U.S. patent application number 15/639198 was filed with the patent office on 2018-02-01 for peptides for assisting delivery across the blood brain barrier.
This patent application is currently assigned to Children's Medical Center Corporation. The applicant listed for this patent is Children's Medical Center Corporation. Invention is credited to Priti KUMAR, Manjunath NARASIMHASWAMY, Premlata SHANKAR.
Application Number | 20180028677 15/639198 |
Document ID | / |
Family ID | 39301776 |
Filed Date | 2018-02-01 |
United States Patent
Application |
20180028677 |
Kind Code |
A1 |
NARASIMHASWAMY; Manjunath ;
et al. |
February 1, 2018 |
Peptides for Assisting Delivery Across the Blood Brain Barrier
Abstract
The present invention provides compositions and methods useful
for delivering agents to target cells or tissues, for example nerve
cells and other cells in the central nervous system. The
compositions and methods are useful for delivering agents across
the blood-brain barrier. The present invention also provides
methods of using the compositions provided by the present invention
to deliver agents, for example therapeutic agents for the treatment
of neurologically related disorders.
Inventors: |
NARASIMHASWAMY; Manjunath;
(El Paso, TX) ; SHANKAR; Premlata; (El Paso,
TX) ; KUMAR; Priti; (Hamden, CT) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Children's Medical Center Corporation |
Boston |
MA |
US |
|
|
Assignee: |
Children's Medical Center
Corporation
Boston
MA
|
Family ID: |
39301776 |
Appl. No.: |
15/639198 |
Filed: |
June 30, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14265939 |
Apr 30, 2014 |
9757470 |
|
|
15639198 |
|
|
|
|
12301847 |
Nov 21, 2008 |
8748567 |
|
|
PCT/US2007/012152 |
May 22, 2007 |
|
|
|
14265939 |
|
|
|
|
60802377 |
May 22, 2006 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 47/6455 20170801;
A61K 49/0056 20130101; A61K 47/62 20170801; A61K 47/645 20170801;
A61K 47/6921 20170801; A61K 47/6951 20170801; A61K 47/6911
20170801; A61K 47/64 20170801; B82Y 5/00 20130101 |
International
Class: |
A61K 47/64 20060101
A61K047/64; A61K 47/69 20060101 A61K047/69; B82Y 5/00 20060101
B82Y005/00; A61K 49/00 20060101 A61K049/00 |
Goverment Interests
GOVERNMENT SUPPORT
[0002] This invention was supported, in part, by National
Institutes of Health (NIH) Grant No. U19 AI056900. The government
of the United States has certain rights to the invention.
Claims
1.-65. (canceled)
66. A composition for targeted delivery of an effector agent to a
neuronal cell, astrocyte or microglia cell, comprising an amino
acid sequence of SEQ ID NO: 13 or a variant of at least 85%
sequence identity to SEQ ID NO: 1, and at least one targeting agent
and at least one effector agent.
67. The composition of claim 66, wherein the effector agent is
conjugated to the amino acid sequence of SEQ ID NO: 13 or a variant
of at least 85% sequence identity to SEQ ID NO: 1.
68. The composition of claim 66, wherein the amino acid sequence of
SEQ ID NO: 13 or a variant of at least 85% sequence identity to SEQ
ID NO: 1 is present on the surface of a nanoparticle and wherein
the effector agent is present on the surface or in the
nanoparticle.
69. The composition of claim 68, wherein the nanoparticle is a
liposome or polymeric nanoparticle.
70. The composition of claim 69, wherein the liposome or polymeric
nanoparticle is a cationic liposome.
71. The composition of claim 66, wherein the effector agent is
selected from the group consisting of: a nucleic acid agent, a RNAi
agent or a microRNA agent, a small molecule, a protein, peptide,
aptamer.
72. The composition of claim 71, wherein the nucleic acid is
selected from the group consisting of: RNA, siRNA, mRNA, tRNA,
miRNA, shRNA or combinations thereof.
73. The composition of claim 71, wherein the nucleic acid is
selected from the group consisting of: DNA, antisense nucleic
acids, oligonucleic acids, peptide nucleic acid (PNA),
pseudo-complementary PNA (pcPNA), locked nucleic acid (LNA), and
antigomirs.
74. The composition of claim 66, wherein the effector agent is an
antibody, peptidomimetic monoclonal antibody or avimir.
75. The composition of claim 66, wherein the amino acid sequence of
SEQ ID NO: 13 or a variant of at least 85% sequence identity to SEQ
ID NO: 1 is conjugated to a cell permeable peptide.
76. The composition of claim 75, wherein the cell permeable peptide
is a polymer consisting of arginine residues or is a protamine
peptide.
77. A method for treatment of cancer comprising administering the
subject with cancer the composition according to claim 66.
Description
CROSS REFERENCED TO RELATED APPLICATIONS
[0001] This Application is a Continuation Application of Ser. No.
14/265,939 filed Apr. 30, 2014, which is a Continuation Application
of Ser. No. 12/301,847 filed Nov. 21, 2008, which is a National
Phase Entry Application under 35 U.S.C. .sctn. 371 of International
Application PCT/US2007/012152, filed May 22, 2007, which claims the
benefit under 35 U.S.C. .sctn. 119(e) of U.S. Provisional
Application Ser. No. 60/802,377 filed on May 22, 2006, the contents
of each are incorporated herein in their entirety by reference.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which
has been submitted in ASCII format via EFS-Web and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Jun. 30, 2017, is named 2017-06-30-Sequence_Listing.txt and is
12,548 bytes in size.
FIELD OF THE INVENTION
[0004] The present invention relates generally to the field of drug
delivery and more specifically to the delivery of agents to the
central nervous system, and delivery of agents for the treatment of
neurologically related conditions in the central nervous system and
other target cells.
BACKGROUND OF THE INVENTION
[0005] The blood brain barrier (BBB) is a system-wide membrane
barrier that prevents the brain uptake of circulating drugs,
protein therapeutics, RNAi drugs, and gene medicines. Drugs or
genes can be delivered to the human brain for the treatment of
serious brain disease either (a) by injecting the drug or gene
directly into the brain, thus bypassing the BBB, or (b) by
injecting the drug or gene into the bloodstream so that the drug or
gene enters the brain via the transvascular route across the BBB.
With intra-cerebral administration of the drug, it is necessary to
drill a hole in the head and perform a procedure called craniotomy.
In addition to being expensive and highly invasive, this craniotomy
based drug delivery to the brain approach is ineffective, because
the drug or gene is only delivered to a tiny volume of the brain at
the tip of the injection needle. The only way the drug or gene can
be distributed widely in the brain is the transvascular route
following injection into the bloodstream. However, this latter
approach requires the ability to undergo transport across the BBB.
The BBB has proven to be a very difficult and stubborn barrier to
traverse safely.
[0006] The traditional approach to delivery of drugs across the BBB
is called "BBB disruption". One of the earliest techniques tried is
the transient disruption of the barrier (BBBD) by infusing
hyperosmolar solutions, which sucks water out of capillary
endothelial cells, thereby shrinking them to open the gaps [47-49].
Another approach to disrupt BBB is the use of bradykinin receptor
agonists, such as the compound RMP7 (Cereport, Alkermes), which
binds to the receptors on the surface of endothelial cells and
kicks off a biochemical cascade that loosens the tight junctions
[50]. However, none of these methods is very effective and
moreover, they suffer from the drawback that BBB disruption also
allows the non-specific entry of other potentially brain-toxic
molecules such as serum albumin. Accordingly, this approach has not
gained widespread clinical acceptance.
[0007] Transvascular approach provides the most ideal noninvasive
means to treat neurological diseases. If not for the BBB, the
capillaries, which stretch for over 400 miles in the brain and
encase virtually every brain cell, would offer the most promising
delivery approach [46]. The most promising transvascular approach
to brain is to use transporter molecules since this allows delivery
of specific molecules without disrupting the BBB [46]. A
peptidomimetic mAb, such as against the transferrin receptor can be
used as a molecular "Trojan horse" to ferry any attached drug or
gene across the BBB. Recently, great progress has been made in
brain delivery by combining the antibody targeting technology with
siRNA encapsulation within liposomes [46]. The problems associated
with the use of conventional cationic polyplexes, such as the
aggregation of the DNA and sequestration in the lung and liver can
be eliminated if the DNA is encapsulated in the interior of a
nanocontainer such as a liposome or a polymeric nanoparticle. If
the surface of the liposome is conjugated with polyethylene glycol
or hyaluron, this makes the liposome stable in blood with prolonged
blood residence times. If the tips of PEG or hyaluron are
conjugated with a BBB molecular "Trojan horse", such as
anti-transferrin receptor antibody, this immunoliposome is
effectively delivered across the BBB. This system has been used to
deliver reporter genes with success in the rat, mice and monkey
brains [76-81]. Recently, this technology has also been used to
deliver shRNAs to target specific genes in brain tumors in mice as
well as monkeys [37, 82]. Thus, this method seems optimal to
introduce shRNA encoding vectors as well as synthetic siRNA
duplexes.
SUMMARY OF THE INVENTION
[0008] The inventors have discovered a method to deliver agents
across the blood brain barrier (BBB). As disclosed herein, one
embodiment of the present invention relates to methods to deliver
agents across the blood brain barrier. In another embodiment, the
present invention provides methods to deliver agents to a cell, for
example a cell with acetyl choline receptors (AchR) present on the
surface of the cell. For example, the present invention provides
methods to deliver agents to a CNS cell.
[0009] In one aspect, the present invention relates to a
composition comprising a targeting agent, wherein targeting agent
is conjugated with a carrier particle, and an agent, herein termed
an "effector agent" is associated with the carrier particle.
[0010] In some embodiments, the targeting agent is an RVG peptide
or a derivative or a variant thereof. In alternative embodiments,
targeting agents include, for example insulin, transferrin, insulin
like growth factor (IGF), leptin, low density lipoprotein (LDL) and
fragments or peptidomimetics or derivatives thereof.
[0011] In some embodiments, the carrier particle is, for example, a
lyposomal or polymeric nanoparticles, for example a liposome,
polyarginine, protamine, or a cyclodextrin-based nanoparticle. In
alternative embodiments, the carrier particle is a cell permeable
agent, for example a cell permeable agent, for example but not
limited to, 11dR, 9dR or TAT-HIV or a fragment thereof.
[0012] In some embodiments, where the carrier particle is, for
example, a lyposomal or polymeric nanoparticles, for example a
liposome, polyarginine, protamine, or a cyclodextrin-based
nanoparticle, the carrier particle can optionally further comprise
cell permeable agents, for example but not limited to, polymeric
arginine residues of various lengths such as 11R or 9R as disclosed
herein or TAT-HIV or fragments thereof. In other embodiments, the
carrier particle can optionally further comprise additional
targeting agents, for example, in embodiments where the carrier
particle is conjugated to an RVG peptide, the carrier particle can
also comprise additional targeting agents, for example insulin,
transferrin, insulin like growth factor (IGF), leptin, low density
lipoprotein (LDL) and fragments or peptidomimetics or derivatives
thereof.
[0013] One aspect of the present invention relates to a method for
preparing an effector agent for delivery to a cell, comprising
associating an effector agent with a carrier particle, wherein the
carrier particle is associated with a rabies virus glycoprotein
(RVG) peptide comprising SEQ ID NO:13 or a variant, fragment or
derivative thereof, wherein the RVG peptide binds to an
acetylcholine receptor (AChR) present on the surface of the cell.
In such embodiments, a derivative or variant thereof comprises a
conservative amino acid substitution.
[0014] In another aspect, the present invention relates to a method
for delivering an effector agent across the blood-brain barrier of
a subject, the method comprising administering to the subject a
composition comprising a rabies virus glycoprotein (RVG) peptide
comprising SEQ ID NO:13 or a variant, fragment or derivative
thereof, wherein the RVG peptide is attached to a carrier particle,
and wherein the effector agent is associated with the carrier
particle.
[0015] A further aspect of the present invention relates to a
method for delivering an effector agent to a cell of the CNS, the
method comprising contacting the cell with a rabies virus
glycoprotein (RVG) peptide comprising SEQ ID NO:13 or a variant,
fragment or derivative thereof, wherein the RVG peptide is attached
to a carrier particle, and wherein the effector agent is associated
with the carrier particle, and the RVG peptide binds to binds to an
acetylcholine receptor (AChR) present on the surface of the cell of
the CNS.
[0016] A further aspect of the present invention relates to a
composition for targeted delivery of an effector agent to a cell,
wherein the composition comprises at least one rabies virus
glycoprotein (RVG) peptide comprising SEQ ID NO:13 or a variant,
fragment or derivative thereof, and at least one carrier particle
attached thereto, wherein the effector agent is associated with the
carrier particle.
[0017] In some embodiments, carrier particle comprises a cell
permeable agent, for example a cell permeable peptide. In some
embodiments, the cell permeable peptide is a polymeric arginine
residue of various lengths, such as 11 residues (termed "11dR" or
"11R" herein) or 9 residues (termed "9R" herein), or 7 or 5
residues in length, as disclosed herein.
[0018] In some embodiments the carrier particle comprises a
liposome, polyarginine, protamine, or a cyclodextrin-based
nanoparticle.
[0019] In some embodiments, the effector agent is delivered to a
cell, for example a cell is located inside the blood brain barrier,
for example a central nervous system cell. Examples of central
nervous system cells include, for example but not limited to
neuron, neuronal cell, brain cells, glial, astrocyte or neuronal
supporting cells. In some embodiments, the cell comprises acetyl
choline receptor (AchR) or a homologue or fragment thereof, for
example the cell comprises the a subunit of AchR or a fragment or
homologue thereof. In some embodiments, the cell comprises the
.alpha.1 and/or .alpha.7 subunit of AchR or a fragment or homologue
thereof.
[0020] In some embodiments, the cell is present within a subject,
for example a mammalian subject, for example a human subject. In
alternative embodiments, the cell is ex vivo, and in further
embodiments, the cell is in a biological sample, for example in
vitro.
[0021] In some embodiments, an effector agent is a nucleic acid or
a nucleic acid analogue, for example but not limited to a DNA or
RNA, for example siRNA, mRNA, tRNA, miRNA, strand template RNA
(stRNA), shRNA, or analogues or combinations thereof. In some
embodiments, an effector agent is a nucleic acid analogue, for
example but not limited to antisense nucleic acids, oligonucleic
acids or oligonucleotides, peptide nucleic acid (PNA),
pseudo-complementary PNA (pcPNA), locked nucleic acid (LNA) or
derivatives or analogues thereof. In some embodiments, the effector
is a miRNA mimetic and in alternative embodiments, the effector is
an antigomir, an oligonucleotide for silencing and/or inhibiting
endogenous miRNA.
[0022] In alternative embodiments, the effector agent is a small
molecule, and in alternative embodiments the effector agent is a
protein or peptide, or the effector agent is a peptidomimetic,
aptamer, antibody or protein or variant thereof. In some
embodiments, the effector agent is an avimer, which is a peptide
having multi-target site recognition capability.
[0023] In further embodiments, the effector agent is a therapeutic
agent and/or diagnostic agent and/or an imaging agent.
[0024] In some embodiments, the carrier particle further comprises
an additional targeting agent, wherein the targeting agent is a
blood brain barrier targeting agent. Examples of such blood-barrier
targeting agents include, for example but are not limited to,
insulin, transferrin, insulin like growth factor (IGF), leptin, low
density lipoprotein (LDL) and fragments or peptidomimetics or
derivatives thereof. In some embodiments, additional targeting
agents can be avimers for targeting receptors on the surface cells
of the BBB, for example for targeting receptors for insulin,
transferrin, insulin like growth factor (IGF), leptin, low density
lipoprotein (LDL).
[0025] In some embodiments, the composition comprises an effector
agent associated to a carrier particle, where the carrier particle
is conjugated to a targeting agent (for example an RVG peptide).
The composition is useful to deliver effector agents across the
blood brain barrier in a subject. In some embodiments, the
composition can further comprise a pharmaceutically acceptable
carrier.
[0026] In further embodiments, the composition as disclosed herein
is useful as a medicant for central nervous system disorders.
[0027] In some embodiments, administration of such a composition
can be by any suitable route, for example but not limited to
subcutaneous, intravenous, intracranial, or oral administration. In
further embodiments, administration is, for example but not limited
to, parenteral, intranasal, intracranial or intravenous.
[0028] Another aspect of the present invention relates to a method
for delivering an effector agent to a cell expressing the alpha
subunit of the acetylcholine receptor, the method comprising
contacting the cell with an RVG peptide comprising SEQ ID NO:13 or
a variant, fragment or derivative thereof, wherein the RVG peptide
is attached to a carrier particle, wherein the effector agent is
associated with the carrier particle. In some embodiments, the
cells are in vitro, and in some embodiments the cells are in vivo
or ex vivo.
[0029] Another aspect of the present invention relates to a method
for delivering an agent across the blood-brain barrier of a
subject, the method comprising administering to the subject a
composition comprising a targeting agent, wherein the targeting
agent is attached to a carrier particle, and wherein the agent is
associated with the carrier particle. In some embodiments, the
targeting agent is an RVG peptide of SEQ ID NO:13 or a variant,
fragment or derivative thereof, and in alternative embodiments, the
targeting agent is, for example but not limited to, insulin,
transferrin, insulin like growth factor (IGF), leptin, low density
lipoprotein (LDL) and fragments or peptidomimetics or derivatives
thereof.
[0030] The present invention provides a method for delivery of an
agent to the central nervous system (CNS) of a host. The method
comprises administering to the host an agent, wherein the agent
comprises an RVG peptide comprising SEQ ID NO:13 13 or a variant,
fragment or derivative thereof, wherein the RVG peptide is attached
to a carrier particle and a therapeutic agent is associated with
the carrier particle.
[0031] The invention further provides a targeted delivery
composition comprising an RVG peptide, wherein the RVG peptide is
attached to a carrier particle. The invention still further
provides the targeted delivery composition wherein an effector
agent is a therapeutic agent, which is associated with the carrier
particle.
[0032] In one embodiment, the carrier particle is a lyposomal or
polymeric nanoparticle, for example a liposome, a polyarginine
peptide, a protamine or a cyclodextrin-based nanoparticle.
[0033] In one embodiment, the effector agent or therapeutic agent
is a nucleic acid, e.g., siRNA, shRNA, stRNA, miRNA or DNA or
nucleic acid analogues, antigomers or derivatives thereof. In
another embodiment, the therapeutic agent is a small molecule. In
yet another embodiment, the therapeutic agent is a protein, e.g.,
an enzyme, an antibody, peptidiomimetic, aptamer, avimer and
derivatives thereof.
[0034] In one embodiment, the carrier particle further comprises a
blood brain barrier targeting agent in addition to the RVG
peptide.
[0035] In one embodiment, the agent is further administered with a
pharmaceutically acceptable carrier. In one embodiment, the
administration is parenteral, intranasal, intracranial or
intraocular.
[0036] The invention further provides a method for targeted
delivery of an agent to a cell expressing the alpha subunit of the
acetylcholine receptor. The method comprises administering the
agent to the cell. The agent comprises an RVG peptide comprising
SEQ ID NO: 13 or a fragment, derivative or variant thereof, wherein
the RVG peptide is attached to a carrier particle, wherein a
therapeutic agent is associated with the carrier particle. In one
embodiment, the cell is in vitro.
BRIEF DESCRIPTION OF THE DRAWINGS
[0037] FIG. 1 shows the pLL3.7 lentiviral vector.
[0038] FIG. 2 shows efficient transduction and intracellular
processing of shRNA. BHK 21 cells were transduced with lentiviruses
and analyzed by flow cytometry for GFP expression (left) and tested
for endogenous FvE.sup.J specific siRNA production by Northern
blotting (right).
[0039] FIG. 3 shows FvE.sup.J shRNA inhibits JEV replication.
Transduced BHK 21 cells were infected with Japanese Encephalitis
virus (JEV) and viral replication analyzed by flow cytometry 2 days
later using a JEV-specific antibody.
[0040] FIG. 4 shows degradation of viral RNA by FvE.sup.J shRNA.
RNA from transduced and infected cells was probed with a JEV cDNA
probe.
[0041] FIG. 5 shows FvE.sup.J shRNA protects against JEV. Mock,
control Luc or FvE.sup.J shRNA injected mice were challenged with
JEV and observed for mortality.
[0042] FIG. 6 shows absence of brain pathology in FvE.sup.J
shRNA-treated mice. Mice injected with Luc shRNA (left) or
FvE.sup.J shRNA (right) were infected with JEV for 5 days and the
brain sections examined for histopathology. Shown are low
magnification (.times.20) (top panels) and high magnification
(.times.400) (bottom panels).
[0043] FIGS. 7A-7B show the absence of virus in FvE.sup.J
shRNA-treated mice. Mice were treated as in FIG. 5. Panel 7A shows
FACs analysis of brain cells administered with Luc-siRNA or
FvE-siRNA. Panel 7B shows brain homogenates from animals
administered with Luc-siRNA, or FvE-siRNA and titered for viral
titre of JEV.
[0044] FIGS. 8A-8B show siFvE.sup.J siRNA can protect against JE in
vitro as well as in vivo. FIG. 8A shows neuro 2A cells transfected
with siLuc (grey filled) or with siFvE.sup.J siRNA in lipofectamine
(broken line) or complexed with JetSI/dope (solid line) were
infected with JEV for 2 days before staining. FIG. 8B shows mice
(5/group) were infected with JEV and treated with control or
siFvE.sup.J siRNA after 30 min or 6 h after infection.
[0045] FIGS. 9A-9B show siFvE.sup.JW siRNA protects against both
Japanese Encephalitis virus (JEV) and West Nile Virus (WNV) in
vitro and in vivo. FIG. 9A shows neuro 2A cells treated with siLuc
or siFvE.sup.JW siRNA complexed with JetSI/dope were infected with
JEV or WNV for 2 days before staining. FIG. 9B shows mice
(10/group) were infected with JEV (left) or WNV (right) and treated
with control siLuc or siFvE.sup.JW siRNA after 30 min or 6 h after
infection and followed for survival over time.
[0046] FIG. 10 shows RVG pseudotyping allows neuronal cell specific
targeting. HeLa or BHK-21 or Neuro 2a cells were infected with
PLL3.7 lentiviruses pseudotyped with either VSV-G or RVG and
examined for GFP fluorescence 2 days later.
[0047] FIG. 11 shows RVG pseudotyping enhances shRNA effectiveness.
Mice were injected with indicated doses of lentiviruses psuedotyped
with either VSV-G or RVG, challenged with JEV and observed for
mortality.
[0048] FIG. 12 shoes RVG peptide specifically binds neuronal cells.
Neuro 2a and HeLa cells were sequentially incubated with RVG-Bio or
Scrambled RVG-Bio and SAPE and examined by flow cytometry.
[0049] FIG. 13 shows .alpha.-bungarotoxin inhibits RVG peptide
binding. RVG peptide binding. Neuro 2a cells were stained with
RVG-Bio peptide in the presence or absence of a-bungarotoxin then
tested for RVG peptide (10-7 M) binding.
[0050] FIG. 14 shows RVG peptide binds mouse brain cells. Freshly
isolated brain and spleen cells were stained with RVG-Bio and
SAPE.
[0051] FIG. 15 shows intravenously injected RVG peptide binds brain
cells. Mice were given a control peptide or RVG-Bio intravenously
and 2 h later, brain cells stained with SAPE.
[0052] FIG. 16 shows RVG-TAT peptide can deliver DNA vector to
neuronal cells. Neuro 2a or BHK-21 cells were transduced with
pLL3.7 DNA bound to RVG-TAT and examined for GFP expression 2 days
later.
[0053] FIG. 17 shows RVG-11dR peptide delivers both DNA and siRNA.
Neuro 2a cells were transduced with pLL3.7 DNA vector (left) or
FITC labeled siRNA (right) bound to RVG-11dR and examined for GFP
or FITC fluorescence 2 days later.
[0054] FIG. 18 shows RVG-11dR delivered siRNA is functional. Neuro
2a cells were first transfected with GFP DNA and then treated with
GFP siRNA alone or bound to RVG-11dR and examined 2 days later.
[0055] FIG. 19 shows immunoliposomes for targeted delivery of
siRNA. Activated CD4 T cells were incubated with CD4
siRNA-encapsulated hyaluran liposomes coated with LFA-1 (AL-57) or
an isotype control (IgG1) antibody and examined for CD4 expression
2 days later.
[0056] FIGS. 20A-20B show RVG binds specifically to the neuronal
cell line, Neuro 2a and the binding is inhibited by
.alpha.-bungarotoxin. FIG. 20A shows HeLa and Neuro 2a cells
incubated with biotinylated RVG peptide and examined for peptide
binding by staining with streptavidin-PE (SAPE). Control peptide
did not bind to either cell type while RVG binding was detected
exclusively on Neuro 2a cells. FIG. 20B shows RVG binding to Neuro
2a cells was measured in the presence of indicated concentrations
of .alpha.-bungarotoxin. RVG peptide was used at 2 .mu.M.
[0057] FIG. 21 shows RVG can be detected in the mouse brain after
intravenous injection. Mice were injected i.v. with 100 .mu.g of
biotinylated RVG or the control peptide and 2 h later, single cell
suspensions of brain examined by flow cytometry after internal
staining with SAPE.
[0058] FIGS. 22A-22B show CORVUS (a chimeric peptide comprising an
RVG peptide fused to a cell penetrating peptide) binds and delivers
siRNA into neuronal cells. FIG. 22A shows 100 pmole of siRNA was
complexed with CORVUS or control peptide at the indicated molar
ratios and binding of siRNA was assessed by gel mobility
retardation on 2% agarose gels. FIG. 23B shows peptides incubated
with 100 pmoles FITC-labeled siRNA at the indicated concentrations
for 10 min and then added to Neuro 2a cells in culture. siRNA
uptake was assessed 16 h later. Control peptide was used at 25
.mu.M. A 10:1 molar ratio of peptide to siRNA was deemed
optimal.
[0059] FIGS. 23A-23B show CORVUS delivered siRNA is functional.
Peptides were mixed with 200 pmole of anti-GFP siRNA at a 10:1
molar ratio and added to Neuro 2a cells stably expressing GFP. FIG.
23A shows GFP expression levels were monitored 60 h later. FIG. 23B
shows CORVUS was found to be as efficient as Lipofectamine 2000.TM.
in silencing GFP expression.
[0060] FIGS. 24A-24E show CORVUS (RVG-9R) can deliver siRNA to
brain cells after i.v. injection in mice. Mice were injected twice,
6 h apart, intravenously in the tail vein with 50 .mu.g of
FITC-labeled siRNA complexed to peptides at a 10:1 molar ratio.
FIG. 24A-E shows organs were harvested 16 h after the last
injection and single cell suspensions analyzed for the presence of
siRNA FITC. FIG. 24A shows control brain samples, Fog 24B shows
liver with CORVUS or control peptide, FIG. 24C shows brain from
CORVUS and control treated samples, and FIG. 24D shows spleen with
CORVUS or control peptide. FIG. 24E shows siRNA was detected
specifically in the brain tissue of mice treated with CORVUS.
Control peptide did not induce any uptake of siRNA.
[0061] FIGS. 25A-25B show transvascular delivery of GFP siRNA
complexed to CORVUS specifically knocks down GFP expression in
GFP-Tg mice. Mice transgenic for GFP were intravenously
administered 50 .mu.g anti-GFP siRNA complexed to either CORVUS or
control peptides 3 times at 16 h intervals. FIG. 25A shows organs
harvested 60 h after the last treatment and single cell suspensions
analyzed for GFP expression levels. FIG. 25B shows filled
histograms represent FACS plots with wild-type mice.
[0062] FIGS. 26A-26E show a short RVG peptide binds to neuronal
cells in vitro and in vivo. FIG. 26A shows Neuro 2a and HeLa cells
(inset) were incubated with biotinylated RVG or RV-MAT peptides,
stained with SAPE and examined by flow cytometry. FIG. 26B shows
Peptide binding was also tested using indicated cell lines. RVMAT
did not bind any of the cell lines (not shown). FIG. 26C shows
Neuro 2a cells were stained with biotinylated RVG in the absence
(red histogram) or presence of decreasing concentrations of BTX
(grey histograms). FIG. 26D shows freshly isolated mouse brain and
spleen cells were tested for peptide binding. FIG. 26E shows mice
were injected iv with biotinylated RVG or RV-MAT peptide and 4 h
later, isolated brain cells stained with SAPE.
[0063] FIGS. 27A-27D show an RVG-9R peptide binds and delivers
siRNA to neuronal cells in vitro resulting in gene silencing. FIG.
27A shows mobility of free or peptide-complexed siRNA was analyzed
by agarose gel electrophoresis. FIG. 27B shows Neuro 2a cells were
examined for uptake of FITC-siRNA complexed with RVG-9R at the
indicated concentrations. FIG. 27C shows Neuro 2a and HeLa (inset)
cells were examined for uptake of FITC-siRNA complexed with RVG-9R
or RV-MAT-9R peptides at 1:10 molar ratio. Lipofectamine
transfection was used as positive control. FIG. 27D shows Neuro 2a
cells stably expressing GFP were transduced with GFP siRNA
complexed to RVG-9R or RV-MAT-9R peptides and GFP silencing tested
2 days later. A representative histogram and cumulative data from 3
independent experiments (inset) are shown.
[0064] FIGS. 28A-28B show RVG-9R enables transvascular delivery of
siRNA to the CNS. FIG. 28A shows mice were injected iv with
FITC-siRNA/peptide complexes and uptake by brain, spleen and liver
cells examined by flow cytometry. Representative histograms (top)
and cumulative data (bottom) are shown. FIG. 28B shows coronal
sections of brain from FITC-siRNA/RVG-9R injected mice (n=6) were
stained with anti-FITC antibody and examined by fluorescent
microscopy. Images of FITC-positive cells in the cortex, striatum
and thalamus at lower (left panel) and higher magnification of
boxed regions (middle panel) are shown. Right panel shows images
from control Ig stained brain sections at the higher magnification.
Scale bar=200 .mu.m.
[0065] FIGS. 29A-29D show brain-specific gene silencing by iv
injection of RVG-9R/siRNA complex. FIG. 29A shows GFP Tg mice were
iv injected with GFP siRNA/peptide complexes and their brain,
spleen and liver cells analyzed for GFP expression. Representative
histograms (top) and cumulative data (bottom) are shown. Dotted
lines in the histograms represent cells from wild type mice. FIG.
29B shows Balb/c mice iv injected with SOD1 siRNA/peptide complexes
and their brain, spleen and livers examined for SOD1 mRNA (top) and
protein levels (bottom). The numbers below the western blot
represent the ratios of band intensities of SOD-1 normalized to
that of .beta.-actin. FIG. 29C shows small RNAs isolated from
different organs of RVG-9R/SOD1 siRNA injected mice were probed
with siRNA sense strand oligo. Antisense strand oligo was used as
positive control (first and last lanes). FIG. 29D shows mice iv
injected with SOD siRNA bound to RVG-9R and the duration of gene
silencing determined by quantitation of SOD1 mRNA levels (top) and
SOD1 protein enzyme activity (bottom) on indicated days after siRNA
administration.
[0066] FIGS. 30A-30C show iv treatment with antiviral siRNA/RVG-9R
complex protects mice against JEV encephalitis. FIG. 30A shows
JEV-infected mice were treated iv with siLuc or siFvEJ complexed to
either RVG-9R or RVMAT-9R daily for 4 days and monitored for
survival. FIG. 30B shows RNA isolated from the brains of
RVG-9R/siFvEJ treated mice were examined for the presence of siRNA
antisense strand by Northern blotting. Antisense strand of siFvEJ
served as positive control. FIG. 30C shows Balb/c mice were
injected iv with siFvEJ bound to RVG-9R peptide and 7 h later,
their serum samples tested for IFN levels by ELISA. The
immunostimulatory .beta.gal 728 siRNA complexed with RVG-9R or
lipofectamine was used as positive control.
[0067] FIG. 31 shows RVG-9R binding confers partial protection from
serum nucleases. Naked and RVG-9R-complexed siRNA were incubated
with sera at 37.degree. C. and aliquots taken at indicated times
digested with proteinase K, electrophoresed on 15% polyacrylamide
gels and visualized with SYBR gold staining. The position of intact
siRNA is indicated.
[0068] FIGS. 32A-32B show an RVG-9R siRNA complex does not induce
antibodies or inflammatory cytokines. FIG. 32A shows mice injected
with siRNA complexed to RVG-9R or for positive control, with the
immunogenic TNP-KLH-biotin peptide on days 0, 3, 10 and 22 and
serum samples collected on days 21 and 30 tested for the presence
of antibodies to RVG or biotin by ELISA. FIG. 32B shows sera
obtained 1 day after the 4.sub.th RVG-9R/siRNA injection were
tested for the indicated panel of secreted cytokines and chemokines
in an ELISA assay. Sera from LPS injected mice served as positive
control. Asterisks indicate statistically significant
differences.
DETAILED DESCRIPTION OF THE INVENTION
[0069] Unless otherwise defined herein, scientific and technical
terms used in connection with the present application shall have
the meanings that are commonly understood by those of ordinary
skill in the art. Further, unless otherwise required by context,
singular terms shall include pluralities and plural terms shall
include the singular.
[0070] It should be understood that this invention is not limited
to the particular methodology, protocols, and reagents, etc.,
described herein and as such can vary. The terminology used herein
is for the purpose of describing particular embodiments only, and
is not intended to limit the scope of the present invention, which
is defined solely by the claims.
[0071] Other than in the operating examples, or where otherwise
indicated, all numbers expressing quantities of ingredients or
reaction conditions used herein should be understood as modified in
all instances by the term "about." The term "about" when used in
connection with percentages can mean .+-.1%.
[0072] A major bottleneck in harnessing the potential of RNAi for
clinical use is the lack of suitable delivery methods. Delivery is
particularly difficult in the CNS and the methods used for systemic
delivery such as intravenous hydrodynamic injection [42, 43] and
intravenous (IV or iv) injection of siRNA or shRNA vectors
complexed with lipofectamine or polyethyleneimine [44] are unlikely
to work for delivery to the CNS because of the presence of BBB.
Thus, the only available method for CNS delivery at present is
local sterotaxic injection of nonreplicating viral vectors and
siRNA [61]. One problem with these approaches is the extremely
limited spread, confining delivery to a small area at the site of
injection. Thus, delivery methods to ensure a more extensive spread
of the delivered si/shRNAs for its efficacy in situations like
tumors and intracranial infections are needed. The inventors have
discovered a peptide derived from Rabies virus glycoprotein (RVG)
can specifically target neuronal cells. This peptide has previously
been shown to competitively inhibit .alpha.-bungarotoxin binding to
the nicotinic acetylcholine receptor .alpha.7 subunit [94, 95,
102]. Acetylcholine receptor .alpha.7 subunit is widely expressed
by many cell types in the brain including the neurons, astrocytes
and glia cells and it is also expressed by the brain capillary
endothelial cells [98].
[0073] Accordingly, in one embodiment the present invention
provides methods to deliver agents to the brain or spinal cord,
wherein at least one agent is associated to RVG peptide as
disclosed herein. In some embodiments, the RVG peptide is
associated with a carrier particle, for example a lyposomal or
polymeric nanoparticles, such as a liposome, and the agent is
associated with the carrier particle. In some embodiments, the
carrier particle is a cell permeable agent. In further embodiments,
the cell permeable agent is a cell permeable peptide, for example
polymeric arginine residues of various lengths such as 11dR or 9R
as disclosed herein, or TAT. In further embodiments the RVG peptide
is conjugated to other targeting agents, or the carrier particle is
conjugated to additional targeting genes.
[0074] The inventors have discovered that the RVG peptide results
in extensive spread of agents in the central nervous system, thus
results in delivery of an agent to sites distal to the site of
administration, for example distal to the site of intracranial or
intraparemchal injection. Moreover, in one embodiment, the RVG
peptide facilitates the crossing of an agent across the BBB. In
some embodiments, the RVG peptide is conjugated, for example fused
to a cell penetrating peptide (such as for example but not limited
to, HIV-TAT, or polymeric arginine residues of various lengths such
as 9R or 11dR as disclosed herein) or combined with a brain
endothelial cell transporter (such as transferrin or transferrin
receptor antibody), and thus, facilitates brain delivery by a
noninvasive intravenous approach. In some embodiments, the effector
agents are therapeutic agents.
[0075] Therapeutic agents for which are, for example nucleic acids
such as siRNA, miRNA and shRNAs effector agents can be expressed
via vectors offer the advantage of long term expression which can
be desirable in some situations like in the treatment of
neurological disorders, neurodegenerative diseases and cancer.
Synthetic siRNAs offer a drug-like approach for transient gene
silencing. Moreover, in the non-dividing cells of the CNS, the
effect is prolonged, e.g., 3 weeks. Alternatively, the RVG delivery
method can be used in conjunction with therapeutic agents that are
not RNAi agents, such as but not limited to small molecules,
peptides, antibodies, avimers, nucleic acid analogues, antigomers,
miRNA mimetics or any other agent that is compatible with delivery
by means of the carrier particles associated with an RVG peptide as
disclosed herein.
[0076] As disclosed herein, the present invention is based, in
part, on the discovery that peptides derived from the rabies virus
glycoprotein are useful as targeting moieties to deliver agents to
cells expressing the a subunit of the acetylcholine receptor or a
homologue thereof and for example neuronal cells. In some
embodiments, the neuronal cells are in a subject (i.e. in vivo),
and in some embodiments the neuronal cells are ex vivo or are
cultured neuronal cells, for example in vitro such as primary
neuronal cultured cells. In some embodiments, the neuronal cells
are neuronal precursor or neuronal progenitor cells, such as
neuronal progenitor stem cells that express the a subunit of the
acetylcholine receptor or a homologue thereof.
[0077] Accordingly, the present invention is also directed to a
method and a composition for delivering therapeutic compositions to
target cells. In particular, the invention is directed to a method
and a composition for targeted delivery to target cells protected
by the blood brain barrier (BBB). The method utilizes a composition
comprising a peptide derived from the Rabies virus glycoprotein
(RVG) that is capable of specifically binding to target cells, but
not other cell types. The composition further comprises a carrier
particle attached to an RVG peptide as disclosed herein. The
carrier particle can be further associated with an effector agent,
or a therapeutic composition. Thus, the invention is directed to
targeted delivery to target cells by means of an RVG peptide.
Targeting Agents and Rabies Virus Glycoprotein (RVG) Peptide
[0078] The glycoprotein from the neurotropic Rabies virus shows a
significant homology with the snake venom alpha neurotoxin that
binds to the nicotinic acetylcholine receptor [91]. In fact,
further studies showed that the acetylcholine receptor is also a
Rabies virus receptor [92, 93]. Interestingly, an RVG peptide was
also found to competitively inhibit .alpha.-bungarotoxin binding to
the acetylcholine receptor [94, 95]. However, there has been no
indication that the 29 mer RVG peptide (RVG) as disclosed herein
facilitates targeted delivery to such cells expressing the
acetylcholine receptor or that such a peptide can facilitate
passage through the blood brain barrier.
[0079] Accordingly, in one embodiment the present invention
provides a targeting agent to selectively targets cells expressing
the a subunit of the acetylcholine receptor, thereby facilitating
specific delivery to such target cells. In one embodiment of the
present invention, a targeting agent comprises amino acid residues
173-202 of the RVG: YTIWMPENPRPGTPCDIFTNSRGKRASNG (SEQ ID NO: 13)
or a variant or a derivative or fragment thereof. In further
embodiments, the targeting agent is a fragment of SEQ ID NO:13.
Such a fragment of SEQ ID NO:13 can be, for example, 1, 2, 3, 4, 5,
6, 7, 8, 9 or 10 amino acids deleted from the N-terminal and/or
C-terminal of SEQ ID NO:13. Persons of ordinary skill in the art
can easily identify the minimal peptide fragment of SEQ ID NO:13 by
sequentially deleting N- and/or C-terminal amino acids from SEQ ID
NO:13 and assessing the function of the resulting peptide fragment,
such as function of the peptide fragment to bind acetylcholine
receptor and/or ability to transmit through the blood brain barrier
as disclosed herein. In some embodiments, a fragment of SEQ ID
NO:13 is any 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16 or
15 peptides of SEQ ID NO:13. In some embodiments, a fragment of SEQ
ID NO:13 is less than 15 peptides in length.
[0080] The term "derivative" as used herein refers to peptides
which have been chemically modified, for example but not limited to
by techniques such as ubiquitination, labeling, pegylation
(derivatization with polyethylene glycol) or addition of other
molecules.
[0081] As used herein, "variant" with reference to a polynucleotide
or polypeptide, refers to a polynucleotide or polypeptide that can
vary in primary, secondary, or tertiary structure, as compared to a
reference polynucleotide or polypeptide, respectively (e.g., as
compared to a wild-type polynucleotide or polypeptide). A "variant"
of a RGV peptide, for example SEQ ID NO:13 is meant to refer to a
molecule substantially similar in structure and function, i.e.
where the function is the ability to pass or transit through the
BBB, to either the entire molecule, or to a fragment thereof. A
molecule is said to be "substantially similar" to another molecule
if both molecules have substantially similar structures or if both
molecules possess a similar biological activity. Thus, provided
that two molecules possess a similar activity, they are considered
variants as that term is used herein even if the structure of one
of the molecules not found in the other, or if the sequence of
amino acid residues is not identical.
[0082] For example, a variant of an RVG peptide can contain a
mutation or modification that differs from a reference amino acid
in SEQ ID NO:13. In some embodiments, a variant of SEQ ID NO:13 is
a fragment of SEQ ID NO:13 as disclosed herein. In some
embodiments, a variant can be a different isoform of SEQ ID NO:13
or can comprise different isomer amino acids. Variants can be
naturally-occurring, synthetic, recombinant, or chemically modified
polynucleotides or polypeptides isolated or generated using methods
well known in the art. Variants can include conservative or
non-conservative amino acid changes, as described below.
Polynucleotide changes can result in amino acid substitutions,
additions, deletions, fusions and truncations in the polypeptide
encoded by the reference sequence. Variants can also include
insertions, deletions or substitutions of amino acids, including
insertions and substitutions of amino acids and other molecules)
that do not normally occur in the peptide sequence that is the
basis of the variant, for example but not limited to insertion of
ornithine which do not normally occur in human proteins. The term
"conservative substitution," when describing a polypeptide, refers
to a change in the amino acid composition of the polypeptide that
does not substantially alter the polypeptide's activity. For
example, a conservative substitution refers to substituting an
amino acid residue for a different amino acid residue that has
similar chemical properties. Conservative amino acid substitutions
include replacement of a leucine with an isoleucine or valine, an
aspartate with a glutamate, or a threonine with a serine.
"Conservative amino acid substitutions" result from replacing one
amino acid with another having similar structural and/or chemical
properties, such as the replacement of a leucine with an isoleucine
or valine, an aspartate with a glutamate, or a threonine with a
serine. Thus, a "conservative substitution" of a particular amino
acid sequence refers to substitution of those amino acids that are
not critical for polypeptide activity or substitution of amino
acids with other amino acids having similar properties (e.g.,
acidic, basic, positively or negatively charged, polar or
non-polar, etc.) such that the substitution of even critical amino
acids does not reduce the activity of the peptide, (i.e. the
ability of the peptide to penetrate the BBB). Conservative
substitution tables providing functionally similar amino acids are
well known in the art. For example, the following six groups each
contain amino acids that are conservative substitutions for one
another: 1) Alanine (A), Serine (S), Threonine (T); 2) Aspartic
acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4)
Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L),
Methionine (M), Valine (V); and 6) Phenylalanine (F), Tyrosine (Y),
Tryptophan (W). (See also Creighton, Proteins, W. H. Freeman and
Company (1984).) In some embodiments, individual substitutions,
deletions or additions that alter, add or delete a single amino
acid or a small percentage of amino acids can also be considered
"conservative substitutions" is the change does not reduce the
activity of the peptide (i.e. the ability of an RVG peptide variant
to penetrate the BBB). Insertions or deletions are typically in the
range of about 1 to 5 amino acids. The choice of conservative amino
acids may be selected based on the location of the amino acid to be
substituted in the peptide, for example if the amino acid is on the
exterior of the peptide and expose to solvents, or on the interior
and not exposed to solvents.
[0083] In alternative embodiments, one can select the amino acid
which will substitute an existing amino acid based on the location
of the existing amino acid, i.e. its exposure to solvents (i.e. if
the amino acid is exposed to solvents or is present on the outer
surface of the peptide or polypeptide as compared to internally
localized amino acids not exposed to solvents). Selection of such
conservative amino acid substitutions are well known in the art,
for example as disclosed in Dordo et al, J. Mol Biol, 1999, 217,
721-739 and Taylor et al, J. Theor. Biol. 119(1986);205-218 and S.
French and B. Robson, J. Mol. Evol. 19(1983)171. Accordingly, one
can select conservative amino acid substitutions suitable for amino
acids on the exterior of a protein or peptide (i.e. amino acids
exposed to a solvent), for example, but not limited to, the
following substitutions can be used: substitution of Y with F, T
with S or K, P with A, E with D or Q, N with D or G, R with K, G
with N or A, T with S or K, D with N or E, I with L or V, F with Y,
S with T or A, R with K, G with N or A, K with R, A with S, K or
P.
[0084] In alternative embodiments, one can also select conservative
amino acid substitutions encompassed suitable for amino acids on
the interior of a protein or peptide, for example one can use
suitable conservative substitutions for amino acids is on the
interior of a protein or peptide (i.e. the amino acids are not
exposed to a solvent), for example but not limited to, one can use
the following conservative substitutions: where Y is substituted
with F, T with A or S, I with L or V, W with Y, M with L, N with D,
G with A, T with A or S, D with N, I with L or V, F with Y or L, S
with A or T and A with S, G, T or V. In some embodiments,
non-conservative amino acid substitutions are also encompassed
within the term of variants. A variant of a RGV peptide, for
example a variant of SEQ ID NO:13 is meant to refer to any molecule
substantially similar in structure and function to either the
entire molecule of SEQ ID NO:13, or to a fragment thereof. A
molecule is said to be "substantially similar" to another molecule
if both molecules have substantially similar structures or if both
molecules possess a similar biological activity, for example if
both molecules are able to penetrate the BBB. Thus, provided that
two molecules possess a similar activity, (i.e. a variant of an RVG
peptide which can penetrate the BBB similar to that of the RVG
peptide corresponding to SEQ ID NO:13) are considered variants and
are encompassed for use as disclosed herein, even if the structure
of one of the molecules not found in the other, or if the sequence
of amino acid residues is not identical.
[0085] As used herein, the term "nonconservative" refers to
substituting an amino acid residue for a different amino acid
residue that has different chemical properties. The nonconservative
substitutions include, but are not limited to aspartic acid (D)
being replaced with glycine (G); asparagine (N) being replaced with
lysine (K); or alanine (A) being replaced with arginine (R).
[0086] The term "insertions" or "deletions" are typically in the
range of about 1 to 5 amino acids. The variation allowed can be
experimentally determined by producing the peptide synthetically
while systematically making insertions, deletions, or substitutions
of nucleotides in the sequence using recombinant DNA
techniques.
[0087] The term "functional derivative" and "mimetic" are used
interchangeably, and refers to a compound which possess a
biological activity (either functional or structural) that is
substantially similar to a biological activity of the entity or
molecule its is a functional derivative of. The term functional
derivative is intended to include the fragments, variants,
analogues or chemical derivatives of a molecule.
[0088] The term "fragment" of a peptide or molecule as used herein
refers to any contiguous polypeptide subset of the molecule.
Fragments of an RGV peptide, for example fragments of SEQ ID NO:13
useful in the methods as disclosed herein have the same activity as
that of SEQ ID NO:13. Stated another way, a fragment of an RVG
peptide is a fragment of SEQ ID NO:13 which can penetrate the BBB
and/or bind .alpha. acetylcholine receptor as the RVG peptide
corresponding to SEQ ID NO:13. Fragments as used herein typically
are soluble (i.e. not membrane bound). Examples of fragments of SEQ
ID NO:13 include but are not limited to any 28, 27, 26, 25, 24, 23,
22, 21, 20, 19, 18, 17, 16 or 15 peptides of SEQ ID NO:13. In some
embodiments, a fragment of SEQ ID NO:13 is less than 15 peptides in
length.
[0089] As used herein, "homologous", when used to describe a
polynucleotide, indicates that two polynucleotides, or designated
sequences thereof, when optimally aligned and compared, are
identical, with appropriate nucleotide insertions or deletions, in
at least 70% of the nucleotides, usually from about 75% to 99%, and
more preferably at least about 98 to 99% of the nucleotides. The
term "homolog" or "homologous" as used herein also refers to
homology with respect to structure and/or function. With respect to
sequence homology, sequences are homologs if they are at least 50%,
at least 60 at least 70%, at least 80%, at least 90%, at least 95%
identical, at least 97% identical, or at least 99% identical. The
term "substantially homologous" refers to sequences that are at
least 90%, at least 95% identical, at least 97% identical or at
least 99% identical. Homologous sequences can be the same
functional gene in different species.
[0090] As used herein, the term "substantial similarity" in the
context of polypeptide sequences, indicates that the polypeptide
comprises a sequence with at least 60% sequence identity to a
reference sequence, or 70%, or 80%, or 85% sequence identity to the
reference sequence, or most preferably 90% identity over a
comparison window of about 10-20 amino acid residues. In the
context of amino acid sequences, "substantial similarity" further
includes conservative substitutions of amino acids. Thus, a
polypeptide is substantially similar to a second polypeptide, for
example, where the two peptides differ by one or more conservative
substitutions.
[0091] The term "substantial identity" means that two peptide
sequences, when optimally aligned, such as by the programs GAP or
BESTFIT using default gap weights, share at least 65 percent
sequence identity, preferably at least 80 or 90 percent sequence
identity, more preferably at least 95 percent sequence identity or
more (e.g., 99 percent sequence identity or higher). Preferably,
residue positions which are not identical differ by conservative
amino acid substitutions.
[0092] An "analog" of a molecule such as RGV peptide, for example
SEQ ID NO:13 refers to a molecule similar in function to either the
entire molecule or to a fragment thereof. The term "analog" is also
intended to include allelic, species and induced variants. Analogs
typically differ from naturally occurring peptides at one or a few
positions, often by virtue of conservative substitutions. Analogs
typically exhibit at least 80 or 90% sequence identity with natural
peptides. Some analogs also include unnatural amino acids or
modifications of N or C terminal amino acids. Examples of unnatural
amino acids are, for example but not limited to; acedisubstituted
amino acids, N-alkyl amino acids, lactic acid, 4-hydroxyproline,
.gamma.-carboxyglutamate, .epsilon.-N,N,N-trimethyllysine,
.epsilon.-N-acetyllysine, O-phosphoserine, N-acetylserine,
N-formylmethionine, 3-methylhistidine, 5-hydroxylysine,
.sigma.-N-methylarginine. Fragments and analogs can be screened for
prophylactic or therapeutic efficacy in transgenic animal models as
described below.
[0093] As used herein, a molecule is said to be a "chemical
derivative" of another molecule when it contains additional
chemical moieties not normally a part of the molecule. Such
moieties can improve the molecule's solubility, absorption,
biological half life, etc. The moieties can alternatively decrease
the toxicity of the molecule, eliminate or attenuate any
undesirable side effect of the molecule, etc. Moieties capable of
mediating such effects are disclosed in Remington's Pharmaceutical
Sciences, 18th edition, A. R. Gennaro, Ed., MackPubl., Easton, Pa.
(1990).
[0094] The term "substitution" when referring to a peptide, refers
to a change in an amino acid for a different entity, for example
another amino acid or amino-acid moiety. Substitutions can be
conservative or non-conservative substitutions.
[0095] As used herein, the term "sequence identity" means that two
polynucleotide or amino acid sequences are identical (i.e., on a
nucleotide-by-nucleotide or residue-by-residue basis) over the
comparison window. The term "percentage of sequence identity" is
calculated by comparing two optimally aligned sequences over the
window of comparison, determining the number of positions at which
the identical nucleic acid base (e.g., A, T. C, G. U. or 1) or
residue occurs in both sequences to yield the number of matched
positions, dividing the number of matched positions by the total
number of positions in the comparison window (i.e., the window
size), and multiplying the result by 100 to yield the percentage of
sequence identity.
[0096] The terms "substantial identity" as used herein denotes a
characteristic of a polynucleotide or amino acid sequence, wherein
the polynucleotide or amino acid comprises a sequence that has at
least 85 percent sequence identity, preferably at least 90 to 95
percent sequence identity, more usually at least 99 percent
sequence identity as compared to a reference sequence over a
comparison window of at least 18 nucleotide (6 amino acid)
positions, frequently over a window of at least 24-48 nucleotide
(8-16 amino acid) positions, wherein the; percentage of sequence
identity is calculated by comparing the reference sequence to the
sequence which can include deletions or additions which total 20
percent or less of the reference sequence over the comparison
window. The reference sequence can be a subset of a larger
sequence. The term "similarity", when used to describe a
polypeptide, is determined by comparing the amino acid sequence and
the conserved amino acid substitutes of one polypeptide to the
sequence of a second polypeptide. The term "homologous", when used
to describe a polynucleotide, indicates that two polynucleotides,
or designated sequences thereof, when optimally aligned and
compared, are identical, with appropriate nucleotide insertions or
deletions, in at least 70% of the nucleotides, usually from about
75% to 99%, and more preferably at least about 98 to 99% of the
nucleotides.
[0097] Determination of homologs of the genes or peptides of the
present invention can be easily ascertained by the skilled artisan.
The terms "homology" or "identity" or "similarity" are used
interchangeably herein and refers to sequence similarity between
two peptides or between two nucleic acid molecules. Homology and
identity can each be determined by comparing a position in each
sequence which can be aligned for purposes of comparison. When an
equivalent position in the compared sequences is occupied by the
same base or amino acid, then the molecules are identical at that
position; when the equivalent site occupied by the same or a
similar amino acid residue (e.g., similar in steric and/or
electronic nature), then the molecules can be referred to as
homologous (similar) at that position. Expression as a percentage
of homology/similarity or identity refers to a function of the
number of identical or similar amino acids at positions shared by
the compared sequences. A sequence which is "unrelated" or
"non-homologous" shares less than 40% identity, though preferably
less than 25% identity with a sequence of the present
application.
[0098] In one embodiment, the term "RVG peptide homolog" refers to
an amino acid sequence that has 40% homology to the full length
amino acid sequence of the RVG peptide as disclosed herein, for
example the RVG peptide corresponding to SEQ ID NO:13 as disclosed
herein, more preferably at least about 50%, still more preferably,
at least about 60% homology, still more preferably, at least about
70% homology, even more preferably, at least about 75% homology,
yet more preferably, at least about 80% homology, even more
preferably at least about 85% homology, still more preferably, at
least about 90% homology, and more preferably, at least about 95%
homology. As discussed above, the homology is at least about 50% to
100% and all intervals in between (i.e., 55%, 60%, 70%, 75%, 80%,
85%, 90%, 95%, 98%, etc.).
[0099] For sequence comparison, typically one sequence acts as a
reference sequence, to which test sequences are compared. When
using a sequence comparison algorithm, test and reference sequences
are input into a computer, subsequence coordinates are designated,
if necessary, and sequence algorithm program parameters are
designated. The sequence comparison algorithm then calculates the
percent sequence identity for the test sequence(s) relative to the
reference sequence, based on the designated program parameters.
[0100] Optimal alignment of sequences for comparison can be
conducted, for example, by the local homology algorithm of Smith
and Waterman (Adv. Appl. Math. 2:482 (1981), which is incorporated
by reference herein), by the homology alignment algorithm of
Needleman and Wunsch (J. Mol. Biol. 48:443-53 (1970), which is
incorporated by reference herein), by the search for similarity
method of Pearson and Lipman (Proc. Natl. Acad. Sci. USA 85:2444-48
(1988), which is incorporated by reference herein), by computerized
implementations of these algorithms (e.g., GAP, BESTFIT, FASTA, and
TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group, 575 Science Dr., Madison, Wis.), or by visual
inspection. (See generally Ausubel et al. (eds.), Current Protocols
in Molecular Biology, 4th ed., John Wiley and Sons, New York
(1999)).
[0101] One example of a useful algorithm is PILEUP. PILEUP creates
a multiple sequence alignment from a group of related sequences
using progressive, pairwise alignments to show the percent sequence
identity. It also plots a tree or dendogram showing the clustering
relationships used to create the alignment. PILEUP uses a
simplification of the progressive alignment method of Feng and
Doolittle (J. Mol. Evol. 25:351-60 (1987), which is incorporated by
reference herein). The method used is similar to the method
described by Higgins and Sharp (Comput. Appl. Biosci. 5:151-53
(1989), which is incorporated by reference herein). The program can
align up to 300 sequences, each of a maximum length of 5,000
nucleotides or amino acids. The multiple alignment procedure begins
with the pairwise alignment of the two most similar sequences,
producing a cluster of two aligned sequences. This cluster is then
aligned to the next most related sequence or cluster of aligned
sequences. Two clusters of sequences are aligned by a simple
extension of the pairwise alignment of two individual sequences.
The final alignment is achieved by a series of progressive,
pairwise alignments. The program is run by designating specific
sequences and their amino acid or nucleotide coordinates for
regions of sequence comparison and by designating the program
parameters. For example, a reference sequence can be compared to
other test sequences to determine the percent sequence identity
relationship using the following parameters: default gap weight
(3.00), default gap length weight (0.10), and weighted end
gaps.
[0102] Another example of an algorithm that is suitable for
determining percent sequence identity and sequence similarity is
the BLAST algorithm, which is described by Altschul et al. (J. Mol.
Biol. 215:403-410 (1990), which is incorporated by reference
herein). (See also Zhang et al., Nucleic Acid Res. 26:3986-90
(1998); Altschul et al., Nucleic Acid Res. 25:3389-402 (1997),
which are incorporated by reference herein). Software for
performing BLAST analyses is publicly available through the
National Center for Biotechnology Information internet web site.
This algorithm involves first identifying high scoring sequence
pairs (HSPs) by identifying short words of length W in the query
sequence, which either match or satisfy some positive-valued
threshold score T when aligned with a word of the same length in a
database sequence. T is referred to as the neighborhood word score
threshold (Altschul et al. (1990), supra). These initial
neighborhood word hits act as seeds for initiating searches to find
longer HSPs containing them. The word hits are then extended in
both directions along each sequence for as far as the cumulative
alignment score can be increased. Extension of the word hits in
each direction is halted when: the cumulative alignment score falls
off by the quantity X from its maximum achieved value; the
cumulative score goes to zero or below, due to the accumulation of
one or more negative-scoring residue alignments; or the end of
either sequence is reached. The BLAST algorithm parameters W, T,
and X determine the sensitivity and speed of the alignment. The
BLAST program uses as defaults a word length (W) of 11, the
BLOSUM62 scoring matrix (see Henikoff and Henikoff, Proc. Natl.
Acad. Sci. USA 89:10915-9 (1992), which is incorporated by
reference herein) alignments (B) of 50, expectation (E) of 10, M=5,
N=-4, and a comparison of both strands.
[0103] In addition to calculating percent sequence identity, the
BLAST algorithm also performs a statistical analysis of the
similarity between two sequences (see, e.g., Karlin and Altschul,
Proc. Natl. Acad. Sci. USA 90:5873-77 (1993), which is incorporated
by reference herein). One measure of similarity provided by the
BLAST algorithm is the smallest sum probability (P(N)), which
provides an indication of the probability by which a match between
two nucleotide or amino acid sequences would occur by chance. For
example, a nucleic acid is considered similar to a reference
sequence if the smallest sum probability in a comparison of the
test nucleic acid to the reference nucleic acid is less than about
0.1, more typically less than about 0.01, and most typically less
than about 0.001.
[0104] In another embodiment, targeting agents other than the RVG
peptide are encompassed for use in the present invention. Examples
of such targeting agents include, but are not limited to other
molecules capable of delivering attached cargo across the BBB. Such
BBB targeting agents can be any of the known targeting moieties
that undergo receptor mediated transport across the BBB via
endogenous peptide receptor transport systems localized in the
brain capillary endothelial plasma membrane, which forms the BBB in
vivo. In some embodiments, targeting agents useful in the methods
of the present invention are, for example but not limited to
insulin, transferrin, insulin-like growth factor (IGF), leptin, low
density lipoprotein (LDL), and the corresponding peptides, peptide
fragments, peptidomimetics or derivatives thereof, as well as
monoclonal antibodies that mimic these endogenous peptides. In some
embodiment, a targeting agent is a avimer of fragments, for example
but not limited to the binding domains of insulin, transferrin,
insulin-like growth factor (IGF), leptin or low density lipoprotein
(LDL) proteins, thus enabling multi-receptor targeting of receptors
expressed on the surface of cells of the BBB.
[0105] Without being bound by theory, peptidomimetic monoclonal
antibodies are also useful as targeting agents in the methods of
the present invention. Such antibodies bind to exofacial epitopes
on the BBB receptor, removed from the binding site of the
endogenous peptide ligand, and "piggyback" across the BBB via the
endogenous peptide receptor-mediated transcytosis system.
Peptidomimetic monoclonal antibodies are species specific. For
example, the OX26 murine monoclonal antibody to the rat transferrin
receptor is used for drug delivery to the rat brain (Pardridge et
al. 1991. J Pharmacol Exp Ther 256:66-70); however, variants or
derivatives of transferring targeting agents are preferred in
humans (Lee et al. 2000. J Pharmacol. Exp Ther 292: 1048-1052).
Monoclonal antibodies to the human insulin receptor (HIR) are also
useful for delivering the pharmaceutical composition to the human
brain. In some embodiments, "humanized" monoclonal antibodies are
used. Exemplary, humanized monoclonal antibodies to the human
insulin receptor that are particularly well-suited for use in the
present invention are described in detail in U.S. Patent App. No.
2004/0101904, the contents of which application are hereby
specifically incorporated by reference. Other targeting agents
useful in the methods as disclosed herein are, for example the rat
8D3 or rat RI7-217 monoclonal antibody to the mouse transferrin
receptor for drug delivery to mouse brain (Lee et al. 2000. J
Pharmacol Exp Ther 292: 1048-1052), or murine, chimeric or
humanized antibodies to the human or animal transferrin receptor,
the human or animal leptin receptor, the human or animal IGF
receptor, the human or animal LDL receptor, the human or animal
acetylated LDL receptor.
[0106] The term "targeting agent" or "targeting moiety" refers to
an agent that homes in on or selectively targets or preferentially
associates or binds to a particular tissue, cell type, receptor, or
other molecule or particle f interest. In the methods of the
present invention, the targeting agent promotes transport or
preferential localization of an effector agent to the target of
interest, i.e., neuronal cells. One targeting agent of the present
invention comprises an amino acid sequence derived from the rabies
virus glycoprotein (RVG) that is effective in binding to cells
expressing the a subunit of the acetylcholine receptor, including,
for example, brain cells, spinal cord cells, neuronal cells, glia
cells and endothelial cells comprising the BBB.
[0107] As used herein, the term "target cells" is used herein to
refer to cells which sit entirely within BBB-protected CNS tissue.
The term "target cells" as used herein also refers to cells
expressing the a subunit of the acetylcholine receptor. In one
embodiment, the target cells express a type 1 and/or a type 7
acetylcholine receptor. An RVG peptide as disclosed herein binds to
the .alpha.-subunit of the acetylcholine receptor. Accordingly, an
RVG peptide as disclosed herein is useful as a targeting moiety for
the selective targeting of cells expressing the a subunit of the
acetylcholine receptor. Cells expressing the a subunit of the
acetylcholine receptor include, for example, neurons, glial cells
and endothelial cells comprising the blood brain barrier. Target
cells of the present invention also include, cells whose endogenous
milieu is separated by the BBB, for example, cells in the central
nervous system, e.g., brain cells, spinal cord cells, glial cells
and other cells supporting neurons, for e.g. astrocytes or "nursing
cells" and cells of the central nervous system. In some
embodiments, the target cells can be any cell expressing the a
subunit of acetylcholine receptor or a homologue thereof, such as
for example but not limited to neuronal cells in a subject (i.e. in
vivo), neuronal cells ex vivo or cultured neuronal cells (i.e. in
vitro) such as, for example as primary neuronal cultured cells. In
some embodiments, the target cells are neuronal precursor or
neuronal progenitor cells, such as neuronal progenitor stem cells
that express the a subunit of the acetylcholine receptor or a
homologue thereof.
[0108] The term "glial cells" or "glia" (also called neuroglial
cells), which are used interchangeably herein refers to various
types of cells which cannot receive or transmit nerve signals, and
which instead support and serve the neurons located inside the BBB.
These glial cells perform various activities that can be regarded
as supporting, housekeeping, and "nursing" functions within the
CNS. Glial cells are divided into various categories, including
oligodendroglia cells, astrocytes, ependymal cells, and microglia
cells and are commonly known by persons of ordinary skill in the
art.
[0109] The term "selectively target" as used herein refers to the
ability of a targeting agent to home in on or bind to a target cell
with a greater affinity than to non-target cells. For example,
about 10%, about 20%, about 30%, about 40%, preferably about 50%,
more preferably about 60%, more preferably about 70%, still more
preferably about 80%, still more preferably about 90%, still more
preferably about 100% or greater affinity for the target cell
relative to non-target cells.
[0110] The term "amino acid" is used in its broadest sense, and
includes naturally occurring amino acids as well as non-naturally
occurring amino acids, including amino acid analogs and
derivatives. For example, homo-phenylalanine, citrulline, and
norleucine are considered amino acids for the purposes of the
invention. "Amino acids" also includes amino residues such as
proline and hydroxyproline. The side chains can be either the (R)
or (S) configuration. If non-naturally occurring side chains are
used, non-amino acid substituents can be used.
[0111] The term "peptide" as used herein, refers to a compound made
up of a single chain of D- or L-amino acids or a mixture of D- and
L-amino acids joined by peptide bonds. Generally, peptides contain
at least two amino acid residues and are less than about 50 amino
acids in length.
[0112] The terms "peptide" "polypeptide" and "protein" are used
interchangeably to refer to a polymer of amino acid residues, and
are not limited to a minimum length. Thus, peptides, oligopeptides,
dimers, multimers, and the like, whether produced biologically,
recombinantly, or synthetically and whether composed of naturally
occurring or non-naturally occurring amino acids, are included
within this definition. Both full-length proteins and fragments
thereof are encompassed by the definition. The terms also include
co-translational (e.g., signal peptide cleavage) and
post-translational modifications of the polypeptide, such as, for
example, disulfide-bond formation, glycosylation, acetylation,
phosphorylation, proteolytic cleavage (e.g., cleavage by furins or
metalloproteases), and the like. Furthermore, for purposes of the
present invention, a "polypeptide" refers to a protein that
includes modifications, such as deletions, additions, and
substitutions (generally conservative in nature as would be known
to a person in the art), to the native sequence, as long as the
protein maintains the desired activity. These modifications can be
deliberate, as through site-directed mutagenesis, or can be
accidental, such as through mutations of hosts that produce the
proteins, or errors due to PCR amplification or other recombinant
DNA methods.
[0113] The term "recombinant" as used herein to describe a nucleic
acid molecule, means a polynucleotide of genomic, cDNA, viral,
semisynthetic, and/or synthetic origin, which, by virtue of its
origin or manipulation, is not associated with all or a portion of
the polynucleotide with which it is associated in nature. The term
recombinant as used with respect to a protein or polypeptide, means
a polypeptide produced by expression of a recombinant
polynucleotide. The term recombinant as used with respect to a host
cell means a host cell into which a recombinant polynucleotide has
been introduced. Recombinant is also used herein to refer to, with
reference to material (e.g., a cell, a nucleic acid, a protein, or
a vector) that the material has been modified by the introduction
of a heterologous material (e.g., a cell, a nucleic acid, a
protein, or a vector).
[0114] The term "polymer" as used herein, refers to a linear chain
of two or more identical or non-identical subunits joined by
covalent bonds. A peptide is an example of a polymer that can be
composed of identical or non-identical amino acid subunits that are
joined by peptide linkages.
[0115] As used herein, the term "gene" refers to a nucleic acid
comprising an open reading frame encoding a polypeptide, including
both exon and (optionally) intron sequences. A "gene" refers to
coding sequence of a gene product, as well as non-coding regions of
the gene product, including 5'UTR and 3'UTR regions, introns and
the promoter of the gene product. These definitions generally refer
to a single-stranded molecule, but in specific embodiments will
also encompass an additional strand that is partially,
substantially or fully complementary to the single-stranded
molecule. Thus, a nucleic acid can encompass a double-stranded
molecule or a double-stranded molecule that comprises one or more
complementary strand(s) or "complement(s)" of a particular sequence
comprising a molecule. As used herein, a single stranded nucleic
acid can be denoted by the prefix "ss", a double stranded nucleic
acid by the prefix "ds", and a triple stranded nucleic acid by the
prefix "ts." The term "gene" refers to the segment of DNA involved
in producing a polypeptide chain, it includes regions preceding and
following the coding region as well as intervening sequences
(introns) between individual coding segments (exons). A "promoter"
is a region of a nucleic acid sequence at which initiation and rate
of transcription are controlled. It can contain elements at which
regulatory proteins and molecules can bind, such as RNA polymerase
and other transcription factors, to initiate the specific
transcription of a nucleic acid sequence. The term "enhancer"
refers to a cis-acting regulatory sequence involved in the
transcriptional activation of a nucleic acid sequence. An enhancer
can function in either orientation and can be upstream or
downstream of the promoter. As used herein, the term "gene
product(s)" is used to refer to include RNA transcribed from a
gene, or a polypeptide encoded by a gene or translated from
RNA.
[0116] The term "protein" as used herein, refers to a compound that
is composed of linearly arranged amino acids linked by peptide
bonds, but in contrast to peptides, has a well-defined
conformation. Proteins, as opposed to peptides, generally consist
of chains of 50 or more amino acids.
[0117] The incorporation of non-natural amino acids, including
synthetic non-native amino acids, substituted amino acids, or one
or more D-amino acids into the peptides (or other components of the
composition, with exception for protease recognition sequences) is
desirable in certain situations. D-amino acid-containing peptides
exhibit increased stability in vitro or in vivo compared to L-amino
acid-containing forms. Thus, the construction of peptides
incorporating D-amino acids can be particularly useful when greater
in vivo or intracellular stability is desired or required. More
specifically, D-peptides are resistant to endogenous peptidases and
proteases, thereby providing better oral trans-epithelial and
transdermal delivery of linked drugs and conjugates, improved
bioavailability of membrane-permanent complexes (see below for
further discussion), and prolonged intravascular and interstitial
lifetimes when such properties are desirable. The use of D-isomer
peptides can also enhance transdermal and oral trans-epithelial
delivery of linked drugs and other cargo molecules. Additionally,
D-peptides cannot be processed efficiently for major
histocompatibility complex class II-restricted presentation to T
helper cells, and are therefore less likely to induce humoral
immune responses in the whole organism. Peptide conjugates can
therefore be constructed using, for example, D-isomer forms of cell
penetrating peptide sequences, L-isomer forms of cleavage sites,
and D-isomer forms of therapeutic peptides.
[0118] In yet a further embodiment, the peptides are retro-inverso
peptides. A "retro-inverso peptide" refers to a peptide with a
reversal of the direction of the peptide bond on at least one
position, i.e., a reversal of the amino- and carboxy-termini with
respect to the side chain of the amino acid. Thus, a retro-inverso
analogue has reversed termini and reversed direction of peptide
bonds while approximately maintaining the topology of the side
chains as in the native peptide sequence. The retro-inverso peptide
can contain L-amino acids or D-amino acids, or a mixture of L-amino
acids and D-amino acids, up to all of the amino acids being the
D-isomer. Partial retro-inverso peptide analogues are polypeptides
in which only part of the sequence is reversed and replaced with
enantiomeric amino acid residues. Since the retro-inverted portion
of such an analogue has reversed amino and carboxyl termini, the
amino acid residues flanking the retro-inverted portion are
replaced by side-chain-analogous .alpha.-substituted
geminal-diaminomethanes and malonates, respectively. Retro-inverso
forms of cell penetrating peptides have been found to work as
efficiently in translocating across a membrane as the natural
forms. Synthesis of retro-inverso peptide analogues are described
in Bonelli, F. et al., Int J Pept Protein Res. 24(6):553-6 (1984);
Verdini, A and Viscomi, G. C., J. Chem. Soc. Perkin Trans.
1:697-701 (1985); and U.S. Pat. No. 6,261,569, which are
incorporated herein in their entirety by reference. Processes for
the solid-phase synthesis of partial retro-inverso peptide
analogues have been described (EP 97994-B) which is also
incorporated herein in its entirety by reference.
[0119] In one embodiment, the targeted delivery composition
includes polymers, for example peptides such as an RVG peptide and
a peptide carrier particle, comprised of D- or L-amino acid
residues. Use of naturally occurring L-amino acid residues in the
transport polymers has the advantage that break-down products
should be relatively non-toxic to the cell or organism.
[0120] In some embodiments, the peptide carrier particle comprises
arginine amino acid subunits, for example
.alpha.-amino-.beta.-guanidi-novaleric acid and
.alpha.-amino-.epsilon.-amidinohexanoic acid (isosteric amidino
analog). In some embodiments, the guanidinium group in arginine has
a pKa of about 12.5. More generally, in some embodiments each
polymer subunit of a peptide carrier particle contains a highly
basic sidechain moiety which (i) has a pKa of greater than 11, more
preferably 12.5 or greater, and (ii) contains, in its protonated
state, at least two geminal amino groups (NH.sub.2) which share a
resonance-stabilized positive charge, which gives the moiety a
bidentate character. Other amino acids, such as
.alpha.-amino-.beta.-guanidinopropionic acid,
.alpha.-amino-.gamma.-guanidinobutyric acid, or
.alpha.-amino-.epsilon.-guanidinocaproic acid can also be used
(containing 2, 3 or 5 linker atoms, respectively, between the
backbone chain and the central guanidinium carbon).
[0121] In alternative embodiments, the peptides as disclosed
herein, for example an RVG peptide and/or peptide carrier particles
can comprise D-amino acids. Compositions containing exclusively
D-amino acids have the advantage of decreased enzymatic
degradation. However, they can also remain largely intact within
the target cell. Such stability is generally not problematic if the
agent being delivered to the cell is biologically active when a
peptide carrier particle is still attached. For agents that are
inactive when conjugated with a peptide carrier particle, a linker
that is cleavable and can be cleaved by a suitable mechanism in a
target cell (e.g., by enzyme- or solvent-mediated cleavage within a
cell) can be included to promote release of the agent from the
peptide carrier particle in the target cell.
Carrier Particles
[0122] The carrier particles of the effector agents include any
carrier particle modifiable by attachment of a targeting agent
known to the skilled artisan. Carrier particles include but are not
limited to liposomal or polymeric nanoparticles such as liposomes,
proteins, and non-protein polymers. Carrier particles can be
selected according to their ability to transport the effector agent
of choice and the ability to covalently attach the targeting agent
to the carrier particle.
[0123] In some embodiments, carrier particles include colloidal
dispersion systems, which include, but are not limited to,
macromolecule complexes, nanocapsules, microspheres, beads and
lipid-based systems including oil-in-water emulsions, micelles,
mixed micelles, liposomes and lipid:oligonucleotide complexes of
uncharacterized structure. In some embodiments, the carrier
particle comprises a plurality of liposomes. Liposomes are
microscopic spheres having an aqueous core surrounded by one or
more outer layers made up of lipids arranged in a bilayer
configuration (see, generally, Chonn et al., Current Op. Biotech.
1995, 6, 698-708). Other carrier particles are cellular uptake or
membrane-disruption moieties, for example polyamines, e.g.
spermidine or spermine groups, or polylysines; lipids and
lipophilic groups; polymyxin or polymyxin-derived peptides;
octapeptin; membrane pore-forming peptides; ionophores; protamine;
aminoglycosides; polyenes; and the like. Other potentially useful
functional groups include intercalating agents; radical generators;
alkylating agents; detectable labels; chelators; or the like.
[0124] One can use other carrier particles, for example lipid
particle or vesicle, such as a liposome or microcrystal, which may
be suitable for parenteral administration. The particles may be of
any suitable structure, such as unilamellar or plurilamellar, so
long as the antisense oligonucleotide is contained therein.
Positively charged lipids such as
N-[I-(2,3dioleoyloxi)propyll-N,N,N-trimethyl-anunoniummethylsulfate,
or "DOTAP," are particularly preferred for such particles and
vesicles. The preparation of such lipid particles is well known.
See, e.g., U.S. Pat. Nos. 4,880,635; 4,906,477; 4,911,928;
4,917,951; 4,920,016; and 4,921,757 which are incorporated herein
by reference. Other non-toxic lipid based vehicle components may
likewise be utilized to facilitate uptake of the antisense compound
by the cell.
[0125] In some embodiments, a carrier particle is a liposome. The
outer surface of the liposomes can be modified with a
long-circulating agent, e.g., PEG, e.g., hyaluronic acid (HA). The
liposomes can be modified with a cryoprotectant, e.g., a sugar,
such as trehalose, sucrose, mannose or glucose, e.g., HA. In one
embodiment, a liposome is coated with HA. HA acts as both a
long-circulating agent and a cryoprotectant. The liposome is
modified by attachment of the targeting moiety. In another
embodiment, the targeting moiety is covalently attached to HA,
which is bound to the liposome surface. Alternatively, the carrier
particle is a micelle. Alternatively, the micelle is modified with
a cryoprotectant, e.g., HA, PEG.
[0126] Liposomes useful in the methods and compositions as
disclosed herein can be produced from combinations of lipid
materials well known and routinely utilized in the art to produce
liposomes. Lipids can include relatively rigid varieties, such as
sphingomyelin, or fluid types, such as phospholipids having
unsaturated acyl chains. "Phospholipid" refers to any one
phospholipid or combination of phospholipids capable of forming
liposomes. Phosphatidylcholines (PC), including those obtained from
egg, soy beans or other plant sources or those that are partially
or wholly synthetic, or of variable lipid chain length and
unsaturation are suitable for use in the present invention.
Synthetic, semisynthetic and natural product phosphatidylcholines
including, but not limited to, distearoylphosphatidylcholine
(DSPC), hydrogenated soy phosphatidylcholine (HSPC), soy
phosphatidylcholine (soy PC), egg phosphatidylcholine (egg PC),
hydrogenated egg phosphatidylcholine (HEPC),
dipalmitoylphosphatidylcholine (DPPC) and
dimyristoylphosphatidylcholine (DMPC) are suitable
phosphatidylcholines for use in this invention. All of these
phospholipids are commercially available. Further,
phosphatidylglycerols (PG) and phosphatic acid (PA) are also
suitable phospholipids for use in the present invention and
include, but are not limited to, dimyristoylphosphatidylglycerol
(DMPG), dilaurylphosphatidylglycerol (DLPG),
dipalmitoylphosphatidylglycerol (DPPG),
distearoylphosphatidylglycerol (DSPG) dimyristoylphosphatidic acid
(DMPA), distearoylphosphatidic acid (DSPA), dilaurylphosphatidic
acid (DLPA), and dipalmitoylphosphatidic acid (DPPA).
Distearoylphosphatidylglycerol (DSPG) is the preferred negatively
charged lipid when used in formulations. Other suitable
phospholipids include phosphatidylethanolamines,
phosphatidylinositols, sphingomyelins, and phosphatidic acids
containing lauric, myristic, stearoyl, and palmitic acid chains.
For the purpose of stabilizing the lipid membrane, it is preferred
to add an additional lipid component, such as cholesterol.
Preferred lipids for producing liposomes according to the invention
include phosphatidylethanolamine (PE) and phosphatidylcholine (PC)
in further combination with cholesterol (CH). According to one
embodiment of the invention, a combination of lipids and
cholesterol for producing the liposomes of the invention comprise a
PE:PC:Chol molar ratio of 3:1:1. Further, incorporation of
polyethylene glycol (PEG) containing phospholipids is also
contemplated by the present invention.
[0127] Liposomes useful in the methods and compositions as
disclosed herein can be obtained by any method known to the skilled
artisan. For example, the liposome preparation of the present
invention can be produced by reverse phase evaporation (REV) method
(see U.S. Pat. No. 4,235,871), infusion procedures, or detergent
dilution. A review of these and other methods for producing
liposomes can be found in the text Liposomes, Marc Ostro, ed.,
Marcel Dekker, Inc., New York, 1983, Chapter 1. See also Szoka Jr.
et al., (1980, Ann. Rev. Biophys. Bioeng., 9:467). A method for
forming ULVs is described in Cullis et al., PCT Publication No.
87/00238, Jan. 16, 1986, entitled "Extrusion Technique for
Producing Unilamellar Vesicles". Multilamellar liposomes (MLV) can
be prepared by the lipid-film method, wherein the lipids are
dissolved in a chloroform-methanol solution (3:1, vol/vol),
evaporated to dryness under reduced pressure and hydrated by a
swelling solution. Then, the solution is subjected to extensive
agitation and incubation, e.g., 2 hour, e.g., at 37.degree. C.
After incubation, unilamellar liposomes (ULV) are obtained by
extrusion. The extrusion step modifies liposomes by reducing the
size of the liposomes to a preferred average diameter.
Alternatively, liposomes of the desired size can be selected using
techniques such as filtration or other size selection techniques.
While the size-selected liposomes of the invention should have an
average diameter of less than about 300 nm, it is preferred that
they are selected to have an average diameter of less than about
200 nm with an average diameter of less than about 100 nm being
particularly preferred. When the liposome of the present invention
is a unilamellar liposome, it preferably is selected to have an
average diameter of less than about 200 nm. The most preferred
unilamellar liposomes of the invention have an average diameter of
less than about 100 nm. It is understood, however, that
multivesicular liposomes of the invention derived from smaller
unilamellar liposomes will generally be larger and can have an
average diameter of about less than 1000 nm. Preferred
multivesicular liposomes of the invention have an average diameter
of less than about 800 nm, and less than about 500 nm while most
preferred multivesicular liposomes of the invention have an average
diameter of less than about 300 nm.
[0128] A method for coating the liposomes or other polymeric
nanoparticles with targeting agents, such as an RVG peptide
comprising SEQ ID NO:13 or variants, derivatives or fragments
thereof are disclosed in U.S. Provisional Application No.
60/794,361 filed Apr. 24, 2006, and International Patent
Application: PCT/US07/10075 filed Apr. 24, 2007 with are
incorporated in their entirety herein by reference.
[0129] In some embodiments, the outer surface of the liposomes can
be further modified with a long-circulating agent. The modification
of the liposomes with a hydrophilic polymer as the long-circulating
agent is known to enable to prolong the half-life of the liposomes
in the blood. Examples of the hydrophilic polymer include
polyethylene glycol, polymethylethylene glycol,
polyhydroxypropylene glycol, polypropylene glycol,
polymethylpropylene glycol and polyhydroxypropylene oxide. In one
embodiment, a hydrophilic polymer is polyethylene glycol (PEG).
Glycosaminoglycans, e.g., hyaluronic acid, can also be used as
long-circulating agents.
[0130] In some embodiments, the targeting agent, such as an RVG
peptide comprising SEQ ID NO:13 or a derivative, variant or
fragment thereof is conjugated to a cryoprotectant present on the
liposome, e.g., HA. Crosslinking reagents include glutaraldehyde
(GAD), bifunctional oxirane (OXR), ethylene glycol diglycidyl ether
(EGDE), N-hydroxysuccinimide (NETS), and a water soluble
carbodiimide, preferably 1-ethyl-3-(3-dimethylaminopropyl)
carbodiimide (EDC). As is known to the skilled artisan, any
crosslinking chemistry can be used, including, but not limited to,
thioether, thioester, malimide and thiol, amine-carboxyl,
amine-amine, and others listed in organic chemistry manuals, such
as, Elements of Organic Chemistry, Isaak and Henry Zimmerman
Macmillan Publishing Co., Inc. 866 Third Avenue, New York, N.Y.
10022. Through the complex chemistry of crosslinking, linkage of
the amine residues of the recognizing substance and liposomes is
established.
[0131] In some embodiments, after the targeting agent is conjugated
or covalently attached to the lipid particle by way of covalent
linkage to the cryoprotectant, or by way of covalent linkage to
another targeting agent covalently linked to the cryoprotectant,
the lipid particle may be lyophilized. The lipid particle may
remain lyophilized prior to rehydration, or prior to rehydration
and encapsulation of the agent of interest, for extended periods of
time. In one embodiment, the lipid particle remains lyophilized for
about 1 month, about 2 months, about 3 months, about 6 months,
about 9 months, about 12 months, about 18 months, about 2 years or
more prior to rehydration.
[0132] In another embodiment, the carrier particle is a
cyclodextrin-based nanoparticle. Polycation formulated
nanoparticles have been used for drug delivery into the brain as
well as for systemic delivery of siRNA [114, 115]. A unique
cyclodextrin-based nanoparticle technology has been developed for
targeted gene delivery in vivo [116-123]. This delivery system
consists of two components. The first component is a biologically
non-toxic cyclodextrin-containing polycation (CDP). CDPs
self-assemble with siRNA to form colloidal particles about 50 nm in
diameter and protects si/shRNA against degradation in body fluids.
Moreover, the CDP has been engineered to contain imidazole groups
at their termini to assist in the intracellular trafficking and
release of the nucleic acid [123]. CDP also enables assembly with
the second component. The second component is an
adamantane-terminated polyethylene glycol (PEG) modifier for
stabilizing the particles in order to minimize interactions with
plasma and to attach cell surface targeting molecules such as
transferrin or RVG peptides. Thus, the advantages of this delivery
system are: 1) since the CDP protects the siRNA from degradation,
chemical modification of the nucleic acid is unnecessary, 2) the
colloidal particles do not aggregate and have extended life in
biological fluids because of the surface decoration with PEG that
occurs via inclusion complex formation between the terminal
adamantane and the cyclodextrins [123], 3) cell type-specific
targeted delivery is possible because some of the PEG chains
contain targeting ligands, 4) it does not induce an immune response
[116, 119], and 5) in vivo delivery does not produce an interferon
response even when a siRNA is used that contains a motif known to
be immunostimulatory when delivered in vivo with lipids [116].
[0133] In another embodiment, the carrier particle is a cationic
peptide, e.g., protamine. See, for example, WO 06/023491, which is
specifically incorporated herein in its entirety by reference.
[0134] The glycosaminoglycan carrier particles disclosed in U.S.
Patent Appl. No. 20040241248 and the glycoprotein carrier particles
in WO 06/017195, which are incorporated herein in their entirety by
reference, are useful in the methods of the present invention.
Similar naturally occurring polymer-type carriers known to the
skilled artisan are also useful in the methods of the present
invention.
[0135] Soluble non-protein polymers are useful as carrier
particles. Such polymers can include polyvinylpyrrolidone, pyran
copolymer, polyhydroxypropylrnethacrylamidephenol,
polyhydroxyethylaspartamidephenol, or polyethyleneoxidepolylysine
substituted with palitoyl residues. Furthermore, the therapeutic
agents can be coupled to a class of biodegradable polymers useful
in achieving controlled release of a drug, for example, polylactic
acid, polepsilon caprolactone, polyhydroxy butyric acid,
polyorthoesters, polyacetals, polydihydropyrans,
polycyanoacrylates, and cross-linked or amphipathic block
copolymers of hydrogels. The therapeutic agents can also be affixed
to rigid polymers and other structures such as fullerenes or
Buckeyballs.
[0136] The carrier particle can be conjugated to the targeting
agent, for example RVG peptide or variant thereof. The conjugation
can be a non-covalent or covalent interaction, for example, by
means of chemical crosslinkage or conjugation.
[0137] As used herein, the term "conjugate" or "conjugation" refers
to the attachment of two or more entities to form one entity. For
example, the methods of the present invention provide conjugation
of a targeting agent (for example an RVG peptide or variant or
fragment or derivative) joined with another entity, for example a
carrier particle, for example a liposome or cell penetrating agent,
for e.g. a cell penetrating peptide. The attachment can be by means
of linkers, chemical modification, peptide linkers, chemical
linkers, covalent or non-covalent bonds, or protein fusion or by
any means known to one skilled in the art. The joining can be
permanent or reversible. In some embodiments, several linkers can
be included in order to take advantage of desired properties of
each linker and each protein in the conjugate. Flexible linkers and
linkers that increase the solubility of the conjugates are
contemplated for use alone or with other linkers as disclosed
herein. Peptide linkers can be linked by expressing DNA encoding
the linker to one or more proteins in the conjugate. Linkers can be
acid cleavable, photocleavable and heat sensitive linkers. Methods
for conjugation are well known by persons skilled in the art and
are encompassed for use in the present invention.
[0138] According to the present invention, the targeting agent, for
example an RVG peptide, can be linked to the carrier particle
entity via any suitable means, as known in the art, see for example
U.S. Pat. Nos. 4,625,014, 5,057,301 and 5, 514,363, which are
incorporated herein in their entirety by reference. For example,
the agent to be transported can be covalently conjugated to the
transporting entity, either directly or through one or more
linkers. In one embodiment, the transporting entity of the present
invention is conjugated directly to an agent to be transported. In
another embodiment, the transporting entity of the present
invention is conjugated to an agent to be transported via a linker,
e.g. a transport enhancing linker.
[0139] A large variety of methods for conjugation of targeting
agents with carrier particles or diagnostic moieties are known in
the art. Such methods are e.g. described by Hermanson (1996,
Bioconjugate Techniques, Academic Press), in U.S. Pat. No.
6,180,084 and U.S. Pat. No. 6,264,914 which are incorporated herein
in their entirety by reference and include e.g. methods used to
link haptens to carriers proteins as routinely used in applied
immunology (see Harlow and Lane, 1988, "Antibodies: A laboratory
manual", Cold Spring Harbor Laboratory Press, Cold Spring Harbor,
N.Y.). It is recognized that, in some cases, a targeting agent or
carrier particle can lose efficacy or functionality upon
conjugation depending, e.g., on the conjugation procedure or the
chemical group utilised therein. However, given the large variety
of methods for conjugation the skilled person is able to find a
conjugation method that does not or least affects the efficacy or
functionality of the entities to be conjugated.
[0140] Suitable methods for conjugation of a targeting agent with
carrier particle include e.g. carbodimide conjugation (Bauminger
and Wilchek, 1980, Meth. Enzymol. 70: 151-159). Alternatively, a
moiety can be coupled to a targeting agent as described by Nagy et
al., Proc. Natl. Acad. Sci. USA 93:7269-7273 (1996), and Nagy et
al., Proc. Natl. Acad. Sci. USA 95:1794-1799 (1998), each of which
are incorporated herein by reference. Another method for
conjugating one can use is, for example sodium periodate oxidation
followed by reductive alkylation of appropriate reactants and
glutaraldehyde crosslinking.
[0141] One can use a variety of different linkers to conjugate the
targeting agent, for example RVG peptide as described herein to a
carrier particle, for example but not limited to aminocaproic horse
radish peroxidase (HRP) or a heterobiofunctional cross-linker, e.g.
carbonyl reactive and sulfhydryl-reactive cross-linker.
Heterobiofunctional cross linking reagents usually contain two
reactive groups that can be coupled to two different function
targets on proteins and other macromolecules in a two or three-step
process, which can limit the degree of polymerization often
associated with using homobiofunctional cross-linkers. Such
multistep protocols can offer a great control of conjugate size and
the molar ratio of components.
[0142] The term "linker" refers to any means to join two or more
entities, for example a peptide with another peptide, or a
liposome. A linker can be a covalent linker or a non-covalent
linker. Examples of covalent linkers include covalent bonds or a
linker moiety covalently attached to one or more of the proteins to
be linked. The linker can also be a non-covalent bond, e.g. an
organometallic bond through a metal center such as platinum atom.
For covalent linkages, various functionalities can be used, such as
amide groups, including carbonic acid derivatives, ethers, esters,
including organic and inorganic esters, amino, urethane, urea and
the like. To provide for linking, the effector molecule and/or the
probe can be modified by oxidation, hydroxylation, substitution,
reduction etc. to provide a site for coupling. It will be
appreciated that modification which do not significantly decrease
the function of the target agent, for example RVG peptide and/or
the carrier particle are preferred.
[0143] In some embodiments where the carrier particle is a liposome
or polymeric nanoparticle, the effector agent and/or targeting
agent, such as an RVG peptide is captured within a liposomes or
polymeric nanoparticle or immunoliposomes. For example, a
suspension of RVG peptide or variant or fragment thereof and/or
effector agent can be encapsulated in micelles to form liposomes by
conventional methods (U.S. Pat. No. 5,043,164, U.S. Pat. No. 4,957,
735, I5 U.S. Pat. No. 4,925,661; Connor and Huang, (1985) J. Cell
Biol. 101: 581; Lasic D. D. (1992) Nature 355: 279; Novel Drug
Delivery (eds. Prescott and Nimmo, Wiley, New York-, 1989); Reddy
et al. (1992) J. Immunol. 148:1585), which are incorporated herein
in their entirety by reference. Liposomes comprising targeting
agent that binds specifically to neurons (e.g., neurons expressing
acetylcholine receptor (AchR)) or cells of the blood brain barrier
can be used to target the agents to those cells. The terms
"encapsulation" and "entrapped," as used herein, refer to the
incorporation of an agent in a lipid particle. The agent is present
in the aqueous interior of the lipid particle. In one embodiment, a
portion of the encapsulated agent takes the form of a precipitated
salt in the interior of the liposome. The agent may also self
precipitate in the interior of the liposome.
[0144] In another embodiment where the effector agent is a nucleic
acid, e.g., DNA, RNA, siRNA, plasmid DNA, short-hairpin RNA, small
temporal RNA (stRNA), microRNA (miRNA), RNA mimetics, or
heterochromatic siRNA, the nucleic acid effector agent has a
charged backbone that prevents efficient encapsulation in the lipid
particle. Accordingly, the nucleic acid effector agent of interest
may be condensed with a cationic polymer, e.g., PEI, polyamine
spermidine, and spermine, or cationic peptide, e.g., protamine and
polylysine, prior to encapsulation in the lipid particle. In some
embodiments, the effector agent is not condensed with a cationic
polymer.
[0145] In some embodiments, an effector agent is encapsulated in
the lipid particle or other polymeric nanoparticle in the following
manner. The lipid particle or polymeric nanoparticle, in which can
additionally comprise a cryoprotectant and/or a targeting agent is
provided lyophilized. The effector agent is in an aqueous solution.
The effector agent in aqueous solution is utilized to rehydrate the
lyophilized lipid particle or nanoparticle. Thus, the effector
agent is encapsulated in the rehydrated lipid particle or polymeric
nanoparticle. For example but not limited to, the cDNA for the
glial cell line derived neurogrowth factor (GDNF) may be targeted
to the dopamine cells at the substantia nigra in Parkinson's
disease patients.
[0146] In some embodiments, two or more effector agents can be
delivered by the lipid particle or polymeric nanoparticles by the
methods as disclosed herein. In such embodiments, one agent can be
hydrophobic and the other hydrophilic. The hydrophobic agent can be
added to the lipid particle during formation of the lipid particle.
The hydrophobic agent associates with the lipid portion of the
lipid particle. The hydrophilic agent is added in the aqueous
solution rehydrating the lyophilized lipid particle. An exemplary
embodiment of two agent delivery is described below, wherein a
condensed siRNA is encapsulated in a liposome and wherein a drug
that is poorly soluble in aqueous solution is associated with the
lipid portion of the lipid particle. As used herein, "poorly
soluble in aqueous solution" refers to a composition that is less
that 10% soluble in water.
[0147] Any suitable lipid: pharmaceutical agent ratio that is
efficacious is contemplated by this invention. Preferred lipid:
pharmaceutical agent molar ratios include about 2:1 to about 30:1,
about 5:1 to about 100:1, about 10:1 to about 40:1, about 15:1 to
about 25:1.
[0148] The preferred loading efficiency of therapeutic or
pharmaceutical agent is a percent encapsulated pharmaceutical agent
of about 50%, about 60%, about 70% or greater. In one embodiment,
the loading efficiency for a hydrophilic agent is a range from
50-100%. The preferred loading efficiency of pharmaceutical agent
associated with the lipid portion of the lipid particle, e.g., a
pharmaceutical agent poorly soluble in aqueous solution, is a
percent loaded pharmaceutical agent of about 50%, about 60%, about
70%, about 80%, about 90%, about 100%. In one embodiment, the
loading efficiency for a hydrophobic agent in the lipid layer is a
range from 80-100%.
[0149] In one aspect of the method, the liposome or polymeric
nanoparticle is detectably labeled with a label selected from the
group including a radioactive label, a fluorescent label, a
non-fluorescent label, a dye, or a compound which enhances magnetic
resonance imaging (MRI). In one embodiment, the liposome product is
detected by acoustic reflectivity. The label may be attached to the
exterior of the liposome or may be encapsulated in the interior of
the liposome.
[0150] In some embodiments, and in the event that the carrier
particle is a peptide or protein, and the targeting agent is also a
peptide or antibody, or contains amino acids as part of its
structure, the targeting agent (for example an RVG peptide) can be
fused either in frame or out of frame with the carrier particle to
form a fusion protein. In general, the targeting agent (i.e. an RVG
peptide) and carrier particle can be fused directly or via one or
more amino acid linkers. Any suitable amino acid linkers can be
used to modify the stability, conformation, charge, or other
structure features of the resulting fusion protein in order to
facilitate its transport to target cells. In some embodiments,
fusion proteins can also be formed from the carrier particle and
effector agent, where both the carrier particle and effector agents
are proteins or contain amino acids as part of their structure, and
preferably the activity of the effector agent is not compromised by
being fused with the carrier particle.
[0151] The term "fusion protein" refers to a recombinant protein of
two or more fused proteins. Fusion proteins can be produced, for
example, by a nucleic acid sequence encoding one protein joined to
the nucleic acid encoding another protein such that they constitute
a single open-reading frame that can be translated in the cells
into a single polypeptide harboring all the intended proteins. The
order of arrangement of the proteins can vary. As a non-limiting
example, the nucleic acid sequence encoding an RVG peptide can be
fused to either the 5' or the 3' end of the nucleic acid sequence
encoding a carrier particle. In this manner, on expression of the
nucleic acid construct, the RVG peptide is functionally expressed
and fused to the N-terminal or C-terminal end of the carrier
protein. In certain embodiments, the carrier peptide can be
modified such that the carrier protein function (i.e. ability to
associate with the effector agent) remains unaffected by fusion to
the RVG peptide and vice versa, the RVG peptide can be modified,
for example RVG peptide variants can be used so that the RVG
peptide retains the ability to penetrate or pass through the BBB
even when fused with another protein, for example the carrier
particle.
[0152] The targeted delivery composition can also be prepared via
recombinant expression through bacterial or eukaryotic expression
systems of a protein-based carrier particle, for example HIV-TAT
(SEQ ID NO:15) or a fragment thereof, protamine, and an RVG
peptide. Bacterial and eukaryotic expression systems are well known
and used routinely by those skilled in the art. Accordingly, in one
embodiment a targeted delivery composition comprises an RVG peptide
or variant or fragment or derivative thereof, and a polymeric
arginine residue of a varying length, such as 9R or 11R as
disclosed herein. An example of one such targeted delivery
composition is RVG-11dR:
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRRRR (SEQ ID NO: 14).
Another example of one such targeted delivery composition is
RVG-9dR: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR (SEQ ID NO: 34).
Another example of such a targeted delivery composition comprise an
RVG peptide and a protamine peptide:
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRSQSRSRYYRQRQR SRRRRRRS (SEQ ID NO:
16). In another embodiment, a targeted delivery composition
comprises an RVG peptide and TAT:
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGYGRKKRRQRRRKKRK (SEQ ID NO: 15). In
some embodiments, SEQ ID NO:14 and SEQ ID NO:34 can gave arginine
(R) sequentially deleted or added from the C-terminal end, for
example deleted by 1, 2, 3, 4, 5, or 6 C-terminal R residues.
[0153] In some embodiments, the carrier particle also comprises a
cell penetrating agent. A cell penetrating agent can also be
covalently attached to a carrier particle, e.g., a liposomal
carrier particle. In some embodiments, the composition of the
present invention includes a cell penetrating agent and a separate
carrier particle. For example, a cell penetrating agent can be
attached to a liposomal carrier particle.
[0154] Any peptide or fragment thereof, which is capable of
crossing a biological membrane, either in vivo or in vitro, is
encompassed for use in the methods and compositions of the present
invention. Such peptides that are capable of crossing membranes are
termed "cell penetrating agents". "Cell penetrating agents" or
"translocation agents "comprise agents that facilitate delivery of
an associated compound of interest or cargo across a cell membrane.
It is known that certain peptides have the ability to penetrate a
lipid bilayer (e.g., cell membranes) and translocate an attached
cargo across the cell membrane. This is referred to herein as
"translocation activity". Without being bound by theory, these
membrane penetrating peptides appear to enter the cell, in part,
via non-endocytic mechanisms, as indicated by the ability of the
cell penetrating peptides to enter the cell at low temperatures
(e.g., 4.degree. C.) that would normally inhibit endocytic,
receptor-based, internalization pathways.
[0155] Generally, the cell penetrating agents are capable of
facilitating transfer of a cargo or compound such as an effector
agent across a lipid bilayer in a non-selective manner because
entry into the cell does not appear to occur by receptor-mediated
endocytic pathway. Consequently, the cell penetrating agent is
capable of translocating cargoes non-selectively into a variety of
cell types. In some embodiments, to control delivery of the
compositions into cell types, the compositions can further comprise
a cell penetrating peptide inhibitor or an inhibitor of cell
penetrating peptide. Modification of the inhibitor results in
release of the inhibitory effect and formation of an active cell
penetrating composition.
[0156] In some embodiments, the cell penetrating agent is a cell
penetrating peptide. Methods to synthesize such peptides are well
known to one of ordinary skill in the art. For example, several
cell penetrating peptides have been identified which can be used as
carrier peptides in the methods of the invention for transporting
RNA interfering agents across biological membranes. These peptides
include, for example, the homeodomain of antennapedia, a Drosophila
transcription factor (Wang et al., (1995) PNAS USA., 92,
3318-3322); a fragment representing the hydrophobic region of the
signal sequence of Kaposi fibroblast growth factor with or without
NLS domain (Antopolsky et al. (1999) Bioconj. Chem., 10, 598-606);
a signal peptide sequence of caiman crocodylus Ig(5) light chain
(Chaloin et al. (1997) Biochem. Biophys. Res. Comm., 243, 601-608);
a fusion sequence of HIV envelope glycoprotein gp4114, (Morris et
al. (1997) Nucleic Acids Res., 25, 2730-2736); a transportan
A-achimeric 27-mer consisting of N-terminal fragment of
neuropeptide galanine and membrane interacting wasp venom peptide
mastoporan (Lindgren et al., (2000), Bioconjugate Chem., 11,
619-626); a peptide derived from influenza virus hemagglutinin
envelop glycoprotein (Bongartz et al., 1994, Nucleic Acids Res.,
22, 468 1 4688); RGD peptide; and a peptide derived from the human
immunodeficiency virus type-1 ("HIV-1"). Purified HIV-1 TAT protein
is taken up from the surrounding medium by human cells growing in
culture (Frankel and Pabo, (1988) Cell, 55, pp. 1189-93). TAT
protein trans-activates certain HIV genes and is essential for
viral replication. The full-length HIV-1 TAT protein has 86 amino
acid residues. The HIV tat gene has two exons. TAT amino acids 1-72
are encoded by exon 1, and amino acids 73-86 are encoded by exon 2.
The full-length TAT protein is characterized by a basic region
which contains two lysines and six arginines (amino acids 47-57)
and a cysteine-rich region which contains seven cysteine residues
(amino acids 22-37). The basic region (i.e., amino acids 47-57) is
thought to be important for nuclear localization and cell
penetration (Ruben et al., J. Virol. 63: 1-8 (1989); Hauber et al.,
J. Virol. 63 1181-1187 (1989); Rudolph et al. (2003)
278(13):11411). The cysteine-rich region mediates the formation of
metal-linked dimers in vitro (Frankel et al., Science 240: 70-73
(1988); Frankel, et al., Proc. Natl. Acad. Sci USA 85: 6297-6300
(1988)) and is essential for its activity as a transactivator
(Garcia et al., EMBO J. 7:3143 (1988); Sadaie. et al., J. Virol.
63: 1 (1989)). As in other regulatory proteins, the N-terminal
region can be involved in protection against intracellular
proteases (Bachmair et al., Cell 56: 1019-1032 (1989). See also,
e.g., Morris, M. C. et al., Nature Biotechnol. 19:1173-1176 (2001);
Dupont, A. J. and Prochiantz, A., CRC Handbook on Cell Penetrating
Peptides, Langel, Editor, CRC Press, (2002); Chaloin, L. et al.,
Biochemistry 36(37):11179-87 (1997); and Lundberg, P. and Langel,
U., J. Mol. Recognit. 16(5):227-233 (2003); all publications
incorporated herein by reference.
[0157] In one embodiment of the invention, such a cell penetrating
agent comprises the basic region comprising amino acids 47-57 of
the HIV-1 TAT peptide (SEQ ID NO:1). In another embodiment, a cell
penetrating agent comprises the basic region comprising amino acids
48-60 of the HIV-1 TAT peptide (SEQ ID NO:2). In yet another
embodiment, a cell penetrating agent comprises the basic region
comprising amino acids 49-57, 48-60, or 47-57 of the HIV-1 TAT
peptide, does not comprise amino acids 22-36 of the HIV-1 TAT
peptide, and does not comprise amino acids 73-86 of the HIV-1 TAT
peptide. In still another embodiment, the specific peptides set
forth in Table 1, below, or fragments thereof, can be used as cell
penetrating agents in the methods and compositions as disclosed
herein.
TABLE-US-00001 TABLE 1 SEQ ID PEPTIDE SEQUENCE NO: HIV-1 TAT (49-
RKKRRQRRR 1 57) HIV-1 TAT (48- GRKKRRQRRRTPQ 2 60) HIV-1 TAT (47-
YGRKKRRQRRR 3 57) Kaposi fibroblast AAV ALL PAV LLA LLA 4 growth
factor P + VQR KRQ KLMP of caiman MGL GLH LLV LAA ALQ 5 crocodylus
Ig(5) GA light chain HIV envelope GAL FLG FLG AAG STM 6
glycoprotein GA + PKS KRK 5 (NLS of the gp41 SV40) Drosophila RQI
KIW FQN RRM KWK K 7 Antennapedia amide RGD peptide X-RGD-X 8
influenza virus GLFEAIAGFIENGWEGMIDG 9 hemagglutinin GGYC envelop
glycoprotein transportan A GWT LNS AGY LLG KIN 10 LKA LAA LAK KIL
Pre-S-peptide (S)DH QLN PAF 11 Somatostatin (tyr- (S)FC YWK TCT 12
3-octreotate) (s) optional Serine for coupling italic = optional D
isomer for stability
[0158] In yet another embodiment, an active thiol at the 5' end of
the sense strand can be coupled to a cysteine reside added to the C
terminal end of a cell penetrating agent for delivery into the
cytosol (such as a fragment of tat or a fragment of the Drosophila
Antennapedia peptide). Internalization via these peptides bypasses
the endocytic pathway and therefore removes the danger of rapid
degradation in the harsh lysosomal environment, and can reduce the
concentration required for biological efficiency compared to free
oligonucleotides.
[0159] Other arginine rich peptides are also included for use as
cell penetrating agents as disclosed herein. For example, a TAT
analog can comprise D-amino acids and arginine-substituted TAT
(47-60), RNA-binding peptides derived from virus proteins such as
HIV-1 Rev, and flock house virus coat proteins, and the DNA binding
sequences of leucine zipper proteins, such as cancer-related
proteins c-Fos and c-Jun and the yeast transcription factor GCN4,
all of which contain several arginine residues (see Futaki, et al.
(2001) J. Biol Chem 276(8):5836-5840 and Futaki, S. (2002) Intl.
Pharm 245(1-2):1-7, which are incorporated herein by reference). In
one embodiment, the arginine rich peptide contains about 4 to about
11 arginine residues. In another embodiment, the arginine residues
are contiguous residues.
[0160] In another embodiment, the cell penetrating peptides
comprise a membrane signal peptide or membrane translocation
sequence capable of translocating across the cell membrane. A cell
penetrating "signal peptide" or "signal sequence" refers to a
sequence of amino acids generally of a length of about 10 to about
50 or more amino acid residues, many (typically about 55-60%)
residues of which are hydrophobic such that they have a
hydrophobic, lipid-soluble portion. Generally, a signal peptide is
a peptide capable of penetrating through the cell membrane to allow
the import and/or export of cellular proteins.
[0161] As used herein a "signal sequence", also known as a "leader
sequence" can be used, when desired, to direct the peptide through
a membrane of a cell. Such a sequence refers to an amino acid
sequence which can be naturally present on the peptides of the
present invention or provided from heterologous sources by
recombinant DNA techniques.
[0162] Signal peptides can be selected from the SIGPEP database
(von Heijne, Protein Sequence Data Analysis 1:4142 (1987); von
Heijne and Abrahmsen, L., FEBS Letters 224:439-446 (1989)).
Algorithms can also predict signal peptide sequences for use in the
compositions (see, e.g., SIGFIND--Signal Peptide Prediction Server
version SignalP V2.0b2, Bendtsen et al. "Improved prediction of
signal peptides: SignalP 3.0."J. Mol. Biol., 340:783-795, 2004;
Nielsen et al. "Identification of prokaryotic and eukaryotic signal
peptides and prediction of their cleavage sites." Protein
Engineering, 10:1-6, 1997; Bairoch and Boeckmann, "The SWISS-PROT
protein sequence data bank: current status" Nucleic Acids Res.
22:3578-3580, 1994.). When a specific cell type is to be targeted,
a signal peptide used by that cell type can be chosen. For example,
signal peptides encoded by a particular oncogene can be selected
for use in targeting cells in which the oncogene is expressed.
Additionally, signal peptides endogenous to the cell type can be
chosen for importing biologically active molecules into that cell
type. Any selected signal peptide can be routinely tested for the
ability to translocate across the cell membrane of any given cell
type (see, e.g., U.S. Pat. No. 5,807,746, which is incorporated
herein in its entirety by reference). Exemplary signal peptide
sequences with membrane translocation activity include, by way of
example and not limitation, those of Karposi fibroblast growth
factor AAVALLPAVLLALLAPAAADQNQLMP. (SEQ ID NO: 17) or a derivative,
variant or fragment thereof.
[0163] In another embodiment of the present invention, cell
penetrating agents comprise Herpes Simplex Virus VP22 tegument
protein, its analogues, derivatives and variants (Elliott, G. and
O'Hare, P., Gene Ther. 6:12-21 (1999); Derer, W. et al., J. Mol.
Med. 77:609-613 (1999)). VP22, encoded by the UL49 gene, is a
structural component of the tegument compartment of the HSV virus.
A composition containing the C-terminal amino acids 159-301 of HSV
VP22 protein is capable of translocating different types of cargoes
into cells. Translocating activity is observed with a minimal
sequence of DAATATRGRSAASRPTERPRAPARSASRPRRPVE (SEQ ID NO: 18).
Homologues of VP22 found in herpes viruses are also capable of
delivery of attached compounds of interest across cell membranes
(Harms, J. S. et al., J. Virol. 74:3301-3312 (2000); Dorange, F. et
al., J. Gen. Virol. 81:2219-2230 (2000), which are incorporated
herein in their entirety by reference).
[0164] In another embodiment the present invention, the cell
penetrating peptides comprise cationic peptides with membrane
translocation activity. Cationic amino acids include for example,
but are not limited to, arginine, lysine, and ornithine. Active
peptides with arginine rich sequences are present in the Grb2
binding protein, having the sequence RRWRRWWRRWWRRWRR (SEQ ID NO:
19) (Williams, E. J. et al., J. Biol. Chem. 272:22349-22354 (1997))
and polyarginine heptapeptide RRRRRRR (7R) (SEQ ID NO: 20) (Chen,
L. et al., Chem. Biol. 8:1123-1129 (2001); Futaki, S. et al., J.
Biol. Chem. 276:5836-5840 (2001); and Rothbard, J. B. et al., Nat.
Med. 6(11):1253-7 (2000) which are incorporated herein in their
entirety by reference). An exemplary cell penetrating peptide of
this type has the sequence RPKKRKVRRR (SEQ ID NO: 21), which is
found to penetrate the membranes of a variety of cell types. Also
useful are branched cationic peptides capable of translocation
across membranes, including by way of example and not limitation,
(KKKK).sub.2GGC (SEQ ID NO:22), (KWKK).sub.2GCC (SEQ ID NO: 23),
and (RWRR).sub.2GGC (SEQ ID NO: 24) (Plank, C. et al., Human Gene
Ther. 10:319-332 (1999) which are incorporated herein in their
entirety by reference).
[0165] In a further embodiment, the cell penetrating peptides
comprise chimeric sequences of cell penetrating peptides that are
capable of translocating across cell membrane. An exemplary
molecule of this type is transportan GALFLGFLGGAAGSTMGAWSQPKSKRKV
(SEQ ID NO:25), a chimeric peptide derived from the first twelve
amino acids of galanin and a 14 amino acid sequence from mastoporan
(Pooga, M et al., Nature Biotechnol. 16:857-861 (1998). Analogues
of transportans are described in Soomets, U. et al., Biochim
Biophys Acta. 1467(1): 165-76 (2000) and Lindgren, M. et al.
Bioconjug Chem. 11 (5):619-26 (2000). An exemplary deletion
analogue, transportan-10, has the sequence AGYLLGKINLKALAALAKKIL
(SEQ ID NO: 26).
[0166] Other types of cell penetrating peptides are the VT5
sequences DPKGDPKGVTVTVTVTVTGKGDPKPD (SEQ ID NO: 27), which is an
amphipathic, beta-sheet forming peptide (Oehlke, J., FEBS Lett.
415(2):196-9 (1997); unstructured peptides described in Oehlke J.,
Biochim Biophys Acta. 1330(1):50-60 (1997); alpha helical
amphipatic peptide with the sequence KLALKLALKALKAALKLA (SEQ ID NO:
28) (Oehlke, J. et al., Biochim Biophys Acta. 1414(1-2):127-39
(1998); sequences based on murine cell adhesion molecule vascular
endothelial cadherin, amino acids 615-632 LLIILRRRIRKQAHAHSK (SEQ
ID NO: 29) (Elmquist, A. et al., Exp Cell Res. 269(2):237-44
(2001); sequences based on third helix of the islet 1 gene enhancer
protein RVIRVWFQNKRCKDKK (SEQ ID NO: 30) (Kilk, K. et al.,
Bioconjug. Chem. 12(6):911-6 (2001)); amphipathic peptide carrier
Pep-1 KETWWETWWTEWSQPKKKRKV (SEQ ID NO: 31) (Morris, M. C. et al.,
Nat Biotechnol. 19(12):1173-6 (2001)); and the amino terminal
sequence of mouse prion protein MANLGYWLLALFVTMWTDVGLCKKRPKP (SEQ
ID NO: 32) (Lundberg, P. et al., Biochem. Biophys. Res. Commun.
299(1):85-90 (2002)). In some embodiments, the cell penetrating
peptides are variants, fragments of derivatives of SEQ ID NOS: 17
to 32.
[0167] In some embodiments of the present invention, a cell
penetrating agent does not comprise amino acids. In such an
embodiment, the cell penetrating agents is a small molecule or
comprises polymers of subunits other than amino acids. For example
such subunits can include, but are not limited to, hydroxy amino
acids, N-methyl-amino acids amino aldehydes, and the like, which
result in polymers with reduced peptide bonds. Other subunit types
can be used, depending on the nature of the selected backbone. A
variety of backbone types can be used to order and position the
sidechain guanidino and/or amidino moieties, such as alkyl backbone
moieties joined by thioethers or sulfonyl groups, hydroxy acid
esters (equivalent to replacing amide linkages with ester
linkages), replacing the alpha carbon with nitrogen to form an aza
analog, alkyl backbone moieties joined by carbamate groups,
polyethyleneimines (PEIs), and amino aldehydes, which result in
polymers composed of secondary amines.
[0168] A more detailed backbone list includes N-substituted amide
(CONR replaces CONH linkages), esters (CO.sub.2), ketomethylene
(COCH.sub.2) reduced or methyleneamino (CH.sub.2NH), thioamide
(CSNH), phosphinate (PO.sub.2RCH.sub.2), phosphonamidate and
phosphonamidate ester (PO.sub.2RNH), retropeptide (NHCO),
transalkene (CR.dbd.CH), fluoroalkene (CF.dbd.CH), dimethylene
(CH.sub.22CH.sub.2), thioether (CH.sub.2S), hydroxyethylene
(CH(OH)CH.sub.2), methyleneoxy (CH.sub.2O), tetrazole (CN.sub.24),
retrothioamide (NHCS), retroreduced (NHCH.sub.2), sulfonamido
(SO.sub.2NH), methylenesulfonamido (CHRSO.sub.2NH),
retrosulfonamide (NHSO.sub.2), and peptoids (N-substituted
glycines), and backbones with malonate and/or gem-diaminoalkyl
subunits, for example, as reviewed by Fletcher et al. (1998) and
detailed by references cited therein. Peptoid backbones
(N-substituted glycines) can also be used. Many of the foregoing
substitutions result in approximately isosteric polymer backbones
relative to backbones formed from .alpha.-amino acids.
[0169] Polymers are constructed by any method known in the art.
Exemplary peptide polymers can be produced synthetically,
preferably using a peptide synthesizer (Applied Biosystems Model
433) or can be synthesized recombinantly by methods well known in
the art.
[0170] Alternatively, peptides and polypeptides of the present
invention, for example targeting agents, for example RVG peptide or
cell permeable peptides can be obtained directly by chemical
synthesis, e.g., using a commercial peptide synthesizer according
to vendor's instructions. Methods and materials for chemical
synthesis of polypeptides are well known in the art. See, e.g.,
Merrifield, 1963, "Solid Phase Synthesis," J. Am. Chem. Soc.
83:2149-2154.
[0171] A peptide of the present invention, for example RVG peptide
or cell permeable peptides can be introduced into a cell using
conventional techniques for transporting proteins into intact
cells. In some embodiments, the RVG peptide is conjugated to a cell
permeable protein by fusion as discussed herein, and in some
embodiments the conjugate is further fused to an internalization
peptide sequence, for example an internalization sequence derived
from Antennapedia (Bonfanti et al., Cancer Res. 57:1442-1446) or to
a nuclear localization protein such as HIV TAT peptide (U.S. Pat.
No. 5,652,122, which is specifically incorporated herein in its
entirety by reference).
[0172] Alternatively, the polypeptides of the present invention,
for example an RVG peptide and/or a cell permeable peptide can be
expressed in the cell following introduction of a DNA encoding the
protein, e.g., a nucleic acid encoding the RVG peptide and/or cell
permeable protein. In some embodiments, the nucleic acid comprises
the nucleic acid sequence encoding an RVG peptide and a nucleic
acid sequence encoding a cell permeable protein, for example to
generate an RVG peptide-cell permeable protein fusion protein. In
such embodiments, conventional expression vectors are useful in the
methods of as described herein, and in some embodiments the subject
can be administered the cells expressing the nucleic acid, or the
nucleic acids can be administered directly to the subject by means
commonly known in the art, for example by using a catheter.
[0173] In some embodiments, the peptides or peptide constructs as
described herein, for example an RVG peptide and/or a cell
permeable peptide or derivatives thereof, are cleavable peptides. A
cleavable peptide is a peptide comprising an amino acid sequence
that is recognized by a protease or peptidase or other cleaving
agent present in a cell, for example a target cell, or found in
surrounding tissue, or produced by a microbe capable of
establishing an infection in a mammal.
[0174] Peptides that are cleavable typically have, but are not
required to comprise one or more amino acids in addition to the
amino acid recognition sequence; for example additional amino acids
at the amino- or carboxy terminal, or both, ends of the recognition
sequence. Means of adding amino acids to an amino acid sequence,
e.g., in an automated peptide synthesizer, as well as means of
detecting cleavage of a peptide, e.g., by chromatographic analysis
for the amino acid products of such cleavage, are well known to
ordinarily skilled artisans given the teachings of this invention.
Peptide recognition sequences typically range from about 2 to 20
amino acids in length, and are typically located between the two
fragments of the peptide to be cleaved, for example but not limited
to, an RVG peptide and a cell permeable peptide.
[0175] The peptides or polypeptides useful in the present
invention, for example RVG peptide and/or a cell permeable peptide
or derivatives thereof can be modified at their amino termini, for
example, so as to increase their hydrophilicity. Increased
hydrophilicity enhances exposure of the peptides on the surfaces of
lipid-based carriers into which the parent peptide-lipid conjugates
have been incorporated. Polar groups suitable for attachment to
peptides so as to increase their hydrophilicity are well known, and
include, for example and without limitation: acetyl ("Ac"),
3-cyclohexylalanyl ("Cha"), acetyl-serine ("Ac Ser"),
acetyl-seryl-serine ("Ac-Ser-Ser-"), succinyl ("Suc"),
succinyl-serine ("Suc-Ser"), succinyl-seryl-serine ("Suc-Ser-Ser"),
methoxy succinyl ("MeO-Suc"), methoxy succinyl-serine
("MeO-Suc-Ser"), methoxy succinyl-seryl-serine ("MeO-Suc-Ser-Ser")
and seryl-serine ("Ser-Ser-") groups, polyethylene glycol ("PEG"),
polyacrylamide, polyacrylomorpholine, polyvinylpyrrolidine, a
polyhydroxyl group and carboxy sugars, e.g., lactobionic, N-acetyl
neuraminic and sialic acids, groups. The carboxy groups of these
sugars would be linked to the N-terminus of the peptide via an
amide linkage. Presently, the preferred N-terminal modification is
a methoxy-succinyl modification.
[0176] It will be appreciated that peptides often contain amino
acids other than the 20 amino acids commonly referred to as the 20
naturally occurring amino acids, and many amino acids, including
the terminal amino acids, can be modified either by natural
processes such as glycosylation and other post-translational
modifications, or by chemical modification techniques which are
well known in the art. Even the common modifications that occur
naturally in polypeptides are too numerous to list exhaustively
here, but they are well described in basic texts and in more
detailed monographs, as well as in a voluminous research
literature, and they are well known to those of skill in the art.
Among the known modifications which can be present in polypeptides
of the present invention are, to name an illustrative few,
acetylation, acylation, ADP-ribosylation, amidation, covalent
attachment of flavin, covalent attachment of a heme moiety,
covalent attachment of a polynucleotide or polynucleotide
derivative, covalent attachment of a lipid or lipid derivative,
covalent attachment of phosphotidylinositol, cross-linking,
cyclization, disulfide bond formation, demethylation, formation of
covalent cross-links, formation of cysteine, formation of
pyroglutamate, formylation, gamma-carboxylation, glycation,
glycosylation, GPI anchor formation, hydroxylation, iodination,
methylation, myristoylation, oxidation, proteolytic processing,
phosphorylation, prenylation, racemization, selenoylation,
sulfation, transfer-RNA mediated addition of amino acids to
proteins such as arginylation, and ubiquitination.
[0177] Such modifications are well known to those of skill and have
been described in great detail in the scientific literature.
Several particularly common modifications, glycosylation, lipid
attachment, sulfation, gamma-carboxylation of glutamic acid
residues, hydroxylation and ADP-ribosylation, for instance, are
described in most basic texts, such as, for instance, 1. E.
Creighton, Proteins-Structure and Molecular Properties, 2nd Ed.,
W.H. Freeman and Company, New York, 1993. Many detailed reviews are
available on this subject, such as, for example, those provided by
Wold, F., in Posttranslational Covalent Modification of Proteins,
B. C. Johnson, Ed., Academic Press, New York, pp 1-12, 1983; Sifter
et al., Meth. Enzymol. 182: 626-646, 1990 and Rattan et al.,
Protein Synthesis: Posttranslational Modifications and Aging, Ann.
N.Y. Acad. Sci. 663: 48-62, 1992.
[0178] It will also be appreciated, as is well known and as noted
above, that peptides and polypeptides are not always entirely
linear. For instance, polypeptides can be branched as a result of
ubiquitination, and they can be circular, with or without
branching, generally as a result of posttranslational events,
including natural processing events and events brought about by
human manipulation which do not occur naturally. Circular, branched
and branched circular polypeptides can be synthesized by non
translational natural processes and by entirely synthetic
methods.
[0179] Modifications can occur anywhere in a polypeptide, including
the peptide backbone, the amino acid side-chains and the amino or
carboxyl termini. In fact, blockage of the amino or carboxyl group
in a polypeptide, or both, by a covalent modification, is common in
naturally occurring and; synthetic polypeptides and such
modifications can be present in polypeptides of the present
invention, as well. For instance, the amino terminal residue of
polypeptides made in E. coli, prior to proteolytic processing,
almost invariably will be N-formylmethionine.
[0180] The modifications that occur in a polypeptide often will be
a function of how it is made. For polypeptides made by expressing a
cloned gene in a host, for instance, the nature and extent of the
modifications in large part will be determined by the host cell
posttranslational modification capacity and the modification
signals present in the polypeptide amino acid sequence. For
instance, as is well known, glycosylation often does not occur in
bacterial hosts such as E. coli. Accordingly, when glycosylation is
desired, a polypeptide should be expressed in a glycosylation host,
generally a eukaryotic cell. Insect cells often carry out the same
posttranslational glycosylation as mammalian cells and, for this
reason, insect cell expression systems have been developed to
efficiently express mammalian proteins having native patterns of
glycosylation, inter alia. Similar considerations apply to other
modifications.
[0181] It will be appreciated that the same type of modification
can be present to the same or varying degree at several sites in a
given polypeptide. Also, a given peptide or polypeptide can contain
many types of modifications.
[0182] In some embodiments, N-methyl and hydroxy-amino acids can be
substituted for conventional amino acids in solid phase peptide
synthesis. However, production of polymers with reduced peptide
bonds requires synthesis of the dimmer of amino acids containing
the reduced peptide bond. Such dimers are incorporated into
polymers using standard solid phase synthesis procedures. Other
synthesis procedures are well known in the art.
Effector Agents
[0183] The present invention provides a method to deliver effector
agents across the blood brain barrier using, for example, an RVG
peptide or variant thereof. Effector agents delivered by this
approach can include, for example but not limited to, therapeutic
agents, diagnostic agents and imaging agents among others.
[0184] In some embodiments, an RVG peptide is conjugated to a
carrier particle, and an effector agent is associated with the
carrier particle. In some embodiments, the carrier particle is a
cell permeable agent (for example but not limited to a polymeric
arginine residue of varying lengths such as 9R or 11R as disclosed
herein or TAT), and in alternative embodiments a carrier particle
is for example, a liposomal or polymeric nanoparticles such as a
liposome. In some embodiments, where the carrier particle is for
example a liposome, the carrier particle can further comprise cell
permeable agents and/or targeting agents.
[0185] An "effector agent" as used herein refers to an agent that
is transported by the carrier particle and targeting agent (i.e. an
RVG peptide) across the BBB. An effector agent can be a chemical
molecule of synthetic or biological origin. In some embodiments, an
effector agent is generally a molecule that can be used in a
pharmaceutical composition, for example the effector agent is a
therapeutic agent. An effector agent as used herein also refers to
any chemical entity or biological product, or combination of
chemical entities or biological products, administered to a subject
to treat or prevent or control a disease or condition, and are
herein referred to as "therapeutic agents".
[0186] In alternative embodiments, an effector agents can be a
chemical entity or biological product, or combination of chemical
entities or biological products, administered to a subject for
imaging purposes in the subject, for example to monitor the
presence or progression of disease or condition, and are herein
referred to as "imaging agents" or "diagnostic agents".
[0187] A chemical entity or biological product as disclosed herein
is preferably, but not necessarily a low molecular weight compound,
but can also be a larger compound, or any organic or inorganic
molecule, including modified and unmodified nucleic acids such as
antisense nucleic acids, RNAi, such as siRNA, shRNA, miRNA, nucleic
acid analogues, miRNA analogues, antigomirs, peptides,
peptidomimetics, avimers, receptors, ligands, and antibodies,
aptamers, polypeptides or analogues, derivatives or variants
thereof. For example, oligomers of nucleic acids, amino acids,
carbohydrates include without limitation proteins,
oligonucleotides, ribozymes, DNAzymes, glycoproteins, siRNAs,
lipoproteins, aptamers, and modifications, derivatives and
combinations thereof
[0188] A therapeutic agent is an agent useful in the treatment of a
disease, disorder or malignancy. In some embodiments, the disease,
disorder or malignancy is a central nervous system (CNS) disorder,
for example but not limited to a neurodegenerative disease. In some
embodiment, the disease or disorder is associated with cells
expressing the acetylcholine receptor.
[0189] As used herein, the terms "treating" or "treatment" of a
disease include preventing the disease, i.e. preventing clinical
symptoms of the disease in a subject that can be exposed to, or
predisposed to, the disease, but does not yet experience or display
a symptom of the disease; inhibiting the disease, i.e., arresting
the development of the disease or a clinical symptom of the
disease; or relieving the disease, i.e., causing regression of the
disease or a clinical symptom of the disease.
[0190] Effector agents useful in the present invention include, for
example effector agents for the treatment of diseases associated
with cells expressing the a subunit of the acetylcholine receptor,
e.g., cells protected by the BBB, e.g., neuronal cells, e.g., brain
cancer cells. Useful therapeutic agents include nucleic acids such
as siRNA, small molecule drugs, peptides. More than one therapeutic
agent can be delivered by the delivery agent of the present
invention.
[0191] Effector agents delivered by the compositions and methods of
the present invention include siRNAs targeting viruses infecting
neuronal cells, such as siRNAs targeting flaviviruses, e.g.,
Japanese encephalitis virus, (see U.S. Prov. Appl. 60/723,686 and
Kumar et al. PLoS Med. 2006 April; 3(4):e96) which are incorporated
herein in their entirety by reference, siRNAs targeting
herpesviruses, e.g., HSV-1, HSV-2, varicella zoster virus (see U.S.
Prov. Appl. 60/687,216 and Palliser et al., 2006, Nature 439,
89-94) which are incorporated herein in their entirety by
reference. In one embodiment, the siRNAs targeting herpesvirus
target the latency associated transcript (e.g., GenBank Accession
no. M17921).
[0192] Effector agents delivered by the composition and methods as
disclosed herein include therapeutic agents for prevention and/or
treatment of brain tumors. For example, RNAi-induced
down-regulation of the oncogenic EGFR can serve as an effective
therapy for brain tumors [37]. A significant (.about.50%) decline
in the growth of intracranial gliomas also has been attained by
RNAi-mediated knockdown of proteases, such as the receptor-bound
urokinase plasminogen activator, cathepsin B, or matrix
metalloprotease-9, which enable tumor progression [36, 87].
Complete regression of the tumor growth was achieved with osmotic
minipump-aided intratumoral infusion of a combination of
shRNAs.
[0193] Effector agents for the treatment of neuronal diseases can
be delivered by the methods as disclosed herein to treat, for
example, neurological disorders and neurodegenerative disease for
example but not limited to, Alzheimer's disease, Parkinson's
disease, Huntington's disease, A.L.S., multiple sclerosis,
neuro-AIDS, brain cancer, stroke, brain injury, spinal cord injury,
autism, lysosomal storage disorders, fragile X syndrome, inherited
mental retardation, inherited ataxias, blindness, paralysis,
stroke, traumatic brain injury and spinal cord injury.
[0194] Effector agents delivered by the methods as disclosed herein
include small molecules chemical and peptides to block
intracellular signaling cascades, enzymes (kinases), proteasome
function, lipid metabolism, cell cycle and membrane trafficking.
Agents delivered by the methods of the present invention include
agents that promote neuronal growth, e.g., axonal outgrowth. Such
therapeutic agents can be useful in the treatment of neuronal
injury, e.g., spinal cord injury, stroke and traumatic brain
injury.
[0195] A wide variety of therapeutic agents are available and are
encompassed for use as effector agents, for example but not limited
to: protein neurotrophic factors (for example, nerve growth factor)
to treat brain injury, neurological diseases or disorders and
neurodegenerative diseases; enzymes to replace enzymatic activities
lost through genetic defects where the loss causes severe metabolic
storage diseases such as Tay-Sachs disease; neurotransmitters and
neuromodulators, such as dopamine and .beta.-endorphin, that would
be useful for treating Parkinson's disease and intractable pain,
respectively, or conditions including disorders of movement,
cognition, and behavior: antibiotics for treating infectious
diseases, such as neurosyphilis or AIDS, where penetration into the
brain of systemically administered antibiotics is presently a block
to treatment; chemotherapeutic agents for treating brain tumors
with agents that do not reach the tumor in sufficient amounts when
tolerable doses are administered systemically; and diagnostic
agents, such as specific contrast media for brain imaging, that are
currently not used because of poor penetration into the brain upon
systemic administration.
[0196] Further exemplary therapeutic agents useful in the methods
as described herein include for example, but are not limited to;
various neurotrophic factors, growth factors, or neurite inhibitory
factors that can help prevent or repair various forms of neuronal
damage caused by CNS disorders such as neurodegenerative diseases,
or by ischemic or hypoxic crises such as stroke, cardiac arrest,
suffocation, blood loss, or other types of physical injury or
trauma. In some embodiments, therapeutic agents are also various
neurotrophic hormones, growth factors, or neurite inhibitory
factors that can help stimulate the formation of new synaptic
connections between existing neurons and/or guide the outgrowth of
neuronal processes to facilitate some connections and discourage
others. In some subjects, this type of treatment can help
facilitate the recovery of nervous function lost due to aging or
various diseases. It can also help subjects regain muscular,
speech, and other functions after a stroke, head injury, or other
ischemic, hypoxic, excitotoxic, or similar crisis.
[0197] In further embodiments, therapeutic agents for use as
effector agents can include various types of endocrine, paracrine,
and related or similar polypeptides that can help treat various
glandular, growth-related, maturation-related, sexual, and other
disorders. Effector agents can be, for example, polypeptides that
increase the quantities of certain neurotransmitter molecules
inside the BBB to treat various neurodegenerative diseases. For
example, polypeptides that can increase dopamine levels inside the
brain (by acting as enzymes, hormones, or release factors, or
through various other mechanisms) can be used to treat Parkinson's
disease. Alternately, polypeptides that can increase acetylcholine
levels can be useful for treating Alzheimer's disease.
[0198] In some embodiments of the present invention, effector
agents, for example therapeutic agents can be any desired entity,
e.g. polypeptide, polynucleotide, chemical compound, growth factor,
hormone, antibody, cytokine, or the like including entities that
cannot pass across the blood-brain barrier by themselves.
[0199] Usually, an agent that is a therapeutic agent is useful for
treating neuronal cells or other target cells associated with any
neurologically related disorder. For example, an effector agent to
be delivered by the compositions and methods as disclosed herein
can be a pharmaceutically active agent or a combination thereof
that at least as part of its action targets the central nervous
system, olfactory, visual system, or any other system associated
with neurologically related disorders.
[0200] Examples of such therapeutic agents useful as effector
agents are, but are not limited to neurotrophic factor including,
without any limitation, nerve growth factor (NGF), ciliary
neurotrophic factor (CNTF), brain-derived neurotrophic factor
(DNTF), and glial-derived neurotrophic factor (GDNF). In another
embodiment, effector agent useful to be delivered by the
compositions and methods as disclosed herein include, without
limitation cardiotrophin-1 (CT1), insulin-like growth factor-1
(IGF1), transforming growth factor-32 (TGF-32), epidermal growth
factor (EGF), fibroblast growth factor (FGF), vascular endothelial
growth factor (VEGF) and interferon .alpha..
[0201] In yet another embodiment, the effector agents useful in the
methods as disclosed herein are for example, insulin, glia-derived
nexin, gangliosides, phosphatylserine, extracellular matrix
remodeling enzymes and their inhibitors, integrins and their
ligands, nerve toxins, nerve transmitters, protein chaperones, or
protease inhibitors, e.g. serine protease inhibitors such as
4-(2-aminoethyl)-benzenesulfonyl fluoride (AEBSF) and
horseradish-peroxidase (HRP).
[0202] In another embodiment, the effector agent, for example a
siRNA therapeutic agent as disclosed herein can be prepared to be
delivered in a "prodrug" form. The term "prodrug" indicates a
therapeutic agent that is prepared in an inactive form that is
converted to an active form (i.e., drug) within the body or cells
thereof by the action of endogenous enzymes or other chemicals
and/or conditions.
[0203] According to the present invention, the effector agent of
the present invention can be transported to various target cells or
tissues. For example, the effector agent of the present invention
can be transported to any nerve cell, e.g. nerve cell in the
central nervous system, olfactory, or visual system. The effector
agent of the present invention can also be transported to a
neurologically related target cell or tissue, e.g. cells or tissues
that interact with or are targets of the nervous system.
[0204] In some embodiments, the therapeutic agents useful as
effector agents are cytotoxic or growth-suppressing polypeptides
that can be used inside the BBB to treat certain types of cancer or
other diseases. Therapeutic agents useful in the present invention
include, for example, various types of receptor antagonists,
antibodies, and other polypeptides that can block or suppress one
or more types of neuronal activity and can be used to help control
and reduce neuropathic pain, hyperalgesia, and similar
problems.
[0205] In some embodiments, lysosomal storage diseases due to lack
of a particular polypeptide in the CNS can be treated by delivery
of an agent comprising that polypeptide or a mimetic thereof into
the CNS by the methods of the present invention.
[0206] In further embodiments, infections of the CNS by viruses,
prions, or bacteria can be treated by delivering into the CNS
effector agents that help control or reduce the spread of the
infection. For example, delivery of effector agents comprising
polypeptides that bind to the receptors and inhibit virus docking
and/or viral transport can be able to reduce the spread of viruses,
such as HIV or HSV within the CNS. Further embodiments include, for
example, effector agents which are recombinant antibodies to
antigens within the CNS that can be used to modulate physiological
processes in a beneficial or useful way. For example, delivery of
recombinant antibodies to myelin associated neurite inhibitory
molecules such as No-Go can be able to enable regrowth and
regeneration of CNS nerves, following spinal cord injury and other
traumatic injuries.
[0207] In some embodiments, an effector agent is a therapeutic
agent for the treatment of brain tumors and gliomas which can be
delivered by the methods as described herein, for example such
therapeutic agents are chemotherapy agents. The term
"chemotherapeutic agent" or "chemotherapy agent" are used
interchangeably herein and refers to an agent that can be used in
the treatment of cancers and neoplasms, for example brain cancers
and gliomas and that is capable of treating such a disorder. In
some embodiments, a chemotherapeutic agent can be in the form of a
prodrug which can be activated to a cytotoxic form.
Chemotherapeutic agents are commonly known by persons of ordinary
skill in the art and are encompassed for use in the present
invention. For example, chemotherapeutic drugs for the treatment of
brain tumors and gliomas include, but are not limited to:
temozolomide (Temodar), procarbazine (Matulane), and lomustine
(CCNU). Chemotherapy given intravenously (by IV, via needle
inserted into a vein) includes vincristine (Oncovin or Vincasar
PFS), cisplatin (Platinol), carmustine (BCNU, BiCNU), and
carboplatin (Paraplatin), Mexotrexate (Rheumatrex or Trexall).
[0208] The term "effective amount" as used herein refers to the
amount of therapeutic agent of pharmaceutical composition to
alleviate at least some of the symptoms of the disease or disorder.
The term "effective amount" includes within its meaning a
sufficient amount of pharmacological composition to provide the
desired effect. The exact amount required will vary depending on
factors such as the type of tumor to be treated, the severity of
the tumor, the drug resistance level of the tumor, the species
being treated, the age and general condition of the subject, the
mode of administration and so forth. Thus, it is not possible to
specify the exact "effective amount". However, for any given case,
an appropriate "effective amount" can be determined by one of
ordinary skill in the art using only routine experimentation.
[0209] In one embodiment, the carrier particle is a liposomal or
polymeric nanoparticles, for example a liposome. The therapeutic
agents can be associated with nanoparticles such as liposomes by
any method known to the skilled artisan, including encapsulation in
the interior, association with the lipid portion of the molecule or
association with the exterior of the liposome. Small molecule drugs
soluble in aqueous solution can be encapsulated in the interior of
the liposome. Small molecule drugs that are poor soluble in aqueous
solution can associate with the lipid portion of the liposome.
siRNAs can associate with the exterior of the liposome. siRNAs can
be condensed with cationic polymers, e.g., PEI, or cationic
peptides, e.g., protamines, and encapsulated in the interior of the
liposome. Therapeutic peptides can be encapsulated in the interior
of the liposome. In some embodiments, therapeutic peptides, and/or
targeting agents, for example, transferrin, insulin like growth
factor (IGF) and II and peptidomimetics and antibodies thereof can
be covalently attached to the exterior of the liposome.
[0210] In one embodiment, an effector agent is a nucleic acid,
e.g., plasmid, DNA, shRNA, miRNA, stRNA, siRNA, miRNA mimetic or
antigomir. In such embodiments where the effector agent is a
nucleic acid, the carrier particles associated with the effector
agent can be liposomal or polymeric nanoparticles such as a
liposome or in some embodiments the carrier particle is a peptide,
for example, TAT, or an polymeric arginine peptide of varying
length, such as 11R or 9R as disclosed herein (Melikov et al., Cell
Mol Life Sci. 2005; 62: 2739-49). Alternatively, carrier particles
useful for transporting nucleic acid effector agents to the BBB
include, for example protamines, liposomes and polymers. In another
embodiment, the effector agent a siRNA and the carrier particle is
a carrier protein such as an polymeric arginine peptide of varying
length, such as 11R or 9R as disclosed herein.
[0211] In some embodiments, an effector agent, for example RNA
interfering agent and the carrier particle are combined together
prior to contacting a biological membrane. Combining the RNA
interfering agent and the carrier particle results in an
association of the effector agent and the carrier particle. In one
embodiment, an RNA interfering agent and the carrier particle are
directly linked together, and thus, linkers are not required for
association of the effector agent, for example RNA interference
molecule) with the carrier particle. In another embodiment, the RNA
interfering agent and the carrier polymer are bound together via
electrostatic bonding.
[0212] In some embodiments, the effector agent functions as an RNA
interference molecule. The term "RNAi" as used herein refers to
interfering RNA, or RNA interference molecules are nucleic acid
molecules or analogues thereof for example RNA-based molecules that
inhibit gene expression. RNAi refers to a means of selective
post-transcriptional gene silencing. RNAi can result in the
destruction of specific mRNA, or prevents the processing or
translation of RNA, such as mRNA.
[0213] In some embodiments, an effector agent is a siRNA. The term
"short interfering RNA" (siRNA), also referred to herein as "small
interfering RNA" is defined as an agent which functions to inhibit
expression of a target gene, e.g., by RNAi. An siRNA can be
chemically synthesized, it can be produced by in vitro
transcription, or it can be produced within a host cell. siRNA
molecules can also be generated by cleavage of double stranded RNA,
where one strand is identical to the message to be inactivated.
[0214] In one embodiment, an siRNA effector agent is a double
stranded RNA (dsRNA) molecule of about 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, or 30 nucleotides in length, preferably
about 15 to about 28 nucleotides, more preferably about 19, 20, 21,
22, 23, 24, or 25 nucleotides in length, and more preferably about
19, 20, 21, 22, or 23 nucleotides in length, and can contain a 3'
and/or 5' overhang on each strand having a length of about 1, 2, 3,
4, or 5 nucleotides. The length of the overhang is independent
between the two strands, i.e., the length of the over hang on one
strand is not dependent on the length of the overhang on the second
strand. Preferably the siRNA is capable of promoting RNA
interference through degradation or specific post-transcriptional
gene silencing (PTGS) of the target messenger RNA (mRNA).
[0215] An siRNAs effector agent for use in the methods as disclosed
herein also include small hairpin (also called stem loop) RNAs
(shRNAs). In one embodiment, these shRNAs are composed of a short,
e.g. about 19 to about 25 nucleotide, antisense strand, followed by
a nucleotide loop of about 5 to about 9 nucleotides, and the
analogous sense strand. Alternatively, the sense strand can precede
the nucleotide loop structure and the antisense strand can follow.
These shRNAs can be contained in plasmids, retroviruses, and
lentiviruses and expressed from, for example, the pol III U6
promoter, or another promoter (see, e.g., Stewart, et al. (2003)
RNA April; 9(4):493-501, incorporated by reference herein in its
entirety).
[0216] The term "shRNA" as used herein refers to short hairpin RNA
which functions as RNAi and/or siRNA species but differs in that
shRNA species are double stranded hairpin-like structure for
increased stability.
[0217] In some embodiments, the effector agent is an avimer.
Avimers are multi-domain proteins with binding and inhibiting
properties and are comprised typically of multiple independent
binding domains linked together, and as such creates avidity and
improved affinity and specificity as compared to conventional
single epitope binding proteins such as antibodies. In some
embodiments, one can use an avimer that is a protein or polypeptide
that can bind simultaneously to a single protein target and/or
multiple protein targets, as known as multi-point attachment in the
art. Avimers are useful as therapeutic agents which function son
multiple drug targets simultaneously for the progenitor cell and/or
treatment of multifactorial diseases or disorders, for example
multifactorial neurodegenerative diseases or neurological
disease.
[0218] In some embodiments, the effector agent is a antigomir.
Antigomirs are oligonucleotides, for example synthetic
oligonucleotides capable of gene silencing endogenous miRNAs.
[0219] The term "association" or "interaction" as used herein in
reference to the association or interaction of an effector agent,
e.g., siRNA, with a carrier particle, refers to any association
between the effector agent, e.g., siRNA, with a carrier particle,
e.g., a peptide carrier, either by a direct linkage or an indirect
linkage. An indirect linkage includes an association between a
effector agent, e.g., siRNA, and a carrier particle wherein said
effector agent, e.g., siRNA, and said carrier particle are attached
via a linker moiety, e.g., they are not directly linked. Linker
moieties include, but are not limited to, e.g., nucleic acid linker
molecules, e.g., biodegradable nucleic acid linker molecules. A
nucleic acid linker molecule can be, for example, a dimer, trimer,
tetramer, or longer nucleic acid molecule, for example an
oligonucleotide of about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more nucleotides
in length.
[0220] A direct linkage includes any linkage wherein a linker
moiety is not required. In one embodiment, a direct linkage
includes a chemical or a physical interaction wherein the two
moieties, the therapeutic agent, e.g., siRNA, and the carrier
particle, interact such that they are attracted to each other.
Examples of direct interactions include non-covalent interactions,
hydrophobic/hydrophilic, ionic (e.g., electrostatic, coulombic
attraction, ion-dipole, charge-transfer), Van der Waals, or
hydrogen bonding, and chemical bonding, including the formation of
a covalent bond. Accordingly, in one embodiment, an effector agent,
e.g., siRNA, and the carrier particle are not linked via a linker,
e.g., they are directly linked. In a further embodiment, the
therapeutic agent, e.g., siRNA, and the carrier particle are
electrostatically associated with each other.
[0221] In some embodiments, the effector agent can be an imaging
agent. In order to function as a suitable effector agent for
medical imaging, the effector agent is useful in a molecular
imaging diagnosis procedure, for example but not limited to,
magnetic resonance (MR) imaging. Delivery of such effector agents
using the methods and compositions as disclosed herein can enhance
the imaging of CNS (i.e. brain and spinal cord) structures and
function by MRI or PET for example. Contrast enhancement can be
provided by gadolinium, for example, gadolinium in the form of
Gd-DTPA-aminohexanoic acid. Other imaging agents are useful in the
methods as disclosed herein include, for example other lanthanide
ion coordination complexes can allow for even greater enhanced
relaxation at higher field strength (Aime, S., et al., Chem. Soc.
Rev. 27:19-29, 1998; Aime et al., J. Mannet. Reson. Iman.
16:394-406, 2002). Paramagnetic CES T agents are useful as imaging
agents in the methods and compositions as disclosed herein, for
example as Eu+3, Tb+3, Dy+3, Er+3, Tm+3, or Yb+3 alter tissue
contrast via chemical exchange saturation transfer of presaturated
spins to bulk I water (Elst, L. V., et al., Mann. Reson. Med.
47:1121-1130, 2002). In some embodiments, more than one imaging
agent can be used simultaneously in the composition and methods of
the present invention, with techniques available for attachment of
multiple imaging agents, for example Gd-DTPA to proteins to enhance
the MR signal known by persons of ordinary skill in the art. The T1
acceleration and contrast enhancement of Gd and especially Fe have
been shown to saturate at very high field strength, however, while
these other lanthanides do not, thus taking full advantage of the
increased resolution of very high field strengths.
[0222] In some embodiments, an imaging effector agent is useful as
diagnostic agent capable of detection in vivo following
administration. Exemplary imaging effector agents useful for
diagnostic purposes include electron dense material, magnetic
resonance imaging agents, radiopharmaceuticals and fluorescent
molecules. Radionucleotides useful for imaging include
radioisotopes of copper, gallium, indium, rhenium, and technetium,
including isotopes .sup.64Cu, .sup.67Cu, .sup.111In, .sup.99mTc,
.sup.67Ga or .sup.68Ga. Imaging agents disclosed by Low et al. in
U.S. Pat. No. 5,688,488, incorporated herein by reference, are also
useful in the compositions as disclosed herein.
[0223] Accordingly in some embodiments, the methods as disclosed
herein provides methods that are useful for diagnostic purposes,
for example but not limited to visualization of plaques and other
structures in the CNS of a subject, for example visualization of
plaques in the brain of subject with Alzheimer's Disease. In
further embodiments, the compositions and methods of the present
invention are useful for monitoring the effect of a therapeutic
intervention and/or for prognostic purposes. For example, in some
embodiments the present invention can be used for monitoring the
efficacy of a therapeutic treatment in a subject treated with a
therapy for Alzheimer's Disease and monitoring the reduction of
plaques in the subject brain.
[0224] Accordingly, as disclosed herein the method provides a means
to deliver nucleic acids, such as siRNA, nucleic acids, nucleic
acid analogues, miRNA, miRNA mimetics, antigomirs and the like to
neuronal cells in vivo and in vivo. The methods as disclosed herein
are useful for delivering effector agents to neuronal cells in
vitro, in vivo or ex vivo for multiple purposes, such as (i)
research purposes including but not limited to investigating or
studying neuronal function and responses, increasing our
understanding of neuronal survival, development, and response to
agents as well as general neuronal function and neuronal toxicity
assays, and (ii) therapeutic purposes.
Central Nervous System (CNS) Disorders
[0225] In some embodiments, the present invention provides methods
to deliver effector agents across the blood brain barrier in a
subject. In an alternative embodiment, the present invention
provides methods to treat CNS disorders, the method comprising
administering to a subject a composition comprising an effector
agent, a targeting agent (for example, an RVG peptide or variant or
fragment or derivative thereof) and a carrier particle, wherein the
effector agent is associated with the carrier particle. Examples of
carrier particles are for example, but not limited to cell
permeable agents and various forms of liposomal or polymeric
nanoparticles such as liposomes. Thus, the present invention
provides methods to treat CNS disorders, such as neurological
disorders and neurodegenerative diseases.
[0226] CNS disorders include disorders of the central nervous
system as well as disorders of the peripheral nervous system. CNS
disorders include, but are not limited such as neurological
disorders, neurodegenerative diseases, brain and spinal cord
injuries, cerebrovascular ischemia, neurodegenerative diseases,
dementia, traumatic brain injury, stroke, post-stroke,
post-traumatic brain injury, small-vessel cerebrovascular disease,
and neurological disorders: for example pugilist, pain, neuropathy,
neurotrauma, organophosphate poisoning, depression, schizophrenia,
anxiety disorders, epilepsy and bipolar disorder and
cognitive-related disorders such as dementia and memory loss.
[0227] Examples of neurodegenerative diseases useful to be treated
by the method and compositions as disclosed herein include, for
example but not limited to: amyotrophic lateral sclerosis (ALS),
Parkinson's disease, Huntington's disease, Wilson's disease,
multi-system atrophy, Alzheimer's disease, Pick's disease,
Lewy-body disease, Hallervorden-Spatz disease, torsion dystonia,
hereditary sensorimotor neuropathies (HMSN),
Gerstmann-Skaussler-Schanker; disease, Creutzfeld-Jakob-disease,
Machado-Joseph disease, Friedreich ataxia, Non-Friedreich ataxias,
Gilles de la Tourette syndrome, familial tremors,
olivopontocerebellar degenerations, paraneoplastic cerebral
syndromes, hereditary spastic paraplegias, hereditary optic
neuropathy (Leber), retinitis pigmentosa, Stargardt disease, and
Kearns-Sayre syndrome.
[0228] Other neurodegenerative disorders include, for example e.g.
Alpers' disease, Autosomal Dominant Neurodegenerative Disorder,
Batten Disease, Cerebral calcinosis, Cockayne Syndrome,
corticobasal ganglionic degeneration, Dementia with Lewy Bodies,
Lewy Body Variant, Multiple System Atrophy, Neuronal inkanuclear
inclusion disease, Olivopontocerebellar Atrophy, Postpoliomyelitis
Syndrome, Progressive Supranuclear Palsy, Rett Syndrome, Shy-Drager
Syndrome, Tauopathies, Tri-nucleotide repeat diseases, and Tuberous
Sclerosis.
[0229] Further examples of neurodegenerative disorders, include for
example cerebrovascular accidents (CVA), vascular-related dementia,
bovine spongiform encephalopathy (BSE), multiple sclerosis (MS),
peripheral disorders with a CNS component, such as septic shock,
hepatic encephalopathy, (diabetic) hypertension, diabetic
microangiopathy, sleeping sickness, Whipple disease, Duchenne
muscular dystrophy (DMD) and (pre)eclampsia, neuropsychiatric
disorders, such as depression, autism, anxiety attention deficit
hyperactivity disorder (ADHD), bipolar disorder, schizophrenia and
other psychoses.
[0230] Other CNS disorders include, for example brain tumors,
epilepsy, migraine, narcolepsy, insomnia, chronic fatigue syndrome,
mountain sickness, encephalitis, meningitis, AIDS-related
dementia.
[0231] Parkinson's disease (which is classically characterized
chiefly by depigmentation of the substantia nigra and by the
presence of Lewy bodies) and Parkinsonian Syndromes (or
Parkinsonian disorders) are useful to be treated by the method and
compositions as disclosed herein. Parkinson's disease differs from
other parkinsonian disorders based on clinicopathologic criteria.
(Dauer and Przedborski (2003), Neuron, 39, 889-909). Examples of
Parkinsonism syndromes include, for example but not limited to;
Parkinson's disease, Secondary Parkinsonism, a familial
neurodegenerative disease or a Parkinsonism plus syndrome.
Classification of Parkinsonism is briefly, Primary (idiopathic)
Parkinsonism-Parkinson's disease (sporadic, familial), Secondary
(acquired, symptomatic) Parkinsonism-infectious (postencephalitic,
slow virus), drug-induced (dopamine antagonists and depletors),
Hemiatrophy (hemiparkinsonism), Hydrocephalus (normal pressure
hydrocephalus), hypoxia, infectious (postencephalistis), metabolic
(parathyroid dysfunction), toxin (MPTP, CO, Mn, Hg. CS2, methanol,
ethanol), Trauma (pugilistic encephalopathy), tumor, and vascular
(multinfarct state), Heredodegenerative Parkinsonism-Huntington's
disease, Wilson's disease, Hallervorden-Spatz disease,
Olivopontocerebellar and spinocerebeller degenerations,
neuroacanthocytosis, Lubag (X-linked dystonia-parkinsonism), and
mitochondrial cytopathies with stratial necrosis Multiple system
degenerations (parkinsonism plus)-Cortical-basal ganglionic
degeneration, Dementia syndromes (Alzheimer's diseases, diffuse
Lewy body disease, frontotemporal dementia), Lytico-Bodig
(Guamanian Parkinsonism-dementia-ALS), Multiple system atrophy
syndromes (striatonigral degeneration, Shy-Drager syndrome,
sporadic olivopontocerebellar degeneration (OPAC), motor neuron
disease parkinsonism), Progressive pallidal atrophy, and
progressive supranuclear palsy.
[0232] The methods and compositions as disclosed herein are also
useful in the treatment of dementias, for example but not limited
to, vascular dementia, dementia with Lewy bodies, frontotemporal
dementia and Parkinsonism linked to chromosome 17, front and
temporal dementias, progressive nuclear palsy, corticobasal
degeneration, Huntington's disease, thalamic degeneration,
Creutzfeldt-Jakob dementia, HIV dementia, schizophrenia with
dementia, and Korsakoff's psychosis.
[0233] Similarly, cognitive-related disorders, such as mild
cognitive impairment, age-associated memory impairment, age-related
cognitive decline, vascular cognitive impairment, attention deficit
disorders (ADD), attention deficit hyperactivity disorders (ADHD),
and memory disturbances in children with reaming disabilities can
be treated using the methods and compositions as disclosed
herein.
[0234] The methods and compositions as disclosed herein are also
useful in treatment of depression. Depression is characterized by
sadness, loss of interest in activities, and decreased energy.
Other symptoms include loss of confidence and self-esteem,
inappropriate guilt, thoughts of death and suicide, diminished
concentration, and disturbance of sleep and appetite. A variety of
somatic symptoms can also be present. Though depressive feelings
are common, especially after experiencing setbacks in life,
depressive disorder is diagnosed only when the symptoms reach a
threshold and last at least two weeks. Depression can vary in
severity from mild to very severe, and includes polar (constant)
and unipolar (mainic or bi-polar) depression, as well as seasonal
affective disorder (SAD). Depression is typically characterized
into eight basic dimensions i.e., Pessimism, Weak Concentration,
Sleep Problems, Anhedonia, Fatigue, Loneliness, Low Self-esteem,
and Somatic Complaints to define the profile of children's and
adolescents' depression. Depression can occur as an idiopathic
disease (with no somatic disease associated with it), or it can be
a psychiatric symptom of a somatic disorder, especially a number of
neurodegenerative disorders.
[0235] Depressive disorders (DDs) are frequent psychiatric
comorbidities of neurological disorders like multiple sclerosis,
stroke, dementia, migraine, Parkinson's disease, and epilepsy. The
clinical manifestations of DDs in these neurological disorders are
identical to those of idiopathic mood disorders, for example,
Multiple Sclerosis, Traumatic brain injury, stroke: dementia,
Alzheimer's disease, Migraine, Parkinson's disease, Epilepsy and
Huntington's Disease.
[0236] In some embodiments, the methods and compositions as
disclosed herein are also useful for modulating neuronal physiology
by delivery of agents that alter the expression of neuropeptide
genes, for example agents that act as agonists or antagonists or
activate or inhibit genes, for example genes that (i) express
polypeptides that can block and suppress pain (such as so-called
"endorphins"); (ii) genes that express growth factors; (iii) genes
that express polypeptides to promote regeneration or prolong the
life-spans of cells; and genes express toxic polypeptides, such as
to kill tumor cells
[0237] In some embodiments, the methods and compositions as
disclosed herein are also useful in the treatment of pain and pain
disorders. Pain includes, for example, nociceptive pain (pain as a
result of injury to bodily tissues), including inflammatory pain,
allodynia, hyperallodynia, and neuropathic (pain as a result of
abnormalities to nerves, spinal cord and brain), including phantom
limb pain, post-therapeutic neuralgia. Pain can be acute or chronic
pain, and also includes psychogenic pain (pain related to a
physiological disorder). Nociceptive pain includes somatic and
visceral pain (for example pancreatits, intestinal cystitis,
dysmenorrheal, irritable Bowel syndrome, Crohn's disease, biliary
colic, urethral colic, myocardial infarction and pain syndromes of
the pelvic cavity, e.g., vulvodynia, orchialgia, urethral syndrome
and protatodynia.). Neuropathic pain includes sympathetic pain.
Pain can be associated with CNS disorders, for example, multiple
sclerosis, spinal cord injury, sciatica, failed back surgery
syndrome, traumatic brain injury, epilepsy, Parkinson's disease,
post-stroke, and vascular lesions in the brain and spinal cord
(e.g., infarct, hemorrhage, vascular malformation).
[0238] Neuropathic pain relates to pathological condition that
affects neurons, in a manner that generates unwanted and excessive
pain signals. This is often some anatomical reorganization of the
nerve connections within the BBB, such that there is chronic or
inappropriate pain response. The term "hyperalgesia" is also used,
as a descriptive term that translates directly to "excessive pain"
and the term "allodynia" is also used to refer to this condition.
Neuropathic pain includes post mastectomy pain, "phantom limb"
pain, reflex sympathetic dystrophy (RSD), trigeminal
neuralgiaradioculopathy, post-surgical pain, HIV/AIDS related pain,
cancer pain, metabolic neuropathies (e.g., diabetic neuropathy,
vasculitic neuropathy secondary to connective tissue disease),
paraneoplastic polyneuropathy associated, for example, with
carcinoma of lung, or leukemia, or lymphoma, or carcinoma of
prostate, colon or stomach, trigeminal neuralgia, diabetic
neuropathy, cranial neuralgias, and post-herpetic neuralgia,
arachnoiditis, post-infective pain (such as outbreaks of
"shingles", caused by herpes zoster virus and lingering chronic
pain that arises after a traumatic injury. Pain associated with
peripheral nerve damage, central pain (i.e. due to cerebral
ischemia) and various chronic pain i.e. lumbago, back pain (low
back pain), sciatica inflammatory and/or rheumatic pain. Headache
pain (for example, migraine with aura, migraine without aura, and
other migraine disorders), episodic and chronic tension-type
headache, tension-type like headache, cluster headache, and chronic
paroxysmal hemicrania. Causalgia is another type of neuropathic
pain well as other types of neuropathic pain are well known by
persons of skill in the art Neuropathic pain can range over a very
wide span of intensity and starting at annoying up to excruciating,
debilitating and unbearable.
[0239] In some embodiments, the methods and compositions as
disclosed herein useful for treating some cases of learning or
memory dysfunction, for example, such as occur in aging, dementia,
after brain trauma or injury, and after various types of major
surgery, especially surgery involving a cardiopulmonary bypass
machine.
[0240] In further embodiments, the methods and compositions as
disclosed herein useful for treating disorders due to excitotoxic
damage of neurons, or resulting from diseases or injuries that
involve ischemia (inadequate blood flow, as occurs during a stroke
or cardiac arrest) or hypoxia (inadequate oxygen supply, as occurs
during drowning, carbon monoxide poisoning, etc.) or traumatic head
injury. For example, in animal studies NGF infusion can slow or
reverse the retrograde atrophy of cholinergic cell bodies and fiber
networks and other changes in the cholinergic system that are
caused by infarction or measured by infarct volumes or severity
(e.g., Cuello et al 1992). Administration of NGF (or induction of
NGF synthesis in viva by clenbuterol) has been shown to reduce
infarct volume in rat models of permanent middle cerebral artery
occlusion (Semkova et al 1999). Other animal data indicates that
NGF is able to act after a brain insult to block progression of
neuronal damage (e.g., Guegan et al 1998). Accordingly, by
delivering agents, for example NGF to the BBB after a stroke or
other brain injury or insult, it likely will be able to reduce the
extent and severity of subsequent neuronal loss.
[0241] In some embodiments, the methods and compositions as
disclosed herein are also useful to treat pathogen infections of
the brain and spinal cord, for example but not limited to pathogen
is Meningococci (Neisseria meningitidis) can cause infection of the
layers covering the brain and spinal cord (meningitis).
[0242] In some embodiments, the methods and compositions as
disclosed herein are also useful in treatment of neurological and
psychiatric diseases associated with neural cell death include
septic shock, intracerebral bleeding, subarachnoidal hemorrhage,
multiinfarct dementia, inflammatory diseases (such as vasculitis,
multiple sclerosis, and Guillain-Barre-; syndrome), neurotrauma,
peripheral neuropathies, polyneuropathies, epilepsies,
schizophrenia, depression, metabolic encephalopathies, and
infections of the central nervous system (viral, bacterial,
fungal).
[0243] In yet another embodiment, the methods and compositions as
disclosed herein are also useful to treat disorders where the
tissue affected is in contact with neurons and/or the CNS, for
example Anterior Horn Diseases including Poliomyelitis, Spinal
Muscular Atrophy (e.g. Werding-Hoffman), Muscle Disorders, (e.g.
Muscular Dystrophies including Duchene dystrophy, Becker dystrophy,
Limb Girdle dystrophy, Congenital Dystrophy, Facioscapulohumeral
dystrophy, Distal dystrophy, and Oculopharyngeal dystrophy,
Necrotizing Myopathies including Polymyositis, and Dermatomyositis,
Metabolic Myopathies including Malignant Hyperthermia,
Mitochondrial Myopathies, Myotonic Disorders, and Congenital
Myopathies), diseases of the Neuromuscular Junction, (e.g.
Myasthenia Gravis, and Eaton-Lambert Syndrome), diseases of the
Peripheral Nerve, (e.g. Metabolic Neuropathies including Diabetes
Mellitus, Vitamin deficiency, Uremia, and Porphyria, Toxic
Neuropathies including alcohol, vincristine, isoniazid, arsenic,
lead, hexane, hexachlorophene, acrylamide, and triethyltin,
Vasculitic Neuropathies including Polyarteritis nodosa,
Churg-Strauss Syndrome, and Rheumatoid artritis, Inflammatory
Neuropathies including Guillain-Barre and Chronic Inflammatory
demyelinating neuropathy, Hypertrophic Neuropathies including
Charcot-Marie-Tooth Disease, Dejerine-Sottas Neuropathy, and
Refsum's Disease, Genetic Neuropathies including the various forms
of leukodystrophy, Ataxia-telangiectasia and Giant Axonal
Neuropathy, Infectious Neuropathies including Herpes Zoster
Neuritis, Herpes Simplex, and Leprosy, Diabetic Neuropathies
including Distal symmetrical primarily sensory neuropathy,
Autonomic Neuropathy, Proximal asymmetrical painful primary
neuropathy, and Cranial mononeuropathy.
[0244] In other embodiments, the methods of the present invention
are also useful to treat CNS disorders where the CNS disorder is a
tumor or cancer. Tumors or cancers of the brain are referred to as
a brain tumor or cancer, glioma or oligodenrogliomia and are
included as CNS disorders herein.
[0245] The term "brain tumor" as used herein is any intracranial
tumor created by abnormal and uncontrolled cell division, normally
either found in the brain itself (neurons, glial cells (astrocytes,
oligodendrocytes, ependymal cells), lymphatic tissue, blood
vessels), in the cranial nerves (myelin-producing Schwann cells),
in the brain envelopes (meninges), skull, pituitary and pineal
gland, or spread from cancers primarily located in other organs
(metastatic tumors). Primary (true) brain tumors are commonly
located in the posterior cranial fossa in children and in the
anterior two-thirds of the cerebral hemispheres in adults, although
they can affect any part of the brain. Most primary brain tumors
originate from glia (gliomas), astrocytes (astrocytomas),
oligodendrocytes (oligodendrogliomas), or ependymal cells
(ependymoma). There are also mixed forms, with both an astrocytic
and an oligodendroglial cell component. These are called mixed
gliomas or oligoastrocytomas. Additionally, mixed glio-neuronal
tumors (tumors displaying a neuronal, as well as a glial component,
e.g. gangliogliomas, disembryoplastic neuroepithelial tumors) and
tumors originating from neuronal cells (e.g. gangliocytoma, central
gangliocytoma) can also be encountered.
[0246] Other varieties of primary brain tumors include: primitive
neuroectodermal tumors (PNET, e.g. medulloblastoma, meningiomas,
medulloepithelioma, neuroblastoma, retinoblastoma,
ependymoblastoma), tumors of the pineal parenchyma (e.g.
pineocytoma, pineoblastoma), ependymal cell tumors, choroid plexus
tumors, neuroepithelial tumors of uncertain origin (e.g.
gliomatosis cerebri, astroblastoma), etc. Another type of primary
intracranial tumor is primary cerebral lymphoma, also known as
primary CNS lymphoma, which is a type of non-Hodgkin's
lymphoma.
[0247] As used herein, the term "glioma" refers to a tumor
originating in the neuroglia of the brain or spinal cord. Gliomas
are derived form the glial cell types such as astrocytes and
oligodendrocytes, thus gliomas include astrocytomas and
oligodendrogliomas, as well as anaplastic gliomas, glioblastomas,
and ependymomas. Astrocytomas and ependymomas can occur in all
areas of the brain and spinal cord in both children and adults.
[0248] In some embodiments, the present invention is useful for
treating neurodegenerative disorders of the CNS (such as
Alzheimer's disease), by delivering agents such as neurotrophic or
neuroprotective factors to neurons at risk of degenerating. In some
embodiments, delivery of effector agents, for example neurotrophic
factors to target cells, is for example but not limited to the
affected neurons. As a non-limiting example, where the treatment is
for Alzheimer's Disease, the methods and compositions can be used
to deliver effector agents, for example, to the basal forebrain
cholinergic neurons in a subject having or at risk of developing
Alzheimer's disease. Such a delivery of such therapeutic agents can
slow, and potentially halt, the neurodegenerative process. In some
embodiments, the methods and compositions as disclosed herein are
useful for treating trauma or injury to the CNS (such as that which
occurs in head injury), by delivering an effector agent such as a
neuronal growth factor (such as neurotrophic factors) to the target
cells, where the target cells are injured and surviving neurons. As
an example, GDNF can be an effector agent which is delivered to
target cells such as cortical motor neurons for treatment of
subjects following stroke and/or head trauma and/or for the
treatment of ALS.
[0249] In further embodiments, the present invention can be adapted
to treatment of various types of CNS-related neurological disorders
or deficiencies which are correlated with either too little or too
much of some particular polypeptide. This can be accomplished by
using this method to deliver an agent into BBB-protected CNS
tissue, either: (i) an agent, for example a polypeptide which
provides an additional quantity of a polypeptide, to reduce or
eliminate a deficiency; or, (ii) an agent, for example an RNAi or
polypeptide which blocks, antagonizes, or otherwise suppresses a
certain molecule, receptor, or reaction, thereby helping to
controlling a CNS disorder that is caused or characterized by too
much of a particular molecule.
Therapeutic Administration
[0250] In one embodiment, the present invention provides a
composition comprising a targeting agent, for example an RVG
peptide and a carrier particle, wherein an effector agent is
associated with the carrier particle. In some embodiments, the
carrier particle is a liposomal or polymeric nanoparticles such as
a liposome or a cell permeable agent. In some embodiments, the
composition comprises an RVG peptide or fragment or variant
thereof, and a carrier peptide and can further comprise a cell
permeable agent.
[0251] In some embodiments, the composition comprises targeting
agents, for example RVG peptides conjugated to carrier particles,
and at least one effector agent. In some embodiments, where the
composition comprises a plurality of targeting agents and carrier
particles, there can be various different of targeting agents,
which can be conjugated all to the same type of carrier particle,
or different carrier particles. By way of a non-limiting example,
the composition can comprise an RVG peptide as a targeting agent
which is conjugated to a liposomal or polymeric nanoparticles such
as a liposome carrier peptide, and the composition can also
comprise another targeting agent-carrier particle conjugate
comprising a transferrin peptide as the targeting agent and a
polymeric arginine residue of various length, such as 9R or 11R as
disclosed herein as the carrier peptide. In other words, the
composition can comprise a plurality of targeting agent-carrier
particle conjugates with effector agents associated with the
carrier particles. Accordingly, in some embodiments the targeting
agent and carrier particle of each targeting agent-carrier particle
conjugate can be the same or different types of targeting agent and
carrier particles respectively. In some embodiments, the
composition comprises a plurality of targeting agents conjugated to
a plurality of different types of carrier particles. In some
embodiments, any combination of targeting agent can be used with
any combination of carrier particle. Accordingly, depending on the
carrier particles present in the composition will also determines
the types of effector agents also in the composition. As a
non-limiting example, if the composition comprises a targeting
agent-carrier particle conjugate comprising a liposome carrier
particle, the effector agent associated with the carrier particle
can be, for example a small molecule, whereas in alternative
embodiments, where the composition comprises a targeting
agent-carrier particle conjugate comprising a peptide carrier
particle, for example 9dR or 11dR, the effector agent associated
with the carrier particle can be, for example a nucleic acid for
example a RNAi.
[0252] In further embodiments where the composition comprises a
plurality of targeting agents and carrier particles, the effector
agent also present in the composition that is associated with the
carrier particle can also be different. For instance, an effector
agent associated with the carrier particle can be a different type
of effector agent, for example nucleic acid effector agent or a
peptide effector agent. In some embodiments, the effector agent can
be different variant of the same type of effector agent, for
example if the effector agent is a nucleic acid, the composition
can comprise both RNA and DNA effector agents. In further
embodiments, the composition can comprise a plurality of effector
agents that are variants of the same type of agent, for example
variants or derivatives of siRNA. By way of a non-limiting example,
the composition can comprise a plurality of RNAi effector agents
that associate with the carrier peptide, where the RNAi effector
agents are different, for example the RNAi effector agent silences
different gene targets or targets different regions on the same
gene.
[0253] Compositions as disclosed herein wherein the carrier
particle is a liposome or polymeric nanoparticle can be
administered by any convenient route, including parenteral,
enteral, mucosal, topical, e.g., subcutaneous, intravenous,
topical, intramuscular, intraperitoneal, transdermal, rectal,
vaginal, intranasal or intraocular. In one embodiment, the
compositions as disclosed herein are not topically administered. In
one embodiment, the delivery is by oral administration of the
composition formulation. In one embodiment, the delivery is by
intranasal administration of the composition, especially for use in
therapy of the brain and related organs (e.g., meninges and spinal
cord). Along these lines, intraocular administration is also
possible. In another embodiment, the delivery means is by
intravenous (i.v.) administration of the composition, which is
especially advantageous when a longer-lasting i.v. formulation is
desired. Suitable formulations can be found in Remington's
Pharmaceutical Sciences, 16th and 18th Eds., Mack Publishing,
Easton, Pa. (1980 and 1990), and Introduction to Pharmaceutical
Dosage Forms, 4th Edition, Lea & Febiger, Philadelphia (1985),
each of which is incorporated herein by reference.
[0254] The compositions as disclosed herein can be administered in
prophylatically or therapeutically effective amounts. The targeted
delivery compositions as disclosed herein can be administered along
with a pharmaceutically acceptable carrier. A prophylatically or
therapeutically effective amount means that amount necessary, at
least partly, to attain the desired effect, or to delay the onset
of, inhibit the progression of, or halt altogether, the onset or
progression of the particular disease or disorder being treated.
Such amounts will depend, of course, on the particular condition
being treated, the severity of the condition and individual patient
parameters including age, physical condition, size, weight and
concurrent treatment. These factors are well known to those of
ordinary skill in the art and can be addressed with no more than
routine experimentation. It is preferred generally that a maximum
dose be used, that is, the highest safe dose according to sound
medical judgment. It will be understood by those of ordinary skill
in the art, however, that a lower dose or tolerable dose can be
administered for medical reasons, psychological reasons or for
virtually any other reasons.
[0255] The terms "composition" or "pharmaceutical composition" are
used interchangeably herein and refers to compositions or
formulations that usually comprise an excipient, such as a
pharmaceutically acceptable carrier that is conventional in the art
and that is suitable for administration to mammals, and preferably
humans or human cells. Such compositions can be specifically
formulated for administration via one or more of a number of
routes, including but not limited to, oral, parenteral,
intravenous, intraarterial, subcutaneous, intranasal, sublingual,
intraspinal, intracerebroventricular, and the like. Cells
administered a composition as disclosed herein can be part of a
subject, for example for therapeutic, diagnostic, or prophylactic
purposes. The cells can also be cultured, for example cells as part
of an assay for screening potential pharmaceutical compositions,
and the cells can be part of a transgenic animal for research
purposes. In addition, compositions for topical (e.g., oral mucosa,
respiratory mucosa) and/or oral administration can form solutions,
suspensions, tablets, pills, capsules, sustained-release
formulations, oral rinses, or powders, as known in the art are
described herein. The compositions also can include stabilizers and
preservatives. For examples of carriers, stabilizers and adjuvants,
University of the Sciences in Philadelphia (2005) Remington: The
Science and Practice of Pharmacy with Facts and Comparisons, 21st
Ed.
[0256] The "pharmaceutically acceptable carrier" means any
pharmaceutically acceptable means to mix and/or deliver the
targeted delivery composition to a subject. The term
"pharmaceutically acceptable carrier" as used herein means a
pharmaceutically acceptable material, composition or vehicle, such
as a liquid or solid filler, diluent, excipient, solvent or
encapsulating material, involved in carrying or transporting the
subject agents from one organ, or portion of the body, to another
organ, or portion of the body. Each carrier must be "acceptable" in
the sense of being compatible with the other ingredients of the
formulation and is compatible with administration to a subject, for
example a human. For the clinical use of the methods of the present
invention, targeted delivery composition of the invention is
formulated into pharmaceutical compositions or pharmaceutical
formulations for parenteral administration, e.g., intravenous;
mucosal, e.g., intranasal; enteral, e.g., oral; topical, e.g.,
transdermal; ocular, e.g., via corneal scarification or other mode
of administration. The pharmaceutical composition contains a
compound of the invention in combination with one or more
pharmaceutically acceptable ingredients. The carrier can be in the
form of a solid, semi-solid or liquid diluent, cream or a capsule.
These pharmaceutical preparations are a further object of the
invention. Usually the amount of active compounds is between
0.1-95% by weight of the preparation, preferably between 0.2-20% by
weight in preparations for parenteral use and preferably between 1
and 50% by weight in preparations for oral administration.
[0257] The term "parenteral administration" and "administered
parenterally" as used herein means modes of administration other
than enteral and topical administration, usually by injection, and
includes, without limitation, intravenous, intramuscular,
intraarterial, intrathecal, intraventricular, intracapsular,
intraorbital, intracardiac, intradermal, intraperitoneal,
transtracheal, subcutaneous, subcuticular, intraarticular, sub
capsular, subarachnoid, intraspinal, intracerebro spinal, and
intrasternal injection and infusion. The phrases "systemic
administration," "administered systemically, " "peripheral
administration" and "administered peripherally" as used herein mean
the administration of a compound, drug or other material other than
directly into the central nervous system, such that it enters the
animal's system and, thus, is subject to metabolism and other like
processes, for example, subcutaneous administration.
[0258] As used herein, the terms "administering," and "introducing"
are used interchangeably herein and refer to the placement of the
pharmaceutical composition comprising the RVG peptide and
associated agents of the present invention into a subject by a
method or route which results in at least partial localization of
the agents at a desired site. The agents of the present invention
can be administered by any appropriate route which results in an
effective treatment in the subject.
[0259] In the preparation of pharmaceutical formulations containing
the targeted delivery composition of the present invention in the
form of dosage units for oral administration the compound selected
can be mixed with solid, powdered ingredients, such as lactose,
saccharose, sorbitol, mannitol, starch, arnylopectin, cellulose
derivatives, gelatin, or another suitable ingredient, as well as
with disintegrating agents and lubricating agents such as magnesium
stearate, calcium stearate, sodium stearyl fumarate and
polyethylene glycol waxes. The mixture is then processed into
granules or pressed into tablets.
[0260] Soft gelatin capsules can be prepared with capsules
containing a mixture of the active compound or compounds of the
invention in vegetable oil, fat, or other suitable vehicle for soft
gelatin capsules. Hard gelatin capsules can contain granules of the
active compound. Hard gelatin capsules can also contain the
targeted delivery composition including the targeting moiety and
the carrier particle as well as the therapeutic agent in
combination with solid powdered ingredients such as lactose,
saccharose, sorbitol, mannitol, potato starch, corn starch,
arnylopectin, cellulose derivatives or gelatin.
[0261] Dosage units for rectal or vaginal administration can be
prepared (i) in the form of suppositories which contain the active
substance mixed with a neutral fat base; (ii) in the form of a
gelatin rectal capsule which contains the active substance in a
mixture with a vegetable oil, paraffin oil or other suitable
vehicle for gelatin rectal capsules; (iii) in the form of a
ready-made micro enema; or (iv) in the form of a dry micro enema
formulation to be reconstituted in a suitable solvent just prior to
administration.
[0262] Liquid preparations for oral administration can be prepared
in the form of syrups or suspensions, e.g. solutions or suspensions
containing from 0.2% to 20% by weight of the active ingredient and
the remainder consisting of sugar or sugar alcohols and a mixture
of ethanol, water, glycerol, propylene glycol and polyethylene
glycol. If desired, such liquid preparations can contain coloring
agents, flavoring agents, saccharin and carboxymethyl cellulose or
other thickening agents. Liquid preparations for oral
administration can also be prepared in the form of a dry powder to
be reconstituted with a suitable solvent prior to use.
[0263] Solutions for parenteral administration can be prepared as a
solution of a compound of the invention in a pharmaceutically
acceptable solvent, preferably in a concentration from 0.1% to 10%
by weight. These solutions can also contain stabilizing ingredients
and/or buffering ingredients and are dispensed into unit doses in
the form of ampoules or vials. Solutions for parenteral
administration can also be prepared as a dry preparation to be
reconstituted with a suitable solvent extemporaneously before
use.
[0264] The methods of the present invention to deliver the targeted
delivery composition can also be used to deliver the targeted
delivery composition orally in granular form including sprayed
dried particles, or complexed to form micro or nanoparticles.
[0265] Methods for delivery of an agent to a discrete area of the
brain are well known in the art, and can include the use of
stereotactic imaging and delivery devices.
[0266] The present invention encompasses any suitable method for
intracranial administration of a targeted delivery composition to a
selected target tissue, including injection of an aqueous solution
of a targeted delivery composition and implantation of a controlled
release system, such as a targeted delivery composition
incorporating polymeric implant at the selected target site. Use of
a controlled release implant reduces the need for repeat
injections. Intracranial implants are known. For example,
brachytherapy for malignant gliomas can include stereotatically
implanted, temporary, iodine-125 interstitial catheters. Scharfen.
C. O., et al., High Activity Iodine-125 Intersitial Implant For
Gliomas, Int. J. Radiation Oncology Biol Phys 24(4);583-591:1992.
Additionally, permanent, intracranial, low dose 1-125 seeded
catheter implants have been used to treat brain tumors. Gaspar, et
al., Permanent 1-125 Implants for Recurrent Malignant Gliomas, Int
J Radiation Oncology Biol Phys 43(5);977-982:1999. See also chapter
66, pages 577-580, Bellezza D., et al., Stereotactic Interstitial
Brachytherapy, in Gildenberg P. L. et al., Textbook of Stereotactic
and Functional Neurosurgery, McGraw-Hill (1998).
[0267] Furthermore, local administration of a targeted delivery
composition to treat malignant gliomas by interstitial chemotherapy
using surgically implanted, biodegradable implants is known. For
example, intracranial administration of
3-bis(chloro-ethyl)-1-nitrosourea (BCNU) (Carmustine) containing
polyanhydride waters, has found therapeutic application. Brem, H.
et al., J Neuro-Oncology 26:111-123:1995.
[0268] A polyanhydride polymer, Gliadel.RTM. (Stolle R & D,
Inc., Cincinnati, Ohio) a copolymer of poly-carboxyphenoxypropane
and sebacic acid in a ratio of 20:80 has been used to make
implants, intracranially implanted to treat malignant gliomas.
Polymer and BCNU can be co-dissolved in methylene chloride and
spray-dried into microspheres. The microspheres can then be pressed
into discs 1.4 cm in diameter and 1.0 mm thick by compression
molding, packaged in aluminum foil pouches under nitrogen
atmosphere and sterilized by 2.2 megaRads of gamma irradiation. The
polymer permits release of carmustine over a 2-3 week period,
although it can take more than a year for the polymer to be largely
degraded. Brem, H., et al, Placebo-Controlled Trial of Safety and
Efficacy of Intraoperative Controlled Delivery by Biodegradable
Polymers of Chemotherapy for Recurrent Gilomas, Lancet 345;
10081012:1995.
[0269] Stereotactic procedures can be used for precise intracranial
administration of targeted delivery composition in aqueous form or
as an implant. A cranial neuroblastoma is also treated in this
manner. Thus, intracranial administration of a targeted delivery
composition can be carried out as follows.
[0270] A preliminary MRI scan of the patient can be carried out to
obtain the length of the anterior commissure-posterior commissure
line and its orientation to external bony landmarks. The base of
the frame can then be aligned to the plane of the anterior
commissure-posterior commissure line. CT guidance is used and can
be supplemented with ventriculography. The posterior commissure can
be visualized on 2-mm CT slices and used as a reference point.
[0271] Physiological corroboration of target tissue localization
can be by use of high and low frequency stimulation through an
electrode accompanying or incorporated into the long needle syringe
used. A thermistor electrode 1.6 mm in diameter with a 2 mm exposed
tip can be used (Radionics, Burlington, Mass.). With electrode high
frequency stimulation (75 Hz) paraesthetic responses can be
elicited in the forearm and hand at 0.5-1.0 V using a Radionics
lesion generator (Radionics Radiofrequency Lesion Generator Model
RFG3AV). At low frequency (5 Hz) activation or disruption of tremor
in the affected limb occurred at 2-3 V. With the methods of the
present invention, the electrode is not used to create a lesion.
Following confirmation of target tissue localization, the targeted
delivery composition can be injected. A typical injection is the
desired number of units (i.e. about 0.1 to about 5 units of the
targeted delivery composition in about 0.1 ml to about 0.5 ml of
water or saline. A low injection volume can be used to minimize
toxin diffusion away from target. Typically, the targeted delivery
composition effect can be expected to wear off within a few days to
about 2-4 months depending on the compound. Thus, an alternate
targeted delivery composition format, targeted delivery composition
incorporated within a polymeric implant, can be used to provide
controlled, continuous release of a therapeutic amount of the
targeted delivery composition at the desired location over a
prolonged period (i.e. from about 1 year to about 6 years), thereby
obviating the need for repeated targeted delivery composition
injections.
[0272] Several methods can be used for stereotactically guided
injection of the targeted delivery composition to various
intracranial targets, such as the arcuate nucleus (AN) for
treatment of acromegaly. Thus a stereotactic magnetic resonance
(MM) method relying on three-dimensional (3D) T1-weighted images
for surgical planning and multiplanar T2-weighted images for direct
visualization of the AN, coupled with electrophysiological
recording and injection guidance for AN injection can be used. See
e.g. Bejjani, B. P., et al., Bilateral Subthalamic Stimulation for
Parkinson's Disease by Using Three-Dimensional Stereotactic
Magnetic Resonance Imaging and Electrophysiological Guidance, J
Neurosurg 92(4);615-25:2000. The coordinates of the center of the
AN can be determined with reference to the patient's anterior
commissure-posterior commissure line and a brain atlas.
[0273] Electrophysiological monitoring through several parallel
tracks can be performed simultaneously to define the functional
target accurately. The central track, which is directed at the
predetermined target by using MM imaging, can be selected for
neurotoxin injection. No surgical complications are expected.
[0274] Computer-aided atlas-based functional neurosurgery
methodology can be used to accurately and precisely inject the
desired neurotoxin or implant a neurotoxin controlled release
implant. Such methodologies permit three-dimensional display and
real-time manipulation of hypothalamic structures. Neurosurgical
planning with mutually preregistered multiple brain atlases in all
three orthogonal orientations is therefore possible and permits
increased accuracy of target definition for targeted delivery
composition injection or implantation, reduced time of the surgical
procedure by decreasing the number of tracts, and facilitates
planning of more sophisticated trajectories. See for example
Nowinski W. L. et al., Computer-Aided Stereotactic Functional
Neurosurgery Enhanced by the Use of the Multiple Brain Atlas
Database, IEEE Trans Med Imaging 19(1);62-69:2000.
[0275] In addition to polymeric implants, osmotic pumps can also be
utilized for delivery of the targeted delivery composition of the
present invention by continuous infusion. An osmotic minipump
contains a high-osmolality chamber that surrounds a flexible, yet
impermeable, reservoir filled with the targeted delivery
composition-containing vehicle. Subsequent to the subcutaneous
implantation of this minipump, extracellular fluid enters through
an outer semi-permeable membrane into the high-osmolality chamber,
thereby compressing the reservoir to release the targeted delivery
composition at a controlled, pre-determined rate. The targeted
delivery composition, released from the pump, is directed via a
catheter to a stereotaxically placed cannula for infusion into the
cerebroventricular space, as described herein.
[0276] The term "subject" and "individual" are used interchangeably
herein, and refer to an animal, for example a human, to whom
treatment, including prophylactic treatment, with the cells
according to the present invention, is provided. The term "mammal"
is intended to encompass a singular "mammal" and plural "mammals,"
and includes, but is not limited: to humans, primates such as apes,
monkeys, orangutans, and chimpanzees; canids such as dogs and
wolves; felids such as cats, lions, and tigers; equids such as
horses, donkeys, and zebras, food animals such as cows, pigs, and
sheep; ungulates such as deer and giraffes; rodents such as mice,
rats, hamsters and guinea pigs; and bears. Preferably, the mammal
is a human subject.
[0277] For the methods of the invention, the therapeutically
effective amount or dose can be estimated initially from cell
culture assays. Then, the dosage can be formulated for use in
animal models so as to achieve a circulating concentration range
that includes the IC.sub.50 as determined in cell culture. Such
information can then be used to more accurately determine useful
doses in humans.
[0278] Toxicity and therapeutic effective amount of the compounds
described herein can be determined by standard pharmaceutical
procedures in cell cultures or experimental animals, e.g., by
determining the IC.sub.50 and the LD.sub.50. The data obtained from
these cell culture assays and animal studies can be used in
formulating a range of dosage for use in humans. The dosage can
vary depending upon the dosage form employed and the route of
administration utilized. The exact formulation, route of
administration and dosage can be chosen by the individual physician
in view of the patient's condition. (See e.g., Fingl, et al., 1975,
in "The Pharmacological Basis of Therapeutics", Ch. 1 p.1).
[0279] Dosage amount and interval can be adjusted individually to
provide plasma levels of the carrier portion containing the
targeting and immune response triggering portions. These plasma
levels are referred to as minimal effective concentrations (MECs).
The MEC will vary for each compound but can be estimated from in
vitro data. Dosages necessary to achieve the MEC will depend on
individual characteristics and route of administration.
[0280] Dosage intervals can also be determined using MEC value.
Compounds should be administered using a regimen that maintains
plasma levels above the MEC for 10-90% of the time, preferably
between 30-90% and most preferably between 50-90%.
[0281] In cases of local administration or selective uptake, the
effective local concentration of the carrier portion containing the
targeting and immune response triggering portions can not be
related to plasma concentration. In such cases, other procedures
known in the art can be employed to determine the correct dosage
amount and interval.
[0282] The amount of the pharmaceutical composition of the
preferred embodiments of the present invention administered will,
of course, be dependent on the subject being treated, the severity
of the affliction, the manner of administration, the judgment of
the prescribing physician, etc.
[0283] The pharmaceutical composition can, if desired, be presented
in a suitable container (e.g., a pack or dispenser device), such as
an FDA approved kit, which can contain one or more unit dosage
forms containing the carrier portion containing the targeting and
immune response triggering portions.
[0284] The method can further comprise administering to a subject a
second therapy, wherein the second therapy is therapy for the
treatment of CNS disorders, or an anti-cancer therapy, for example
an anti-angiogenic therapy, chemotherapy, immunotherapy, surgery,
radiotherapy, immunosuppresive agents, or gene therapy with a
therapeutic polynucleotide. The second therapy can be administered
to the subject before, during, after or a combination thereof
relative to the administration of the composition of the present
invention. Anti-cancer therapies are well known in the art and are
encompassed for use in the methods of the present invention.
Chemotherapy includes, but is not limited to an alkylating agent,
mitotic inhibitor, antibiotic, or antimetabolite, anti-angliogenic
agents eyc. The chemotherapy can comprise administration of CPT-11,
temozolomide, or a platin compound. Radiotherapy can include, for
example, x-ray irradiation, w-irradiation, .gamma.-irradiation, or
microwaves
[0285] It should be understood that this invention is not limited
to the particular methodology, protocols, and reagents, etc.,
described herein and as such may vary. The terminology used herein
is for the purpose of describing particular embodiments only, and
is not intended to limit the scope of the present invention, which
is defined solely by the claims.
[0286] Other than in the operating examples, or where otherwise
indicated, all numbers expressing quantities of ingredients or
reaction conditions used herein should be understood as modified in
all instances by the term "about." The term "about" when used in
connection with percentages may mean .+-.1%.
[0287] The invention is further illustrated by the following
examples which should not be construed as limiting. The contents of
all references cited throughout this application, including the
U.S. provisional application 60/802,337 as well as the figures and
table are incorporated herein by reference.
EXAMPLES
Methods:
[0288] Lentiviral experiments. Lentiviruses pseudotyped with VSV-G
or RVG were generated by cotransfection of the lentiviral vector
plasmids along with the helper plasmid pHR'8.9AVPR (core protein)
and either the pVSV-g or pLTR-RVG envelope construct into 293T
cells. Culture supernatants were harvested after 48 h and viral
particles concentrated by ultracentrifugation. Lentiviruses were
spin-infected onto Neuro 2a or HeLa cells in the presence of
polybrene and after 48 h, transduction efficiency was determined by
analyzing GFP expression by flow cytometry. shFVEJ and shLuc
lentiviral constructs and experiments to test protection against
intracranial JEV infections in mice have been previously
reported.sup.8.
[0289] Peptides and siRNAs. RVG (YTIWMPENPRPGTPCDIFTNSRGKRASNG)
(SEQ ID NO: 13); RV-MAT (MNLLRKIVKNRRDEDTQKSSPASAPLDDG) (SEQ ID
NO:33); RVG-9dR (YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR) (SEQ ID
NO: 34); and RV-MAT-9dR (MNLLRKIVKNRRDEDTQKSSPASAPLDDGGGGRRRRRRRRR)
(SEQ ID NO:35) peptides were synthesized and purified by HPLC at
the Tufts University Core Facility. RVG and RVMAT peptides were
also biotinylated at the carboxy terminus. siRNAs used in the
studies included those targeting GFP (siGFP), firefly luciferase
(siLuc), the envelope gene of JEV (siFvEJ) described in Kumar et
al.sup.8, murine Cu--Zn superoxide dismutase (SOD-1).sup.19, and
.beta.-galactosidase (.beta.gal724) bearing a motif that elicits
interferon production.sup.26. For some experiments, siRNA with
FITC-label at the 3' end of the sense strand was used. siRNAs were
obtained from Dharmacon, Inc or synthesized at Samchully Pharm. Co.
Ltd, Seoul, Korea.
[0290] Peptide binding assay For peptide binding studies, Neuro 2a,
HeLa, CHO, 293T and BHK21cell lines and single cell suspensions
made from freshly isolated mouse brain, spleen or liver were used.
Cells were incubated with biotinylated peptides at a 2.5 .mu.M in
PBS for 20 min at 4 oC, washed 3 times with PBS and then treated
with streptavidin-PE (SAPE, BD Pharmingen) and analyzed by flow
cytometry. For competition experiments, cells were incubated with
biotinylated RVG peptide in the absence or presence of different
concentrations of .alpha.-bungarotoxin (BTX, Sigma).
[0291] SMSA For gel mobility shift assays, 100 pmol siRNA was
incubated with peptides at 1:0.1, 1:1 and 1:10 molar ratios of
siRNA:peptide for 15 min, electrophoresed on a 2% agarose gel and
stained with ethidium bromide. siRNA without peptide or incubated
with RVG-bio (without 9R) served as controls.
[0292] Cytotoxicity assay To test the cytotoxicity of RVG-9R/siRNA
complexes, Neuro 2a cells (triplicates of 2.times.10.sup.5
cells/well in 12-well plates) were incubated at different
concentrations of peptide/siRNA complexes for 24-48 h before
determining the viability by a standard MTT assay.
[0293] siRNA transduction and gene silencing in vitro. Uptake of
siRNA into cells was monitored using FITC-labeled siGFP. siRNA (100
pmoles) was incubated with different concentrations of RVG-9R or
RV-MAT-9R in serum free DMEM for 15min at RT. The complexes were
then incubated with Neuro2a and HeLa cells (the cells were plated
at 5.times.10.sup.4 cells per well in 12-well plates the previous
day). After 4 h incubation at 37.degree. C. the medium was replaced
with 2 ml of fresh medium supplemented with 10% fetal bovine serum
(FBS; Hyclone) and the cells were cultured for an additional 8-10 h
before examining by flow cytometry. Transfection with Lipofectamine
2000 was done as per the manufacturers' instructions.
[0294] To test gene silencing, Neuro 2a cells stably expressing GFP
after transduction with the pLL3.7 lentiviral vector were incubated
with 100 pmoles of siGFP complexed with peptides at 10:1
peptide/siRNA ratio and GFP expression analyzed 48 h after
transduction.
[0295] Animal experiments for testing siRNA delivery and gene
silencing. Balb/c, C57BL/6-Tg(ACTB-EGFP)1Osb/J and NOD/SCID were
purchased from Jackson Labs and used at 4-6 weeks of age. All mouse
experiments had been approved by the CBRI institutional review
board and animal infection experiments were done in a biosafety
level 3 animal facility at the CBRI.
[0296] To test peptide uptake by brain cells, 50 .mu.g of
biotinylated peptides in 0.2 ml PBS were injected into the tail
veins of Balb/c mice and 4 h later, single cell suspension of
brains were permeabilized, treated with SAPE and analyzed by flow
cytometry. For all siRNA delivery experiments, peptide/siRNA
complexes (at a peptide:siRNA molar ratio of 10:1) were prepared in
100 .mu.l of 5% glucose and injected iv at 50 .mu.g
siRNA/mouse/injection. FITC-siRNA delivery and SOD-1 gene knockdown
experiments were done in Balb/c mice. GFP silencing experiments
were carried out in C57BL/6-Tg(ACTB-EGFP)1Osb/J mice. For testing
protection against JEV encephalitis, NOD/SCID mice were
intraperitoneally challenged with 5 LD.sub.50 of JEV (LD.sub.50 was
predetermined using serial dilutions of the virus) 4 h before
beginning iv peptide/siRNA treatment.
[0297] Staining of brain sections. Mice were injected twice with
RVG-9R bound siRNA-FITC and brains harvested 10-12 hours later.
Brains were sectioned frozen on a sliding microtome to 40 .mu.m
thickness and incubated for 48 h at 4.sub.0C with mouse anti-FITC
antibodies (Jackson Immuno Research, 20 .mu.g/ml) or isotype
controls (IgG1 from murine myeloma, Sigma, 20 .mu.g/ml). Sections
were washed and FITC immunoreactivity visualized with Alexa 488
goat anti-mouse secondary antibodies (1:500, Invitrogen).
[0298] Quantitative RT-PCR. Total RNA was isolated form different
organs of peptide/SOD1 siRNA treated mice using RNeasy RNA
isolation kit (Qiagen). The RNA was reverse transcribed using
Superscript III and random hexamers (Invitrogen) according to the
manufacturer's protocol. Real-time PCR was performed on 1 .mu.l of
complementary DNA, or a comparable amount of RNA without reverse
transcriptase, using the QuantiTect.TM. SYBR Green PCR kit (Qiagen)
according to the manufacturer's instructions. Amplification
conditions were: 40 cycles of denaturation at 95.degree. C. for 20
s, annealing at 60.degree. C. for 30 s, and extension at 69.degree.
C. for 30 s using Biorad icycler. Primers for GAPDH and SOD-1 have
been previously described (27). Standard curves were generated and
the relative amount of mRNA was normalized to GAPDH mRNA.
Specificity was re-verified by melt curve analysis and agarose gel
electrophoresis.
[0299] Northern blot to detect siRNA. 5 .mu.g of RNA extracted from
cell suspensions by the small RNeasy mini kit (Qiagen,), were
electrophoresed on a 15% TBE-UREA PAGE gel (Invitrogen),
transferred to a positively charged nylon membrane
(BrightStar-plus; Ambion) and probed with sense siRNA probes as
described earlier (8).
[0300] Western blot analysis. Mouse tissue cell suspensions were
homogenized in buffer containing 25 mM HEPES pH 7.5, 300 mM NaCl,
1.5 mM MgCl2 0.1% Triton X 100, 0.2 mM EDTA and 0.5 mM DTT and
protease-inhibitor cocktail (Complete-Mini; Roche Diagnostic). The
samples (10 .mu.g protein each) were electrophoresed on 15%
SDS-polyacrylamide mini gels (Bio-Rad) and transferred to a
polyvinylidene difluoride membrane. The membrane was probed with
anti-.beta.-actin antibodies (Sigma) or anti-SOD1 antibodies
(Stressgen Biotechnologies) and visualized using ECL Western blot
system (Pierce Biotechnologies).
[0301] IFN response. Balb/c mice were iv injected with 50 .mu.g of
either siFvEJ or si.beta.gal728 complexed with RVG-9R peptide.
siRNA .beta.gal728 complexed to Lipofectamine-2000.TM. served as a
positive control. Serum samples obtained 7 h after siRNA treatment
were tested for interferon-alpha levels using mouse type-I IFN
detection ELISA kit (PBL Biomedical Laboratories), according to the
manufacturer's instructions.
[0302] Quantification and Statistical analysis. Western blot
experiments were quantified by determination of band intensities
using ImageJ public domain software from the National Institutes of
Health (http://rsb.info.nih.gov/ij/). All statistical analysis
comparing groups of mice treated with test and control peptides
were performed by one-way ANOVA followed by Bonferroni's post test.
P<0.05 was considered significant.
Example 1
[0303] Generation of lentiviral vectors for stable expression of
shRNAs and testing their antiviral properties. After testing
several viral gene targets, the inventors discovered that a siRNA
designed to target the envelope gene of JEV (FvE.sup.J, nt
1287-1305 of the genomic RNA) could afford robust protection
against JEV infection in cell lines. For stable endogenous
expression of this siRNA, the inventors used the lentiviral vector
Lentilox pLL3.7 described by Rubinson et al [88]. This vector
contains an RNA polymerase III U6 promoter to drive shRNA
expression as well as a GFP reporter gene driven off the CMV
promoter to enable easy identification of transduced cells (FIG.
1). Two complementary oligonucleotides with the siRNA sequence
followed by a 9nt loop, a reverse complement of the siRNA and
transcription termination signal were commercially synthesized,
annealed and cloned into Xho and Hpa digested pLL3.7 vector.
Lentiviral particles were generated in 293 T cells by transfection
with pLL3.7/FvE.sup.J or pLL3.7/Luc (encoding luciferase shRNA to
serve as control) constructs along with plasmids encoding VSV-G and
delta vpr (to supply envelope and regulatory proteins in trans)
using Fugene reagent. Viral supernatants were harvested 48 hours
after transfection. The virus was titrated in 293T cells using GFP
expression as a marker and expressed as transduction units (TU)/ml.
When BHK-21 cells were infected with the lentivirus by spinfection
in the presence of 8 ug/ml polybrene, nearly 100% cells were
transduced as evidenced by GFP expression (FIG. 2, left). Stable
intracellular production of FvE.sup.J specific siRNA was
ascertained 10 days after transduction by Northern analysis using
.sup.32P labeled synthetic siRNA sense strand as probe (FIG. 2,
right). To test the ability of shRNA to inhibit JEV replication,
stably transduced BHK-21 cells were infected with JEV at a
multiplicity of infection (moi) of 1 and the viral replication
monitored by flow cytometry after staining with a JEV-specific
monoclonal 48 h postinfection. As shown in FIG. 3, compared with
mock and control luciferase shRNA, FvE.sup.J shRNA was able to
abrogate JEV infection. That the antiviral effect of FvE mediated
protection is due to siRNA-induced degradation of viral RNA was
confirmed in Northern blots using viral cDNA probe (FIG. 4).
[0304] In vivo effectiveness of FvE.sup.J. The inventors also
tested the FvE.sup.J shRNA for conferring protection against
JEV-induced encephalitis. Balb/c mice were injected with
2.times.10.sup.5 TU of either luciferase or FvE.sup.J shRNA
encoding lentiviruses intracranially into the frontal lobe as
detailed in Kumar et al [6]. Two days later, the mice were again
injected with lentiviruses along with the challenge JE virus at the
earlier injection site and monitored for survival over time. While
all 10 mice injected with no or control shRNA died within 7 days,
all 10 mice injected with FvE.sup.J shRNA survived indefinitely
(FIG. 5). The brains of control mice on day 5 after JEV challenge
showed the typical histopathological features of viral encephalitis
with leukocyte infiltration and neuronal apoptosis, while no brain
inflammation or neuropathology was observed in the FvE.sup.J shRNA
treated mice (FIG. 6). Virus titration of brain homogenates
revealed extremely high levels of viral replication in the control
mice, whereas the FvE.sup.J shRNA-treated mice remained virus free
(FIG. 7).
[0305] Synthetic siRNAs can also protect mice from JEV-induced
encephalitis. Because synthetic siRNA provides a drug like approach
for treatment without the safety concerns associated with
integration of lentiviral vectors, the inventors also tested the
FvE.sup.J siRNA for protection. To enable uptake of siRNA by brain
cells, the inventors complexed the siFvE.sup.J or the control siLuc
siRNAs with the cationic lipid formulation, JetSI along with the
fusogenic lipid dioleoylphosphatidyl-ethanolamine (DOPE), which has
been recently used to deliver siRNA to brain cells in vivo without
toxicity [66]. After ascertaining that JetSI/DOPE can successfully
deliver siFvE.sup.J into Neuro 2a cells to inhibit JEV replication
(FIG. 8a), the inventors injected approximately 40 .mu.g (3.2
nmoles) of siRNAs, complexed with JetSI/DOPE intracranially 30 min
or 6 h after JEV challenge. While in both groups, all mice injected
with the control siLuc died within 5-7 days, all
siFvE.sup.J-treated mice in both groups survived indefinitely (FIG.
8b). The siRNA treatment neither induced IFN responsive genes as
measured by RT-PCR analysis nor led to increased levels of serum
IFN levels as measured by ELISA (data not shown). Moreover, the
siFvE.sup.J-treated mice were completely healthy and brain sections
taken 21 days after challenge showed no histopathological
alterations, demonstrating that the treatment was non-toxic (FIG.
6). These results show that a single treatment with siFvE.sup.J can
protect against fatal encephalitis even when administered after the
infection has already been established. A siRNA targeting the
envelope gene of WNV (siFvEW) was also effective in suppressing WN
encephalitis.
[0306] A single siRNA targeting a region that is highly conserved
among different flaviviruses can suppress encephalitis induced by
both JEV and WNV. In contrast to siFvE.sup.J sequence (nt
1287-1305), which is only conserved within the strains of JEV, a
contiguous sequence in the E gene comprising the cd loop (nt
1307-1328) is essential for mediating viral entry and thus, is
highly conserved even at the nucleotide level between all sequenced
strains of JEV, WNV as well as St. Louis encephalitis virus [89].
Thus the inventors designed a 21 nt siRNA (siFvE) corresponding to
this region. This sequence is identical between the two viruses
except for a single nucleotide mismatch at positions 3 and 21 in
the JEV and WNV target sequence respectively, positions where
mutations are reported to be well tolerated with no significant
effect on siRNA efficacy [90]. As shown in FIG. 9a, siFvE.sup.JW
effectively suppressed both viruses in the Neuro 2a cell line.
Moreover, it was also able to afford 80-100% protection against
lethal encephalitis induced by either JEV or WNV (FIG. 9b). These
results indicate that by careful design of conserved target sites,
it can be possible to use a single siRNA to suppress related
viruses across species. Importantly, the inventors have discovered
that siRNA treatment after infection can also be effective. The
inventors have also observed that siRNA treatment even after 18 h
of infection protected 80% of mice against encephalitis. However,
it was unable to protect when administered 24 h after infection,
when progeny virus has already infected distant areas of brain.
[0307] Pseudotyping the lentivirus with RVG permits neuronal
cell-specific targeting and enhances RNAi effectiveness in the CNS.
Pseudotyping the lentivirus with the neurotropic Rabies virus
glycoprotein (RVG) instead of the conventionally used VSV-G allows
retrograde axonal transport to distal neurons and results in more
extensive spread of the transduced genes [11]. Moreover, RVG
pseudotyping can also allow neuronal cell specific targeting, which
could be an advantage to prevent si/shRNA uptake by irrelevant
cells. Thus, the inventors tested lentiviruses pseudotyped with
either VSV-G or RVG for their ability to deliver shRNA to
non-neuronal or neuronal cells. Indeed, whereas the VSV-G
pseudotyped lentivirus uniformly transduced both HeLa and the mouse
neuroblastoma cell line Neuro 2a, RVG pseudotyping allowed
transduction exclusively of Neuro 2a, but not HeLa or BHK-21
non-neuronal cells (FIG. 10). Further, the RVG-pseudotyped
shFvE.sup.J exhibited a more potent antiviral activity compared to
the corresponding VSV-G pseudotyped lentivirus in that, it
abrogated JEV infection in Neuro 2a even at an moi of 50 (highest
dose tested) while the protection offered by VSVG-pseudotyped
shFvE.sup.J diminished at moi's higher than 25. This can be due to
differences in the respective receptor density, enabling better
entry of RVG pseudotyped virus in neuronal cells.
[0308] The inventors compared the VSV-G- or RVG-pseudotyped
shFvE.sup.J lentiviruses for relative efficacy in vivo by titrating
the dose of lentivirus required to provide complete protection
against a lethal intracranial challenge with JEV. Mice received
either 2.times.10.sup.5 or 2.times.10.sup.3 transduction units (TU)
of the control shLuc or shFvE.sup.J, pseudotyped with either VSV-G
or RVG. Mice were challenged with 4 LD.sub.50 of JEV injected at
the same site and observed for mortality for 21 days. All mice
injected with the control shLuc, whether pseudotyped with VSV-G or
RVG developed encephalitis and succumbed by day 6. In contrast, all
mice receiving a high dose of shFvE.sup.J lentivirus with either
pseudotyping were protected. However, when a lower dose of
lentivirus (2.times.10.sup.3 TU) was used, all mice receiving
VSV-G-pseudotyped shFvE.sup.J died, while all mice injected with
RVG-pseudotyped shFvE.sup.J lentivirus survived indefinitely (FIG.
11). When the extent of protection was further analyzed by serially
increasing the dose of JEV challenge, we could show that the
RVG-pseudotyped lentivirus could protect against JEV challenge at
as high a dose as 50 LD.sub.50. This enhanced protective efficacy
is probably due to the capacity of RVG-pseudotyped lentivirus to
mediate retrograde axonal transport and increase lateral spread
from the injection site [11], resulting in a more extensive
protection of neighboring cells.
[0309] A short synthetic peptide derived from RVG specifically
binds neuronal cells. The glycoprotein from the neurotropic Rabies
virus shows a significant homology with the snake venom alpha
neurotoxin that binds to the nicotinic acetylcholine receptor [91].
In fact, further studies showed that the acetylcholine receptor is
also a Rabies virus receptor [92, 93]. Interestingly an RVG peptide
was also found to competitively inhibit .alpha.-bungarotoxin
binding to the acetylcholine receptor [94]. Structure-function
analysis of the binding domain identified a 29 aa peptide (spanning
aa 173-202 in the RVG) as sufficient for competition with
bungarotoxin binding [95]. However, there has been no indication
that this 29 mer RVG peptide (RVG) (SEQ ID NO:13) binds to neuronal
cells that express the a subunit of the acetylcholine receptor, nor
that it can facilitate delivery to such cells. To detect binding,
the inventors synthesized a biotinylated 29 mer RVG peptide (SEQ ID
NO:13). For control purpose, the inventors also synthesized a 29
mer scrambled RVG peptide (herein termed "RV-MAT"). Acetylcholine
expressing Neuro 2a [96, 97] and the receptor negative HeLa cells
were incubated with the peptides, washed and stained with
streptavidin PE (SAPE). As shown in FIG. 12, Neuro 2a but not HeLa
cells specifically bound the RVG peptide corresponding to SEQ ID
NO:13, but not the scrambled RVG peptide. To further confirm the
binding specificity, the inventors tested if a bungarotoxin can
inhibit RVG peptide binding. Neuro 2a cells were first treated with
different concentrations (10-9 to 10-3 M) of .alpha.-bungarotoxin
and then tested for RVG peptide (10-7 M) binding. As shown in FIG.
13, .alpha.-bungarotoxin could effectively inhibit RVG peptide
binding. The inventors also tested if the RVG peptide can bind
primary neuronal cells isolated ex vivo from the mouse brain.
Single cell suspensions of freshly isolated brain cells and
splenocytes (for control) were treated with RVG-Bio or a control
biotinylated listeria peptide and SAPE and examined by flow
cytometry. Again, the brain cells but not splenocytes were capable
of binding the RVG peptide (FIG. 14). These results demonstrate
that the RVG peptide corresponding to SEQ ID NO:13 can specifically
bind primary neuronal cells. Because actelylcholine receptor
.alpha.7 subunit is widely expressed by many cell types in the
brain including the neurons, astrocytes and glia cells as well as
the brain capillary endothelial cells [98], the inventors also
tested if RVG peptide delivered intravenously in mice can be taken
up by the brain cells. Mice were injected IV with 100 .mu.g of
biotinylated RVG peptide or a control listeria peptide and 2 h
later, single cell suspensions of brain examined by flow cytometry
after staining with SAPE. As shown in FIG. 15, brain cells from
mice treated with RVG but not control peptide were positive for PE
fluorescence, demonstrating that the RVG peptide can allow
transvascular delivery of si/shRNAs.
[0310] RVG peptide fused to the cell penetrating HIV TAT peptide
can deliver shRNA vector to neuronal cells. Although the RVG
peptide can bind neuronal cells, it does not bind nucleic acids and
therefore cannot be used alone to transport naked nucleic acids,
for example si/shRNAs. However, if the RVG peptide corresponding to
SEQ ID NO:13 is coated on nanoparticles or liposomes, the RVG
peptide can be used to deliver nucleic acids to neuronal cells.
Alternatively, a peptide from HIV-TAT can bind the negatively
charged nucleic acids by charge interaction. HIV-TAT is also useful
as it also functions as a cell penetrating peptide[?-9]' Thus, the
inventors synthesized a chimeric RVGTAT peptide consisting of the
29mer RVG and 15mer TAT peptide. For testing delivery, the
inventors first incubated the pLL37 lentiviral vector DNA with the
RVG-TAT peptide (5 .mu.g of DNA with 5-10 fold excess of peptide on
a molar basis in a total volume of 0.5 ml DMEM without serum) for
15-20 min and then, this mixture was added to Neuro 2a or BHK-21
cells. After incubating for 4 h, the cells were washed and cultured
with serum containing culture media. Two days later, the cells were
examined for GFP expression by flow cytometry. As shown in FIG. 16,
Neuro 2a cells expressed GFP at a high level compared to minimal
GFP expression by BHK-21 cells. Since BHK-21 cells do not bind the
RVG peptide, the small level of GFP expression seen probably
represents transduction mediated by the TAT peptide alone as has
been previously reported [7, 8]. This demonstrates that the RVG
peptide by enhancing cell binding can greatly enhance delivery in
neuronal cells. Thus, RVG-TAT peptide can also be used for neuronal
nucleic acid (such as DNA or RNA) delivery.
[0311] RVG peptide fused to the cell penetrating 11dR peptide can
deliver synthetic siRNA to neuronal cells. A 9-11 mer of 1-arginine
(9R or 11R) peptide has been shown to be 20-fold more efficient
than the TAT peptide at cellular uptake, and substitution of 1 with
d-arginine was found to enhance uptake by >100 fold [100]. The
inventors tested if the RVG peptide fused to an 11 mer dR
(RVG-11dR) could deliver shRNA vector and siRNAs to neuronal cells.
The pLL3.7 shRNA vector or a FITC conjugated GFP siRNA was bound to
RVG-11dR peptide as described for the RVG-TAT and was used to
transduce Neuro 2a cells. GFP expression and siRNA delivery was
determined by flow cytometry 2 days later after thoroughly washing
the cells. As FIG. 17 shows, 11dR was able to deliver both the DNA
vector and siRNA efficiently. The inventors also tested if the
siRNA delivered via RVG-11dR can mediate gene silencing. For this,
Neuro 2a cells were first transduced with a GFP encoding plasmid
via RVG-TAT and 2 days later, the cells were transduced with
anti-GFP siRNA bound to RVG-11dR and GFP expression determined 2
days later. Indeed, RVG-11dR delivered siRNA could inhibit GFP
expression significantly (FIG. 18).
[0312] Targeting liposomes. The inventors describe herein the use
of RVG-coated liposomes for in vivo neuronal delivery. A novel
nanoscale hyaluronan-coated liposome formulation for nontoxic,
targeted in vivo delivery was recently developed, as described in
U.S. Provisional Appl. 60/723,686, which is incorporated herein in
its entirety by reference. Here, the siRNA is encapsulated with a
liposome for protection against enzymes in the body fluids. The
liposome is also coated with hyaluran, which enables covalent
linkage with targeting molecules such as antibodies or peptides. To
specifically target activated T cells, the liposome was coated with
the AL-57 antibody that recognizes the form of LFA-1 that is
expressed on activated T cells [101]. CD4 T cells were activated
with ICAM-1 or .alpha.CD3 antibody alone or together. On day 7
after activation, the cells were treated with CD4 siRNA (1 nmol)
encapsulated liposomes coated with the LFA-1 or an isotype control
antibody and CD4 expression determined 2 days later. CD4 expression
was specifically reduced after delivery of CD4 siRNA with LFA-1
antibody coated liposomes (FIG. 19, top panel), but not with
control antibody coated liposomes (FIG. 19, middle panel).
Example 2
[0313] To address the question of whether different carrier
particles could be fused to an RVG peptide for delivery of nucleic
acids, for example RNAi to neuronal cells for functional knock down
of gene expression, the inventors used a short peptide derived from
the Rabies virus (RVG) that binds to the nicotinic acetylcholine
receptor as a means of neuronal cell targeting. The RVG was
biotinylated to detect neuronal cell-specific binding (as shown in
FIG. 20A) and was inhibited by .alpha.-bungarotoxin as shown in
FIG. 20B. The RVG peptide could also be detected in the mouse brain
2 hours after intravenous injection (FIG. 21). A chimeric peptide,
termed "CORVUS" or "RVG-9R" herein comprises an RVG peptide of SEQ
ID NO:13 fused to a carrier particle which is a cell penetrating
peptide such as a polymeric arginine residue of various lengths was
used to test siRNA binding and delivery. As used in Example 2,
CORVUS (an RVG peptide comprising SEQ ID NO:13 fused to a 9 or 11
mer of 1-arganine (called R9 or 11R)), was assessed for its ability
to deliver shRNA vector and RNAi to neuronal cells in vitro and in
vivo and to deliver functional RNAi. CORVUS binds and delivers
siRNA to neuronal cells in vitro (FIG. 22), and CORVUS carrying
anti-GFP RNAi was functional and silenced GFP expression in GFP
expressing Neuro 2a cells (FIG. 23). Furthermore, i.v. injection of
CORVUS loaded with FITC labeled RNAi was significantly detected in
brain tissue of mice (FIG. 24C) compared to the control peptide
(FIG. 24A). GFP siRNA complexed with CORVUS specifically silenced
GFP expression in the brain of GFP transgenic mice after
intravenous (i.v.) administration (FIG. 25B), and SOD-1 siRNA
complexed with CORVUS specifically silenced mouse SOD1 expression
at the mRNA level and protein level in the brain (FIG. 29B).
Example 3
[0314] Pseudotyping lentivirus with RVG confers neuronal
cell-specificity. The envelope glycoprotein of Rabies virus (RVG)
specifically interacts with the nicotinic acetylcholine receptor
(AchR) on neuronal cells to infect brain cells.sup.153, 154. The
inventors assessed if pseudotyping lentivirus with RVG, instead of
the conventionally used vesicular stomatitis virus glycoprotein
(VSV-G) could confer neuronal cell-specificity. GFP encoding
lentiviral vector Lentilox pLL3.7.sup.155 pseudotyped with either
RVG or VSV-G was tested for ability to infect neuronal or
non-neuronal cells. While VSV-G pseudotyped lentivirus infected
both cell types, RVG pseudotyping resulted in infection exclusively
of Neuro 2a, but not HeLa cells (FIG. 10). RVG has been shown to
mediate retrograde axonal transport and increase the spread of a
viral vector within the brain.sup.156, the inventors also tested if
RVG pseudotyping of pLL3.7 encoding a shRNA (shFvE.sup.J).sup.157
targeting Japanese encephalitis virus (JEV) increases its antiviral
efficacy. Different concentrations of shFvE.sup.J lentivirus,
pseudotyped with RVG or VSV-G were tested for protection efficacy
in an intracranial (ic) JEV challenge assay.sup.157. While at a
high dose (2.times.10.sub.5 TU) both lentiviruses equally afforded
protection, at a lower dose (2.times.10.sub.3 TU), all mice treated
with RVG pseudotyped lentivirus survived but all those treated with
VSV-G-pseudotyped lentivirus succumbed to JEV infection (FIG. 11).
Collectively, these results suggest that RVG confers neuronal
cell-specificity and in addition, by facilitating retro-axonal and
trans-synaptic spread.sup.156 also enhances transduction of
neighboring neuronal cells.
[0315] Short RVG peptide specifically binds to neuronal cells. To
determine if the 29 mer RVG peptide specifically binds to neuronal
cells that express AchR, the inventors assessed the ability of a
biotinylated 29 mer RVG peptide and a control peptide of similar
length derived from the viral matrix protein (RV-MAT) to bind to
neuronal cells. The snake venom toxin .alpha.-bungarotoxin
specifically binds AchR, and a short 29 amino acid peptide derived
from RVG (spanning aa 173-202 in the RVG) has been previously
reported to competitively inhibit .alpha.-bungarotoxin binding to
the AchR in solution.sup.10. The inventors discovered that a 29 mer
RVG peptide specifically binds neuronal cells that express AchR. To
detect binding, the inventors synthesized a biotinylated 29 mer RVG
peptide and for control purpose, a peptide of similar length
derived from the viral matrix protein (RV-MAT). AchR expressing
Neuro 2a 11,12 and the receptor negative HeLa cells were incubated
with the peptides, washed and stained with phycoerythrin-conjugated
streptavidin (SAPE). As shown in FIG. 26a, Neuro 2a but not HeLa
cells specifically bound the RVG-, but not RV-MAT peptide. RVG
peptide also did not bind several other non-neuronal cells
including 293T, BHK21 and CHO (FIG. 26b).
[0316] To further confirm AchR-mediated binding specificity, the
inventors tested if .alpha.-bungarotoxin can inhibit RVG peptide
binding to Neuro 2a cells. Neuro 2a cells were treated with
different concentrations (10.sup.-10 to 10.sup.-3M) of
.alpha.-bungarotoxin along with RVG peptide (2.5 .mu.M). As shown
in FIG. 26c, .alpha.-bungarotoxin inhibited RVG peptide binding in
a dose-dependent manner in that, at concentrations of 10.sup.-7M
and higher, .alpha.-bungarotoxin progressively decreased RVG
binding. Moreover, .alpha.-bungarotoxin was also able to displace
pre-bound RVG from Neuro 2a cells (not shown).
[0317] The inventors also tested if the RVG peptide can bind
primary neuronal cells. Single cell suspensions of freshly isolated
mouse brain cells were treated with RVG-bio or the control
RVG-MAT-bio peptides followed by SAPE. Again, brain cells but not
splenocytes were capable of binding the RVG peptide (FIG. 26d).
Because AchR is also expressed by the brain capillary endothelial
cells.sup.13, the inventors also tested if RVG peptide injected iv
can be taken up by the brain cells. Mice were injected iv with 50
.mu.g of biotinylated RVG peptide or control RVG-MAT peptide and 4
h later, single cell suspensions of brain were examined by flow
cytometry after internal staining with SAPE. As shown in FIG. 26e,
brain cells from mice treated with RVG but not the control peptide
were positive for PE fluorescence, demonstrating that the RVG
peptide can cross the BBB to enter brain cells.
[0318] Chimera RVG-9R peptide can bind and deliver siRNA to
neuronal cells. While the RVG peptide can bind neuronal cells, it
does not bind nucleic acids and therefore cannot be used alone to
transport siRNA. However, short positively charged peptides called
cell penetrating peptides (such as a peptide from HIV-TAT) can bind
the negatively charged nucleic acids by charge interaction and also
enable cellular uptake.sup.14-16. A nona (L-arginine) (R9) peptide
has been shown to be 20-fold more efficient than the TAT peptide at
cellular uptake, and substitution of 1 with d-arginine was found to
enhance uptake by >100 fold.sup.17. Moreover, a cholesterol
conjugated oligo dR has been used for siRNA delivery to suppress
VEGF gene in a tumor model in mice.sup.18. The inventors tested if
the RVG peptide fused to 9dR could deliver siRNAs to neuronal
cells. The inventors synthesized an RVG-spacer-9dR (designated
RVG-9R) peptide and a control RV-MAT-spacer-9dR (RV-MAT-9R) peptide
for these studies. The ability of these peptides to bind siRNA was
tested in a gel electrophoresis mobility shift assay (EMSA). As
shown in FIG. 27a, both RVG-9R and RV-MAT-9R peptides were able to
bind siRNA, resulting in quenching of fluorescence and mobility
shift in a dose-dependent manner with maximal and complete binding
at 1:10 molar ratio, demonstrating that the 9R tagging confers
siRNA-binding property to both peptides. Next, the inventors tested
if RVG-9R can be used to transduce siRNA into cells. For this, 100
pmoles of FITC conjugated siRNA was complexed with different
concentrations of RVG-9R and Neuro 2a cells were incubated with the
complexes for 4 h, washed and cultured for another 8-10 hours in
fresh media before examining by flow cytometry. As shown in FIG.
27b, RVG-9R was able to transduce siRNA in a dose-dependent manner
and a peptide: siRNA molar ratio of 10:1 was optimal for maximal
transduction, in agreement with EMSA results shown in FIG. 27a. To
determine the neuronal specificity of RVG-9R-mediated siRNA
delivery, the inventors transduced Neuro 2a and HeLa cells using
FITC-siRNA complexed with RVG-9R or RV-MAT-9R at the optimal siRNA:
peptide ratio, using lipofectamine as positive control. As shown in
FIG. 27c, lipofectamine enabled siRNA uptake by both HeLa and Neuro
2a cells as expected and RV-MAT-9R was unable to transduce either
cell type. In contrast, RVG-9R was able to transduce Neuro 2a but
not HeLa cells to a similar degree as lipofectamine. Thus, RVG-9R
allows neuronal cell-specific siRNA delivery.
[0319] Although these results indicate that siRNA can be transduced
into Neuro-2a cells by RVG-9R, siRNA will not be functional and/or
effective unless it is delivered into the cytoplasm, and therefore
it was important to test if the introduced siRNA is functional in
silencing specific gene expression. The inventors then assessed the
gene silencing ability of the RVG-9R delivered siRNA. Neuro 2a
cells stably expressing high levels of GFP (by lentiviral
introduction of pLL3.7 vector encoding GFP) were transduced with
anti-GFP siRNA bound to RVG-9R or RVMAT-9R or transfected with
siRNA using lipofectamine (positive control), and GFP expression
determined 2 days later. RV-MAT-9R complexed with siRNA was unable
to reduce GFP levels, while RVG-9R/siRNA silenced GFP expression to
a similar extent as lipofectamine transfection (FIG. 27d),
demonstrating that the RVG-9R delivered siRNA is indeed functional.
RVG-9R/siRNA complex was also found to be non-toxic in a MTT assay
(>90% viability 48 h after treatment of Neuro-2a cells with
RVG-9R at up to 25:1 peptide-siRNA ratio, data not shown).
[0320] RVG-9R peptide can deliver siRNA to the brain cells after iv
injection in mice. For potential in vivo delivery, the inventors
examined if RVG-9R binding protects the siRNA against degradation
from serum nucleases. Unlike naked siRNA, RVG-9R-bound siRNA was at
stable for up to 8 h (FIG. 31).
[0321] The inventors assessed if RVG-9R can transport siRNA to
brain cells in vivo after iv injection. To examine this, the
inventors examined if the RVG-9R binding protects siRNA against
degradation from serum proteases. Mice were injected iv with 50
.mu.g of FITC-labeled siRNA complexed with either RVG-9R or the
control RV-MAT-9R peptide (at 1:10 molar ratio) in a total volume
of 100 .mu.l in 5% glucose solution. The iv injection was repeated
after 6 hours and 10 hours later, mice were sacrificed and single
cell suspensions from brain, spleen and liver were examined by flow
cytometry for the presence of FITC-positive cells. As shown in FIG.
28a, FITC fluorescence was detected in the brain only when the
siRNA was complexed to RVG-9R. However, no FITC uptake was seen in
the spleen or liver, demonstrating that RVG-9R allows specific
targeting of brain cells in vivo. The presence of FITC positive
cells in different regions throughout the mouse brain was also
confirmed by microscopic examination of brain sections stained with
an anti-FITC antibody, as shown in FIG. 28b.
[0322] Gene silencing by transvascular delivery of siRNA bound to
RVG-9R. The inventors tested brain-specific gene silencing after iv
administration of RVG-9R/siRNA using GFP Tg mice. GFP siRNA (50
.mu.g) was complexed with RVG-9R or RV-MAT-9R and injected in a
volume of 100 .mu.l daily for 3 days in the tail veins of GFP Tg
mice. Two days after the last injection, mice were sacrificed and
single cell suspensions of brain, spleen and liver examined for GFP
expression by flow cytometry. In GFP Tg mice, the GFP expression
was highest in the brain compared to the spleen and liver. Despite
this, a significant reduction in GFP expression was seen after
treatment with RVG-9R-bound but not with RV-MAT-bound siRNA (FIG.
29b). Moreover, this gene silencing was only observed in the brain
and not the liver and spleen, demonstrating the specificity of
brain targeting. To confirm these results in a different system,
the inventors also tested silencing of an endogenous gene in the
brain following RVG-9R mediated iv siRNA delivery. In this case,
wild type Balb/c mice were iv injected with 50 .mu.g of an siRNA
targeting mouse SOD1gene.sup.19 complexed to RVG-9R or RV-MAT-9R, 3
times at 8 h intervals and SOD1 mRNA and protein levels in the
brain, spleen and liver were measured 24 h after the last injection
by qPCR and Western blot respectively. While no changes were
detected in SOD1 levels in any organ in the RVG-MAT-9R/siRNA
treated animals, both SOD1 mRNA and protein levels were
significantly reduced in the brain, but not other organs in the
RVG-9R/siRNA treated mice (FIG. 29b). To confirm that the observed
knockdown is due to the specific delivery of siRNA within the
brain, the inventors also tested for the presence of SOD1 siRNA in
different organs of mice by Northern blot analysis using siRNA
sense strand as probe. siRNA could be detected in the brain but not
in the spleen or liver of treated mice (FIGS. 28a and 29c).
Collectively the inventors have discovered that RVG-9R is able to
deliver siRNA specifically to brain cells after iv administration,
resulting in effective gene silencing in the brain.
Example 4
[0323] RVG-9R enables i.v treatment of viral encephalitis. The
inventors have previously reported that intracranial treatment with
antiviral siRNAs can provide near complete protection from fatal
flaviviral encephalitis in mice.sup.8. However, a noninvasive iv
treatment method would be optimal for siRNA therapy for clinical
use, for example for clinical use in humans. The inventors
demonstrated iv treatment with siRNA bound to RVG-9R can protect
mice from fatal JEV-induced encephalitis. Unlike wild type mice,
immunodeficient NOD/SCID mice used in these studies uniformly
susceptible for peripheral infection with flaviviruses.sup.20, 21.
NOD/SCID mice were infected intraperitoneally with 5LD50 (lethal
dose) of JEV, followed by after 4 hours an iv injection with 50
.mu.g of antiviral FvE.sup.J siRNA (siFvE.sup.J as described in
Kumar et al.sup.8) or an control luciferase siRNA (siLuc) complexed
with RVG-9R or RV-MAT-9R. The siRNA treatment was repeated every
day for at least 3 successive days and the mice were observed for
survival for at least 30 days. Untreated mice, mice treated with
either siFvE.sup.J complexed with RV-MAT-9R or with the control
siLuc complexed with RVG-9R all died within 10 days, showing that
neither the chimeric peptides by themselves or the control siLuc
complexed with RVG-9R affected the course of the disease. In
contrast, treatment with siFvE.sup.J complexed with RVG-9R resulted
in .about.80% survival as shown in FIG. 31a, and the surviving mice
were observed, and did not show any signs of sickness or toxicity
during the entire course of observation for 30 days (FIG. 30a).
Moreover, while the brain sections of control siRNA treated sick
mice revealed typical features of diffuse focal encephalitis marked
by inflammatory cell infiltration and neuronal apoptosis, similar
sections of RVG-9R/siRNA treated surviving mice were completely
normal without any histopahological evidence of infection or
toxicity (not shown).
[0324] The inventors also discovered the presence of siRNA in the
brains of RVG-9R treated mice by Northern blot analysis (FIG. 30b).
The inventors have also earlier reported that FvE.sup.J siRNA
effects are indeed due to RNAi and not because of induction of
non-specific IFN response.sup.8. However, to rule out the
possibility that non-specific IFN production mediated the
protection observed, and to rule out the possibility that FvE.sup.J
siRNA complexed with RVG-9R can induce non-specific IFN responses,
the inventors also measured serum IFN levels following RVG-9R/siRNA
administration. Although, as expected IFN levels were elevated when
mice were treated with a known immunostimulatory siRNA
(.beta.gal724).sup.22, IFN was not induced in RVG-9R/FvE.sup.J
siRNA treated animals (FIG. 30c), demonstrating the protection is
mediated by RNAi. Thus, iv treatment with RVG-9R/siRNA can be
safely and effectively used for the treatment of fatal JEV
infection.
[0325] It is likely that the siRNA is widely distributed within the
brain because most cell types in the brain including neurons,
astrocytes and glial cells express the .alpha.7 subunit of
AchR.sup.13.
[0326] Taken together, the inventors have discovered that an RVG
peptide construct comprising SEQ ID NO:13 permits transvascular
delivery of siRNA to the CNS. Although the exact mechanism by which
such a construct (for example RVG-9R, RVG-11R or other
RVG-containing constructs, or variants, derivatives or fragments
thereof) enable BBB crossing is not known and not wishing to be
bound by theory, because the RVG peptide alone (without 9R) was
also able to enter the brain cells after iv injection (FIG. 27d),
it is likely that receptor-mediated transcytosis via .alpha.7-10
subunit of the AchR (which is widely expressed in the brain
including expression by brain capillary endothelial cells.sup.13)
is involved in the process. The fact that RVG-9R, but not RV-MAT-9R
was capable of facilitating BBB crossing also indicates that
specific receptor binding can be important. Although cell
penetrating peptides might also enable membrane crossing of cargo
covalently conjugated at the terminus by unknown mechanisms.sup.23,
24, receptor clustering mediated by a 10:1 molar ratio of
siRNA/RVG-9R binding may be important for efficient transport of
siRNA into the neuronal cells (particularly when the siRNA is
non-covalently bound to the peptide) and this can explain the
neuronal cell specificity of targeting by RVG-9R. Because the
RVG-9R delivered siRNA was functional in gene silencing in multiple
systems, it is likely that the siRNA detaches from the peptide
inside the cell.
[0327] Similarly, siRNA complexed with protamine has also been
reported to be released in the cytoplasm of cells by unknown
mechanisms to mediate gene silencing.sup.25. The inventors have
discovered that RVG-9R mediates transvascular delivery of siRNAs to
the CNS. The inventors have discovered an intravenous RNAi-based
treatment approach for flaviviral encephalitis, as well as RVG
assisted brain delivery useful for delivery of a variety of other
therapeutic molecules such as gene therapy vectors and small
molecule drugs to the brain for the treatment of a wide variety of
neurodegenerative diseases and disorders.
REFERENCES
[0328] The references cited below and throughout the specification
are incorporated herein by reference in their entirety. All patents
and other publications identified are expressly incorporated herein
by reference for the purpose of describing and disclosing, for
example, the methodologies described in such publications that
might be used in connection with the present invention. These
publications are provided solely for their disclosure prior to the
filing date of the present application. Nothing in this regard
should be construed as an admission that the inventors are not
entitled to antedate such disclosure by virtue of prior invention
or for any other reason. All statements as to the date or
representation as to the contents of these documents is based on
the information available to the applicants and does not constitute
any admission as to the correctness of the dates or contents of
these documents. [0329] 1. Lieberman, J., Song, E., Lee, S. K.
& Shankar, P. Interfering with disease: opportunities and
roadblocks to harnessing RNA interference. Trends Mol Med 9,
397-403 (2003). [0330] 2. Berkhout, B. RNA interference as an
antiviral approach: targeting HIV-1. Curr Opin Mol Ther 6, 141-5
(2004). [0331] 1. Joost Haasnoot, P. C., Cupac, D. & Berkhout,
B. Inhibition of virus replication by RNA interference. J Biomed
Sci 10, 607-16 (2003). [0332] 2. Gitlin, L. & Andino, R.
Nucleic acid-based immune system: the antiviral potential of
mammalian RNA silencing. J Virol 77, 7159-65 (2003). [0333] 3.
Wang, Q. C., Nie, Q. H. & Feng, Z. H. RNA interference:
antiviral weapon and beyond. World J Gastroenterol 9, 1657-61
(2003). [0334] 4. Kumar P, Lee S K, Shankar P, Manjunath N. A
single siRNA suppresses encephalitis induced by two flaviviruses.
PLoS Medicine. April; 3(4):e96 (2006). [0335] 5. Gupta, B.,
Levchenko, T. S. & Torchilin, V. P. Intracellular delivery of
large molecules and small particles by cell-penetrating proteins
and peptides. Adv Drug Deliv Rev 57, 637-51 (2005). [0336] 6.
Dietz, G. P. & Bahr, M. Peptide-enhanced cellular
internalization of proteins in neuroscience. Brain Res Bull 68,
103-14 (2005). [0337] 7. Deshayes, S., Morris, M. C., Divita, G.
& Heitz, F. Cell-penetrating peptides: tools for intracellular
delivery of therapeutics. Cell Mol Life Sci 62, 1839-49 (2005).
[0338] 8. Melikov, K. & Chernomordik, L. V. Arginine-rich cell
penetrating peptides: from endosomal uptake to nuclear delivery.
Cell Mol Life Sci 62, 2739-49 (2005). [0339] 9. Mazarakis, N. D. et
al. Rabies virus glycoprotein pseudotyping of lentiviral vectors
enables retrograde axonal transport and access to the nervous
system after peripheral delivery. Hum Mol Genet 10, 2109-21 (2001).
[0340] 10. Tijsterman, M., Ketting, R. F. & Plasterk, R. H. The
genetics of RNA silencing. Annu Rev Genet 36, 489-519 (2002).
[0341] 11. Dixon, R. A. Natural products and plant disease
resistance. Nature 411, 843-7 (2001). [0342] 12. Plasterk, R. H.
RNA silencing: the genome's immune system. Science 296, 1263-5
(2002). [0343] 13. Bernstein, E., Denli, A. M. & Hannon, G. J.
The rest is silence. Rna 7, 1509-21 (2001). [0344] 14. Ahlquist, P.
RNA-dependent RNA polymerases, viruses, and RNA silencing. Science
296, 1270-3 (2002). [0345] 15. Mello, C. C. & Conte, D., Jr.
Revealing the world of RNA interference. Nature 431, 338-42 (2004).
[0346] 16. Meister, G. & Tuschl, T. Mechanisms of gene
silencing by double-stranded RNA. Nature 431, 343-9 (2004). [0347]
17. Hannon, G. J. & Rossi, J. J. Unlocking the potential of the
human genome with RNA interference. Nature 431, 371-8 (2004).
[0348] 18. Elbashir, S. M. et al. Duplexes of 21-nucleotide RNAs
mediate RNA interference in cultured mammalian cells. Nature 411,
494-8 (2001). [0349] 19. Bertrand, J. R. et al. Comparison of
antisense oligonucleotides and siRNAs in cell culture and in vivo.
Biochem Biophys Res Commun 296, 1000-4 (2002). [0350] 20. Gitlin,
L., Karelsky, S. & Andino, R. Short interfering RNA confers
intracellular antiviral immunity in human cells. Nature 418, 430-4
(2002). [0351] 21. Bagasra, O. & Prilliman, K. R. RNA
interference: the molecular immune system. J Mol Histol 35, 545-53
(2004). [0352] 22. Barik, S. Control of nonsegmented
negative-strand RNA virus replication by siRNA. Virus Res 102,
27-35 (2004). [0353] 23. Novina, C. D. et al. siRNA-directed
inhibition of HIV-1 infection. Nat Med 8, 681-6 (2002). [0354] 24.
Song, E. et al. Sustained small interfering RNA-mediated human
immunodeficiency virus type 1 inhibition in primary macrophages. J
Virol 77, 7174-81 (2003). [0355] 25. Lee, S. K. et al. Lentiviral
delivery of short hairpin RNAs protects CD4 T cells from multiple
clades and primary isolates of HIV. Blood (2005). [0356] 26. Jiang,
M. & Milner, J. Selective silencing of viral gene expression in
HPV-positive human cervical carcinoma cells treated with siRNA, a
primer of RNA interference. Oncogene 21, 6041-8 (2002). [0357] 27.
Bitko, V., Musiyenko, A., Shulyayeva, O. & Barik, S. Inhibition
of respiratory viruses by nasally administered siRNA. Nat Med 11,
50-5 (2005). [0358] 28. Tompkins, S. M., Lo, C. Y., Tumpey, T. M.
& Epstein, S. L. Protection against lethal influenza virus
challenge by RNA interference in vivo. Proc Natl Acad Sci USA 101,
8682-6 (2004). [0359] 29. Palliser, D. et al. An siRNA-based
microbicide protects mice from lethal herpes simplex virus 2
infection. Nature (2005). [0360] 30. Li, B. J. et al. Using siRNA
in prophylactic and therapeutic regimens against SARS coronavirus
in Rhesus macaque. Nat Med 11, 944-51 (2005). [0361] 31. Ptasznik,
A., Nakata, Y., Kalota, A., Emerson, S. G. & Gewirtz, A. M.
Short interfering RNA (siRNA) targeting the Lyn kinase induces
apoptosis in primary, and drug-resistant, BCR-ABL1(+) leukemia
cells. Nat Med 10, 1187-9 (2004). [0362] 32. Sumimoto, H. et al.
Gene therapy for human small-cell lung carcinoma by inactivation of
Skp-2 with virally mediated RNA interference. Gene Ther 12, 95-100
(2005). [0363] 33. Duxbury, M. S. et al. Systemic siRNA-mediated
gene silencing: a new approach to targeted therapy of cancer. Ann
Surg 240, 667-74; discussion 675-6 (2004). [0364] 34. Lakka, S. S.
et al. Inhibition of cathepsin B and MMP-9 gene expression in
glioblastoma cell line via RNA interference reduces tumor cell
invasion, tumor growth and angiogenesis. Oncogene 23, 4681-9
(2004). [0365] 35. Zhang, Y. et al. Intravenous RNA interference
gene therapy targeting the human epidermal growth factor receptor
prolongs survival in intracranial brain cancer. Clin Cancer Res 10,
3667-77 (2004). [0366] 36. Miller, V. M. et al. Allele-specific
silencing of dominant disease genes. Proc Natl Acad Sci USA 100,
7195-200 (2003). [0367] 37. Miller, V. M., Gouvion, C. M.,
Davidson, B. L. & Paulson, H. L. Targeting Alzheimer's disease
genes with RNA interference: an efficient strategy for silencing
mutant alleles. Nucleic Acids Res 32, 661-8 (2004). [0368] 38. Xia,
H. et al. RNAi suppresses polyglutamine-induced neurodegeneration
in a model of spinocerebellar ataxia. Nat Med 10, 816-20 (2004).
[0369] 39. Buckingham, S. D., Esmaeili, B., Wood, M. &
Sattelle, D. B. RNA interference: from model organisms towards
therapy for neural and neuromuscular disorders. Hum Mol Genet 13
Spec No 2, R275-88 (2004). [0370] 40. McCaffrey, A. P. et al. RNA
interference in adult mice. Nature 418, 38-9 (2002). [0371] 41.
Song, E. et al. RNA interference targeting Fas protects mice from
fulminant hepatitis. Nat Med 9, 347-51 (2003). [0372] 42. Ge, Q. et
al. Inhibition of influenza virus production in virus-infected mice
by RNA interference. Proc Natl Acad Sci USA 101, 8676-81 (2004).
[0373] 43. Miller, G. Drug targeting. Breaking down barriers.
Science 297, 1116-8 (2002). [0374] 44. Schlachetzki, F., Zhang, Y.,
Boado, R. J. & Pardridge, W. M. Gene therapy of the brain: the
transvascular approach. Neurology 62, 1275-81 (2004). [0375] 45.
Doolittle, N. D. et al. Safety and efficacy of a multicenter study
using intraarterial chemotherapy in conjunction with osmotic
opening of the blood-brain barrier for the treatment of patients
with malignant brain tumors. Cancer 88, 637-47 (2000). [0376] 46.
Kroll, R. A. & Neuwelt, E. A. Outwitting the blood-brain
barrier for therapeutic purposes: osmotic opening and other means.
Neurosurgery 42, 1083-99; discussion 1099-100 (1998). [0377] 47.
Muldoon, L. L. et al. Comparison of intracerebral inoculation and
osmotic blood-brain barrier disruption for delivery of adenovirus,
herpesvirus, and iron oxide particles to normal rat brain. Am J
Pathol 147, 1840-51 (1995). [0378] 48. Borlongan, C. V., Emerich,
D. F., Hoffer, B. J. & Bartus, R. T. Bradykinin receptor
agonist facilitates lowdose cyclosporine-A protection against
6-hydroxydopamine neurotoxicity. Brain Res 956, 211-20 (2002).
[0379] 49. Makimura, H., Mizuno, T. M., Mastaitis, J. W., Agami, R.
& Mobbs, C. V. Reducing hypothalamic AGRP by RNA interference
increases metabolic rate and decreases body weight without
influencing food intake. BMC Neurosci 3, 18 (2002). [0380] 50. Xia,
H., Mao, Q., Paulson, H. L. & Davidson, B. L. siRNA-mediated
gene silencing in vitro and in vivo. Nat Biotechnol 20, 1006-10
(2002). [0381] 51. Hommel, J. D., Sears, R. M., Georgescu, D.,
Simmons, D. L. & DiLeone, R. J. Local gene knockdown in the
brain using viral-mediated RNA interference. Nat Med 9, 1539-44
(2003). [0382] 52. Van den Haute, C., Eggermont, K., Nuttin, B.,
Debyser, Z. & Baekelandt, V. Lentiviral vector-mediated
delivery of short hairpin RNA results in persistent knockdown of
gene expression in mouse brain. Hum Gene Ther 14, 1799-807 (2003).
[0383] 53. Naldini, L. et al. In vivo gene delivery and stable
transduction of nondividing cells by a lentiviral vector. Science
272, 263-7 (1996). [0384] 54. Blomer, U. et al. Highly efficient
and sustained gene transfer in adult neurons with a lentivirus
vector. J Virol 71, 6641-9 (1997). [0385] 55. Raoul, C. et al.
Lentiviral-mediated silencing of SOD1 through RNA interference
retards disease onset and progression in a mouse model of ALS. Nat
Med 11, 423-8 (2005). [0386] 56. Ralph, G. S. et al. Silencing
mutant SOD1 using RNAi protects against neurodegeneration and
extends survival in an ALS model. Nat Med 11, 429-33 (2005). [0387]
57. Cao, L. et al. VEGF links hippocampal activity with
neurogenesis, learning and memory. Nat Genet 36, 827-35 (2004).
[0388] 58. Harper, S. Q. et al. RNA interference improves motor and
neuropathological abnormalities in a Huntington's disease mouse
model. Proc Natl Acad Sci USA 102, 5820-5 (2005). [0389] 59.
Thakker, D. R., Hoyer, D. & Cryan, J. F. Interfering with the
brain: Use of RNA interference for understanding the
pathophysiology of psychiatric and neurological disorders.
Pharmacol Ther (2005). [0390] 60. Marshall, E. Gene therapy. Second
child in French trial is found to have leukemia. Science 299, 320
(2003). [0391] 61. Hacein-Bey-Abina, S. et al. A serious adverse
event after successful gene therapy for X-linked severe combined
immunodeficiency. N Engl J Med 348, 255-6 (2003). [0392] 62. Omi,
K., Tokunaga, K. & Hohjoh, H. Long-lasting RNAi activity in
mammalian neurons. FEBS Lett 558, 89-95 (2004). [0393] 63. Isacson,
R., Kull, B., Salmi, P. & Wahlestedt, C. Lack of efficacy of
`naked` small interfering RNA applied directly to rat brain. Acta
Physiol Scand 179, 173-7 (2003). [0394] 64. Hassani, Z. et al.
Lipid-mediated siRNA delivery down-regulates exogenous gene
expression in the mouse brain at picomolar levels. J Gene Med 7,
198-207 (2005). [0395] 65. Thakker, D. R. et al. Neurochemical and
behavioral consequences of widespread gene knockdown in the adult
mouse brain by using nonviral RNA interference. Proc Natl Acad Sci
USA101, 17270-5 (2004). [0396] 66. Thakker, D. R. et al.
siRNA-mediated knockdown of the serotonin transporter in the adult
mouse brain. Mol Psychiatry (2005). [0397] 67. Allerson, C. R. et
al. Fully 2'-modified oligonucleotide duplexes with improved in
vitro potency and stability compared to unmodified small
interfering RNA. J Med Chem 48, 901-4 (2005). [0398] 68. Elmen, J.
et al. Locked nucleic acid (LNA) mediated improvements in siRNA
stability and functionality. Nucleic Acids Res 33, 439-47 (2005).
[0399] 69. Layzer, J. M. et al. In vivo activity of
nuclease-resistant siRNAs. Rna 10, 766-71 (2004). [0400] 70. Li, Z.
Y., Mao, H., Kallick, D. A. & Gorenstein, D. G. The effects of
thiophosphate substitutions on native siRNA gene silencing. Biochem
Biophys Res Commun 329, 1026-30 (2005). [0401] 71. Soutschek, J. et
al. Therapeutic silencing of an endogenous gene by systemic
administration of modified siRNAs. Nature 432, 173-8 (2004). [0402]
72. Krutzfeldt, J. et al. Silencing of microRNAs in vivo with
`antagomirs`. Nature 438, 685-9 (2005). [0403] 73. Dorn, G. et al.
siRNA relieves chronic neuropathic pain. Nucleic Acids Res 32, e49
(2004). [0404] 74. Shi, N. & Pardridge, W. M. Noninvasive gene
targeting to the brain. Proc Natl Acad Sci USA 97, 7567-72 (2000).
[0405] 75. Shi, N., Boado, R. J. & Pardridge, W. M. Antisense
imaging of gene expression in the brain in vivo. Proc Natl Acad Sci
USA 97, 14709-14 (2000). [0406] 76. Shi, N., Boado, R. J. &
Pardridge, W. M. Receptor-mediated gene targeting to tissues in
vivo following intravenous administration of pegylated
immunoliposomes. Pharm Res 18, 1091-5 (2001). [0407] 77. Shi, N.,
Zhang, Y., Zhu, C., Boado, R. J. & Pardridge, W. M.
Brain-specific expression of an exogenous gene after i.v.
administration. Proc Natl Acad Sci USA 98, 12754-9 (2001). [0408]
78. Zhu, C. et al. Organ-specific expression of the lacZ gene
controlled by the opsin promoter after intravenous gene
administration in adult mice. J Gene Med 6, 906-12 (2004). [0409]
79. Zhang, Y., Schlachetzki, F. & Pardridge, W. M. Global
non-viral gene transfer to the primate brain following intravenous
administration. Mol Ther 7, 11-8 (2003). [0410] 80. Zhang, Y.,
Boado, R. J. & Pardridge, W. M. In vivo knockdown of gene
expression in brain cancer with intravenous RNAi in adult rats. J
Gene Med 5, 1039-45 (2003). [0411] 81. B. N. Fields, D. M. K., P.
M. Howley (ed.) Field's Virology, 931-952 (Lippincott-Raven,
Philadelphia, 1996). [0412] 82. Biggerstaff, B. J. & Petersen,
L. R. Estimated risk of transmission of the West Nile virus through
blood transfusion in the US, 2002. Transfusion 43, 1007-17 (2003).
[0413] 83. Tyler, K. L. West Nile virus infection in the United
States. Arch Neurol 61, 1190-5 (2004). [0414] 84. Solomon, T.
Flavivirus encephalitis. N Engl J Med 351, 370-8 (2004). [0415] 85.
Gondi, C. S. et al. RNAi-mediated inhibition of cathepsin B and
uPAR leads to decreased cell invasion, angiogenesis and tumor
growth in gliomas. Oncogene 23, 8486-96 (2004). [0416] 86.
Rubinson, D. A. et al. A lentivirus-based system to functionally
silence genes in primary mammalian cells, stem cells and transgenic
mice by RNA interference. Nat Genet 33, 401-6 (2003). [0417] 87.
Rey, F. A., Heinz, F. X., Mandl, C., Kunz, C.
& Harrison, S. C. The envelope glycoprotein from tickborne
encephalitis virus at 2 A resolution. Nature 375, 291-8 (1995).
[0418] 88. Du, Q., Thonberg, H., Wang, J., Wahlestedt, C. &
Liang, Z. A systematic analysis of the silencing effects of an
active siRNA at all single-nucleotide mismatched target sites.
Nucleic Acids Res 33, 1671-7 (2005). [0419] 89. Lentz, T. L.,
Wilson, P. T., Hawrot, E. & Speicher, D. W. Amino acid sequence
similarity between rabies virus glycoprotein and snake venom
curaremimetic neurotoxins. Science 226, 847-8 (1984). [0420] 90.
Lentz, T. L., Burrage, T. G., Smith, A. L., Crick, J. & Tignor,
G. H. Is the acetylcholine receptor a rabies virus receptor?
Science 215, 182-4 (1982). [0421] 91. Lafon, M. Rabies virus
receptors. J Neurovirol 11, 82-7 (2005). [0422] 92. Lentz, T. L.
Rabies virus binding to an acetylcholine receptor alpha-subunit
peptide. J Mol Recognit 3, 82-8 (1990). [0423] 93. Lentz, T. L.
Structure-function relationships of curaremimetic neurotoxin loop 2
and of a structurally similar segment of rabies virus glycoprotein
in their interaction with the nicotinic acetylcholine receptor.
Biochemistry 30, 10949-57 (1991). [0424] 94. Notter, M. F. &
Leary, J. F. Flow cytometric analysis of tetanus toxin binding to
neuroblastoma cells. J Cell Physiol 125, 476-84 (1985). [0425] 95.
Chen, T. J., Chen, S. S., Wu, R. E., Wang, D. C. & Lin, C. H.
Implication of nNOS in the enlargement of AChR aggregates but not
the initial aggregate formation in a novel coculture model. Chin J
Physiol 48, 129-38 (2005). [0426] 96. Gotti, C. & Clementi, F.
Neuronal nicotinic receptors: from structure to pathology. Prog
Neurobiol 74, 363-96 (2004). [0427] 97. Chiu, Y. L., Ali, A., Chu,
C. Y., Cao, H. & Rana, T. M. Visualizing a correlation between
siRNA localization, cellular uptake, and RNAi in living cells. Chem
Biol 11, 1165-75 (2004). [0428] 98. Wender, P. A. et al. The
design, synthesis, and evaluation of molecules that enable or
enhance cellular uptake: peptoid molecular transporters. Proc Natl
Acad Sci USA 97, 13003-8 (2000). [0429] 99. Lu, C., Shimaoka, M.,
Salas, A. & Springer, T. A. The binding sites for competitive
antagonistic, allosteric antagonistic, and agonistic antibodies to
the domain of integrin LFA-1. J Immunol 173, 3972-8 (2004). [0430]
100. Donnelly-Roberts, D. L. & Lentz, T. L. Structural and
conformational similarity between synthetic peptides of
curaremimetic neurotoxins and rabies virus glycoprotein. Brain Res
Mol Brain Res 11, 107-13 (1991). [0431] 101. Dietzschold, B.,
Schnell, M. & Koprowski, H. Pathogenesis of rabies. Curr Top
Microbiol Immunol 292, 45-56 (2005). [0432] 102. Plakhov, I. V.,
Arlund, E. E., Aoki, C. & Reiss, C. S. The earliest events in
vesicular stomatitis virus infection of the murine olfactory
neuroepithelium and entry of the central nervous system. Virology
209, 257-62 (1995). [0433] 103. Lafay, F. et al. Spread of the CVS
strain of rabies virus and of the avirulent mutant AvO1 along the
olfactory pathways of the mouse after intranasal inoculation.
Virology 183, 320-30 (1991). [0434] 104. Kilic, E., Kilic, U. &
Hermann, D. M. TAT fusion proteins against ischemic stroke: Current
status and future perspectives. Front Biosci 11, 1716-21 (2006).
[0435] 105. Diem, R. et al. HIV-Tat-mediated Bcl-XL delivery
protects retinal ganglion cells during experimental autoimmune
optic neuritis. Neurobiol Dis 20, 218-26 (2005). [0436] 106. Yin,
W. et al. TAT-mediated delivery of Bcl-xL protein is
neuroprotective against neonatal hypoxicischemic brain injury via
inhibition of caspases and AIF. Neurobiol Dis (2005). [0437] 107.
Pesola, J. M., Zhu, J., Knipe, D. M. & Coen, D. M. Herpes
simplex virus 1 immediate-early and early gene expression during
reactivation from latency under conditions that prevent infectious
virus production. J Virol 79, 14516-25 (2005). [0438] 108. Shah, K.
et al. Glioma therapy and real-time imaging of neural precursor
cell migration and tumor regression. Ann Neurol 57, 34-41 (2005).
[0439] 109. Shah, K. et al. In vivo imaging of HIV protease
activity in amplicon vector-transduced gliomas. Cancer Res 64,
273-8 (2004). [0440] 110. Tang, Y. et al. In vivo tracking of
neural progenitor cell migration to glioblastomas. Hum Gene Ther
14, 1247-54 (2003). [0441] 111. Shah, K., Tang, Y., Breakefield, X.
& Weissleder, R. Real-time imaging of TRAIL-induced apoptosis
of glioma tumors in vivo. Oncogene 22, 6865-72 (2003). [0442] 112.
Schiffelers, R. M. et al. Cancer siRNA therapy by tumor selective
delivery with ligand-targeted sterically stabilized nanoparticle.
Nucleic Acids Res 32, e149 (2004). [0443] 113. Zhang, W. et al.
Inhibition of respiratory syncytial virus infection with intranasal
siRNA nanoparticles targeting the viral NS1 gene. Nat Med 11, 56-62
(2005). [0444] 114. Hu-Lieskovan, S., Heidel, J. D., Bartlett, D.
W., Davis, M. E. & Triche, T. J. Sequence-specific knockdown of
EWS-FLI1 by targeted, nonviral delivery of small interfering RNA
inhibits tumor growth in a murine model of metastatic Ewing's
sarcoma. Cancer Res 65, 8984-92 (2005). [0445] 115. Kulkarni, R.
P., Mishra, S., Fraser, S. E. & Davis, M. E. Single cell
kinetics of intracellular, nonviral, nucleic acid delivery vehicle
acidification and trafficking. Bioconjug Chem 16, 986-94 (2005).
[0446] 116. Davis, M. E. & Brewster, M. E. Cyclodextrin-based
pharmaceutics: past, present and future. Nat Rev Drug Discov 3,
1023-35 (2004). [0447] 117. Bellocq, N. C. et al. Synthetic
biocompatible cyclodextrin-based constructs for local gene delivery
to improve cutaneous wound healing. Bioconjug Chem 15, 1201-11
(2004). [0448] 118. Pun, S. H. et al. Cyclodextrin-modified
polyethylenimine polymers for gene delivery. Bioconjug Chem 15,
831-40 (2004). [0449] 119. Pun, S. H. et al. Targeted delivery of
RNA-cleaving DNA enzyme (DNAzyme) to tumor tissue by
transferrin-modified, cyclodextrin-based particles. Cancer Biol
Ther 3, 641-50 (2004). [0450] 120. Davis, M. E. et al.
Self-assembling nucleic acid delivery vehicles via linear,
water-soluble, cyclodextrincontaining polymers. Curr Med Chem 11,
179-97 (2004). [0451] 121. Bellocq, N. C., Pun, S. H., Jensen, G.
S. & Davis, M. E. Transferrin-containing, cyclodextrin
polymerbased particles for tumor-targeted gene delivery. Bioconjug
Chem 14, 1122-32 (2003). [0452] 122. Metselaar, J. M. & Storm,
G. Liposomes in the treatment of inflammatory disorders. Expert
Opin Drug Deliv 2, 465-76 (2005). [0453] 123. Torchilin, V. P.
Recent advances with liposomes as pharmaceutical carriers. Nat Rev
Drug Discov 4, 145-60 (2005). [0454] 124. Peer, D., Florentin, A.
& Margalit, R. Hyaluronan is a key component in cryoprotection
and formulation of targeted unilamellar liposomes. Biochim Biophys
Acta 1612, 76-82 (2003). [0455] 125. Peer, D. & Margalit, R.
Physicochemical evaluation of a stability-driven approach to drug
entrapment in regular and in surface-modified liposomes. Arch
Biochem Biophys 383, 185-90 (2000). [0456] 126. Peer, D. &
Margalit, R. Loading mitomycin C inside long circulating hyaluronan
targeted nanoliposomes increases its antitumor activity in three
mice tumor models. Int J Cancer 108, 780-9 (2004). [0457] 127.
Peer, D. & Margalit, R. Tumor-targeted hyaluronan nanoliposomes
increase the antitumor activity of liposomal Doxorubicin in
syngeneic and human xenograft mouse tumor models. Neoplasia 6,
343-53 (2004). [0458] 128. Zhang, Y., Schlachetzki, F., Li, J. Y.,
Boado, R. J. & Pardridge, W. M. Organ-specific gene expression
in the rhesus monkey eye following intravenous non-viral gene
transfer. Mol Vis 9, 465-72 (2003). [0459] 129. Huber, J. D.,
Egleton, R. D. & Davis, T. P. Molecular physiology and
pathophysiology of tight junctions in the blood-brain barrier.
Trends Neurosci 24, 719-25 (2001). [0460] 130. Akdemir, H.,
Selcuklu, A., Pasaoglu, A., Oktem, I. S. & Kavuncu, I.
Treatment of severe intraventricular hemorrhage by intraventricular
infusion of urokinase. Neurosurg Rev 18, 95-100 (1995). [0461] 131.
Vincken, W., Meysman, M., Verbeelen, D., Lauwers, S. & D'Haens,
J. Intraventricular rifampicin in severe tuberculous
meningo-encephalitis. Eur Respir J 5, 891-3 (1992). [0462] 132.
Elgamal, E. A. & Murshid, W. R. Intracavitary administration of
amphotericin B in the treatment of cerebral aspergillosis in a non
immune-compromised patient: case report and review of the
literature. Br J Neurosurg 14, 137-41 (2000). [0463] 133. Rawicki,
B. Treatment of cerebral origin spasticity with continuous
intrathecal baclofen delivered via an implantable pump: long-term
follow-up review of 18 patients. J Neurosurg 91, 733-6 (1999).
[0464] 134. Kamensek, J. Continuous intrathecal baclofen infusions.
An introduction and overview. Axone 20, 93-8 (1999). [0465] 135.
Dario, A. & Tomei, G. A benefit-risk assessment of baclofen in
severe spinal spasticity. Drug Saf 27, 799-818 (2004). [0466] 136.
Uhrbom, L., Nerio, E. & Holland, E. C. Dissecting tumor
maintenance requirements using bioluminescence imaging of cell
proliferation in a mouse glioma model. Nat Med 10, 1257-60 (2004).
[0467] 137. Saydam, O. et al. Herpes simplex virus 1 amplicon
vector-mediated siRNA targeting epidermal growth factor receptor
inhibits growth of human glioma cells in vivo. Mol Ther 12, 803-12
(2005). [0468] 138. Bloom, D. C. HSV LAT and neuronal survival. Int
Rev Immunol 23, 187-98 (2004). [0469] 139. Yarom, N., Buchner, A.
& Dayan, D. Herpes simplex virus infection: part I--Biology,
clinical presentation and latency. Refuat Hapeh Vehashinayim 22,
7-15, 84 (2005). [0470] 140. Bystricka, M. & Russ, G. Immunity
in latent Herpes simplex virus infection. Acta Virol 49, 159-67
(2005). [0471] 141. Decman, V., Freeman, M. L., Kinchington, P. R.
& Hendricks, R. L. Immune control of HSV-1 latency. Viral
Immunol 18, 466-73 (2005). [0472] 142. Thompson, R. L. &
Sawtell, N. M. The herpes simplex virus type 1 latency-associated
transcript gene regulates the establishment of latency. J Virol 71,
5432-40 (1997). [0473] 143. Perng, G. C. et al. Virus-induced
neuronal apoptosis blocked by the herpes simplex virus
latencyassociated transcript. Science 287, 1500-3 (2000). [0474]
144. Thompson, R. L. & Sawtell, N. M. Herpes simplex virus type
1 latency-associated transcript gene promotes neuronal survival. J
Virol 75, 6660-75 (2001). [0475] 145. Bhuyan, P. K. et al. Short
interfering RNA-mediated inhibition of herpes simplex virus type 1
gene expression and function during infection of human
keratinocytes. J Virol 78, 10276-81 (2004). [0476] 146. Peng, W. et
al. Mapping herpes simplex virus type 1 latency-associated
transcript sequences that protect from apoptosis mediated by a
plasmid expressing caspase-8. J Neurovirol 10, 260-5 (2004). [0477]
147. Jin, L. et al. Identification of herpes simplex virus type 1
latency-associated transcript sequences that both inhibit apoptosis
and enhance the spontaneous reactivation phenotype. J Virol 77,
6556-61 (2003). [0478] 148. Wang, Q. Y. et al. Herpesviral
latency-associated transcript gene promotes assembly of
heterochromatin on viral lytic-gene promoters in latent infection.
Proc Natl Acad Sci USA 102, 16055-9 (2005). [0479] 149. Higaki, S.,
Deai, T., Fukuda, M. & Shimomura, Y. Microarray analysis in the
HSV-1 latently infected mouse trigeminal ganglion. Cornea 23, S42-7
(2004). [0480] 150. Jin, L. et al. A herpes simplex virus type 1
mutant expressing a baculovirus inhibitor of apoptosis gene in
place of latency-associated transcript has a wild-type reactivation
phenotype in the mouse. J Virol 79, 12286-95 (2005). [0481] 151.
Sharma, S., Zhou, Y. & Singh, B. R. Cloning, expression, and
purification of C-terminal quarter of the heavy chain of botulinum
neurotoxin type A. Protein Expr Purif (2005). [0482] 152. Zhou, Y.
& Singh, B. R. Cloning, high-level expression, single-step
purification, and binding activity of His6-tagged recombinant type
B botulinum neurotoxin heavy chain transmembrane and binding
domain. Protein Expr Purif 34, 8-16 (2004). [0483] 153. Lentz, T.
L., Burrage, T. G., Smith, A. L., Crick, J. & Tignor, G. H. Is
the acetylcholine receptor a rabies virus receptor? Science 215,
182-4 (1982). [0484] 154. Lafon, M. Rabies virus receptors. J
Neurovirol 11, 82-7 (2005). [0485] 155. Rubinson, D. A. et al. A
lentivirus-based system to functionally silence genes in primary
mammalian cells, stem cells and transgenic mice by RNA
interference. Nat Genet 33, 401-6 (2003). [0486] 156. Mazarakis, N.
D. et al. Rabies virus glycoprotein pseudotyping of lentiviral
vectors enables retrograde axonal transport and access to the
nervous system after peripheral delivery. Hum Mol Genet 10, 2109-21
(2001). [0487] 157. Kumar, P., Lee, S. K., Shankar, P. &
Manjunath, N. A Single siRNA Suppresses Fatal Encephalitis Induced
by Two Different Flaviviruses. PLoS Med 3, e96 (2006). [0488] 158.
Judge, A. D. et al. Sequence-dependent stimulation of the mammalian
innate immune response by synthetic siRNA. Nat Biotechnol 23,
457-62 (2005).
Sequence CWU 1
1
3519PRTHuman immunodeficiency virus type 1 1Arg Lys Lys Arg Arg Gln
Arg Arg Arg 1 5 213PRTHuman immunodeficiency virus type 1 2Gly Arg
Lys Lys Arg Arg Gln Arg Arg Arg Thr Pro Gln 1 5 10 311PRTHuman
immunodeficiency virus type 1 3Tyr Gly Arg Lys Lys Arg Arg Gln Arg
Arg Arg 1 5 10 426PRTKaposi's sarcoma-associated herpesvirus 4Ala
Ala Val Ala Leu Leu Pro Ala Val Leu Leu Ala Leu Leu Ala Pro 1 5 10
15 Val Gln Arg Lys Arg Gln Lys Leu Met Pro 20 25 517PRTCaiman
crocodylus 5Met Gly Leu Gly Leu His Leu Leu Val Leu Ala Ala Ala Leu
Gln Gly 1 5 10 15 Ala 623PRTHuman immunodeficiency virus type 1
6Gly Ala Leu Phe Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr Met Gly 1
5 10 15 Ala Pro Lys Ser Lys Arg Lys 20 716PRTDrosophila
melanogaster 7Arg Gln Ile Lys Ile Trp Phe Gln Asn Arg Arg Met Lys
Trp Lys Lys 1 5 10 15 85PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptideMOD_RES(1)variable amino
acidMOD_RES(5)variable amino acid 8Xaa Arg Gly Asp Xaa 1
5924PRTInfluenza virus 9Gly Leu Phe Glu Ala Ile Ala Gly Phe Ile Glu
Asn Gly Trp Glu Gly 1 5 10 15 Met Ile Asp Gly Gly Gly Tyr Cys 20
1027PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 10Gly Trp Thr Leu Asn Ser Ala Gly Tyr Leu Leu Gly
Lys Ile Asn Leu 1 5 10 15 Lys Ala Leu Ala Ala Leu Ala Lys Lys Ile
Leu 20 25 119PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptideMOD_RES(1)may or may not be present 11Ser
Asp His Gln Leu Asn Pro Ala Phe 1 5 129PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
peptideMOD_RES(1)may or may not be present 12Ser Phe Cys Tyr Trp
Lys Thr Cys Thr 1 5 1329PRTRabies virus 13Tyr Thr Ile Trp Met Pro
Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp 1 5 10 15 Ile Phe Thr Asn
Ser Arg Gly Lys Arg Ala Ser Asn Gly 20 25 1443PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 14Tyr
Thr Ile Trp Met Pro Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp 1 5 10
15 Ile Phe Thr Asn Ser Arg Gly Lys Arg Ala Ser Asn Gly Gly Gly Gly
20 25 30 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 35 40
1547PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 15Tyr Thr Ile Trp Met Pro Glu Asn Pro Arg Pro Gly
Thr Pro Cys Asp 1 5 10 15 Ile Phe Thr Asn Ser Arg Gly Lys Arg Ala
Ser Asn Gly Gly Gly Gly 20 25 30 Tyr Gly Arg Lys Lys Arg Arg Gln
Arg Arg Arg Lys Lys Arg Lys 35 40 45 1654PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 16Tyr
Thr Ile Trp Met Pro Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp 1 5 10
15 Ile Phe Thr Asn Ser Arg Gly Lys Arg Ala Ser Asn Gly Gly Gly Gly
20 25 30 Arg Ser Gln Ser Arg Ser Arg Tyr Tyr Arg Gln Arg Gln Arg
Ser Arg 35 40 45 Arg Arg Arg Arg Arg Ser 501726PRTKaposi's
sarcoma-associated herpesvirus 17Ala Ala Val Ala Leu Leu Pro Ala
Val Leu Leu Ala Leu Leu Ala Pro 1 5 10 15 Ala Ala Ala Asp Gln Asn
Gln Leu Met Pro 20 25 1834PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 18Asp Ala Ala Thr Ala Thr Arg
Gly Arg Ser Ala Ala Ser Arg Pro Thr 1 5 10 15 Glu Arg Pro Arg Ala
Pro Ala Arg Ser Ala Ser Arg Pro Arg Arg Pro 20 25 30 Val Glu
1916PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 19Arg Arg Trp Arg Arg Trp Trp Arg Arg Trp Trp Arg
Arg Trp Arg Arg 1 5 10 15 207PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 20Arg Arg Arg Arg Arg Arg Arg
1 5 2110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 21Arg Pro Lys Lys Arg Lys Val Arg Arg Arg 1 5
102211PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 22Lys Lys Lys Lys Lys Lys Lys Lys Gly Gly Cys 1 5
10 2311PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 23Lys Trp Lys Lys Lys Trp Lys Lys Gly Cys Cys 1 5
10 2411PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 24Arg Trp Arg Arg Arg Trp Arg Arg Gly Gly Cys 1 5
10 2528PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 25Gly Ala Leu Phe Leu Gly Phe Leu Gly Gly Ala Ala
Gly Ser Thr Met 1 5 10 15 Gly Ala Trp Ser Gln Pro Lys Ser Lys Arg
Lys Val 20 25 2621PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 26Ala Gly Tyr Leu Leu Gly Lys Ile Asn
Leu Lys Ala Leu Ala Ala Leu 1 5 10 15 Ala Lys Lys Ile Leu 20
2726PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 27Asp Pro Lys Gly Asp Pro Lys Gly Val Thr Val Thr
Val Thr Val Thr 1 5 10 15 Val Thr Gly Lys Gly Asp Pro Lys Pro Asp
20 25 2818PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 28Lys Leu Ala Leu Lys Leu Ala Leu Lys Ala Leu Lys
Ala Ala Leu Lys 1 5 10 15 Leu Ala 2918PRTMus musculus 29Leu Leu Ile
Ile Leu Arg Arg Arg Ile Arg Lys Gln Ala His Ala His 1 5 10 15 Ser
Lys 3016PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 30Arg Val Ile Arg Val Trp Phe Gln Asn Lys Arg Cys
Lys Asp Lys Lys 1 5 10 15 3121PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 31Lys Glu Thr Trp Trp Glu Thr
Trp Trp Thr Glu Trp Ser Gln Pro Lys 1 5 10 15 Lys Lys Arg Lys Val
20 3228PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 32Met Ala Asn Leu Gly Tyr Trp Leu Leu Ala Leu Phe
Val Thr Met Trp 1 5 10 15 Thr Asp Val Gly Leu Cys Lys Lys Arg Pro
Lys Pro 20 25 3329PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 33Met Asn Leu Leu Arg Lys Ile Val Lys
Asn Arg Arg Asp Glu Asp Thr 1 5 10 15 Gln Lys Ser Ser Pro Ala Ser
Ala Pro Leu Asp Asp Gly 20 25 3441PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 34Tyr Thr Ile Trp Met Pro
Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp 1 5 10 15 Ile Phe Thr Asn
Ser Arg Gly Lys Arg Ala Ser Asn Gly Gly Gly Gly 20 25 30 Arg Arg
Arg Arg Arg Arg Arg Arg Arg 35 40 3541PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 35Met
Asn Leu Leu Arg Lys Ile Val Lys Asn Arg Arg Asp Glu Asp Thr 1 5 10
15 Gln Lys Ser Ser Pro Ala Ser Ala Pro Leu Asp Asp Gly Gly Gly Gly
20 25 30 Arg Arg Arg Arg Arg Arg Arg Arg Arg 35 40
* * * * *
References