 2% to
10% methanol in CH.sub.2Cl.sub.2 as the eluent. A total of 7.25 g
of Boc-Dap-Phe-NH.sub.2 (16.7 mmol, 78%) was obtained as a yellow
oil. LCMS RT=1.28 min (Method B); ESI-MS m/z 434.19
[M+H].sup.+.
[0655] To a stirred 23.degree. C. suspension of
Boc-Dap-Phe-NH.sub.2 (7.25 g, 16.7 mmol) in CH.sub.2Cl.sub.2 (10
mL) was added TFA (10 mL). After 5 h, analysis by LCMS showed the
reaction was complete. The volatile organics were evaporated in
vacuo to give crude product, which was used without further
purification. A total of 6.00 g of H-Dap-Phe-NH.sub.2 was obtained
as an orange solid (13.4 mmol, 80%). LCMS RT=0.691 min (Method B);
ESI-MS m/z 334.17 [M+H].sup.+.
[0656] To a stirred 23.degree. C. suspension of
Fmoc-MeVal-Abu(3-N.sub.3)-Dil-OH TFA salt (456 mg, 0.586 mmol) and
H-Dap-Phe-NH.sub.2 TFA salt (457 mg, 1.02 mmol) in DMF (10 mL) was
added DIEA (0.350 g, 0.500 mL, 2.74 mmol) followed by the addition
of HATU (0.520 g, 1.37 mmol). After 10 h, analysis by LCMS showed
the reaction was complete. The crude reaction was purified by
preparatory RP-HPLC with a Phenomenex Gemini NX-C18 10.mu. 110
.ANG. column (150.times.30 mm) using 10% to 90% MeCN in 0.1%
aqueous formic acid as the eluent. A total of 526 mg of
Fmoc-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 was obtained as the
formic acid salt (0.513 mmol, 75%). LCMS RT=1.81 min (Method B);
ESI-MS m/z 980.39 [M+H].sup.+.
[0657] To a stirred 23.degree. C. solution of
Fmoc-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 (525 mg, 0.513 mmol)
in acetonitrile (10 mL) was added piperidine (5 mL). After 2 h,
analysis by LCMS showed the reaction was complete. To the crude
reaction solution was added hexanes (15 mL.times.3). The
acetonitrile layer was concentrated in vacuo. The crude oil was
purified by preparatory RP-HPLC with a Phenomenex Gemini NX-C18
10.mu. 110 .ANG. column (150.times.30 mm) using 5% to 95% MeCN in
0.1% aqueous TFA as the eluent. A total of 354 mg of the resulting
compound (MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2) was obtained
as the TFA salt (0.406 mmol, 79%). LCMS RT=1.15 min (Method B);
ESI-MS m/z 758.24 [M+H].sup.+; HRMS m/z 758.4915
[C.sub.38H.sub.63N.sub.9O.sub.7+H].sup.+.
[0658] To a stirred 23.degree. C. solution of
MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 (2.0 g, 2.64 mmol) and
Boc-Aoa (0.53 g, 2.77 mmol) in DMF (7.0 mL) and DCM (15.0 mL) was
added HATU (1.05 g, 2.77 mmol), followed by the addition of DIPEA
(0.51 mL, 2.92 mmol). After 1 h, the reaction mixture was
concentrated in vacuo to yield a crude DMF solution which was
further diluted with 150 mL of EtOAc. The crude reaction mixture
was washed with 100 mL of Sat. NaHCO.sub.3, followed by 100 mL of
brine. The organic fraction was dried over a pad of magnesium
sulfate, filtered and concentrated in vacuo. The crude
Boc-Aoa-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 was purified by
flash chromatography (silica gel 40 jtm, 60 .ANG., size) using 0%
to 5% methanol in CH.sub.2Cl.sub.2 as the eluent. A total of 2.13 g
of Boc-Aoa-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 (2.29 mmol,
87%) was obtained as a beige-colored solid. LCMS RT=1.46 min
(Method A); ESI-MS m/z 931.46 [M+H].sup.+.
[0659] To a stirred 23.degree. C. solution of
Boc-Aoa-MeVal-Abu(3-N.sub.3)-Dil-Dap-Phe-NH.sub.2 (2.1 g, 2.26
mmol) in dioxane (15.0 mL) was added 4 M HCl in dioxane (10.0 mL,
40.0 mmol). After 0.5 h, a the reaction mixture was concentrated in
vacuo to yield a crude pale-yellow oil. The crude pale-yellow oil
from was dissolved in 6 mL of methanol and was slowly added
(dropwise) to vigorously stirred 150 mL solution of EtOAc. A white
precipitate was obtained from the solution. The white precipitate
from was collected by filtration, and the supernatant was
concentrated to a solid. Both the white precipitate and the
concentrated supernatant were purified in several portions by
preparatory RP-HPLC with a Phenomenex Gemini 10.mu., C18 110 .ANG.
column (150.times.30 mm) using 5% to 95% MeCN in 0.001 M
hydrochloric acid as the eluent.
[0660] The resulting product fractions were combined, concentrated,
and dried in vacuo for 18 h to yield a white-colored solid. A total
of 1.31 g of AGL-0182-30*HCl (1.51 mmol, 67%) was obtained. LCMS
RT=1.16 min (Method A); ESI-MS m/z 831.27 [M+H].sup.+. (See,
generally Table IV).
[0661] In a preferred embodiment, AGL-0182-30 has the following
formula:
##STR00029##
Example 8
Antibody Drug Conjugation of CHv62.21pAF MAb
[0662] The CHv62.21pAF Mab was conjugated to a
dolaisoluine-dolaproine containing peptide designated AGL-0182-30
using an alkoxyamine linker described herein to create the antibody
drug conjugate (ADC) of the invention designated
CHv62.21pAF-AGL-0182-30 using the following protocols.
[0663] The synthesis of the AGL-0182-30 drug linker was
accomplished using the methods described in Example 7 entitled
"Synthesis of Drug Linker AGL and AGD-0182 Drug Unit".
[0664] Next, the antibody drug conjugate (ADC) of the invention
designated cHv62.21pAF-AGL-0182-30 was made using the following
protocols.
[0665] Briefly, 215.5 mL of the CHv62.21pAF Mab at a concentration
of 17.17 mg/mL formulated in 50 mM citrate buffer containing 500 mM
NaCl at a final pH of 4.0 is added to 9.7 mL of 50 mM citrate
buffer containing 500 mM NaCl at a final pH of 4.0, 9.1 mL of 1.35
M acetic hydrazide (dissolved in water), 7.26 mL of DMSO, and 5.08
mL of a 50 mM solution of AGL-0182-30 (dissolved in DMSO).
Conjugation is allowed to proceed at 28.degree. C. for 16-24 hours.
Excess AGL-0182-30 and other small molecule reaction components are
removed by ultrafiltration/diafiltration with 12 diavolumes of 20
mM Histidine pH 6.0 containing 5% trehalose.
[0666] The resulting antibody drug conjugate (ADC) is designated
CHv62.21pAF-AGL-0182-30 and has the following formula:
##STR00030##
[0667] Wherein the Mab is CHv62.21pAF and p is from 1.8 to 2.0. The
average p value of the antibody drug conjugate set forth in this
Example was approximately 1.9 by Mass Spec analysis. In one
embodiment of the present invention, the p value is between 1.5 and
2.5.
[0668] The resulting ADC of the present invention incorporates a
nnAA into the antibody component of the ADC whereby the Drug Linker
is conjugated via oxime bond and is used for the therapeutic
treatment of the cancers set forth in Table I.
Example 9
Characterization of CHv62.21 MAb
[0669] MAbs that bind FLT3 were generated using the procedures set
forth in the example entitled "Generation of FLT3 Monoclonal
Antibodies (MAbs)" and were screened, identified, and characterized
using a combination of assays known in the art.
[0670] A. FACS Binding
[0671] CHv62.21 was tested for binding to AML and B-ALL cell lines
grown in vitro. (See, Table VII). Briefly, CHv62.21 and an isotype
matched control antibody were biotinylated using NHS LC biotin. In
vitro, exponentially grown cancer cell lines were used for all
experiments. Cells were harvested by and washed by centrifugation.
Cells were Fc blocked to reduce non-specific binding. Antibodies
were diluted to 10 ug/ml final concentration and co-incubated with
cells at 4.degree. C. for 1 hour. At the end of the incubation,
cells were washed and incubated with secondary detection
Streptavidin-PE antibody at a final 1:200 (2.5 ug/ml) dilution for
1 hour at 4.degree. C. After washing un-bound secondary antibody,
cells were analyzed by FACS and geometric mean fluorescence was
determined and reported. Fluorescence ratio was calculated as
follows: Geo mean cHv62.21/Geo mean isotype control=MFR, a measure
of fold expression above isotype control.
[0672] Geometric Mean values and Mean Florescence ratios (MFR)
values were obtained (Table VI) and histograms are shown (Table
VII). The results show that the CHv62.21 binds several human cancer
cell lines expressing AML and B-ALL.
[0673] B. ADCC Activity
[0674] CHv62.21 and CHv62.21pAF was tested for ADCC activity in
vitro. Briefly, the naked and ADC anti-FLT3 monoclonal antibodies,
CHv62.21 and CHv62.21pAF were tested for their ability to mediate
antibody dependent cytotoxicity activity (ADCC) using the target
cell lines EOL-1 and SEM in the presence of the effector cells,
normal human PBMCs using the CytoTox 96.RTM. Non-Radioactive
Cytotoxicity Assay (Promega, G1780).
[0675] One (1) day prior to performing the assay, three (3) vials
of the effector cells, normal human PBMC (Hemacare, Donor ID:
1888), were thawed, washed and plated into T-175 cell culture
flasks in RPMI-1640 supplemented with 10% heat inactivated fetal
bovine serum. The flasks were stored in an incubator at 37.degree.
C. 5% CO2 overnight. The next day, the PBMCs were harvested from
the culture flasks using 0.25% Trypsin-EDTA (Gibco) and washed and
seeded at a concentration of 1.0e6 cells/well in assay buffer
(RPMI1640+0.1% FBS). The target cells SEM and EOL-1 along with the
positive control cell line, Raji were harvested, washed and seeded
at a concentration of 2.0e5 cells/well using assay buffer.
[0676] The test samples were each diluted to a final concentration
of 2.5ug/mL in assay buffer. Equal volumes of target cells, test
sample, and effector cells were added to wells of a 96-well round
bottom plate in triplicate. The plate was gently centrifuged and
incubated for 4 hours in a humidified 37.degree. C. incubator.
After the four (4) hour incubation, the assay plates were
centrifuged and a volume of 50aL of the supernatant was harvested
and transferred to a fresh 96-well plate. The activity of lactate
dehydrogenase in the supernatant was determined by using the
colorimetric LDH Detection Kit; CytoTox 96.RTM. Non-Radioactive
Cytotoxicity Assay (Promega) with absorbance readings taken at 490
nm.
[0677] The data was analyzed by first subtracting the average of
absorbance values of the Culture Medium Background wells from all
absorbance values of Experimental, Effector spontaneous, Target
spontaneous and Target maximum wells. Next, the average of the
corrected absorbance readings was normalized and ADCC activity was
calculated by using the following formula:
ADCC ( % ) = Experimental - Effector Spontaneous - Target
Spontaneous Target Maximum - Target Spontaneous 100
##EQU00001##
[0678] The results in FIG. 7 show that CHv62.21 and CHv62.21pAF
MAbs do not show ADCC activity. However, the positive control,
Rituximab confirms ADCC activity in Raji cell line.
Example 10
CHv62.21pAF-AGL-0182-30 Inhibit Growth of Tumors In Vivo
[0679] The significant expression of FLT3 in tumor cells, together
with its restrictive expression in normal cells makes FLT3 a good
target for antibody therapy and similarly, therapy via ADC. Thus,
the therapeutic efficacy of CHv62.21pAF-AGL-0182-30 in human ALL,
AML, and B-LL cancer xenograft mouse models is evaluated.
[0680] Antibody drug conjugate efficacy on tumor growth and
metastasis formation is studied in mouse cancer xenograft models
(e.g. subcutaneous and orthotopically).
[0681] Subcutaneous (s.c.) tumors are generated by injection of
5.times.10.sup.4-10.sup.6 cancer cells mixed at a 1:1 dilution with
Matrigel (Collaborative Research) in the right flank of male SCID
mice. To test ADC efficacy on tumor formation, i.e. ADC injections
are started on the same day as tumor-cell injections. As a control,
mice are injected with either purified human IgG or PBS; or a
purified MAb that recognizes an irrelevant antigen not expressed in
human cells. In preliminary studies, no difference is found between
control IgG or PBS on tumor growth. Tumor sizes are determined by
caliper measurements, and the tumor volume is calculated as
width.sup.2.times.Length/2, wherein width is the smallest dimension
and length is the largest dimension. Mice with subcutaneous tumors
greater than 1.5 cm in diameter are sacrificed.
[0682] An advantage of xenograft cancer models is the ability to
study neovascularization and angiogenesis. Tumor growth is partly
dependent on new blood vessel development. Although the capillary
system and developing blood network is of host origin, the
initiation and architecture of the neovasculature is regulated by
the xenograft tumor (Davidoff et al., Clin Cancer Res. (2001)
7:2870; Solesvik et al., Eur J Cancer Clin Oncol. (1984) 20:1295).
The effect of antibody and small molecule on neovascularization is
studied in accordance with procedures known in the art, such as by
IHC analysis of tumor tissues and their surrounding
microenvironment.
[0683] CHv62.21pAF-AGL-0182-30 ADC inhibits formation in cancer
cell line(s) denoted MV4-11 subcutaneous established cancer
xenografts. These results indicate the utility of
CHv62.21pAF-AGL-0182-30 in the treatment of local and advanced
stages of cancer and preferably those cancers set forth in Table
I.
[0684] FLT3 ADCs:
[0685] Monoclonal antibodies were raised against FLT3 as described
in the Example entitled "Generation of FLT3 Monoclonal Antibodies
(MAbs)." Further the MAbs are conjugated to a toxin as described in
the Example entitled "Antibody Drug Conjugation of CHv62.21pAF MAb"
to form CHv62.21pAF-AGL-0182-30. The CHv62.21pAF and
CHv62.21pAF-AGL-0182-30 is characterized by FACS, and other methods
known in the art to determine its capacity to bind FLT3.
[0686] Cell Lines and Xenografts:
[0687] The cells are maintained in DMEM, supplemented with
L-glutamine and 10% FBS, as known in the art. The MV4-11 xenografts
are maintained by serial propogation in SCID mice.
[0688] Efficacy and Dose Titration of CHv62.21pAF-AGL-0182-30 in
the Subcutaneously Established Xenograft Model of Human B
Myelomonocytic Leukemia Cell Line MV4-11 Implanted in CB17/SCID
Mice.
[0689] In this experiment, Human B myelomonocytic leukemia MV4-11
cells (3.0.times.10.sup.6 cells per mouse) were injected into the
flanks of individual SCID mice and tumors were allowed to grow.
When the average tumor volumes reached a predetermined size (200
mm.sup.3), animals were tumor-size matched and randomized into
treatment and control groups with similar mean tumor size and
variation in each group using Study Director Software (v.2.1;
Studylog Systems, Inc., South San Francisco, Calif.). All the study
mice were pre-loaded with Fc blocker (mLYS-1c3.1-hIgG1) at 20 mg/kg
by intraperitoneal injection in the afternoon before the day of
drug administration.
[0690] CHv62.21pAF-AGL-0182-30 was dosed at 3 different dosing
levels (0.5, 1.0, and 2.0 mg/kg) as single bolus by intravenous
injection. 20 mM Histidine/5% Trehalose, pH 6.0 and
91.1-AGL-0182-30 were used as the vehicle and ADC controls,
respectively. All agents were administered based on the individual
body weight of each animal obtained immediately prior to each
dosing. Tumor growth in each group was monitored twice weekly using
caliper measurements until study termination. A statistical
analysis of the tumor volume data for the last day before animal
sacrifice was performed using the Kruskal-Wallis test. Pairwise
comparisons were made using Tukey's test procedures (2-sided) to
protect the experiment-wise error rate.
[0691] This study evaluated the efficacy of CHv62.21pAF-AGL-0182-30
and compared it to its ADC control (91.1-AGL-0182-30) in the MV4-11
human B myelomonocytic leukemia xenograft model subcutaneously
established in CB17/SCID mice. CHv62.21pAF-AGL-0182-30 was
administered at 3 different dosing levels (0.5, 1.0, and 2.0 mg/kg)
as a single dose by intravenous (i.v.) bolus injection.
91.1-AGL-0182-30 was dosed at 2 mg/kg by i.v. as the ADC control.
And 20 mM Histidine/5% Trehalose, pH 6.0 was used as the vehicle
control.
[0692] The results indicated no statistic difference between the
treatments of the vehicle and ACD controls (p>0.9999).
CHv62.21pAF-AGL-0182-30 at 2.0 mg/kg statistically significantly
regressed the tumor by 100% (p<0.0001), when compared to the
starting tumor size at the commencement of dosing. Compared to the
vehicle control, CHv62.21pAF-AGL-0182-30 at 1.0 mg/kg statistically
significantly inhibited tumor growth by 78.1% (p<0.0001).
CHv62.21pAF-AGL-0182-30 did not show any efficacy in this model at
the dose of 0.5 mg/kg (p=0.5344). (FIG. 5).
[0693] Efficacy of CHv62.21pAF-AGL-0182-30 (ADC) and CHv62.21pAF
(Naked Antibody) in the Subcutaneously Established Xenograft Model
of Human B Myelomonocytic Leukemia Cell Line MV4-11 Implanted in
CB17 SCID Mice.
[0694] In another experiment, Human B myelomonocytic leukemia
MV4-11 cells (3.0.times.10.sup.6 cells per mouse) were injected
into the flanks of individual SCID mice and tumors were allowed to
grow. When the average tumor volumes reached a predetermined size
(200 mm.sup.3), animals were tumor-size matched and randomized into
treatment and control groups with similar mean tumor size and
variation in each group using Study Director Software (v.2.1;
Studylog Systems, Inc., South San Francisco, Calif.). All the study
mice were pre-loaded with Fc blocker (mLYS-1c3.1-hIgG1) at 20 mg/kg
by intraperitoneal injection in the afternoon before the day of
drug administration. CHv62.21pAF-AGL-0182-30 and the ADC control
(91.1-AGL-0182-30) were dosed at 1 mg/kg as single bolus by
intravenous injection. AGS62P (a.k.a. CHv62.21pAF) and the naked
antibody control (91.1-pAF) were dosed at 2 mg/kg as single bolus
by intravenous injection. All agents were administered based on the
individual body weight of each animal obtained immediately prior to
each dosing. Tumor growth in each group was monitored twice weekly
using caliper measurements until study termination. A statistical
analysis of the tumor volume data for the last day before animal
sacrifice was performed using the Kruskal-Wallis test. Pairwise
comparisons were made using Tukey's test procedures (2-sided) to
protect the experiment-wise error rate.
[0695] This study evaluated efficacy of CHv62.21pAF-AGL-0182-30
(ADC) and CHv62.21pAF (naked antibody).
[0696] The results show that compared to the ADC control
(91.1-AGL-0182.30), CHv62.21pAF-AGL-0182-30 at 1.0 mg/kg as a
single dose by intravenous injection statistically significantly
inhibited tumor growth by 51.4% (p=0.0010). Compared to the naked
antibody control (91.1-pAF), CHv62.21pAF at 2.0 mg/kg as a single
dose by intravenous injection showed no statistically different
(p=0.6570). Furthermore, the results indicated
CHv62.21pAF-AGL-0182-30 at 1.0 mg/kg statistically significantly
inhibited tumor growth by 54.3%, when compared to CHv62.21pAF at
2.0 mg/kg (p=0.0134). (FIG. 6).
[0697] Efficacy of CHv62.21pAF-AGL-0182-30 (ADC) and CHv62.21pAF
(Naked Antibody) in the Subcutaneously Established Xenograft Model
of Human B Myelomonocytic Leukemia Cell Line MV4-11 Implanted in
CB17 SCID Mice.
[0698] In another experiment, Human B myelomonocytic leukemia
MV4-11 cells (3.0.times.10.sup.6 cells per mouse) were injected
into the flanks of individual SCID mice and tumors were allowed to
grow. When the average tumor volumes reached a predetermined size
(200 mm.sup.3), animals were tumor-size matched and randomized into
treatment and control groups with similar mean tumor size and
variation in each group using Study Director Software (v.2.1;
Studylog Systems, Inc., South San Francisco, Calif.). All the study
mice were pre-loaded with Fc blocker (mLYS-1c3.1-hIgG1) at 20 mg/kg
by intraperitoneal injection in the afternoon before the day of
drug administration. CHv62.21pAF-AGL-0182-30 and the ADC control
(91.1-AGL-0182-30) were dosed at 2 mg/kg QW for 2 weeks by
intravenous injection. AGS62P (a.k.a. CHv62.21pAF) and the naked
antibody control (91.1-pAF) were dosed at 2 mg/kg QW for weeks by
intravenous injection. All agents were administered based on the
individual body weight of each animal obtained immediately prior to
each dosing. Tumor growth in each group was monitored twice weekly
using caliper measurements until study termination. A statistical
analysis of the tumor volume data for the last day before animal
sacrifice was performed using the Kruskal-Wallis test. Pairwise
comparisons were made using Tukey's test procedures (2-sided) to
protect the experiment-wise error rate.
[0699] This study evaluated efficacy of CHv62.21pAF-AGL-0182-30
(ADC) and Chv62.21pAF (naked antibody) using a multiple dose
regiment over a 2 week timeframe.
[0700] The results show that compared to the ADC control
(91.1-AGL-0182.30), CHv62.21pAF-AGL-0182-30 at 2.0 mg/kg as a
multiple dose by intravenous injection statistically significantly
inhibited tumor growth with 100% tumor regression at day 17
(p=0.0001). Compared to the naked antibody control (91.1-pAF),
CHv62.21pAF at 2.0 mg/kg as a multiple dose by intravenous
injection showed no statistically different. (FIG. 13).
[0701] Efficacy of CHv62.21pAF-AGL-0182-30 in the Subcutaneously
Established SEM-Xcl Xenograft Model in CB17 SCID Mice.
[0702] In another experiment, human Acute Lymphoblastic Leukemia
SEM-xcl cells (1.0.times.10.sup.6 cells per mouse) were injected
into the flanks of individual SCID mice and tumors were allowed to
grow. When the average tumor volumes reached a predetermined size
(200 mm3), animals were tumor-size matched and randomized into
treatment and control groups with similar mean tumor size and
variation in each group using Study Director Software (v.2.1;
Studylog Systems, Inc., South San Francisco, Calif.).
[0703] CHv62.21pAF-AGL-0182-30 was dosed at 5.0 mg/kg, 2.0 mg/kg,
or 1.0 mg/kg as a single bolus dose on day 0 by intravenous
injection. Control ADC, AGS91.1-pAF-AGL-0182-30, was dosed at 5.0
mg/kg using the same route and dosing schedule. 20 mM histidine/5%
trehalose, pH 5.2 was used as the vehicle. All agents were
administered based on the individual body weight of each animal
obtained immediately prior to each dosing. Tumor growth in each
group was monitored twice weekly using caliper measurements until
study termination. A statistical analysis of the tumor volume data
for the last day before animal sacrifice was performed using the
Kruskal-Wallis test. Pairwise comparisons were made using Tukey's
test procedures (2-sided) to protect the experiment-wise error
rate.
[0704] The results show that CHv62.21pAF-AGL-0182-30 at all three
dosage levels (5.0, 2.0 and 1.0 mg/kg) demonstrated potent
anti-tumor activity when compared to the control ADC,
AGS91.1-pAF-AGL-0182-30, or to the vehicle control (p<0.0001),
resulting in more than 75% tumor growth inhibitions in general.
Moreover, when dosed at 5.0 mg/kg, CHv62.21pAF-AGL-0182-30
significantly regressed the tumor by 57.3% when compared to its
initial starting tumor volume. Statistically significant difference
in efficacy between 5.0 mg/kg and 2.0 mg/kg or 1.0 mg/kg was
observed. (FIG. 14).
[0705] Conclusion
[0706] In summary, FIGS. 5, 6, 13 and 14 show that the FLT3 ADC
entitled CHv62.21pAF-AGL-0182-30 significantly inhibited the growth
of tumors cells that express FLT3 when compared to control ADCs and
naked antibodies that bind FLT3. Thus, the CHv62.21pAF-AGL-0182-30
can be used for therapeutic purposes to treat and manage cancers
set forth in Table I.
Example 11
Human Clinical Trials for the Treatment and Diagnosis of Human
Carcinomas Through Use of FLT3 ADCs
[0707] FLT3 ADCs are used in accordance with the present invention
which specifically bind to FLT3, and are used in the treatment of
certain tumors, preferably those listed in Table I. In connection
with each of these indications, two clinical approaches are
successfully pursued.
[0708] I.) Adjunctive therapy: In adjunctive therapy, patients are
treated with FLT3 ADCs in combination with a chemotherapeutic or
anti-neoplastic agent and/or radiation therapy or a combination
thereof. Primary cancer targets, such as those listed in Table I,
are treated under standard protocols by the addition of FLT3 ADCs
to standard first and second line therapy. Protocol designs address
effectiveness as assessed by the following examples, including but
not limited to, reduction in tumor mass of primary or metastatic
lesions, increased progression free survival, overall survival,
improvement of patients health, disease stabilization, as well as
the ability to reduce usual doses of standard chemotherapy and
other biologic agents. These dosage reductions allow additional
and/or prolonged therapy by reducing dose-related toxicity of the
chemotherapeutic or biologic agent. FLT3 ADCs are utilized in
several adjunctive clinical trials in combination with the
chemotherapeutic or anti-neoplastic agents.
[0709] II.) Monotherapy: In connection with the use of the FLT3
ADCs in monotherapy of tumors, the FLT3 ADCs are administered to
patients without a chemotherapeutic or anti-neoplastic agent. In
one embodiment, monotherapy is conducted clinically in end-stage
cancer patients with extensive metastatic disease. Protocol designs
address effectiveness as assessed by the following examples,
including but not limited to, reduction in tumor mass of primary or
metastatic lesions, increased progression free survival, overall
survival, improvement of patients health, disease stabilization, as
well as the ability to reduce usual doses of standard chemotherapy
and other biologic agents.
[0710] Dosage
[0711] Dosage regimens may be adjusted to provide the optimum
desired response. For example, a single bolus may be administered,
several divided doses may be administered over time or the dose may
be proportionally reduced or increased as indicated by the
exigencies of the therapeutic situation. It is especially
advantageous to formulate parenteral compositions in dosage unit
form for ease of administration and uniformity of dosage. Dosage
unit form as used herein refers to physically discrete units suited
as unitary dosages for the mammalian subjects to be treated; each
unit containing a predetermined quantity of active compound
calculated to produce the desired therapeutic effect in association
with the required pharmaceutical carrier. The specification for the
dosage unit forms of the invention are dictated by and directly
dependent on (a) the unique characteristics of the antibody and/or
ADC and the particular therapeutic or prophylactic effect to be
achieved, and (b) the limitations inherent in the art of
compounding such an active compound for the treatment of
sensitivity in individuals.
[0712] An exemplary, non limiting range for a therapeutically
effective amount of an FLT3 ADC administered in combination
according to the invention is about 0.5 to about 10 mg/kg, about 1
to about 5 mg/kg, at least 1 mg/kg, at least 2 mg/kg, at least 3
mg/kg, or at least 4 mg/kg. Other exemplary non-limiting ranges are
for example about 0.5 to about 5 mg/kg, or for example about 0.8 to
about 5 mg/kg, or for example about 1 to about 7.5 mg/kg. The high
dose embodiment of the invention relates to a dosage of more than
10 mg/kg. It is to be noted that dosage values may vary with the
type and severity of the condition to be alleviated, and may
include single or multiple doses. It is to be further understood
that for any particular subject, specific dosage regimens should be
adjusted over time according to the individual need and the
professional judgment of the person administering or supervising
the administration of the compositions, and that dosage ranges set
forth herein are exemplary only and are not intended to limit the
scope or practice of the claimed composition.
[0713] Clinical Development Plan (CDP)
[0714] The CDP follows and develops treatments of FLT3 ADCs in
connection with adjunctive therapy or monotherapy. Trials initially
demonstrate safety and thereafter confirm efficacy in repeat doses.
Trials are open label comparing standard chemotherapy with standard
therapy plus FLT3 ADCs. As will be appreciated, one non-limiting
criteria that can be utilized in connection with enrollment of
patients is FLT3 expression levels in their tumors as determined by
biopsy.
[0715] As with any protein or antibody infusion-based therapeutic,
safety concerns are related primarily to (i) cytokine release
syndrome, i.e., hypotension, fever, shaking, chills; (ii) the
development of an immunogenic response to the material (i.e.,
development of human antibodies by the patient to the antibody
therapeutic, or HAMA response); and, (iii) toxicity to normal cells
that express FLT3. Standard tests and follow-up are utilized to
monitor each of these safety concerns. FLT3 ADCs are found to be
safe upon human administration.
Example 12
Detection of FLT3 Protein in Normal and Cancer Patient Derived
Specimens
[0716] The detection of FLT3 protein in cancer using anti-FLT3
antibodies was assessed in PBMC samples from peripheral blood of
patients with Acute Lymphocytic Leukemia in the Myeloid (AML) cell
populations.
[0717] A. FACS Binding Materials and Methods
[0718] In this experiment, samples were incubated with a cocktail
of CD45, CD33, CD34, CD3, CD20, CD38 and either anti-Flt3-Biotin or
Isotype-Biotin mAbs. Secondary detection for biotinylated mAbs was
Streptavidin-PE. Fluorescence minus one (FMO) control cocktails
were prepared with Streptavidin-PE (SAv-PE) detection reagent and
were used for gating cell populations. An LSRII flow cytometer (BD
Biosciences) was used for acquisition of data.
[0719] Lymphocytes were gated on CD45+ population from which four
distinct populations were identified, CD33+/3-/20- (Myeloid
blasts), CD33+/3-/34+/38- (Stem Cells), CD33-/3+(T cells) and
CD33-/20+(B cells). Analysis was done with Flowjo software version
9.5.4 (Tri-Star, Ashland, Oreg.). Fluorescent values are reported
as Geometric mean (MFI).
[0720] B. Results
[0721] The results set forth in Table VIII for AML patient samples
shows that anti-FLT3 MAb binds to the Myeloid, Stem Cells, T and B
cell populations of all samples tested.
[0722] Furthermore, as shown in Table VIII, the MFIR distribution
plots for all samples tested show moderate variability in the
Myeloid, stem cell and B cell populations, while T cells had less
variability in MFIR. Mean MFIR for Myeloid blasts was around 963.1,
while mean MFIR for stem cells was 318.2, while mean MFIR for T
cells was 9.842, while MFIR for B-cells was 72.60 in AML. Mean MFIR
for normal samples was 642.4 in Myeloid, 68.29 for stem cells,
11.66 for T-cells, amd 13.73 for B-cells.
[0723] The totality of the results set forth in Table VIII show
that the anti-FLT3 MAbs, such as the the CHv62.21 MAb and
Chv62.21pAF MAb of the invention can detect FLT3 protein
overexpressed in AML.
Example 13
In Vitro Cell Cytotoxicity Mediated by CHv62.21pAF and
CHv62.21pAF-AGL-0182-30
[0724] The ability of FLT3 antibody (CHv62.21pAF) and FLT3 ADC
(CHv62.21pAF-AGL-0182-30) to mediate FLT3 dependent cytotoxicity
was evaluated using the human leukemia MV-4-11 and MOLM-13 cell
lines, which endogenously express FLT3 and the human leukemia cell
line, Karpas299, which does not express FLT3.
[0725] Briefly, The MV-4-11, MOLM-13, and Karpas299 cells were
seeded in 50 .mu.l of complete media, at a density of 1500, 2000,
and 3000 cells/well, respectively, onto 96 well plates and placed
in a tissue culture incubator at 37 degrees C.; 5% CO2. The next
day, cells were Fc blocked at a volume of 25 .mu.l per well to
reduce non-specific binding and a 4x stock solution of
cHv62.21pAF-AGL-0182-30, isotype control antibody conjugated to
AGD-0182 (91.1pAF-AGL-0182-30), cHv62.21pAF, and isotype control
antibody (91.1pAF) were prepared in complete media and 25 .mu.l of
the serial dilutions of the ADCs and antibodies were added to the
appropriate wells. The cells were treated with
cHv62.21pAF-AGL-0182-30, 91.1pAF-AGL-0182-30, cHv62.21pAF, and
91.1pAF for 5 days in a tissue culture incubator at 37 degrees C.;
5% CO2. At the end of the incubation period, 20 .mu.l of Presto
Blue was added to each well and incubated for 2 hours. The plates
were read using a BioTek Synergy H.sub.4 plate reader using 540
Excitation and 590 Emission wavelengths.
[0726] The results in Table IX show that the anti-FLT3 ADC
(CHv62.21pAF-AGL-0182-30) can selectively induce the cytotoxicity
of the FLT3 expressing MOLM-13 and MV-4-11 cell lines while it is
unable to induce the cytotoxicity of the FLT3 non-expressing
Karpas299 cell line. The anti-FLT3 antibody (CHv62.21pAF) does not
induce cytotoxicity in MOLM-13 and MV-4-11 cell lines. Thus, these
data demonstrate that the FLT3 MAb CHv62.21pAF alone does not
induce the cytotoxicity of the cells. Rather, only the FLT3 ADC
CHv62.21pAF-AGL-0182-30 can selectively kill FLT3 expressing
MOLM-13 and MV-4-11 cells while it has no effect on the non-FLT3
expressing Karpas299 cells.
Example 14
Advantages of CHv62.21pAF Over Prior Art FLT3 MAbs
[0727] The CHv62.21pAF MAb of the invention presents several
advantages over other MAbs which bind FLT3. Especially when viewed
in light of the therapeutic utility of the ADC of the invention.
For example, the prior art teaches that after AML patients have
been treated with chemotherapy there is an increase in expression
of plasma FLT3 ligand ("FL"). See, Takashi, et. al., Blood vol.
117(12) (March 2011). Further, it has been shown that increased FL
significantly reduces activity of FLT inhibitors. Id. EB 10
conjugated with Monomethyl auristatin F (EB 10-MMAF) has been
reported as the ADC comprising anti-human FLT3 antibody. (See, Proc
Amer Assoc Cancer Res, Volume 46, 2005). The EB 10 has been shown
to block FL. See, U.S. Pat. No. 8,071,099 (Imclone). Accordingly,
an object of the present invention is to engineer MAbs which bind
FLT3 antigen, but do not bind FL.
[0728] In one experiment, the CHv62.21 MAb of the invention was
confirmed to not block FL. Briefly, Recombinant human FLT3-Fc was
purchased from R and D Systems. This protein was immobilized onto
the surface of activated Luminex microspheres using standard
sulfo-NHS/EDC chemistry according to the procedure provided by
Luminex. A His-tagged version of the protein, along with several
other proteins were conjugated to Luminex microspheres, and served
as controls in this procedure.
[0729] In addition, FLT3 ligand was also purchased from R and D
Systems. The ligand was biotinylated using Thermo Scientific
EZ-Link Sulfo-NHS-LC-Biotin, No-Weigh Formula according to the
manufacturer's recommendations. After two (2) hours of reacting the
protein with Sulfo-NHS-LC-Biotin, unincorporated biotin was removed
by dialysis against DPBS.
[0730] The ability of FLT3 immobilized onto the surface of the
microspheres to bind to its biotinylated ligand was assessed by
reacting the microspheres with various concentrations of
biotinylated ligand, prepared in buffer containing PBS, 2% BSA,
0.05% Tween 20, and 0.1% sodium azide, for 120 minutes at RT with
gentle shaking. At the end of the incubation, the microspheres were
aspirated and washed. Biotinylated FLT3 ligand bound to its
immobilized receptor was detected with Streptavidin-R-Phycoerythrin
(Moss, Inc.). The fluorescence associated with the microspheres was
measured with the Luminex instrument. This assessment revealed that
a concentration of 5 ng/mL biotinylated FLT3 ligand was sufficient
to generate a robust signal, but did not saturate the FLT3
associated with the microspheres.
[0731] Finally, to assess the ability of the FLT3 antibodies to
potentially block ligand, mixtures were prepared containing
biotinylated FLT3 ligand at 5 ng/mL, plus the various antibodies
under investigation at 10 .mu.g/mL. These mixtures were applied to
the FLT3 immobilized onto the microspheres and incubated for 60
minutes. At the end of the incubation, the microspheres were
aspirated and washed. Biotinylated FLT3 ligand bound to its
immobilized receptor was detected with Streptavidin-R-Phycoerythrin
(Moss, Inc.). The fluorescence associated with the microspheres was
measured with the Luminex instrument. Antibodies with the
capability to block ligand were observed by reduction in MFI
(median fluorescence intensity).
[0732] The results of FIG. 8 confirm that FLT3 MAb CHv62.21 is a
non FL blocker and another FLT3 Mab denoted v62-1b37.1 (Table X) is
a FL blocker, similar to the prior art FLT3 MAb denoted EB 10 (See,
U.S. Pat. No. 8,071,099).
[0733] The ability of FLT3 antibodies (CHv62.21 and v62-1b37.1) to
mediate the effect of human FLT3 ligand was evaluated using the
human leukemia EOL-1 cell line, which endogenously expresses FLT3.
Isotype control antibody (mLys-1c3.1) was also used. The EOL-1
cells were seeded in 50 .mu.l of complete media, at a density of
2000 cells per well onto 96 well plates and placed in a tissue
culture incubator at 37.degree. C.; 5% CO2. The next day, cells
were treated with 50, 10 or 5 ng/mL of human FLT3 ligand (in 25
.mu.l of complete media) and 10, 1, 0.1 and 0 .mu.g/mL of test
antibody (in 25 .mu.l of complete media). Media alone was used as
the untreated control. The cells were treated for 5 days in a
tissue culture incubator at 37.degree. C.; 5% CO2. At the end of
the incubation period, 100 .mu.l of Cell Titer Glo was added to
each well and incubated for 30 minutes, shaking, at room
temperature. The plates were read using a BioTek Synergy H.sub.4
plate reader using Luminescence and graphed using Graphpad Prism
software.
[0734] The results in FIG. 9, show that the v62-1b37.1 inhibits
growth at high concentrations in the presence of FLT3 ligand, but
CHv62.21 does not have any effect on growth. Human FLT3 ligand
alone has no effect on growth of the EOL-1 cell line.
[0735] Based on the teachings that FL concentration in plasma was
increased after chemotherapy for cancer treatment (See, Takashi et.
al., supra), it was shown that advantages exist when FLT3 MAbs of
the invention do not block FL. To confirm this point, it was shown
that while the cytotoxic activity of a ligand blocking MAb is
reduced in the presence of FL the cytotoxic activity of a non
ligand blocking Mab is not reduced in the presence of FL.
[0736] The ability of FLT3 ADCs (cHv62.21pAF-AGL-0182-30 and
v62-1b21.1-AGL-0129-08) to mediate FLT3 dependent cytotoxicity in
the absence and presence of human FLT3 ligand (hFL) was evaluated
using the human leukemia RS-4-11 cell line, which endogenously
expresses FLT3.
[0737] Briefly, The RS-4-11 cells were seeded in 50 .mu.l of
complete media at a density of 3000 cells per well onto 96 well
plates and placed in a tissue culture incubator at 37.degree. C.;
5% CO2. The next day, the ADCs were prepared in complete media at
10 ag/mL and serially diluted 1:5 for a total of 9 points. 25 .mu.l
of the serial dilutions of the ADCs were added to the appropriate
wells with and without human FLT3 ligand (100 ng/mL added 25 .mu.l
per well). The cells were treated with v62-1b21.1-AGL-0129-08
(Table XI, See, WO2015/183978, Agensys, Inc.) and
v62-1b37.1-AGL-0129-08 with and without human FLT3 ligand for 5
days in a tissue culture incubator at 37.degree. C.; 5% CO2. At the
end of the incubation period, 20 .mu.l of Presto Blue was added to
each well and incubated for 2 hours. The plates were read using a
BioTek Synergy H.sub.4 plate reader using 540 Excitation and 590
Emission wavelengths and graphed using Graphpad Prism software.
[0738] The results in FIGS. 10(A) and 10(B) show that the anti-FLT3
ADCs (v62-1b21.1-AGL-0129-08 and v62-1b37.1-AGL-0129-08) can induce
cytotoxicity of the FLT3 expressing RS-4-11 cell line. The
anti-FLT3 ADC, v62-1b21.1-AGL-0129-08, has a similar level of
cytotoxicity in the presence and absence of human FLT3 ligand.
However, the cytotoxic activity of the anti-FLT3 ADC,
v62-1b37.1-AGL-0129-08, is reduced in the presence of human FLT3
ligand compared to ADC treatment without ligand.
[0739] In another experiment, The ability of anti-FLT3 antibodies,
CHv62.21 and v62-1b37.1, to bind to FLT3 expressed on the surface
of human leukemia MOLM-13 cell line was evaluated in the presence
of human FLT3 Ligand (hFL). Isotype control antibody, AGS91.1-pAF,
was used as a negative control.
[0740] Briefly, The MOLM-13 cells were seeded at a density of
50,000 cells per well onto round-bottom 96 well plates. The plates
were washed one time with 150 .mu.l per well of PBS. The cells were
Fc blocked (20 ag/mL) at a volume of 50 .mu.l per well in FACS
buffer (PBS+2% FBS+0.1% sodium azide) to reduce non-specific
binding. Cells were incubated at 4.degree. C. for 15 minutes. Human
FLT3 Ligand was added to appropriate wells at 100 ng/mL and
serially diluted 1:2 across the plate for a total of 11 points.
Cells were incubated for 30 minutes at 4.degree. C. prior to adding
biotinylated FLT3 antibodies. After incubation, the biotinylated
anti-FLT3 antibodies and isotype control antibody were prepared in
FACS buffer at 10 ag/mL and 1 ag/mL and 25 .mu.l was added to wells
and incubated for 1 hour at 4.degree. C. Cells were washed two
times with FACS buffer and Streptavidin-PE (Jackson immune) was
added 100 .mu.l per well and incubated for 1 hour at 4.degree. C.
Cells were washed two times with FACS buffer and read on the Attune
Cytometer (Life technologies) and analyzed in FlowJo (Tree Star)
software.
[0741] The results in Figurell 1(A) show that the human FLT3 Ligand
does not interfere with anti-FLT3 antibody, AGS62P, binding to
MOLM-13 cells. However, human FLT3 Ligand does interfere with the
binding of anti-FLT3 antibody, cHv62-1b37.1, to MOLM-13 cells in a
dose-dependent manner.
[0742] Finally, The ability of FLT3 ADC, AGS62P1, to mediate FLT3
dependent cytotoxicity in the absence and presence of human FLT3
ligand (hFL) was evaluated using the human leukemia MOLM-13 cell
line, which endogenously expresses FLT3. Isotype control ADC,
AGS91.1.88-pAF-AGL-0182-30 was used as a negative control.
[0743] Briefly, The MOLM-13 cells were seeded in 50 .mu.l of
complete media at a density of 2000 cells per well onto 96 well
plates and placed in a tissue culture incubator at 37.degree. C.;
5% CO2. The next day, cells were Fc blocked at a volume of 25 .mu.l
per well to reduce non-specific binding. The ADCs were prepared in
complete media for a final concentration of 10 ag/mL and serially
diluted 1:5 for a total of 9 points. 12.5 .mu.l of the serial
dilutions of the ADCs were added to the appropriate wells with and
without human FLT3 ligand (100 ng/mL added 12.5 .mu.l per well).
The cells were treated with AGS62P1 and AGS91.1.88-pAF-AGL-0182-30
with and without human FLT3 ligand for 5 days in a tissue culture
incubator at 37.degree. C.; 5% CO2. At the end of the incubation
period, 20 .mu.l of Presto Blue was added to each well and
incubated for 2 hours. The plates were read using a BioTek Synergy
H.sub.4 plate reader using 540 Excitation and 590 Emission
wavelengths and graphed using Graphpad Prism software.
[0744] The result in FIG. 11(B) show that the human FLT3 Ligand
does not interfere with anti-FLT3 ADC (CHv62.21pAF-AGL-0182-30)
mediated cytotoxicity in MOLM-13 cells.
[0745] Thus, while FLT3 MAbs may be used in a therapeutic context,
not all FLT3 MAbs are the same. The results in FIGS. 8-11 show that
FLT3 MAbs which do not bind FL present prominent advantages over
FLT3 MAbs which are shown to bind FL. Further, in light of the
therapeutic utility of an ADC of the invention, the results show
that an ADC comprising a non-ligand blocker FLT3 Mab, such as
CHv62.21pAF-AGL-0182-30 retains anti-tumor effects compared to ADC
comprising a ligand blocker FLT3 Mabs in the presence of FL. One of
ordinary skill in the art understands that the presence of FL is
known to increase after chemotherapeutic treatments. In addition,
it is known that elevated presence of FL has been shown to decrease
activity of FLT3 inhibitors. Accordingly the results in FIGS. 8-11
suggests that an ADC comprising a non-ligand blocker FLT3 Mab have
a better therapeutic index and anti-tumor effects when compared to
an ADC comprising a ligand blocker FLT3 Mab in cancer patients.
Example 15
Stability Test of CHv62.21pAF-AGL-0182-30
[0746] The stability of FLT3 ADC CHv62.21pAF-AGL-0182-30 and
another FLT3 ADC using another cytotoxic compound denoted
AGL-0301-20 (See, WO2014/043403, Agensys, Inc.) was evaluated in
vitro. In this experiment, human serum (Millipore) was spiked with
0.4 mg/mL of each ADC and phosphate pH 7.3 at a final concentration
of 50 mM and incubated in a humidified incubator at 37.degree. C.
100 .mu.L aliquots were collected and frozen at -80C at 5 minutes,
3 hours, 25.25 hours, 51.25 hours, and 171.2 hours. After all
samples were collected, ELISA was performed to quantify the
antibody and drug components of each ADC.
[0747] The results show that CHv62.21pAF-AGL-0182-30 drug antibody
linkage is stable over the time course of the experiment FIG.
12(A). However, FIG. 12(B) shows that the drug-antibody linkage for
v62-1b21-AGL-0301-20 is labile, resulting in significant
de-conugation over the time course of the experiment.
[0748] Throughout this application, various website data content,
publications, patent applications and patents are referenced.
(Websites are referenced by their Uniform Resource Locator, or URL,
addresses on the World Wide Web.) The disclosures of each of these
references are hereby incorporated by reference herein in their
entireties.
[0749] The present invention is not to be limited in scope by the
embodiments disclosed herein, which are intended as single
illustrations of individual aspects of the invention, and any that
are functionally equivalent are within the scope of the invention.
Various modifications to the models and methods of the invention,
in addition to those described herein, will become apparent to
those skilled in the art from the foregoing description and
teachings, and are similarly intended to fall within the scope of
the invention. Such modifications or other embodiments can be
practiced without departing from the true scope and spirit of the
invention.
Tables
TABLE-US-00001 [0750] TABLE I Tissues/Cells that express FLT3 when
malignant. Acute Myeloid Leukemia ("AML"); Acute Lymphoblastic
Leukemia ("ALL") B-cell Lymphoblastic Leukemia; Precursor B-cell
Lymphblastic Leukemia.
TABLE-US-00002 TABLE II Amino Acid Abbreviations SINGLE LETTER
THREE LETTER FULL NAME F Phe phenylalanine L Leu leucine S Ser
serine Y Tyr tyrosine C Cys cysteine W Trp tryptophan P Pro proline
H His histidine Q Gln glutamine R Arg arginine I Ile isoleucine M
Met methionine T Thr threonine N Asn asparagine K Lys lysine V Val
valine A Ala alanine D Asp aspartic acid E Glu glutamic acid G Gly
glycine
TABLE-US-00003 TABLE III Amino Acid Substitution Matrix Adapted
from the GCG Software 9.0 BLOSUM62 amino acid substitution matrix
(block substitution matrix). The higher the value, the more likely
a substitution is found in related, natural proteins. A C D E F G H
I K L M N P Q R S T V W Y . 4 0 -2 -1 -2 0 -2 -1 -1 -1 -1 -2 -1 -1
-1 1 0 0 -3 -2 A 9 -3 -4 -2 -3 -3 -1 -3 -1 -1 -3 -3 -3 -3 -1 -1 -1
-2 -2 C 6 2 -3 -1 -1 -3 -1 -4 -3 1 -1 0 -2 0 -1 -3 -4 -3 D 5 -3 -2
0 -3 1 -3 -2 0 -1 2 0 0 -1 -2 -3 -2 E 6 -3 -1 0 -3 0 0 -3 -4 -3 -3
-2 -2 -1 1 3 F 6 -2 -4 -2 -4 -3 0 -2 -2 -2 0 -2 -3 -2 -3 G 8 -3 -1
-3 -2 1 -2 0 0 -1 -2 -3 -2 2 H 4 -3 2 1 -3 -3 -3 -3 -2 -1 3 -3 -1 I
5 -2 -1 0 -1 1 2 0 -1 -2 -3 -2 K 4 2 -3 -3 -2 -2 -2 -1 1 -2 -1 L 5
-2 -2 0 -1 -1 -1 1 -1 -1 M 6 -2 0 0 1 0 -3 -4 -2 N 7 -1 -2 -1 -1 -2
-4 -3 P 5 1 0 -1 -2 -2 -1 Q 5 -1 -1 -3 -3 -2 R 4 1 -2 -3 -2 S 5 0
-2 -2 T 4 -3 -1 V 11 2 W 7 Y
TABLE-US-00004 TABLE IV General Method for Synthesis of AGL-0182-30
##STR00031## General Merthod for Synthesis of AGL-0182-30 Where AA1
= Amino acid 1 AA2 = Amino acid 2 AA5 = Amino acid 5 Dil =
Dolaisoleuine Dap = Dolaproine Linker = Aminooxyacetyl
TABLE-US-00005 TABLE V Positions CDR-L1, CDR-L2, CDR-L3 and CDR-H1,
CDR-H2, CDR-H3 as identified by the Kabat, Chothia, and Contact
schemes, respectively. For CDR-H1, residue numbering is given
listed using both the Kabat and Chothia numbering schemes. CDR
Kabat Chothia Contact CDR-L1 L24-L34 L24-L34 L30-L36 RASQGIRNDLG
RASQGIRNDLG RNDLGWY (SEQ ID NO: 14) (SEQ ID NO: 15) (SEQ ID NO: 16)
CDR-L2 L50-L56 L50-L56 L46-L55 AASSLQS AASSLQS RLIYAASSLQ (SEQ ID
NO: 17) (SEQ ID NO: 18) (SEQ ID NO: 19) CDR-L3 L89-L97 L89-L97
L89-L96 LQHNGFPYT LQHNGFPYT LQHNGFPYT (SEQ ID NO: 20) (SEQ ID NO:
21) (SEQ ID NO: 22) CDR-H1* H31-H35 H26-H32 H30-H35 GYSIN GFTFSGY
SGYSIN (SEQ ID NO: 23) (SEQ ID NO: 24) (SEQ ID NO: 25) CDR-H1**
H31-H35 H26-H32 H30-H35 GYSIN GFTFSGY SGYSIN (SEQ ID NO: 26) (SEQ
ID NO: 27) (SEQ ID NO: 28) CDR-H2 H50-H65 H52-H56 H47-H58
SISSSSNYIYYADSVKG SSSSN WVSSISSSSNYI (SEQ ID NO: 29) (SEQ ID NO:
30) (SEQ ID NO: 31) CDR-H3 H95-H102 H95-H102 H93-H101
EGFIAGTTFDAFDI EGFIAGTTFDAFDI AREGFIAGTTFDAFD (SEQ ID NO: 32) (SEQ
ID NO: 33) (SEQ ID NO: 34) *Kabat Numbering **Chothia Numbering
TABLE-US-00006 TABLE VI Table of Geometric Mean values and Mean
Florescence ratio (MFR) values in FACS assay. Cell Line Cancer Type
Source Unstained Secondary Detection Isotype cHv62-1b21.1 MFR
Karpas-299 ALCL DSMZ 623 596 569 634 1 REH ALL ATCC 220 236 235
16200 69 EOL-1 AML Sigma/HPA 282 292 281 14000 50 MOLM-13 AML DSMZ
303 313 320 14000 44 MONOMAC-1 AML Creative Bioarray 315 348 338
11400 34 MV-4-11 AML ATCC 344 355 366 2875 8 OCI-AML2 AML DSMZ 343
337 329 5646 17 PL-21 AML DSMZ 598 584 570 3715 7 SKM-1 AML DSMZ
465 449 445 3208 7 THP-1 AML ATCC 486 475 474 19700 42 RS4; 11
B-ALL ATCC 184 213 213 18400 86 SEM B-ALL DSMZ 181 207 212 132000
623 NALM-1 CML ATCC 197 254 262 12900 49
TABLE-US-00007 TABLE X Antibody Sequence of v62-1b37.1. The amino
acid sequence of v62-1b37.1 heavy chain.. (SEQ ID NO: 12) 1
EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSG 51
INWNGGSTGYADSVKGRFTISRDDAKNSLYLQKNSLRAEDTALYHCARDG 101
YTYGPFDNWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD 151
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY 201
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK 251
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 301
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV 351
YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL 401
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK The amino acid
sequence of v62-1b37.1 light chain.. (SEQ IS NO: 13) 1
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA 51
ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPYTFGQ 101
GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV 151
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG 201
LSSPVTKSFNRGEC
TABLE-US-00008 TABLE XI Chemical composition of AGL-0129-08.
0129-08 means (S)-methyl
2-((2R,3R)-3-((S)-1-((3R,4S,5S)-4-((2S,3S)-3-azido-2-((S)-2-(dimethyl-
amino)-3-methylbutanamido)-N-methylbutanamido)-3-methoxy-5-methylheptanoyl-
)pyrrolidin-2-
yl)-3-methoxy-2-methylpropanamido)-3-phenylpropanoate ##STR00032##
Sequence CWU 1
1
3413307DNAHomo sapienshuman FLT3 1gttttacacg aggcggcatc gcagggctgg
gccggcgcgg cctggggacc ccgggctccg 60gaggccatgc cggcgttggc gcgcgacggc
ggccagctgc cgctgctcgt tgttttttct 120gcaatgatat ttgggactat
tacaaatcaa gatctgcctg tgatcaagtg tgttttaatc 180aatcataaga
acaatgattc atcagtgggg aagtcatcat catatcccat ggtatcagaa
240tccccggaag acctcgggtg tgcgttgaga ccccagagct cagggacagt
gtacgaagct 300gccgctgtgg aagtggatgt atctgcttcc atcacactgc
aagtgctggt cgatgcccca 360gggaacattt cctgtctctg ggtctttaag
cacagctccc tgaattgcca gccacatttt 420gatttacaaa acagaggagt
tgtttccatg gtcattttga aaatgacaga aacccaagct 480ggagaatacc
tactttttat tcagagtgaa gctaccaatt acacaatatt gtttacagtg
540agtataagaa ataccctgct ttacacatta agaagacctt actttagaaa
aatggaaaac 600caggacgccc tggtctgcat atctgagagc gttccagagc
cgatcgtgga atgggtgctt 660tgcgattcac agggggaaag ctgtaaagaa
gaaagtccag ctgttgttaa aaaggaggaa 720aaagtgcttc atgaattatt
tgggatggac ataaggtgct gtgccagaaa tgaactgggc 780agggaatgca
ccaggctgtt cacaatagat ctaaatcaaa ctcctcagac cacattgcca
840caattatttc ttaaagtagg ggaaccctta tggataaggt gcaaagctgt
tcatgtgaac 900catggattcg ggctcacctg ggaattagaa aacaaagcac
tcgaggaggg caactacttt 960gagatgagta cctattcaac aaacagaact
atgatacgga ttctgtttgc ttttgtatca 1020tcagtggcaa gaaacgacac
cggatactac acttgttcct cttcaaagca tcccagtcaa 1080tcagctttgg
ttaccatcgt agaaaaggga tttataaatg ctaccaattc aagtgaagat
1140tatgaaattg accaatatga agagttttgt ttttctgtca ggtttaaagc
ctacccacaa 1200atcagatgta cgtggacctt ctctcgaaaa tcatttcctt
gtgagcaaaa gggtcttgat 1260aacggataca gcatatccaa gttttgcaat
cataagcacc agccaggaga atatatattc 1320catgcagaaa atgatgatgc
ccaatttacc aaaatgttca cgctgaatat aagaaggaaa 1380cctcaagtgc
tcgcagaagc atcggcaagt caggcgtcct gtttctcgga tggataccca
1440ttaccatctt ggacctggaa gaagtgttca gacaagtctc ccaactgcac
agaagagatc 1500acagaaggag tctggaatag aaaggctaac agaaaagtgt
ttggacagtg ggtgtcgagc 1560agtactctaa acatgagtga agccataaaa
gggttcctgg tcaagtgctg tgcatacaat 1620tcccttggca catcttgtga
gacgatcctt ttaaactctc caggcccctt ccctttcatc 1680caagacaaca
tctcattcta tgcaacaatt ggtgtttgtc tcctcttcat tgtcgtttta
1740accctgctaa tttgtcacaa gtacaaaaag caatttaggt atgaaagcca
gctacagatg 1800gtacaggtga ccggctcctc agataatgag tacttctacg
ttgatttcag agaatatgaa 1860tatgatctca aatgggagtt tccaagagaa
aatttagagt ttgggaaggt actaggatca 1920ggtgcttttg gaaaagtgat
gaacgcaaca gcttatggaa ttagcaaaac aggagtctca 1980atccaggttg
ccgtcaaaat gctgaaagaa aaagcagaca gctctgaaag agaggcactc
2040atgtcagaac tcaagatgat gacccagctg ggaagccacg agaatattgt
gaacctgctg 2100ggggcgtgca cactgtcagg accaatttac ttgatttttg
aatactgttg ctatggtgat 2160cttctcaact atctaagaag taaaagagaa
aaatttcaca ggacttggac agagattttc 2220aaggaacaca atttcagttt
ttaccccact ttccaatcac atccaaattc cagcatgcct 2280ggttcaagag
aagttcagat acacccggac tcggatcaaa tctcagggct tcatgggaat
2340tcatttcact ctgaagatga aattgaatat gaaaaccaaa aaaggctgga
agaagaggag 2400gacttgaatg tgcttacatt tgaagatctt ctttgctttg
catatcaagt tgccaaagga 2460atggaatttc tggaatttaa gtcgtgtgtt
cacagagacc tggccgccag gaacgtgctt 2520gtcacccacg ggaaagtggt
gaagatatgt gactttggat tggctcgaga tatcatgagt 2580gattccaact
atgttgtcag gggcaatgcc cgtctgcctg taaaatggat ggcccccgaa
2640agcctgtttg aaggcatcta caccattaag agtgatgtct ggtcatatgg
aatattactg 2700tgggaaatct tctcacttgg tgtgaatcct taccctggca
ttccggttga tgctaacttc 2760tacaaactga ttcaaaatgg atttaaaatg
gatcagccat tttatgctac agaagaaata 2820tacattataa tgcaatcctg
ctgggctttt gactcaagga aacggccatc cttccctaat 2880ttgacttcgt
ttttaggatg tcagctggca gatgcagaag aagcgatgta tcagaatgtg
2940gatggccgtg tttcggaatg tcctcacacc taccaaaaca ggcgaccttt
cagcagagag 3000atggatttgg ggctactctc tccgcaggct caggtcgaag
attcgtagag gaacaattta 3060gttttaagga cttcatccct ccacctatcc
ctaacaggct gtagattacc aaaacaagat 3120taatttcatc actaaaagaa
aatctattat caactgctgc ttcaccagac ttttctctag 3180aagctgtctg
cgtttactct tgttttcaaa gggacttttg taaaatcaaa tcatcctgtc
3240acaaggcagg aggagctgat aatgaacttt attggagcat tgatctgcat
ccaaggcctt 3300ctcaggc 33072993PRTHomo sapienshuman FLT3 2Met Pro
Ala Leu Ala Arg Asp Gly Gly Gln Leu Pro Leu Leu Val Val 1 5 10 15
Phe Ser Ala Met Ile Phe Gly Thr Ile Thr Asn Gln Asp Leu Pro Val 20
25 30 Ile Lys Cys Val Leu Ile Asn His Lys Asn Asn Asp Ser Ser Val
Gly 35 40 45 Lys Ser Ser Ser Tyr Pro Met Val Ser Glu Ser Pro Glu
Asp Leu Gly 50 55 60 Cys Ala Leu Arg Pro Gln Ser Ser Gly Thr Val
Tyr Glu Ala Ala Ala65 70 75 80 Val Glu Val Asp Val Ser Ala Ser Ile
Thr Leu Gln Val Leu Val Asp 85 90 95 Ala Pro Gly Asn Ile Ser Cys
Leu Trp Val Phe Lys His Ser Ser Leu 100 105 110 Asn Cys Gln Pro His
Phe Asp Leu Gln Asn Arg Gly Val Val Ser Met 115 120 125 Val Ile Leu
Lys Met Thr Glu Thr Gln Ala Gly Glu Tyr Leu Leu Phe 130 135 140 Ile
Gln Ser Glu Ala Thr Asn Tyr Thr Ile Leu Phe Thr Val Ser Ile145 150
155 160 Arg Asn Thr Leu Leu Tyr Thr Leu Arg Arg Pro Tyr Phe Arg Lys
Met 165 170 175 Glu Asn Gln Asp Ala Leu Val Cys Ile Ser Glu Ser Val
Pro Glu Pro 180 185 190 Ile Val Glu Trp Val Leu Cys Asp Ser Gln Gly
Glu Ser Cys Lys Glu 195 200 205 Glu Ser Pro Ala Val Val Lys Lys Glu
Glu Lys Val Leu His Glu Leu 210 215 220 Phe Gly Met Asp Ile Arg Cys
Cys Ala Arg Asn Glu Leu Gly Arg Glu225 230 235 240 Cys Thr Arg Leu
Phe Thr Ile Asp Leu Asn Gln Thr Pro Gln Thr Thr 245 250 255 Leu Pro
Gln Leu Phe Leu Lys Val Gly Glu Pro Leu Trp Ile Arg Cys 260 265 270
Lys Ala Val His Val Asn His Gly Phe Gly Leu Thr Trp Glu Leu Glu 275
280 285 Asn Lys Ala Leu Glu Glu Gly Asn Tyr Phe Glu Met Ser Thr Tyr
Ser 290 295 300 Thr Asn Arg Thr Met Ile Arg Ile Leu Phe Ala Phe Val
Ser Ser Val305 310 315 320 Ala Arg Asn Asp Thr Gly Tyr Tyr Thr Cys
Ser Ser Ser Lys His Pro 325 330 335 Ser Gln Ser Ala Leu Val Thr Ile
Val Glu Lys Gly Phe Ile Asn Ala 340 345 350 Thr Asn Ser Ser Glu Asp
Tyr Glu Ile Asp Gln Tyr Glu Glu Phe Cys 355 360 365 Phe Ser Val Arg
Phe Lys Ala Tyr Pro Gln Ile Arg Cys Thr Trp Thr 370 375 380 Phe Ser
Arg Lys Ser Phe Pro Cys Glu Gln Lys Gly Leu Asp Asn Gly385 390 395
400 Tyr Ser Ile Ser Lys Phe Cys Asn His Lys His Gln Pro Gly Glu Tyr
405 410 415 Ile Phe His Ala Glu Asn Asp Asp Ala Gln Phe Thr Lys Met
Phe Thr 420 425 430 Leu Asn Ile Arg Arg Lys Pro Gln Val Leu Ala Glu
Ala Ser Ala Ser 435 440 445 Gln Ala Ser Cys Phe Ser Asp Gly Tyr Pro
Leu Pro Ser Trp Thr Trp 450 455 460 Lys Lys Cys Ser Asp Lys Ser Pro
Asn Cys Thr Glu Glu Ile Thr Glu465 470 475 480 Gly Val Trp Asn Arg
Lys Ala Asn Arg Lys Val Phe Gly Gln Trp Val 485 490 495 Ser Ser Ser
Thr Leu Asn Met Ser Glu Ala Ile Lys Gly Phe Leu Val 500 505 510 Lys
Cys Cys Ala Tyr Asn Ser Leu Gly Thr Ser Cys Glu Thr Ile Leu 515 520
525 Leu Asn Ser Pro Gly Pro Phe Pro Phe Ile Gln Asp Asn Ile Ser Phe
530 535 540 Tyr Ala Thr Ile Gly Val Cys Leu Leu Phe Ile Val Val Leu
Thr Leu545 550 555 560 Leu Ile Cys His Lys Tyr Lys Lys Gln Phe Arg
Tyr Glu Ser Gln Leu 565 570 575 Gln Met Val Gln Val Thr Gly Ser Ser
Asp Asn Glu Tyr Phe Tyr Val 580 585 590 Asp Phe Arg Glu Tyr Glu Tyr
Asp Leu Lys Trp Glu Phe Pro Arg Glu 595 600 605 Asn Leu Glu Phe Gly
Lys Val Leu Gly Ser Gly Ala Phe Gly Lys Val 610 615 620 Met Asn Ala
Thr Ala Tyr Gly Ile Ser Lys Thr Gly Val Ser Ile Gln625 630 635 640
Val Ala Val Lys Met Leu Lys Glu Lys Ala Asp Ser Ser Glu Arg Glu 645
650 655 Ala Leu Met Ser Glu Leu Lys Met Met Thr Gln Leu Gly Ser His
Glu 660 665 670 Asn Ile Val Asn Leu Leu Gly Ala Cys Thr Leu Ser Gly
Pro Ile Tyr 675 680 685 Leu Ile Phe Glu Tyr Cys Cys Tyr Gly Asp Leu
Leu Asn Tyr Leu Arg 690 695 700 Ser Lys Arg Glu Lys Phe His Arg Thr
Trp Thr Glu Ile Phe Lys Glu705 710 715 720 His Asn Phe Ser Phe Tyr
Pro Thr Phe Gln Ser His Pro Asn Ser Ser 725 730 735 Met Pro Gly Ser
Arg Glu Val Gln Ile His Pro Asp Ser Asp Gln Ile 740 745 750 Ser Gly
Leu His Gly Asn Ser Phe His Ser Glu Asp Glu Ile Glu Tyr 755 760 765
Glu Asn Gln Lys Arg Leu Glu Glu Glu Glu Asp Leu Asn Val Leu Thr 770
775 780 Phe Glu Asp Leu Leu Cys Phe Ala Tyr Gln Val Ala Lys Gly Met
Glu785 790 795 800 Phe Leu Glu Phe Lys Ser Cys Val His Arg Asp Leu
Ala Ala Arg Asn 805 810 815 Val Leu Val Thr His Gly Lys Val Val Lys
Ile Cys Asp Phe Gly Leu 820 825 830 Ala Arg Asp Ile Met Ser Asp Ser
Asn Tyr Val Val Arg Gly Asn Ala 835 840 845 Arg Leu Pro Val Lys Trp
Met Ala Pro Glu Ser Leu Phe Glu Gly Ile 850 855 860 Tyr Thr Ile Lys
Ser Asp Val Trp Ser Tyr Gly Ile Leu Leu Trp Glu865 870 875 880 Ile
Phe Ser Leu Gly Val Asn Pro Tyr Pro Gly Ile Pro Val Asp Ala 885 890
895 Asn Phe Tyr Lys Leu Ile Gln Asn Gly Phe Lys Met Asp Gln Pro Phe
900 905 910 Tyr Ala Thr Glu Glu Ile Tyr Ile Ile Met Gln Ser Cys Trp
Ala Phe 915 920 925 Asp Ser Arg Lys Arg Pro Ser Phe Pro Asn Leu Thr
Ser Phe Leu Gly 930 935 940 Cys Gln Leu Ala Asp Ala Glu Glu Ala Met
Tyr Gln Asn Val Asp Gly945 950 955 960 Arg Val Ser Glu Cys Pro His
Thr Tyr Gln Asn Arg Arg Pro Phe Ser 965 970 975 Arg Glu Met Asp Leu
Gly Leu Leu Ser Pro Gln Ala Gln Val Glu Asp 980 985 990
Ser31362DNAHomo sapiensCHv62.21 heavy chain 3gaggtgcagc tggtggagtc
tgggggaggc ctggtcaggc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt
caccttcagt ggctatagca taaactgggt ccgccaggct 120ccagggaagg
ggctggaatg ggtctcatcc attagtagta gtagtaatta catatactac
180gcagactcag tgaagggccg attcaccatc tccagagaca acgccaagaa
ctcactgtat 240ctgcaaatga acagcctgag agccgaggac acggctgtgt
attactgtgc gagagaaggg 300tttatagctg gaactacttt tgatgctttt
gatatctggg gccaagggac aatggtcacc 360gtctcttcag catccaccaa
gggcccatcg gtcttccccc tggcaccctc ctccaagagc 420acctctgggg
gcacagcggc cctgggctgc ctggtcaagg actacttccc cgaaccggtg
480acggtgtcgt ggaactcagg cgccctgacc agcggcgtgc acaccttccc
ggctgtccta 540cagtcctcag gactctactc cctcagcagc gtggtgaccg
tgccctccag cagcttgggc 600acccagacct acatctgcaa cgtgaatcac
aagcccagca acaccaaggt ggacaagaaa 660gttgagccca aatcttgtga
caaaactcac acatgcccac cgtgcccagc acctgaactc 720ctggggggac
cgtcagtctt cctcttcccc ccaaaaccca aggacaccct catgatctcc
780cggacccctg aggtcacatg cgtggtggtg gacgtgagcc acgaagaccc
tgaggtcaag 840ttcaactggt acgtggacgg cgtggaggtg cataatgcca
agacaaagcc gcgggaggag 900cagtacaaca gcacgtaccg tgtggtcagc
gtcctcaccg tcctgcacca ggactggctg 960aatggcaagg agtacaagtg
caaggtctcc aacaaagccc tcccagcccc catcgagaaa 1020accatctcca
aagccaaagg gcagccccga gaaccacagg tgtacaccct gcccccatcc
1080cgggaggaga tgaccaagaa ccaggtcagc ctgacctgcc tggtcaaagg
cttctatccc 1140agcgacatcg ccgtggagtg ggagagcaat gggcagccgg
agaacaacta caagaccacg 1200cctcccgtgc tggactccga cggctccttc
ttcctctata gcaagctcac cgtggacaag 1260agcaggtggc agcaggggaa
cgtcttctca tgctccgtga tgcatgaggc tctgcacaac 1320cactacacgc
agaagagcct ctccctgtct ccgggtaaat aa 13624453PRTHomo sapiensCHv62.21
heavy chain 4Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Arg
Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Gly Tyr 20 25 30 Ser Ile Asn Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Ser Ser Ser Ser
Asn Tyr Ile Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80 Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala
Arg Glu Gly Phe Ile Ala Gly Thr Thr Phe Asp Ala Phe Asp Ile 100 105
110 Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser Ala Ser Thr Lys Gly
115 120 125 Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser
Gly Gly 130 135 140 Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val145 150 155 160 Thr Val Ser Trp Asn Ser Gly Ala Leu
Thr Ser Gly Val His Thr Phe 165 170 175 Pro Ala Val Leu Gln Ser Ser
Gly Leu Tyr Ser Leu Ser Ser Val Val 180 185 190 Thr Val Pro Ser Ser
Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 195 200 205 Asn His Lys
Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys 210 215 220 Ser
Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu225 230
235 240 Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr 245 250 255 Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val 260 265 270 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val 275 280 285 Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser 290 295 300 Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu305 310 315 320 Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 325 330 335 Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 340 345 350
Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 355
360 365 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala 370 375 380 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr385 390 395 400 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu 405 410 415 Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser 420 425 430 Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser 435 440 445 Leu Ser Pro Gly
Lys 450 5645DNAHomo sapiensCHv62.21 light chain 5gacatccaga
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc
gggcaagtca gggcattaga aatgatttag gctggtatca gcagaaacca
120gggaaagccc ctaagcgcct gatctatgct gcatccagtt tgcaaagtgg
ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa ttcactctca
caatcagcag cctgcagcct 240gaagattttg caacttatta ctgtctacag
cataatggtt tcccgtacac ttttggccag 300gggaccaagc tggagatcaa
acggactgtg gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc
agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat
420cccagagagg ccaaagtaca gtggaaggtg gataacgccc tccaatcggg
taactcccag 480gagagtgtca cagagcagga cagcaaggac agcacctaca
gcctcagcag caccctgacg 540ctgagcaaag cagactacga gaaacacaaa
gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc ccgtcacaaa
gagcttcaac aggggagagt gttaa 6456214PRTHomo sapiensCHv62.21 light
chain 6Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val
Gly 1
5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn
Asp 20 25 30 Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu
Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr
Cys Leu Gln His Asn Gly Phe Pro Tyr 85 90 95 Thr Phe Gly Gln Gly
Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Val
Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr
Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135
140 Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser
Gln145 150 155 160 Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr
Tyr Ser Leu Ser 165 170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr
Glu Lys His Lys Val Tyr 180 185 190 Ala Cys Glu Val Thr His Gln Gly
Leu Ser Ser Pro Val Thr Lys Ser 195 200 205 Phe Asn Arg Gly Glu Cys
210 71362DNAHomo sapiensCHv62.21 heavy chain 7gaggtgcagc tggtggagtc
tgggggaggc ctggtcaggc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt
caccttcagt ggctatagca taaactgggt ccgccaggct 120ccagggaagg
ggctggaatg ggtctcatcc attagtagta gtagtaatta catatactac
180gcagactcag tgaagggccg attcaccatc tccagagaca acgccaagaa
ctcactgtat 240ctgcaaatga acagcctgag agccgaggac acggctgtgt
attactgtgc gagagaaggg 300tttatagctg gaactacttt tgatgctttt
gatatctggg gccaagggac aatggtcacc 360gtctcttcat agtccaccaa
gggcccatcg gtcttccccc tggcaccctc ctccaagagc 420acctctgggg
gcacagcggc cctgggctgc ctggtcaagg actacttccc cgaaccggtg
480acggtgtcgt ggaactcagg cgccctgacc agcggcgtgc acaccttccc
ggctgtccta 540cagtcctcag gactctactc cctcagcagc gtggtgaccg
tgccctccag cagcttgggc 600acccagacct acatctgcaa cgtgaatcac
aagcccagca acaccaaggt ggacaagaaa 660gttgagccca aatcttgtga
caaaactcac acatgcccac cgtgcccagc acctgaactc 720ctggggggac
cgtcagtctt cctcttcccc ccaaaaccca aggacaccct catgatctcc
780cggacccctg aggtcacatg cgtggtggtg gacgtgagcc acgaagaccc
tgaggtcaag 840ttcaactggt acgtggacgg cgtggaggtg cataatgcca
agacaaagcc gcgggaggag 900cagtacaaca gcacgtaccg tgtggtcagc
gtcctcaccg tcctgcacca ggactggctg 960aatggcaagg agtacaagtg
caaggtctcc aacaaagccc tcccagcccc catcgagaaa 1020accatctcca
aagccaaagg gcagccccga gaaccacagg tgtacaccct gcccccatcc
1080cgggaggaga tgaccaagaa ccaggtcagc ctgacctgcc tggtcaaagg
cttctatccc 1140agcgacatcg ccgtggagtg ggagagcaat gggcagccgg
agaacaacta caagaccacg 1200cctcccgtgc tggactccga cggctccttc
ttcctctata gcaagctcac cgtggacaag 1260agcaggtggc agcaggggaa
cgtcttctca tgctccgtga tgcatgaggc tctgcacaac 1320cactacacgc
agaagagcct ctccctgtct ccgggtaaat aa 13628453PRTHomo sapiensCHv62.21
heavy chainVARIANT124Xaa = para-acetylphenylalanine (pAF) 8Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Gly Tyr 20
25 30 Ser Ile Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ser Ser Ile Ser Ser Ser Ser Asn Tyr Ile Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala
Lys Asn Ser Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Glu Gly Phe Ile Ala
Gly Thr Thr Phe Asp Ala Phe Asp Ile 100 105 110 Trp Gly Gln Gly Thr
Met Val Thr Val Ser Ser Xaa Ser Thr Lys Gly 115 120 125 Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly 130 135 140 Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val145 150
155 160 Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr
Phe 165 170 175 Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser
Ser Val Val 180 185 190 Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr
Tyr Ile Cys Asn Val 195 200 205 Asn His Lys Pro Ser Asn Thr Lys Val
Asp Lys Lys Val Glu Pro Lys 210 215 220 Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu225 230 235 240 Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 245 250 255 Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 260 265 270
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 275
280 285 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser 290 295 300 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu305 310 315 320 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala 325 330 335 Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro 340 345 350 Gln Val Tyr Thr Leu Pro
Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 355 360 365 Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 370 375 380 Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr385 390 395
400 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
405 410 415 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser 420 425 430 Val Met His Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser 435 440 445 Leu Ser Pro Gly Lys 450 9453PRTHomo
sapiensCHv62.21 heavy chain 9Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Arg Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Gly Tyr 20 25 30 Ser Ile Asn Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile
Ser Ser Ser Ser Asn Tyr Ile Tyr Tyr Ala Asp Ser Val 50 55 60 Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Glu Gly Phe Ile Ala Gly Thr Thr Phe Asp Ala Phe
Asp Ile 100 105 110 Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser Ala
Ser Thr Lys Gly 115 120 125 Pro Ser Val Phe Pro Leu Ala Pro Ser Ser
Lys Ser Thr Ser Gly Gly 130 135 140 Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val145 150 155 160 Thr Val Ser Trp Asn
Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 165 170 175 Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 180 185 190 Thr
Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 195 200
205 Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys
210 215 220 Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu225 230 235 240 Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr 245 250 255 Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val 260 265 270 Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val 275 280 285 Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 290 295 300 Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu305 310 315 320
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 325
330 335 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro 340 345 350 Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr
Lys Asn Gln 355 360 365 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala 370 375 380 Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr385 390 395 400 Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 405 410 415 Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 420 425 430 Val Met
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 435 440 445
Leu Ser Pro Gly Lys 450 10214PRTHomo sapiensCHv62.21 light chain
10Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1
5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn
Asp 20 25 30 Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu
Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr
Cys Leu Gln His Asn Gly Phe Pro Tyr 85 90 95 Thr Phe Gly Gln Gly
Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Val
Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr
Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135
140 Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser
Gln145 150 155 160 Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr
Tyr Ser Leu Ser 165 170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr
Glu Lys His Lys Val Tyr 180 185 190 Ala Cys Glu Val Thr His Gln Gly
Leu Ser Ser Pro Val Thr Lys Ser 195 200 205 Phe Asn Arg Gly Glu Cys
210 11453PRThomo sapiensCHv62.21 heavy chainVARIANT124Xaa =
para-acetylphenylalanine (pAF) 11Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Arg Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Gly Tyr 20 25 30 Ser Ile Asn Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser
Ile Ser Ser Ser Ser Asn Tyr Ile Tyr Tyr Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65
70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Arg Glu Gly Phe Ile Ala Gly Thr Thr Phe Asp
Ala Phe Asp Ile 100 105 110 Trp Gly Gln Gly Thr Met Val Thr Val Ser
Ser Xaa Ser Thr Lys Gly 115 120 125 Pro Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys Ser Thr Ser Gly Gly 130 135 140 Thr Ala Ala Leu Gly Cys
Leu Val Lys Asp Tyr Phe Pro Glu Pro Val145 150 155 160 Thr Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 165 170 175 Pro
Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 180 185
190 Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
195 200 205 Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu
Pro Lys 210 215 220 Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu225 230 235 240 Leu Gly Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr 245 250 255 Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val 260 265 270 Ser His Glu Asp Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 275 280 285 Glu Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 290 295 300 Thr
Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu305 310
315 320 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala 325 330 335 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro 340 345 350 Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu
Met Thr Lys Asn Gln 355 360 365 Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala 370 375 380 Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr385 390 395 400 Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 405 410 415 Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 420 425 430
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 435
440 445 Leu Ser Pro Gly Lys 450 12449PRTHomo sapiensv62-1b37.1
heavy chain 12Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Arg
Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Asp Asp Tyr 20 25 30 Gly Met Ser Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Asn Trp Asn Gly
Gly Ser Thr Gly Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asp Ala Lys Asn Ser Leu Tyr65 70 75 80 Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr His Cys 85 90 95 Ala
Arg Asp Gly Tyr Thr Tyr Gly Pro Phe Asp Asn Trp Gly Gln Gly 100 105
110 Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe
115 120 125 Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala
Ala Leu 130 135 140 Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr Val Ser Trp145 150 155 160 Asn Ser Gly Ala Leu Thr Ser Gly Val
His Thr Phe Pro Ala Val Leu 165 170 175 Gln Ser Ser Gly Leu Tyr Ser
Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190 Ser Ser Leu Gly Thr
Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205 Ser Asn Thr
Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220 Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230
235 240 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser 245 250 255 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp 260 265 270 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn 275
280 285 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val 290 295 300 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu305 310 315 320 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys 325 330 335 Thr Ile Ser Lys Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350 Leu Pro Pro Ser Arg Glu
Glu Met Thr Lys Asn Gln Val Ser Leu Thr 355 360 365 Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380 Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395
400 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
405 410 415 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 420 425 430 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly 435 440 445 Lys 13214PRTHomo sapiensv62-1b37.1
light chain 13Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln
Gly Ile Arg Asn Asp 20 25 30 Leu Gly Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr
Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe
Ala Thr Tyr Tyr Cys Leu Gln His Asn Ser Tyr Pro Tyr 85 90 95 Thr
Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105
110 Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly
115 120 125 Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg
Glu Ala 130 135 140 Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser
Gly Asn Ser Gln145 150 155 160 Glu Ser Val Thr Glu Gln Asp Ser Lys
Asp Ser Thr Tyr Ser Leu Ser 165 170 175 Ser Thr Leu Thr Leu Ser Lys
Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190 Ala Cys Glu Val Thr
His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205 Phe Asn Arg
Gly Glu Cys 210 1411PRTHomo sapiens 14Arg Ala Ser Gln Gly Ile Arg
Asn Asp Leu Gly 1 5 10 1511PRTHomo sapiens 15Arg Ala Ser Gln Gly
Ile Arg Asn Asp Leu Gly 1 5 10 167PRTHomo sapiens 16Arg Asn Asp Leu
Gly Trp Tyr1 5 177PRTHomo sapiens 17Ala Ala Ser Ser Leu Gln Ser1 5
187PRTHomo sapiens 18Ala Ala Ser Ser Leu Gln Ser1 5 1910PRTHomo
sapiens 19Arg Leu Ile Tyr Ala Ala Ser Ser Leu Gln 1 5 10 209PRTHomo
sapiens 20Leu Gln His Asn Gly Phe Pro Tyr Thr1 5 219PRTHomo sapiens
21Leu Gln His Asn Gly Phe Pro Tyr Thr1 5 229PRTHomo sapiens 22Leu
Gln His Asn Gly Phe Pro Tyr Thr1 5 235PRTHomo sapiens 23Gly Tyr Ser
Ile Asn1 5 247PRTHomo sapiens 24Gly Phe Thr Phe Ser Gly Tyr1 5
256PRTHomo sapiens 25Ser Gly Tyr Ser Ile Asn1 5 265PRTHomo sapiens
26Gly Tyr Ser Ile Asn1 5 277PRTHomo sapiens 27Gly Phe Thr Phe Ser
Gly Tyr1 5 286PRTHomo sapiens 28Ser Gly Tyr Ser Ile Asn1 5
2917PRTHomo sapiens 29Ser Ile Ser Ser Ser Ser Asn Tyr Ile Tyr Tyr
Ala Asp Ser Val Lys 1 5 10 15 Gly305PRTHomo sapiens 30Ser Ser Ser
Ser Asn1 5 3112PRTHomo sapiens 31Trp Val Ser Ser Ile Ser Ser Ser
Ser Asn Tyr Ile 1 5 10 3214PRTHomo sapiens 32Glu Gly Phe Ile Ala
Gly Thr Thr Phe Asp Ala Phe Asp Ile 1 5 10 3314PRTHomo saiens 33Glu
Gly Phe Ile Ala Gly Thr Thr Phe Asp Ala Phe Asp Ile 1 5 10
3415PRTHomo sapiens 34Ala Arg Glu Gly Phe Ile Ala Gly Thr Thr Phe
Asp Ala Phe Asp 1 5 10 15
* * * * *
References