U.S. patent application number 15/611016 was filed with the patent office on 2017-11-09 for compositions and methods for treating eye infections and disease.
The applicant listed for this patent is UNIVERSITY OF VIRGINIA PATENT FOUNDATION. Invention is credited to Gordon W. LAURIE.
Application Number | 20170322226 15/611016 |
Document ID | / |
Family ID | 54072366 |
Filed Date | 2017-11-09 |
United States Patent
Application |
20170322226 |
Kind Code |
A1 |
LAURIE; Gordon W. |
November 9, 2017 |
COMPOSITIONS AND METHODS FOR TREATING EYE INFECTIONS AND
DISEASE
Abstract
The present invention provides compositions and methods for
identifying subjects suffering from dry eye that can be treated by
topical administration of a composition comprising lacritin or a
bioactive fragment thereof. The application discloses in part that
a .about.90 KDa deglycanated form of syndecan-1 is abundant in
tears of normal individuals but not individuals suffering from dry
eye, whereas a .about.25 kDa syndecan-1 fragment is detectable in
dry, but not normal tears.
Inventors: |
LAURIE; Gordon W.;
(Charlottesville, VA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
UNIVERSITY OF VIRGINIA PATENT FOUNDATION |
Charlottesville |
VA |
US |
|
|
Family ID: |
54072366 |
Appl. No.: |
15/611016 |
Filed: |
June 1, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15125357 |
Sep 12, 2016 |
|
|
|
PCT/US2015/019964 |
Mar 11, 2015 |
|
|
|
15611016 |
|
|
|
|
61951680 |
Mar 12, 2014 |
|
|
|
62019476 |
Jul 1, 2014 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 31/02 20180101;
G01N 2800/162 20130101; A61P 27/02 20180101; C12Y 302/01166
20130101; A61K 38/18 20130101; G01N 2333/4728 20130101; A61K 9/0048
20130101; G01N 33/6893 20130101; G01N 2333/4722 20130101; A61P
43/00 20180101; G01N 2333/4706 20130101; G01N 33/573 20130101; C07K
14/475 20130101; G01N 33/68 20130101; G01N 2800/16 20130101; G01N
2333/924 20130101; G01N 2333/70596 20130101; A61K 38/1709
20130101 |
International
Class: |
G01N 33/68 20060101
G01N033/68; G01N 33/573 20060101 G01N033/573; A61K 9/00 20060101
A61K009/00; A61K 38/17 20060101 A61K038/17 |
Goverment Interests
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
[0002] This invention was made with government support under Grant
Nos. EY013143 and EY018222, awarded by The National Institutes of
Health. The government has certain rights in the invention.
Claims
1. A method of treating dry eye, the method comprising: topically
administering a therapeutically effective amount of a sterile,
aqueous, topical pharmaceutical composition to an ocular surface,
wherein the sterile aqueous topical pharmaceutical composition
comprises: a peptide, or a pharmaceutically acceptable salt
thereof, wherein the peptide, or pharmaceutically acceptable salt
thereof, has an amino acid sequence consisting of SEQ ID NO: 5,
wherein the C-terminus of the peptide is amidated, wherein the
N-terminus of the peptide is acylated, and a pharmaceutically
acceptable aqueous carrier.
2. The method of claim 1, wherein the peptide, or pharmaceutically
acceptable salt thereof, is at a concentration of 0.001% to 1%
(w/w).
3. The method of claim 1, wherein the pharmaceutically acceptable
aqueous carrier comprises a buffer.
4. The method of claim 1, wherein the sterile, aqueous, topical
pharmaceutical composition further comprises a tonicity agent.
5. The method of claim 1, wherein the sterile, aqueous, topical
pharmaceutical composition further comprises a viscosity building
agent.
6. The method of claim 1, wherein the subject has Sjogren's
Syndrome.
7. The method of claim 1, wherein the subject is recovering from
photorefractive keratectomy or laser-assisted in situ
keratomileusis.
8. The method of claim 1, wherein the subject has Sjogren's
Syndrome, wherein the peptide, or pharmaceutically acceptable salt
thereof, is at a concentration of 0.001% to 1% (w/w), wherein the
pharmaceutically acceptable aqueous carrier comprises a buffer, and
wherein the sterile, aqueous, topical pharmaceutical composition
further comprises, a tonicity agent, and a surfactant.
9. A method of treating dry eye comprising: topically administering
a therapeutically effective amount of a pharmaceutical composition
to an ocular surface, wherein the pharmaceutical composition
comprises: a peptide, or a pharmaceutically acceptable salt
thereof, wherein the peptide, or pharmaceutically acceptable salt
thereof, has an amino acid sequence consisting of SEQ ID NO: 7,
wherein the C-terminus of the peptide is amidated, wherein the
N-terminus of the peptide is acylated, and a pharmaceutically
acceptable carrier.
10. The method of claim 9, wherein the pharmaceutical composition
comprises 0.001% to 1% (w/w) of the peptide, or pharmaceutically
acceptable salt thereof.
11. The method of claim 9, wherein the pharmaceutically acceptable
carrier comprises a buffer.
12. The method of claim 9, wherein the pharmaceutical composition
further comprises a tonicity agent.
13. The method of claim 9, wherein the pharmaceutical composition
further comprises a preservative agent.
14. The method of claim 9, wherein the pharmaceutical composition
further comprises a viscosity building agent.
15. The method of claim 9, wherein the pH of the pharmaceutical
composition is between 7 and 8.
16. The method of claim 9, wherein the pharmaceutical composition
further comprises one or more lubricating agents.
17. The method of claim 9, wherein the subject has Sjogren's
Syndrome.
18. The method of claim 9, wherein the subject is recovering from
photorefractive keratectomy or laser-assisted in situ
keratomileusis.
19. A method of treating dry eye in a subject, comprising:
detecting a 25 kDa syndecan-1 fragment in tears of a subject; and
administering to an eye of the subject a therapeutically effective
amount of a pharmaceutical composition comprising: a peptide, or a
pharmaceutically acceptable salt thereof, wherein the peptide, or
pharmaceutically acceptable salt thereof, has an amino acid
sequence selected from the group consisting of SEQ ID NO: 5, 6, 7,
8, or a derivative thereof, wherein the derivative thereof differs
from SEQ ID NO: 5, 6, 7 or 8 by one or two amino acid
substitutions, and a pharmaceutically acceptable carrier.
20. The method of claim 19, wherein the subject is recovering from
photorefractive keratectomy or laser-assisted in situ
keratomileusis.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 15/125,357, filed Sep. 12, 2016, which is a U.S. national
counterpart application of PCT International Application Serial No.
PCT/US2015/019964, filed Mar. 11, 2015, which claims priority to
U.S. Provisional Application Ser. No. 62/019,476, filed Jul. 1,
2014, and U.S. Provisional Application Ser. No. 61/951,680, filed
Mar. 12, 2014, the disclosures of all which are hereby incorporated
herein by reference in their entirety.
INCORPORATION BY REFERENCE OF MATERIAL SUBMITTED ELECTRONICALLY
[0003] Incorporated by reference in its entirety is a
computer-readable nucleotide/amino acid sequence listing submitted
concurrently herewith and identified as follows: 19 kilobytes ACII
(Text) file named "266367SeqListing.txt," created on Jun. 1,
2017.
BACKGROUND
[0004] Health of the ocular surface is dependent on tear fluid
secretions from the lacrimal gland. The lacrimal acinar cells
comprising the lacrimal gland are polarized and highly
differentiated tear secreting cells that adhere to a complex
periacinar basement membrane. The bulk of the apical cell cytoplasm
contains large secretory granules packed with tear proteins. Known
tear proteins include: lysozyme, which plays a prominent
bactericidal role on the corneal surface; lactoferrin, which
functions as both a bactericidal agent and as a potential inhibitor
of complement activation; secretory component, which regulates the
transcellular movement of IgA into acini lumen where it acts on the
corneal surface to inhibit bacterial adhesion; and tear lipocalins
(tear-specific prealbumin) and growth factors TGF.alpha., TGF.beta.
and EGF the functions of which are not known. In rats, peroxidase
is a tear component which has served as a convenient marker in
experimental studies. Tears not only have an important bactericidal
role, they also keep the cornea clean and lubricated and are
important for the well-being of the corneal epithelium.
[0005] The surface of the eye is one of the most accessible and
vulnerable tissues. Corneal epithelial cells confront environmental
insults constantly including: UV irradiation, widely varying air
temperature fluxes, pollutants, bacteria and other microbial
organisms. The tear fluid which bathes the corneal surface is the
most likely source of cytoprotective and anti-inflammatory agents
since the cornea lacks blood supply, unlike other tissues where
blood vessels supply such agents. Indeed, tear fluid is rich in
bactericidal proteins. Dry Eye subjects suffering insufficient tear
production are subject to corneal ulceration, infection or
inflammation. Similar symptoms can be generated by extended contact
lens use, since volume of tear supply is limited.
[0006] When lacrimal acinar cell tear output is collectively
deficient, `Dry Eye` (also known as keratoconjunctivitis sicca
[KCS]); is the result. Dry Eye is a common ocular manifestation of
Sjogren's's syndrome, an autoimmune disease with unknown etiology
that affects millions of people worldwide. Most commonly affected
are post-menopausal women with varying degrees of severity. If
untreated, Dry Eye can lead to corneal abrasion, ulceration,
bacterial infection, and loss of vision. Molecular mechanisms
underlying the pathogenic decline of secretory output by the main
lacrimal gland are potentially multiple. Lacrimal glands of
Sjogren's's syndrome subjects contain foci of B and T lymphocytes
whose pathogenic expansion, possibly due to viral insult, can
destroy lacrimal acini. However, acinar volume loss often appears
insufficient relative to the theoretical overcapacity of the main
lacrimal gland. Estimates suggest a potential secretory output up
to ten-fold greater than is required to maintain a normal aqueous
tear film layer. Other mechanisms therefore warrant attention, such
as aberrant secretion of one or several common cytokines that may
directly or indirectly alter lacrimal acinar cell function and/or
lead to a decline in neural innervation. Novel autocrine/paracrine
factor(s) released by lacrimal acinar cells into the tear film may
be required for the health of the lacrimal secretory machinery,
ductal system, and corneal epithelium. The periacinar basement
membrane is also required for normal secretory function, in part
via `BM180` whose apparent synergy with laminin-1 promotes
stimulated tear secretion. Alteration of each of these factors,
together or independent of hormonal changes, could contribute to
decreased secretory capacity.
[0007] The lacrimal-corneal axis is a fundamental regulator of
ocular health and plays a key role in ocular surface inflammation
associated with Dry Eye Syndromes and corneal injury. A host of
mediators are implicated in the development and progression of
corneal inflammation, such as the proinflammatory cytokines
TNF-.alpha., IL-1.beta., IL-6 and the chemokine IL-8. Also involved
are the arachidonic acid-derived eicosanoids which are produced by
the activity of cyclooxygenases (primarily PGE2), lipooxygenases
(12 (s)-HETE) and cytochrome P450 (12 (r)-HETE).
[0008] Lacritin is a 12.3 kDa secreted glycoprotein that is
apically released from human lacrimal acinar cells during reflex
tearing and can be detected in mixed reflex and basal human tears
by ELISA and Western blotting. Lacritin is also produced by
corneal, conjunctival, meibomian, and salivary epithelia as one of
the most eye-restricted genes. Recent studies on lacritin
mechanisms of action indicate converging PKC.alpha. and NFkB
signaling pathways suggesting that lacritin may have a key
anti-inflammatory role on the ocular surface. Recent clinical
studies support this hypothesis. Comparison of tear proteins from
19 subjects suffering from Blepharitis (inflammation of the lid) vs
27 healthy volunteers revealed lacritin to be decreased by 56% in
subjects. Sumadre et al. (Invest Ophthalmol Vis Sci., 2011;
52:6265-6270; DOI:10.1167/iovs.10-6220) showed that lacritin
acutely increased basal tearing to 30% over vehicle and that
multiple doses per day were well tolerated. It was also recently
reported that lacritin is selectively downregulated more than any
other tear protein in contact lens--related dry eye. Lacritin
stimulates MUC16 production by human corneal epithelial cells at
levels matching or exceeding that of serum (Laurie G E, et al. IOVS
2006; 47:ARVO E-Abstract 1606). Autologous serum is a reportedly
successful method of treating dry eye. Lacritin also promotes basal
tear secretion by cultured rat and monkey lacrimal acinar cells and
stimulates human corneal epithelial cell growth.
[0009] Few cell types appear capable of being targeted by lacritin.
Targeted cells include lacrimal acinar, salivary ductal/HeLa, human
corneal, and embryonic kidney cells, but no others among 17
different cell lines tested. Its co-receptor syndecan-1 is widely
expressed on ocular surface epithelia. Thus, lacritin appears to be
a multifunctional eye-specific factor with a potential role in tear
secretion and corneal epithelial renewal.
[0010] There is a long felt need in the art for compositions and
methods useful for detecting and diagnosing dry eye, treating dry
eye, and developing treatment strategies and regimens based on the
a diagnosis of dry eye. The present invention satisfies these
needs.
SUMMARY
[0011] The present invention couples a novel mechanism for the
molecular identification of dry eye disease with a restorative
therapy that addresses cause. The invention relates to the
discovery disclosed herein that a .about.90 KDa deglycanated form
of syndecan-1 is abundant in tears of normal individuals but not in
individuals suffering from dry eye. Furthermore a .about.25 kDa
syndecan-1 fragment is detectable in dry, but not normal tears. The
invention also relates to the discovery that topical lacritin, the
agonist of deglycanated syndecan-1, sensitizes corneal sensory
nerves to drying of the surface of the eye, and increases the
neural wet response. Accordingly, one embodiment of the present
invention is directed to identifying dry eye by a relative decrease
in .about.90 kDa deglycanated form of syndecan-1 and/or the
presence of 25 kDa syndecan-1 in tears. Another embodiment is
directed to increasing the corneal neural dry and wet responses by
topical application of a lacritin polypeptide to the eye.
[0012] Applicants have also discovered that that aqueous deficient
dry eye tears are associated with decreased lacritin monomer,
increased lacritin-C splice variant, and latent (chronically
active) heparanase (HPSE). Accordingly, in one embodiment a method
is provided for identifying patients suffering from dry eye and
selecting such patient for treatment. In one embodiment a method
for identifying a subject having dry eye is provided wherein the
presence of at least one protein selected from the group consisting
of [0013] latent heparanase; [0014] 90 kDa deglycanated SDC-1;
[0015] 25 kDa SDC-1; and [0016] inactive lacritin-C splice variant;
is detected in a tear sample obtained from the subject. Patients
with dry eye are then identified by those that have one or more of
the following:
[0017] a decreased level of latent heparanase and a corresponding
increase in active heparanase, relative to levels present in tears
from a normal eye;
[0018] a decreased level of 90 kDa deglycanated SDC-1, relative to
levels present in tears from a normal eye;
[0019] presence of 25 kDa SDC-1; and/or
[0020] presence of inactive lacritin-C splice variant. Such
identified subjects can then be treated by contacting the ocular
surface of the subject's eyes with a composition comprising
lacritin or a bioactive fragment thereof.
[0021] The detection of latent heparanase, 90 kDa deglycanated
SDC-1A, 25 kDa SDC-1 or inactive lacritin-C splice variant can be
conducted using standard techniques known to those skilled in the
art, including the use of antibodies. In one embodiment antibodies
could be embedded in Schirmer strips on which tears are collected
for precise and inexpensive molecular diagnosis in an
ophthalmologist's or optometrist's office. Current approaches for
identifying subjects afflicted with dry eye do not address cause,
and therefore suffer from inaccuracy and are nonspecific. Examples
of current methods include: a) subject questionnaires, b) rose
bengal or lissamine green staining of ocular surface damage, c)
Schirmer strip measurement of tear volume, d) tear break up time,
e) tear evaporation rate, f) tear meniscus height or radius, g)
tear film index or turnover rate, h) tear osmolarity, i) lysozyme
or lactoferrin assay, and j) tear ferning analysis.
[0022] Restoration of active lacritin to the ocular surface has
been found to rescue the normal corneal sensory neural dry and wet
responses necessary for normal eye physiology. Since all glands
wetting the eye are regulated by the reflex arc downstream of
corneal sensory input, lacritin or lacritin fragments, synthetic
peptides or mimetics should benefit all forms of dry eye.
Preclinical studies in rabbits and in dry eye mice models imply
that it may also restore the density of corneal sensory innervation
that decreases in dry eye. In contrast, commonly used `artificial
tears` temporarily alleviate symptoms without addressing cause.
[0023] It is disclosed herein that aqueous deficient dry eye tears
are associated with decreased lacritin monomer, increased
lacritin-C splice variant, less deglycanated SDC1, increased 25 kDa
SDC1 fragment, and decreased latent heparanase and increased active
heparanase. Therefore, the present invention provides compositions
and methods for detecting and diagnosing dry eye and for developing
and providing treatment regimens for subjects found to have dry eye
using one or more of the markers of dry eye disclosed herein. The
present application provides compositions and methods for detecting
and diagnosing dry eye, including the FOXO3 translocation assay
disclosed herein. Multiple methods are also available and described
for detecting and measuring the protein and protein fragments
useful for detecting and diagnosing eye.
[0024] The present invention further provides for the use of
lacritin, or biologically active fragments or homologs thereof, to
sensitize corneal sensory nerves to drying of the surface of the
eye and increases the neural wet response. In one embodiment, use
of topical lacritin or fragment N-94 (SEQ ID NO: 7) restores or
increases tearing. In one aspect, the use restores basal tearing.
In one aspect, topical administration of lacritin suppresses
lacrimal gland inflammation.
[0025] In accordance with one embodiment a method of treatment is
provided to restore the levels of 90 kDa syndecan-1 (SDC1) or other
deglycanated forms of syndecan-1 in the tears of a subject with dry
eye. Restoring SDC1 enhances activity of lacritin that is present.
The present invention further provides methods of treating dry eye
using inhibitors of transglutaminase (TGM), which can be inhibitors
of TGM activity or levels or synthesis.
[0026] In accordance with one embodiment, a composition is provided
comprising a peptide, a non-native peptide, or a peptidomimetic
derivative, comprising a sequence selected from the group
consisting of SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO:
7 and SEQ ID NO: 8 or a sequence that differs from SEQ ID NO: 1,
SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8 by 1, 2,
3, 4 or 5 amino acids, or a biologically active fragment, homolog,
or derivative thereof. In one embodiment a peptide differs from SEQ
ID NO: 1, SEQ ID NO: 5, or SEQ ID NO: 7 by 1, 2, 3, 4 or 5
conservative amino acid substitutions. In one embodiment, the amino
acid modifications are amino acid substitution, and in one
embodiment the substitutions are conservative amino acid
substitutions.
[0027] In some embodiments, the peptide of the present disclosure
comprises an amino acid sequence which has at least 75%, 80%, 85%,
90% or 95% sequence identity to amino acid sequence SEQ ID NO: 1,
SEQ ID NO: 5, or SEQ ID NO: 7 or a biologically active fragment,
homolog, or derivative thereof.
[0028] In some embodiments, the peptide of the present disclosures
comprises a non-native amino acid sequence which has at least 75%,
80%, 85%, 90% or 95% sequence identity to amino acid sequence SEQ
ID NO: 1, SEQ ID NO: 5, or SEQ ID NO: 7 or a peptidomimetic
derivative of SEQ ID NO: 1, SEQ ID NO: 5 or SEQ ID NO: 7. The
statement that the peptide is a non-native is intended to exclude
the native peptides of parent lacritin proteins.
[0029] In accordance with one embodiment a method of enhancing
corneal wound healing in a subject in need thereof is provided. The
method comprises contacting an ocular surface of said subject with
a composition comprising lacritin or a bioactive fragment thereof.
In one embodiment the bioactive fragment of lacritin is selected
from the group consisting of
[0030] KQFIENGSEFAQKLLKKFS (SEQ ID NO: 5);
[0031] KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7);
[0032] KQFIENGSEFANKLLKKFS (SEQ ID NO: 6); and
[0033] KQFIENGSEFANKLLKKFSLLKPWA (SEQ ID NO: 8) or a derivative
thereof that differs from SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7
or SEQ ID NO: 8 by one or two amino acid substitutions. In one
embodiment the subject is recovering from PRK (photorefractive
keratectomy) or LASIK (Laser-Assisted in situ Keratomileusis)
surgery.
[0034] In another embodiment a bactericidal composition is
provided, comprising a C-terminal fragment of lacritin. In one
embodiment the fragment is a peptide selected from SEQ ID NO: 5,
SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 or a derivative thereof
that differs from SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 or SEQ
ID NO: 8 by one or two amino acid substitutions. In one embodiment
the fragment is a peptide consisting of the sequence of SEQ ID NO:
7. In one embodiment the composition comprises a pharmaceutically
acceptable carrier wherein the composition is suitable for topical
administration to an ocular surface of a subject. In one embodiment
the composition, further comprises a second anti-bacterial agent.
As disclosed herein a method of treating a corneal infection is
provided wherein the method comprises contacting the cornea of a
subject in need thereof with the composition comprising a
C-terminal fragment of lacritin.
BRIEF DESCRIPTION OF THE DRAWINGS
[0035] FIG. 1. Detection of rare, deglycanated and 25 kDa forms of
syndecan-1 respectively in normal and dry eye tears. Left paired
samples (before photorefractive keratectomy (PRK) or Laser-Assisted
in situ Keratomileusis (LASIK)) .about.90 kDa deglycanated SDC1 is
abundant in normal tears and barely detectable in dry eye tears.
Day 1 (D1) after PRK or LASIK surgery, .about.90 kDa deglycanated
SDC1 is less than in dry eye tears. Also, a 25 kDa SDC1 fragment is
apparent in dry eye tears. Surgery promotes dry eye by severing
corneal sensory nerves. Week 1 (W1) after PRK or LASIK surgery, the
.about.90 deglycanated SDC1 level is restored in normal tears that
received surgery, and 25 kDa level in dry eye tears remains
elevated (less at 1 Month (M1).
[0036] FIGS. 2A & 2B. Detection of elevated levels of inactive
lacritin-C splice variant in dry eye tears. FIG. 2A is a Western
blot demonstrating the detection of lacritin-C using mab 4F6.
Lacritin-C splice variant is constantly elevated in dry eye. FIG.
2B is a Western blot using secondary antibody alone and serves as a
negative control. No bands are detected using only the secondary
antibody.
[0037] FIGS. 3A & 3B. Detection of more latent heparanase in
normal tears vs dry eye tears, and more activated heparanase in dry
eye years. FIG. 3A is a Western blot demonstrating the detection of
heparanase using #1453 antibody. Latent heparanase is indicated by
.about.75 kDa band; active heparanase indicated by .about.50 kDa
band. FIG. 3B is a Western blot demonstrating the detection of
heparanase using #753 antibody.
[0038] FIGS. 4A-4C: Corneal health restorative activity of
lacritin, and a C-terminal 25 amino acid fragment of lacritin
(LACRIPEP). Cultured human corneal epithelial cells were treated
with inflammatory cytokines to induce stress, and cells were
treated with 10 nM of an inactive lacritin truncation mutant
(C-25), lacritin or LACRIPEP. Measurements of cytoplasmic staining
in a FOXO3 assay (wherein nuclear FOXO3 staining is indicative of
cell death) reveal LACRIPEP is equally active as lacritin (See FIG.
4A) in enhancing cell survival relative to the negative control
(C-25). Studies in dry eye (Aire-/-) mice also demonstrate the
bioactivity of topically administered LACRIPEP. LACRIPEP prevents
loss of tearing as dry eye disease develops in Aire(-/-) dry eye
mice (FIG. 4B; closed circles) relative to topically administered
PBS (opened circles) and Aire(-/-) dry eye mice administered
LACRIPEP have less corneal staining, which is an indicator of cell
death, as dry eye disease develops (FIG. 4C; closed circles)
relative to PBS (opened circles).
[0039] FIG. 5 Comparative pro-survival activity of lacritin and
lacritin synthetic peptides. Quantitation of FOXO3 immunostaining
in interferon-.gamma. and tumor necrosis factor stressed human
HCE-T cells treated with lacritin C-terminal truncation mutant C-25
(negative control; inactive), lacritin (lacrt), lacritin C-terminal
peptide N-94 (SEQ ID NO: 7) or N-94/C-6 (SEQ ID NO: 5), or tissue
transglutaminase polymerized lacritin (inactive). Dosage for each
administered peptide is 10 nM. More nuclear staining indicates
stress/death. More cytoplasmic staining (arrows) indicates
survival. 203-379 cells were counted for each treatment. Comparison
of all but polymerized lacrt vs C-25 by two-way ANOVA with
Bonferroni post test, P=0.01.
[0040] FIGS. 6A & 6B LACRIPEP shows surprising stability in
human tears. FIG. 6A presents immunoblots of protease sensitive
positive control `SN pep` from a different protein, and LACRIPEP
(`N-94`; SEQ ID NO: 7), after incubation in lacritin-depleted human
tears for 2-16 hr at 37.degree. C. FIG. 6B presents mass
spectrometric analysis, wherein the top row presents MS profiles of
SN pep, LACRIPEP (`N-94`), and LACRIPEP without six C-terminal
amino acids (`N-94/C-6`) prior to addition to tears and the
37.degree. C. incubation step, and the bottom row provides MS
profiles after incubation in lacritin depleted tears for 4 hr at
37.degree. C.
[0041] FIGS. 7A & 7B Biphasic dose response of LACRIPEP.
Biphasic dose response of topical LACRIPEP was demonstrated testing
rabbit basal tearing (FIG. 7A) and in rat corneal sensory nerve
stimulation (pLAC; FIG. 7B) relative to an inactive lacritin
fragment control (C-25D).
[0042] FIG. 8 Distribution of a single 4 .mu.M dose of topical
.sup.125I-Lacripep-Y on rat eyes. Slight amounts of
.sup.125I-Lacripep-Y are detectable in blood and plasma. A
considerable amount is retained in tears.
[0043] FIG. 9 Alignment of the 25 amino acid C-terminal fragments
of lacritin homologs from primate species including human (SEQ ID
NO: 7); Chimpanzee (SEQ ID NO: 17); Bushbaby (SEQ ID NO: 18);
Gorilla (SEQ ID NO: 19); Macaque (SEQ ID NO: 20); Marmoset (SEQ ID
NO: 21); Mouse Lemur (SEQ ID NO: 22) and Orangutan (SEQ ID NO: 23)
demonstrating a high sequence conservation between primate
species.
DETAILED DESCRIPTION
Abbreviations and Acronyms
[0044] FACS means fluorescence activated cell sorter
[0045] HCE means human corneal epithelial
[0046] HPSE means heparanase
[0047] HS means heparan sulfate
[0048] HSG means human salivary gland
[0049] INFG means interferon gamma (also referred to as IFNG)
[0050] IRB means institutional review board
[0051] SDC1 means syndecan-1
[0052] TGM means transglutaminase
[0053] TNF means tumor necrosis factor
Definitions
[0054] In describing and claiming the invention, the following
terminology will be used in accordance with the definitions set
forth below.
[0055] As used herein, the term "lacritin polypeptide" and the like
terms is defined as any peptide comprising the amino acid sequence
SEQ ID NO: 1 and or a biologically active fragment, homolog, or
derivative thereof. As used herein, the term "biologically active
fragments" or "bioactive fragment" of a lacritin polypeptide
encompasses natural or synthetic portions of the amino acid
sequence MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEI
SGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGK
GMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 1). Fragments of
lacritin (SEQ ID NO: 1) include, for example: KQFIENGSEFAQKLLKKFS
(SEQ ID NO: 5) (`N-94/C-6`) (Wang et al., (2006) J. Cell Biol. 174,
689-700). and KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7) (`N-94`)
(see Zhang et al., (2013) J. Biol. Chem. 288, 12090-12101).
[0056] The term "about," as used herein, means approximately, in
the region of, roughly, or around. When the term "about" is used in
conjunction with a numerical value or range, it modifies that range
by extending the boundaries above and below the numerical values
set forth. For example, in one aspect, the term "about" is used
herein to modify a numerical value above and below the stated value
by a variance of 20%, but is not intended to designate any value or
range of values to only this broader definition. Each value or
range of values preceded by the term "about" is also intended to
encompass the embodiment of the stated absolute value or range of
values.
[0057] As used herein an "acylated" amino acid is an amino acid
comprising an acyl group which is non-native to a
naturally-occurring amino acid, regardless by the means by which it
is produced. Exemplary methods of producing acylated amino acids
and acylated peptides are known in the art and include acylating an
amino acid before inclusion in the peptide or peptide synthesis
followed by chemical acylation of the peptide. In some embodiments,
the acyl group causes the peptide to have one or more of (i) a
prolonged half-life in circulation, (ii) a delayed onset of action,
(iii) an extended duration of action, and (iv) an improved
resistance to proteases.
[0058] As used herein, an "alkylated" amino acid is an amino acid
comprising an alkyl group which is non-native to a
naturally-occurring amino acid, regardless of the means by which it
is produced. Exemplary methods of producing alkylated amino acids
and alkylated peptides are known in the art and including
alkylating an amino acid before inclusion in the peptide or peptide
synthesis followed by chemical alkylation of the peptide. Without
being held to any particular theory, it is believed that alkylation
of peptides will achieve similar, if not the same, effects as
acylation of the peptides, e.g., a prolonged half-life in
circulation, a delayed onset of action, an extended duration of
action, and an improved resistance to proteases.
[0059] As used herein, the term "pharmaceutically acceptable
carrier" includes any of the standard pharmaceutical carriers, such
as a phosphate buffered saline solution, water, emulsions such as
an oil/water or water/oil emulsion, and various types of wetting
agents. The term also encompasses any of the agents approved by a
regulatory agency of the US Federal government or listed in the US
Pharmacopeia for use in animals, including humans.
[0060] As used herein the term "pharmaceutically acceptable salt"
refers to salts of compounds that retain the biological activity of
the parent compound, and which are not biologically or otherwise
undesirable. Many of the compounds disclosed herein are capable of
forming acid and/or base salts by virtue of the presence of amino
and/or carboxyl groups or groups similar thereto.
[0061] As used herein, the term "hydrophilic moiety" refers to any
compound that is readily water-soluble or readily absorbs water,
and which are tolerated in vivo by mammalian species without toxic
effects (i.e. are biocompatible). Examples of hydrophilic moieties
include polyethylene glycol (PEG), polylactic acid, polyglycolic
acid, a polylactic-polyglycolic acid copolymer, polyvinyl alcohol,
polyvinylpyrrolidone, polymethoxazoline, polyethyloxazoline,
polyhydroxyethyl methacrylate, polyhydroxypropyl methacrylamide,
polymethacrylamide, polydimethylacrylamide, and derivatised
celluloses such as hydroxymethylcellulose or hydroxyethylcellulose
and co-polymers thereof, as well as natural polymers including, for
example, albumin, heparin and dextran.
[0062] A "subject" of experimentation, diagnosis or treatment is an
animal, including a human.
[0063] As used herein the term "Dry eye" (or Dry Eye) encompasses
any condition in which there are insufficient tears to lubricate
and nourish the eye. Subjects with dry eyes either do not produce
enough tears or have a poor quality of tears. Dry eye as used
herein includes, but is not limited to: aqueous-deficient and
evaporative dry eye. Aqueous-deficient dry eye includes, but is not
limited to, Sjogren's Syndrome Dry Eye (including primary and
secondary), Non-Sjogren's Dry Eye (including lacrimal deficiency,
lacrimal gland duct obstruction, reflex block, and from systemic
drugs). Evaporative dry eye includes, but is not limited to,
Intrinsic (including meibomian oil deficiency, disorders of the lid
aperture, low blink rate, and resulting from the drug action of
Accutane) and Extrinsic (including Vitamin A deficiency, topical
drug preservatives, contact lens wear, and ocular surface disease
(such as allergies).
[0064] As used herein, the term "treating" includes prophylaxis of
the specific disorder or condition, or alleviation of the symptoms
associated with a specific disorder or condition and/or preventing
or eliminating said symptoms. For example, as used herein the term
"treating dry eye" will refer in general to maintaining basal tear
levels near normal levels and may include increasing tear levels
depending on a given situation.
[0065] As used herein an "effective" amount or a "therapeutically
effective amount" of a pharmaceutical agent refers to a nontoxic
but sufficient amount of an agent to provide the desired effect.
For example one desired effect would be the prevention or treatment
of dry eye. The amount that is "effective" will vary from subject
to subject, depending on the age and general condition of the
individual, mode of administration, and the like. Thus, it is not
always possible to specify an exact "effective amount." However, an
appropriate "effective" amount in any individual case may be
determined by one of ordinary skill in the art using routine
experimentation.
[0066] The terms "additional therapeutically active compound" or
"additional therapeutic agent", as used in the context of the
present invention, refers to the use or administration of a
compound for an additional therapeutic use for a particular injury,
disease, or disorder being treated. Such a compound, for example,
could include one being used to treat an unrelated disease or
disorder, or a disease or disorder which may not be responsive to
the primary treatment for the injury, disease or disorder being
treated.
[0067] The term "identity" as used herein relates to the similarity
between two or more sequences. Identity is measured by dividing the
number of identical residues by the total number of residues and
multiplying the product by 100 to achieve a percentage. Thus, two
copies of exactly the same sequence have 100% identity, whereas two
sequences that have amino acid/nucleic acid deletions, additions,
or substitutions relative to one another have a lower degree of
identity. Those skilled in the art will recognize that several
computer programs, such as those that employ algorithms such as
BLAST (Basic Local Alignment Search Tool, Altschul et al. (1993) J.
Mol. Biol. 215:403-410) are available for determining sequence
identity.
[0068] As used herein an amino acid "modification" refers to a
substitution of an amino acid, or the derivation of an amino acid
by the addition and/or removal of chemical groups to/from the amino
acid, and includes substitution with any of the 20 amino acids
commonly found in human proteins, as well as atypical or
non-naturally occurring amino acids. Commercial sources of atypical
amino acids include Sigma-Aldrich (Milwaukee, Wis.), ChemPep Inc.
(Miami, Fla.), and Genzyme Pharmaceuticals (Cambridge, Mass.).
Atypical amino acids may be purchased from commercial suppliers,
synthesized de novo, or chemically modified or derivatized from
naturally occurring amino acids.
[0069] As used herein an amino acid "substitution" refers to the
replacement of one amino acid residue by a different amino acid
residue.
[0070] As used herein, the term "conservative amino acid
substitution" is defined herein as exchanges within one of the
following five groups:
[0071] I. Small aliphatic, nonpolar or slightly polar residues:
[0072] Ala, Ser, Thr, Pro, Gly;
[0073] II. Polar, negatively charged residues and their amides:
[0074] Asp, Asn, Glu, Gln, cysteic acid and homocysteic acid;
[0075] III. Polar, positively charged residues: [0076] His, Arg,
Lys; Ornithine (Orn)
[0077] IV. Large, aliphatic, nonpolar residues: [0078] Met, Leu,
Ile, Val, Cys, Norleucine (Nle), homocysteine
[0079] V. Large, aromatic residues: [0080] Phe, Tyr, Trp, acetyl
phenylalanine
[0081] The term "isolated" as used herein means having been removed
from its natural environment. In some embodiments, a peptide is
made through recombinant methods and the peptide is isolated from
the host cell.
[0082] The term "purified," as defined herein means the isolation
of a molecule or compound in a form that is substantially free of
contaminants normally associated with the molecule or compound in a
native or natural environment and means having been increased in
purity as a result of being separated from other components of the
original composition. The term "purified polypeptide" is used
herein to describe a polypeptide which has been separated from
other compounds including, but not limited to nucleic acid
molecules, lipids and carbohydrates.
[0083] A "peptidomimetic" refers to a chemical compound having a
structure that is different from the general structure of an
existing peptide, but that functions in a manner similar to the
existing peptide, e.g., by mimicking the biological activity of
that peptide. Peptidomimetics typically comprise
naturally-occurring amino acids and/or unnatural amino acids, but
can also comprise modifications to the peptide backbone. For
example a peptidomimetic may include a sequence of
naturally-occurring amino acids with the insertion or substitution
of a non-peptide moiety, e.g. a retroinverso fragment, or
incorporation of non-peptide bonds such as an azapeptide bond (CO
substituted by NH) or pseudo-peptide bond (e.g. NH substituted with
CH.sub.2), or an ester bond (e.g., depsipeptides, wherein one or
more of the amide (--CONHR--) bonds are replaced by ester (COOR)
bonds). Alternatively the peptidomimetic may be devoid of any
naturally-occurring amino acids.
[0084] As use herein, the terms "administration of" and or
"administering" a compound should be understood to mean providing a
compound of the invention to a subject in need of treatment.
[0085] As used herein, amino acids are represented by the full name
thereof, by the three letter code corresponding thereto, or by the
one-letter code corresponding thereto, as indicated in the
following table:
TABLE-US-00001 Full Name Three-Letter Code One-Letter Code Aspartic
Acid Asp D Glutamic Acid Glu E Lysine Lys K Arginine Arg R
Histidine His H Tyrosine Tyr Y Cysteine Cys C Asparagine Asn N
Glutamine Gln Q Serine Ser S Threonine Thr T Glycine Gly G Alanine
Ala A Valine Val V Leucine Leu L Isoleucine Ile I Methionine Met M
Proline Pro P Phenylalanine Phe F Tryptophan Trp W
[0086] As used herein the term "amino acid" encompasses any
molecule containing both amino and carboxyl functional groups,
wherein the amino and carboxylate groups are attached to the same
carbon (the alpha carbon). The alpha carbon optionally may have one
or two further organic substituents. For the purposes of the
present disclosure designation of an amino acid without specifying
its stereochemistry is intended to encompass either the L or D form
of the amino acid, or a racemic mixture. However, in the instance
where an amino acid is designated by its three letter code and
includes a superscript number, the D form of the amino acid is
specified by inclusion of a lower case d before the three letter
code and superscript number (e.g., dLys1), wherein the designation
lacking the lower case d (e.g., Lys1) is intended to specify the
native L form of the amino acid. In this nomenclature, the
inclusion of the superscript number designates the position of the
amino acid in the peptide sequence numbered consecutively from the
N-terminus. The expression "amino acid" as used herein is meant to
include both natural and synthetic amino acids, and both D and L
amino acids. "Standard amino acid" means any of the twenty L-amino
acids commonly found in naturally occurring peptides.
[0087] As used herein the term "non-coded amino acid" encompasses
any amino acid that is not an L-isomer of any of the following 20
amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met,
Asn, Pro, Gln, Arg, Ser, Thr, Val, Trp, Tyr, regardless of whether
it is prepared synthetically or derived from a natural source.
[0088] As used herein a general reference to a peptide is intended
to encompass peptides that have modified amino and carboxy termini,
including but not limited to salts. For example, an amino acid
sequence designating the standard amino acids is intended to
encompass standard amino acids at the N- and C-terminus as well as
a corresponding hydroxyl acid at the N-terminus and/or a
corresponding C-terminal amino acid modified to comprise an amide
group in place of the terminal carboxylic acid Amino acids
contained within the peptides of the present invention, and
particularly at the carboxy- or amino-terminus, can be modified by
methylation, amidation, acetylation or substitution with other
chemical groups which can change the peptide's circulating
half-life without adversely affecting their activity. Additionally,
a disulfide linkage may be present or absent in the peptides of the
invention.
[0089] The term "amino acid" is used interchangeably with "amino
acid residue," and may refer to a free amino acid and to an amino
acid residue of a peptide. It will be apparent from the context in
which the term is used whether it refers to a free amino acid or a
residue of a peptide.
[0090] Amino acids may be classified into seven groups on the basis
of the side chain R: (1) aliphatic side chains, (2) side chains
containing a hydroxylic (OH) group, (3) side chains containing
sulfur atoms, (4) side chains containing an acidic or amide group,
(5) side chains containing a basic group, (6) side chains
containing an aromatic ring, and (7) proline, an imino acid in
which the side chain is fused to the amino group.
[0091] The nomenclature used to describe the peptide compounds of
the present invention follows the conventional practice wherein the
amino group is presented to the left and the carboxy group to the
right of each amino acid residue. In the formulae representing
selected specific embodiments of the present invention, the amino-
and carboxy-terminal groups, although not specifically shown, will
be understood to be in the form they would assume at physiologic pH
values, unless otherwise specified.
[0092] The term "basic" or "positively charged" amino acid as used
herein, refers to amino acids in which the R groups have a net
positive charge at pH 7.0, and include, but are not limited to, the
standard amino acids lysine, arginine, and histidine.
[0093] The term "antibody," as used herein, refers to an
immunoglobulin molecule which is able to specifically bind to a
specific epitope on an antigen. Antibodies can be intact
immunoglobulins derived from natural sources or from recombinant
sources and can be immunoreactive portions of intact
immunoglobulins. Antibodies are typically tetramers of
immunoglobulin molecules. The antibodies in the present invention
may exist in a variety of forms including, for example, polyclonal
antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as
single chain antibodies and humanized antibodies.
[0094] An "antimicrobial agent," as used herein, refers to any
compound which impedes the growth of any microbes, or kills such
microbes.
[0095] A "bactericidal agent," as used herein, refers to any
compound which impedes the growth of bacteria, or kills
bacteria.
[0096] As used herein, the term "biologically active fragments" or
"bioactive fragment" of the polypeptides encompasses natural or
synthetic portions of the full length protein that are capable of
specific binding to their natural ligand or of performing the
function of the protein.
[0097] As used herein, the terms "complementary" or
"complementarity" are used in reference to polynucleotides (i.e., a
sequence of nucleotides) related by the base pairing rules. For
example, for the sequence "AGT," is complementary to the sequence
"TCA."
[0098] The use of the word "detect" and its grammatical variants
refers to measurement of the species without quantification,
whereas use of the word "determine" or "measure" with their
grammatical variants are meant to refer to measurement of the
species with quantification. The terms "detect" and "identify" are
used interchangeably herein.
[0099] As used herein, a "detectable marker" or a "reporter
molecule" is an atom or a molecule that permits the specific
detection of a compound comprising the marker in the presence of
similar compounds without a marker. Detectable markers or reporter
molecules include, e.g., radioactive isotopes, antigenic
determinants, enzymes, nucleic acids available for hybridization,
chromophores, fluorophores, chemiluminescent molecules,
electrochemically detectable molecules, and molecules that provide
for altered fluorescence polarization or altered light
scattering.
[0100] As used herein, the phrase "enhancing survival" refers to
decreasing the amount of death, or the rate of death, in a cell
population. Enhancing survival can be due to preventing cell death
alone (e.g., cell death in conjunction with apoptosis), or
decreasing the rate of cell death. The decrease in cell death can
also result from indirect effects such as inducing proliferation of
some cells, such indirect effect effectively replenishing at least
some or all of a population of cells as they die Enhancing survival
of cells can also be accomplished by a combination of inducing
proliferation and decreasing cell death, or the rate of cell death.
"Promoting survival" and "enhancing survivability" are used
interchangeably with "enhancing survival" herein.
[0101] A "fragment" or "segment" is a portion of an amino acid
sequence, comprising at least one amino acid, or a portion of a
nucleic acid sequence comprising at least one nucleotide. The terms
"fragment" and "segment" are used interchangeably herein. A
fragment of a lacritin peptide which is used herein as part of a
composition for use in a treatment or to elicit a lacritin effect
is presumed to be a biologically active fragment for the response
to be elicited.
[0102] As used herein, a "functional" biological molecule is a
biological molecule in a form in which it exhibits a property or
activity by which it is characterized. A functional enzyme, for
example, is one which exhibits the characteristic catalytic
activity by which the enzyme is characterized.
[0103] As used herein, a "gene" refers to the nucleic acid coding
sequence as well as the regulatory elements necessary for the DNA
sequence to be transcribed into messenger RNA (mRNA) and then
translated into a sequence of amino acids characteristic of a
specific polypeptide.
[0104] As used herein, the term "insult" refers to contact with a
substance or environmental change that results in an alteration of
normal cellular metabolism in a cell or population of cells.
Environmental insults may include, but are not limited to,
chemicals, environmental pollutants, heavy metals, viral or
bacterial infections, changes in temperature, changes in pH, as
well as agents producing oxidative damage, DNA damage, or
pathogenesis. The term "insult" is used interchangeably with
"environmental insult" herein.
[0105] As used herein, the term "syndecan-1" refers to peptides
comprising the amino acid sequence of SEQ ID NO: 2 and biologically
active fragments, derivatives, and homologs thereof. As used
herein, the term "biologically active fragments" or "bioactive
fragment" of a syndecan-1 polypeptide encompasses natural or
synthetic portions of the amino acid sequence
TABLE-US-00002 (SEQ ID NO: 2)
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAG
ALQDITLSQQTPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPK
EGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHQASTTTATTAQEPAT
SHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQL
PAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRK
EVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ KPTKQEEFYA.
The underlined portion of SEQ ID NO: 2 represents "shed and
deglycanated 90 kDa form of syndecan-1" (or 90 kDa deglycanated
SDC-1), having the sequence:
TABLE-US-00003 (SEQ ID NO: 3)
QIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLT
AIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEAT
PRPRETTQLPTTHQASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQ
ADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAV
VAVEPDRRNQSPVDQGATGASQGLLDRKE.
[0106] As used herein, the term "a 25 kDa fragment of SDC-1
ectodomain" (or 25 kDa SDC-1) refers to a 25 kDa fragment of SDC-1
that contains the LPEV sequence of the 90 kDa deglycanated
SDC-1.
[0107] As used herein, the term "heparanase" refers to peptides
comprising the amino acid sequence of SEQ ID NO: 4 and biologically
active fragments, derivatives, and homologs thereof. As used
herein, the term "biologically active fragments" or "bioactive
fragment" of a heparanase polypeptide encompasses natural or
synthetic portions of the amino acid sequence
TABLE-US-00004 (SEQ ID NO: 4)
MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLH
LVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTD
FLIFDPKKESTFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQL
LLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWN
SSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGSQLGEDFIQLH
KLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGG
GAPLLSDTFAAGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDP
LPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDL
TLYAINLHNVTKYLRLPYPFSNKQVDKYLLRPLGPHGLLSKSVQLNGLTL
KMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVAACI.
[0108] As used herein, a "ligand" is a compound that specifically
binds to a target compound. A ligand (e.g., an antibody)
"specifically binds to" or "is specifically immunoreactive with" a
compound when the ligand functions in a binding reaction which is
determinative of the presence of the compound in a sample of
heterogeneous compounds. Thus, under designated assay (e.g.,
immunoassay) conditions, the ligand binds preferentially to a
particular compound and does not bind to a significant extent to
other compounds present in the sample. For example, an antibody
specifically binds under immunoassay conditions to an antigen
bearing an epitope against which the antibody was raised. A variety
of immunoassay formats may be used to select antibodies
specifically immunoreactive with a particular antigen. For example,
solid-phase ELISA immunoassays are routinely used to select
monoclonal antibodies specifically immunoreactive with an antigen.
See Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold
Spring Harbor Publications, New York, for a description of
immunoassay formats and conditions that can be used to determine
specific immunoreactivity.
[0109] As used herein, the term "linkage" refers to a connection
between two groups. The connection can be either covalent or
non-covalent, including but not limited to ionic bonds, hydrogen
bonding, and hydrophobic/hydrophilic interactions.
[0110] As used herein, the term "linker" refers to a molecule that
joins two other molecules either covalently or noncovalently, e.g.,
through ionic or hydrogen bonds or van der Waals interactions.
[0111] "Ocular surface," as used herein, refers to the surface of
the eye, particularly the corneal surface.
[0112] The phrase "ocular surface-associated disease, disorder, or
condition," as used herein, refers to any disease, disorder or
condition which directly or indirectly causes, or can cause, any of
the problems or symptoms described herein regarding disease,
disorders, or conditions of the ocular surface.
[0113] "Operably linked" refers to a juxtaposition wherein the
components are configured so as to perform their usual function.
Thus, control sequences or promoters operably linked to a coding
sequence are capable of effecting the expression of the coding
sequence.
[0114] A "marker" is an atom or molecule that permits the specific
detection of a molecule comprising that marker in the presence of
similar molecules without such a marker. Markers include, for
example radioactive isotopes, antigenic determinants, nucleic acids
available for hybridization, chromophors, fluorophors,
chemiluminescent molecules, electrochemically detectable molecules,
molecules that provide for altered fluorescence polarization or
altered light scattering and molecules that allow for enhanced
survival of an cell or organism (i.e. a selectable marker). A
reporter gene is a gene that encodes for a marker.
[0115] The term "measuring the level of expression" or "determining
the level of expression" as used herein refers to any measure or
assay which can be used to correlate the results of the assay with
the level of expression of a gene or protein of interest. Such
assays include measuring the level of mRNA, protein levels, etc.
and can be performed by assays such as northern and western blot
analyses, binding assays, immunoblots, etc. The level of expression
can include rates of expression and can be measured in terms of the
actual amount of an mRNA or protein present. Such assays are
coupled with processes or systems to store and process information
and to help quantify levels, signals, etc. and to digitize the
information for use in comparing levels.
[0116] A "polylinker" is a nucleic acid sequence that comprises a
series of three or more different restriction endonuclease
recognitions sequences closely spaced to one another (i.e. less
than 10 nucleotides between each site).
[0117] As used herein, the term "promoter/regulatory sequence"
means a nucleic acid sequence which is required for expression of a
gene product operably linked to the promoter/regulator sequence. In
some instances, this sequence may be the core promoter sequence and
in other instances, this sequence may also include an enhancer
sequence and other regulatory elements which are required for
expression of the gene product. The promoter/regulatory sequence
may, for example, be one which expresses the gene product in a
tissue specific manner
[0118] A "constitutive promoter is a promoter which drives
expression of a gene to which it is operably linked, in a constant
manner in a cell. By way of example, promoters which drive
expression of cellular housekeeping genes are considered to be
constitutive promoters.
[0119] An "inducible" promoter is a nucleotide sequence which, when
operably linked with a polynucleotide which encodes or specifies a
gene product, causes the gene product to be produced in a living
cell substantially only when an inducer which corresponds to the
promoter is present in the cell.
[0120] A "tissue-specific" promoter is a nucleotide sequence which,
when operably linked with a polynucleotide which encodes or
specifies a gene product, causes the gene product to be produced in
a living cell substantially only if the cell is a cell of the
tissue type corresponding to the promoter.
[0121] As used herein, "nucleic acid," "DNA," and similar terms
also include nucleic acid analogs, i.e. analogs having other than a
phosphodiester backbone. For example, the so called "peptide
nucleic acids," which are known in the art and have peptide bonds
instead of phosphodiester bonds in the backbone, are considered
within the scope of the present invention.
[0122] Unless otherwise specified, a "nucleotide sequence encoding
an amino acid sequence" includes all nucleotide sequences that are
degenerate versions of each other and that encode the same amino
acid sequence. Nucleotide sequences that encode proteins and RNA
may include introns.
[0123] The term "peptide" encompasses a sequence of 3 or more amino
acids wherein the amino acids are naturally occurring or synthetic
(non-naturally occurring) amino acids. Peptide mimetics include
peptides having one or more of the following modifications:
[0124] 1. peptides wherein one or more of the peptidyl --C(O)NR--
linkages (bonds) have been replaced by a non-peptidyl linkage such
as a --CH2-carbamate linkage (--CH2OC(O)NR--), a phosphonate
linkage, a --CH2-sulfonamide (--CH 2-S(O)2NR--) linkage, a urea
(--NHC(O)NH--) linkage, a --CH2-secondary amine linkage, or with an
alkylated peptidyl linkage (--C(O)NR--) wherein R is C1-C4
alkyl;
[0125] 2. peptides wherein the N-terminus is derivatized to a
--NRR1 group, to a --NRC(O)R group, to a --NRC(O)OR group, to a
--NRS(O)2R group, to a --NHC(O)NHR group where R and R1 are
hydrogen or C1-C4 alkyl with the proviso that R and R1 are not both
hydrogen;
[0126] 3. peptides wherein the C terminus is derivatized to
--C(O)R2 where R 2 is selected from the group consisting of C1-C4
alkoxy, and --NR3R4 where R3 and R4 are independently selected from
the group consisting of hydrogen and C1-C4 alkyl.
[0127] Synthetic or non-naturally occurring amino acids refer to
amino acids which do not naturally occur in vivo but which,
nevertheless, can be incorporated into the peptide structures
described herein. The resulting "synthetic peptide" contain amino
acids other than the 20 naturally occurring, genetically encoded
amino acids at one, two, or more positions of the peptides. For
instance, naphthylalanine can be substituted for tryptophan to
facilitate synthesis. Other synthetic amino acids that can be
substituted into peptides include L-hydroxypropyl,
L-3,4-dihydroxyphenylalanyl, alpha-amino acids such as
L-alpha-hydroxylysyl and D-alpha-methylalanyl,
L-alpha.-methylalanyl, beta-amino acids, and isoquinolyl. D amino
acids and non-naturally occurring synthetic amino acids can also be
incorporated into the peptides. Other derivatives include
replacement of the naturally occurring side chains of the 20
genetically encoded amino acids (or any L or D amino acid) with
other side chains.
[0128] The term "fusion polypeptide" or "fusion protein" refers to
a chimeric protein containing a reference protein (e.g., lacritin)
joined at the N- and/or C-terminus to one or more heterologous
sequences (e.g., a non lacritin polypeptide, such as syndecan).
Polypeptide molecules are said to have an "amino terminus" (N
terminus) and a "carboxy terminus" (C terminus) because peptide
linkages occur between the backbone amino group of a first amino
acid residue and the backbone carboxyl group of a second amino acid
residue. The terms "N terminal" and "C terminal" in reference to
polypeptide sequences refer to regions of polypeptides including
portions of the N terminal and C terminal regions of the
polypeptide, respectively. A sequence that includes a portion of
the N terminal region of polypeptide includes amino acids
predominantly from the N terminal half of the polypeptide chain,
but is not limited to such sequences. For example, an N terminal
sequence may include an interior portion of the polypeptide
sequence including bases from both the N terminal and C terminal
halves of the polypeptide. The same applies to C terminal regions.
N terminal and C terminal regions may, but need not, include the
amino acid defining the ultimate N terminus and C terminus of the
polypeptide, respectively.
[0129] The fusion proteins of the invention may be prepared by
recombinant methods or by solid phase chemical peptide synthesis
methods. Such methods have been known in the art since the early
1960's (Merrifield, 1963) (See also Stewart et al., Solid Phase
Peptide Synthesis, 2 ed., Pierce Chemical Co., Rockford, Ill., pp.
11-12)) and have recently been employed in commercially available
laboratory peptide design and synthesis kits (Cambridge Research
Biochemicals). In addition, a number of available FMOC peptide
synthesis systems are available. For example, assembly of a
polypeptide or fragment can be carried out on a solid support using
an Applied Biosystems, Inc. Model 431A automated peptide
synthesizer. Such equipment provides ready access to the peptides
of the invention, either by direct synthesis or by synthesis of a
series of fragments that can be coupled using other known
techniques.
[0130] The invention also includes a stable cell line that
expresses a lacritin bioactive fragment or a lacritin/syndecan-1
fusion protein, as well as an expression cassette comprising a
nucleic acid molecule encoding the lacritin fragment or
lacritin/syndecan-1 fusion protein, and a vector capable of
expressing the nucleic acid molecule of the invention in a host
cell. Preferably, the expression cassette comprises a promoter,
e.g., a constitutive or regulatable promoter, operably linked to
the nucleic acid sequence. In one embodiment, the expression
cassette contains an inducible promoter. Also provided is a host
cell, e.g., a prokaryotic cell or an eukaryotic cell such as a
plant or vertebrate cell, e.g., a mammalian cell, including but not
limited to a human, non-human primate, canine, feline, bovine,
equine, ovine or rodent (e.g., rabbit, rat, ferret or mouse) cell,
which comprises the expression cassette or vector of the invention,
and a kit which comprises the nucleic acid molecule, expression
cassette, vector, host cell or lacritin/syndecan-1 fusion
protein.
[0131] A "vector" is also meant to include a composition of matter
which comprises an isolated nucleic acid and which can be used to
deliver the isolated nucleic acid to the interior of a cell.
Numerous vectors are known in the art including, but not limited
to, linear polynucleotides, polynucleotides associated with ionic
or amphiphilic compounds, plasmids, and viruses. Thus, the term
"vector" includes an autonomously replicating plasmid or a virus.
The term should also be construed to include non-plasmid and
non-viral compounds which facilitate transfer of nucleic acid into
cells, such as, for example, polylysine compounds, liposomes, and
the like. Examples of viral vectors include, but are not limited
to, adenoviral vectors, adeno-associated virus vectors, retroviral
vectors, plasmids, cosmids, lambda phage vectors, and the like.
[0132] "Expression vector" refers to a vector comprising a
recombinant polynucleotide comprising expression control sequences
operatively linked to a nucleotide sequence to be expressed. An
expression vector comprises sufficient cis-acting elements for
expression; other elements for expression can be supplied by the
host cell or in an in vitro expression system. Expression vectors
include all those known in the art, such as cosmids, plasmids
(e.g., naked or contained in liposomes) and viruses that
incorporate the recombinant polynucleotide.
[0133] As used herein, the term "wound" relates to a physical tear
or rupture to a tissue or cell layer. A wound may occur by any
physical insult, including a surgical procedure.
EMBODIMENTS
[0134] As disclosed herein compositions having lacritin based
activity are disclosed for treating an ocular surface-associated
disease, disorder, or condition. In accordance with one embodiment
a composition is provided comprising a lacritin polypeptide, a
bioactive fragment of lacritin, a non-native lacritin peptide, or
peptidomimetic derivative of lacritin. In one embodiment the
composition comprises a sequence selected from the group consisting
of SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 5, and SEQ
ID NO: 6 or a sequence that differs from SEQ ID NO: 1, SEQ ID NO:
7, SEQ ID NO: 8, SEQ ID NO: 5, or SEQ ID NO: 6 by 1, 2, 3, 4 or 5
amino acid modifications. In one embodiment the composition
comprises a sequence selected from the group consisting of SEQ ID
NO: 7 or SEQ ID NO: 8 or a sequence that differs from SEQ ID NO: 7
or SEQ ID NO: 8 by 1, 2, 3, 4 or 5 amino acid substitutions, and in
a further embodiment the 1, 2, 3, 4 or 5 amino acid substitutions
are conservative amino acid substitutions.
[0135] In one embodiment a composition is provided comprising a
bioactive fragment of lacritin, wherein the bioactive fragment
consists of the sequence of SEQ ID NO: 7 or a derivative that
differs from SEQ ID NO: 7 by a single amino acid substitution. In
one embodiment the single amino acid substitution is a conservative
amino acid substation and in a further embodiment the amino acid
substitution is at position 4, 6, 8, 10, 17 and 19. In one
embodiment the bioactive fragment consists of the sequence of SEQ
ID NO: 7 or a derivative that differs from SEQ ID NO: 7 by a single
amino acid substitution at position 4 or 19. Surprisingly,
applicants have found that the 25 amino acid C-terminal fragment of
native human lacritin (SEQ ID NO: 7) has enhance stability in human
tears relative to the same fragment having the terminal 6 amino
acids removed (SEQ ID NO: 5). In particular, immunoblotting reveals
that N-94/C-6 loses epitopes after incubation in lacritin depleted
tears for 4 hr at 37.degree. C. whereas Lacripep (`N-94`; SEQ ID
NO: 7) does not.
[0136] Although topical application of ophthalmic products has
remained the most popular and well-tolerated administration route
for patient compliance, the bioavailability of eye drops is
severely hindered by blinking, baseline and reflex lacrimation, and
nasolacrimal drainage. One solution to enhance the therapeutic
index of topical treatments is through the application of polymeric
nanoparticles as drug carriers. In accodance with one embodiment a
pharmaceutical composition is provided comprising lacritin, or a
bioactive fragment thereof linked to a nanoparticle. In one
embodiment the nanoparticle is a thermo-responsive elastin-like
polypeptide (ELP). ELPs are composed of the repetitive pentapeptide
motif (Val-Pro-Gly-Xaa-Gly)n (SEQ ID NO: 24) and exhibit unique
reversible inverse phase transition temperatures, Tt, below which
they solubilize and above which they phase separate. In one
embodiment the carboxy terminus of lacritin or a bioactive fragment
thereof is linked to an ELP and in one embodiment the C-terminus of
a peptide consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7,
or SEQ ID NO: 8 is linked to the repetitive pentapeptide motif
(VPGSG).sub.48(VPGIG).sub.48 (SEQ ID NO: 28).
[0137] In accordance with one embodiment, a composition is provided
comprising a syndecan-1 peptide, a non-native peptide, or a
peptidomimetic derivative thereof. In one embodiment the peptide
comprises a sequence selected from the group consisting of SEQ ID
NO: 2 and SEQ ID NO: 3 or a sequence that differs from SEQ ID NO: 2
and SEQ ID NO: 3 by 1, 2, 3, 4 or 5 amino acids, and homologs and
fragments thereof. In one embodiment a peptide differs from SEQ ID
NO: 2 and SEQ ID NO: 3 by 1, 2, 3, 4 or 5 conservative amino acid
substitutions. In one embodiment, the amino acid modifications are
amino acid substitution, and in one embodiment the substitutions
are conservative amino acid substitutions. In one embodiment the
composition comprises a syndecan-1 fragment consisting of the
sequence of SEQ ID NO: 2.
[0138] In some embodiments, the peptide of the present disclosure
comprises an amino acid sequence which has at least 75%, 80%, 85%,
90% or 95% sequence identity to an amino acid sequence of SEQ ID
NO: 2 or SEQ ID NO: 3 or a fragment or homolog thereof.
[0139] In some embodiments, the peptide of the present disclosures
comprises a non-native amino acid sequence which has at least 75%,
80%, 85%, 90% or 95% sequence identity to an amino acid sequence of
SEQ ID NO: 2 or SEQ ID NO: 3 or a peptidomimetic derivative of SEQ
ID NO: 2 or SEQ ID NO: 3. The statement that the peptide is a
non-native is intended to exclude the native peptides of parent
proteins.
[0140] Compositions comprising a lacritin peptide or bioactive
fragment or derivative thereof have use in treating ocular
surface-associated diseases, disorders, and conditions, including
dry eye. Accordingly, in one embodiment lacritin polypeptide
comprising compositions are used to treat such diseases, disorders,
and conditions.
[0141] In accordance with one embodiment, a composition is provided
comprising a heparinase peptide, a non-native peptide, or a
peptidomimetic derivative thereof, wherein the peptide comprises a
sequence selected from the group consisting of SEQ ID NO: 4 or a
sequence that differs from SEQ ID NO: 4 by 1, 2, 3, 4 or 5 amino
acids, and homologs and fragments thereof. In one embodiment a
heparinase peptide is provided that differs from SEQ ID NO: 4 by 1,
2, 3, 4 or 5 amino acid modifications. In one embodiment, the amino
acid modifications are amino acid substitution, and in one
embodiment the substitutions are conservative amino acid
substitutions.
[0142] In some embodiments, the peptide of the present disclosure
comprises an amino acid sequence which has at least 75%, 80%, 85%,
90% or 95% sequence identity to the amino acid sequence SEQ ID NO:
4 or a fragment or homolog thereof.
[0143] In some embodiments, the peptide of the present disclosure
comprises a non-native amino acid sequence which has at least 75%,
80%, 85%, 90% or 95% sequence identity to an amino acid sequence of
SEQ ID NO: 4 or a peptidomimetic derivative of SEQ ID NO: 4. The
statement that the peptide is a non-native is intended to exclude
the native peptides of parent proteins.
[0144] Derivatives of the peptides disclosed herein, in one
embodiment, contain an amino acid sequence wherein 1, 2, or 3 amino
acids are deleted, substituted or added, relative to the parent
peptide, as long as the modified peptide has an activity equivalent
to that of peptide having the aforementioned amino acid
sequence.
[0145] In another embodiment, a novel, isolated polypeptide having
an amino acid sequence of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7,
or SEQ ID NO: 8 or a biologically active fragment, homolog, or
derivative thereof is provided. In one embodiment the polypeptide
has an amino acid sequence SEQ ID NO: 5 or a biologically active
fragment, homolog, or derivative thereof. In another embodiment,
the polypeptide has amino acid sequence SEQ ID NO: 6. In another
embodiment, the polypeptide has amino acid sequence SEQ ID NO: 7 or
a biologically active fragment, homolog, or derivative thereof. In
another embodiment, the polypeptide has amino acid sequence SEQ ID
NO: 8 or a biologically active fragment, homolog, or derivative
thereof.
[0146] In another embodiment, the present invention provides an
isolated polypeptide comprising amino acid sequence SEQ ID NO: 5,
SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 or a biologically
active fragment, homolog, or derivative thereof for use in therapy.
In one embodiment, the present invention provides an purified
polypeptide comprising amino acid sequence SEQ ID NO: 5, SEQ ID NO:
6, SEQ ID NO: 7, or SEQ ID NO: 8 or a biologically active fragment,
homolog, or derivative thereof for use in therapy. In one
embodiment, the present invention provides a purified polypeptide
consisting of the amino acid sequence of SEQ ID NO: 7 for use in
treating an ocular surface-associated disease, disorder, or
condition.
[0147] In another embodiment, the present invention provides for
the use of an isolated polypeptide comprising amino acid sequence
SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 or a
biologically active fragment, homolog, or derivative thereof for
the manufacture of a medicament for the treatment of an ocular
surface-associated disease, disorder, or condition or any an
indication recited herein. In one embodiment the polypeptide is a
purified polypeptide consisting of the amino acid sequence of SEQ
ID NO: 7.
[0148] In another embodiment, the present invention provides a
novel pharmaceutical composition comprising a therapeutically
effective amount of at least one polypeptide comprising amino acid
sequence SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8
or a biologically active fragment, homolog, or derivative thereof,
wherein the composition is suitable for topical administration to
an ocular surface of a subject.
[0149] In another embodiment, the composition comprises a
polypeptide having amino acid sequence SEQ ID NO: 5 or a
biologically active fragment, homolog, or derivative thereof. In
another embodiment, the composition comprises a polypeptide having
amino acid sequence SEQ ID NO: 6 or a biologically active fragment,
homolog, or derivative thereof. In another embodiment, the
composition comprises a polypeptide having amino acid sequence SEQ
ID NO: 7 or a biologically active fragment, homolog, or derivative
thereof. In another embodiment, the composition comprises a
polypeptide having amino acid sequence SEQ ID NO: 8 or a
biologically active fragment, homolog, or derivative thereof.
[0150] In one embodiment, a composition of the invention further
comprises a carrier. In one aspect, the carrier is buffered saline.
In one aspect, a composition of the invention is a pharmaceutical
composition. In one aspect, a pharmaceutical composition of the
invention comprises a pharmaceutically-acceptable carrier. In one
aspect, the carrier is buffered saline. In one aspect, a
pharmaceutical composition of the invention further comprises at
least one additional therapeutic agent. In another embodiment, the
composition further comprises buffered saline. In another
embodiment, the buffer is phosphate buffer. In another embodiment,
the buffer is selected from sodium phosphate, disodium phosphate,
potassium phosphate, dipotassium phosphate, and a combination
thereof.
[0151] In another embodiment, the composition further comprises a
salt selected from NaCl and KCl. In another embodiment, the pH of
the solution is selected from 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.8,
7.9, and 8. In another embodiment, the pH is 7.4
[0152] An example of a buffered saline suitable for the present
invention comprises H.sub.2O and the following components.
TABLE-US-00005 Concentration Concentration Salt mmol/L g/L NaCl 137
8.0 KCl 2.7 0.2 Na.sub.2HPO.sub.4 10 1.44 KH.sub.2PO.sub.4 1.8
0.24
[0153] In another embodiment, the present invention provides a
novel method of treating dry eye, comprising contacting an ocular
surface of a subject in need thereof with a composition the present
invention. In accordance with one embodiment treatment with a
lacritin based composition disclosed herein results in one or more
of the following effects:
[0154] a) the treatment restores or increases tearing;
[0155] b) the treatment restores or increases tearing without
causing or increasing inflammation;
[0156] c) the treatment restores basal tearing;
[0157] d) the treatment suppresses lacrimal gland inflammation;
[0158] e) the treatment diminishes the susceptibility of the eye to
corneal staining;
[0159] f) the treatment diminishes tear osmolarity;
[0160] g) the treatment improves ocular surface health;
[0161] h) the treatment stimulates lacrimal glands;
[0162] i) the treatment stimulates meibomian glands;
[0163] j) the treatment stimulates conjunctival goblet cells;
[0164] k) the treatment stimulates corneal sensory nerves;
[0165] l) the treatment increases the level of a shed and
deglycanated 90 kDa form of syndecan-1 in the tears of the treated
subject;
[0166] m) the treatment decreases the level of a 25 kDa fragment of
SDC-1 ectodomain in the tears of the treated subject;
[0167] n) the treatment decreases the level of inactive lacritin-C
splice variant in the tears of the treated subject;
[0168] o) the treatment increases the level of latent heparanase in
the tears of the treated subject; and
[0169] p) the treatment decreases the level of activated heparanase
in the tears of the treated subject.
[0170] Patients suitable for treatment using a lacritin containing
composition include patients having one or more of the following
conditions:
[0171] a) the tears of the subject, prior to treatment, contain low
levels of 90 kDa deglycanated SDC-1 compared to normal, non-dry eye
tears;
[0172] b) the tears of the subject, prior to treatment, contain
elevated levels of 25 kDa SDC-1 compared to normal, non-dry eye
tears;
[0173] c) the tears of the subject, prior to treatment, contain
elevated levels of inactive lacritin-C splice variant compared to
normal, non-dry eye tears;
[0174] d) the tears of the subject, prior to treatment, contain low
levels of latent heparanase compared to normal, non-dry eye
tears;
[0175] e) the tears of the subject, prior to treatment, contain
elevated levels of activated heparanase compared to normal, non-dry
eye tears; and
[0176] f) the subject is recovering from PRK (photorefractive
keratectomy) or LASIK (Laser-Assisted in situ Keratomileusis)
surgery or other surgical procedure of the eye, and includes any
subject who underwent PRK or LASIK surgery and is suffering from
dry eye, regardless of the time since receiving the surgery. In one
embodiment a subject having undergone PRK or LASIK surgery within
the past day, month, six months, year, or even years can receive
benefit from treatment using a lacritin containing formulation as
disclosed herein.
[0177] In accordance with one embodiment a method for identifying a
subject afflicted with insufficient tears to lubricate and nourish
the eye, deriving from either insufficient tear quantity or have a
poor quality of tears. In one embodiment the method comprises
screening a tear sample obtained from said subject for the presence
of at least one protein selected from the group consisting of
[0178] latent heparanase/active heparanase; [0179] 90 kDa
deglycanated SDC-1; [0180] 25 kDa SDC-1; and [0181] inactive
lacritin-C splice variant, wherein the concentration of latent
heparanase, or active heparanase, and 90 kDa deglycanated SDC-1 is
measured, and a decreased level of latent heparanase, or increase
in active heparanase, (relative to levels present in tears from a
normal eye) and/or a decreased level of 90 kDa deglycanated SDC-1
(relative to levels present in tears from a normal eye) and/or
detection of 25 kDa SDC-1 in the tear sample, and/or detection of
inactive lacritin-C splice variant in the tear sample identifies
subjects having dry eye. Detection of any one of the individual
four conditions or any combination thereof indicates a subject
suffering from dry eye that would could benefit from the topical
administration of a composition comprising a lacritin polypeptide,
including for example the lacritin fragment of SEQ ID NO: 7.
[0182] In accordance with one embodiment a tear sample is obtained
from a subject and the concentration of the 90 kDa deglycanated
SDC-1 and 25 kDa SDC-1 are measured. Decreased levels of 90 kDa
deglycanated SDC-1 coupled with increased levels of 25 kDa SDC-1,
relative to concentrations of those peptides in tears from a normal
eye, identifies subjects having dry eye. In one embodiment a tear
sample is obtained from a subject and the sample is screened for
the presence of 25 kDa SDC-1, wherein detection of 25 kDa SDC-1
identifies a subject having dry eye. In one embodiment a tear
sample is obtained from a subject and the sample is screened for
the presence of inactive lacritin-C splice variant, wherein
detection of inactive lacritin-C splice variant identifies a
subject having dry eye. In one embodiment a tear sample is obtained
from a subject and the sample is screened for the presence of 25
kDa SDC-1 and inactive lacritin-C splice variant, wherein detection
of 25 kDa SDC-1 and inactive lacritin-C splice variant identifies a
subject having dry eye.
[0183] Advantageously, these markers of dry eye can serve as a
basis for identifying subjects who will benefit from lacritin
therapy. Accordingly, in one embodiment a method is provided for
treating dry eye wherein the first step involves identifying those
subjects suitable for treatment. In one embodiment the method of
treating a subject for dry eye comprises obtaining a tear sample
from the subject, and detecting the presence of at least one
protein selected from the groups consisting of latent
heparanase/active heparanase, 90 kDa deglycanated SDC-1, 25 kDa
SDC-1, and inactive lacritin-C splice variant, wherein a decreased
level of latent heparanase, or increase in active heparanase,
(relative to levels present in tears from a normal eye), a
decreased level of 90 kDa deglycanated SDC-1 (relative to tears
from a normal eye), detection of 25 kDa SDC-1, and/or detection of
inactive lacritin-C splice variant identifies subjects having dry
eye. Those subjects identified as having dry eye based on detected
levels of latent heparanase, active heparanase, 90 kDa deglycanated
SDC-1, 25 kDa SDC-1, and/or inactive lacritin-C splice variant are
then administered a composition comprising a lacritin polypeptide,
including for example the peptide of SEQ ID NO: 7. More
particularly, the ocular surface of the subject is contacted with a
pharmaceutical composition comprising lacritin or a bioactive
fragment thereof.
[0184] In accordance with one embodiment a subject identified as
afflicted with dry eye is contacted with a bioactive fragment of
lacritin selected from the group consisting of
[0185] KQFIENGSEFAQKLLKKFS (SEQ ID NO: 5);
[0186] KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7);
[0187] KQFIENGSEFANKLLKKFS (SEQ ID NO: 6); and
[0188] KQFIENGSEFANKLLKKFSLLKPWA (SEQ ID NO: 8) or a derivative
thereof that differs from SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7
or SEQ ID NO: 8 by one or two amino acid substitutions. In one
embodiment the bioactive fragment of lacritin consists of
KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7).
[0189] In accordance with one embodiment a subject afflicted with
dry eye that is treatable with a lacritin therapy is identified by
testing the tears of the subject for the presence of lacritin
monomer, wherein a selective decrease in monomer compared to a
control indicates for dry eye. The control is a subject (or group
of subjects) not suffering from dry eye. In another embodiment a
subject afflicted with dry eye that is treatable with a lacritin
therapy is identified by testing the tears of the subject for the
presence of 90 kDa deglycanated SDC-1, wherein the detection of
normal levels of 90 kDa deglycanated SDC-1 does not indicate for
dry eye. In another embodiment a subject afflicted with dry eye
that is treatable with a lacritin therapy is identified by
collecting the tears of the subject and separating the proteins of
the tears via their weight. In one embodiment the proteins of tears
are separated through the use of SDS-PAGE.
[0190] In another embodiment, testing is performed by contacting
the tears of the subject with a test strip, comprising an agent
capable of detecting the presence of 25 kDa SDC-1. In one
embodiment the agent is an antibody, optionally a monoclonal
antibody.
[0191] In another embodiment, testing is performed by contacting
the tears of the subject with a test strip, comprising an agent
capable of detecting the presence of 90 kDa deglycanated SDC-1. In
one embodiment the agent is an antibody, optionally a monoclonal
antibody.
[0192] In another embodiment, the tears are tested for the presence
of 25 kDa SDC-1 and 90 kDa deglycanated SDC-1, wherein the presence
of normal levels of 90 kDa deglycanated SDC-1 does not indicate for
dry eye and the presence of 25 kDa SDC-1 indicates for dry eye. In
another embodiment, the method of identifying patients afflicted
with dry eye further comprises a step of treating the subject with
a composition of the present invention. In one embodiment an ocular
surface of a subject found to have 25 kDa SDC-1 in their tears is
treated with a lacritin, or lacritin fragment, containing
composition.
[0193] In another embodiment, the present invention provides a
novel method of identifying a subject having dry eye, comprising
testing the tears of the subject for the presence of 25 kDa SDC-1,
wherein the presence of 25 kDa SDC-1 indicates for dry eye. In one
embodiment, testing is performed by collecting the tears of the
subject and separating the proteins of the tears based on their
weight. In one embodiment the separation of the peptides is
performed using SDS-PAGE.
[0194] In another embodiment, a novel method of identifying a
subject having dry eye is provided wherein the tears of the subject
are tested for the presence of inactive lacritin-C splice variant,
wherein the presence of inactive lacritin-C splice variant
indicates for dry eye. In one embodiment the presence of inactive
lacritin-C splice variant is detected by collecting the tears of
the subject and separating the proteins of the tears via their
weight. In one embodiment the proteins of the tears are separated
through the use of g SDS-PAGE. In another embodiment, testing is
performed by contacting the tears of the subject with a test strip,
comprising an agent capable of detecting the presence of inactive
lacritin-C splice variant. In one embodiment the agent is an
antibody, optionally a monoclonal antibody. In a further embodiment
a method of treatment is provided comprising contacting an ocular
surface of a subject found to have inactive lacritin-C splice
variant in their tears with a composition of the present
invention.
[0195] In another embodiment, a novel method of identifying a
subject having dry eye comprises testing the tears of the subject
for the presence of active and latent heparanase, wherein the
presence of elevated active heparanase or depressed latent
heparanase indicates for dry eye. In one embodiment the testing is
performed by collecting the tears of the subject and separating the
proteins of the tears via their weight and blotting with an
anti-heparanase antibody capable of detecting latent and active
heparanase.
[0196] In one embodiment, a subject suffering from evaporative dry
eye, corneal inflammation, or corneal ulceration is treated by
contacting the cells of a subject in need thereof with a lacritin
polypeptide comprising composition disclosed herein.
[0197] In another embodiment, the present invention provides a
novel method of enhancing the proliferation of human corneal
epithelial cells or lacrimal acinar cells, wherein the method
comprises contacting the cells of a subject in need thereof with a
composition of the present invention. In one embodiment the
lacritin peptide compositions disclosed herein are used to enhance
the proliferation of the subject's corneal epithelial cells,
enhance the proliferation of the subject's lacrimal acinar cells or
inhibit epithelial cell apoptosis or other forms of epithelial cell
death. In one embodiment the method comprises contacting the cells
of a subject in need thereof with a lacritin peptide composition
disclosed herein, wherein the cells are selected from the corneal
cells, conjunctival cells, or a combination of both.
[0198] In another embodiment, the epithelial cell cells contacted
with a lacritin peptide have been subjected to an insult. In one
embodiment the lacritin peptide consists of the sequence of SEQ ID
NO: 7. In one embodiment, the insult is selected from the group
consisting of blepharitis, dry eye, conjunctivitis, Sjogren's
syndrome, corneal abrasion, ulceration, bacterial infection, direct
trauma, surgery, radiant energy, ionizing energy, viral infection,
fungal infection, parasitic infection, keratitis, systemic
dermatologic disorders, collagen vascular diseases, Reiter's
disease, and Behcet's disease.
[0199] In another embodiment a method of treating the diseases of
lysosomal clearing is provided wherein the method comprises
contacting an ocular surface of a subject with a composition of the
present disclosure. In one embodiment, the diseases are selected
from glaucoma and age-related macular degeneration (AMD). In one
embodiment the method comprises contacting an ocular surface of a
subject with a composition comprising a lacritin peptide, wherein
the peptide consists of the sequence of SEQ ID NO: 7.
[0200] In another embodiment, the present invention relates to the
treatment of diseases of lysosomal clearing. Such diseases include:
glaucoma, age-related macular and degeneration (AMD). While not
wishing to be bound by scientific theory, it is believed that
lacritin triggers the autophagic capture and lysosomic degradation
of intracellular aggregated (toxic) proteins in stressed cells. In
AMD, the buildup of `drusen` is both intracellular in retinal
pigment epithelial cells and extracellular nearby these cells. It
is expected that if a topical administration of a polypeptide of
the present invention (e.g., lacritin or polypeptide of SEQ ID NO:
5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8) infiltrates deep
into the eye it will stimulate RPE autophagy to deplete drusen. In
open angle glaucoma, stress in the trabecular meshwork cells leads
to build up of intracellular material that accumulates. Although
autophagy is chronically elevated, this is unhealthy for cells.
Instead, lacritin forces a rapid and transient bolus of accelerated
autophagy sufficient to clear offending accumulating protein.
Autophagy then returns to baseline. A polypeptide of the present
disclosure is expected to gain access to these cells.
[0201] In another embodiment, the present invention provides a
novel bactericidal composition. In accordance with one embodiment a
bactericidal composition is provided comprising a C-terminal
fragment of lacritin selected from SEQ ID NO: 5, SEQ ID NO: 6, SEQ
ID NO: 7, or SEQ ID NO: 8 or a derivative thereof that differs from
SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 or SEQ ID NO: 8 by 1, 2,
or 3 amino acid substitutions. In one embodiment the composition is
suitable for topical administration to an ocular surface of a
subject. In one embodiment the lacritin derivative that differs
from SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 or SEQ ID NO: 8 by 1,
2 or 3 amino acid substitutions, has amino acid substitutions
located at positions selected from positions 4, 6, 8, 10, 17 and 19
relative to the numbering of SEQ ID NO: 7. These positions show
variability among the highly conserved C-terminal regions of
primate species (see FIG. 9). In one embodiment the lacritin
derivative differs from SEQ ID NO: 7 or SEQ ID NO: 8 by 1 or 2
amino acid substitutions at positions 4 and/or 19 relative to the
numbering of SEQ ID NO: 7. In one embodiment the amino acid
substitutions are conservative amino acid substitutions. In
accordance with one embodiment a bactericidal composition is
provided comprising a C-terminal fragment of lacritin selected from
SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In
accordance with one embodiment a bactericidal composition is
provided comprising a C-terminal fragment of lacritin selected from
SEQ ID NO: 7, or SEQ ID NO: 8, and in one embodiment the C-terminal
fragment of lacritin consists of KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID
NO: 7).
[0202] In one embodiment a bactericidal composition is provided
comprising a first anti-bacterial agent, which is a polypeptide
comprising the amino acid sequence of SEQ ID NO: 5, SEQ ID NO: 6,
SEQ ID NO: 7, or SEQ ID NO: 8 or a biologically active fragment,
homolog, or derivative thereof, wherein the composition is suitable
for topical administration to an ocular surface of a subject. In
one aspect, the polypeptide has amino acid sequence SEQ ID NO: 5.
In another aspect, the polypeptide has amino acid sequence SEQ ID
NO: 6. In another aspect, the polypeptide has amino acid sequence
SEQ ID NO: 7. In another aspect, the polypeptide has amino acid
sequence SEQ ID NO: 8. In one aspect, the bactericidal composition
further comprises a bactericidally-acceptable carrier.
[0203] In one embodiment the bactericidal composition further
comprises a second anti-bacterial agent. In one embodiment, the
composition further comprises an anti-microbial agent. Suitable
ophthalmic anti-microbial agents are known to those skilled in the
art and include those described in U.S. Pat. Nos. 5,300,296,
6,316,669, 6,365,636 and 6,592,907, the disclosures of which are
incorporated herein. Examples of anti-microbial agents suitable for
use in accordance with the present invention include benzalkonium
chloride, benzethonium chloride, benzyl alcohol, chlorobutanol,
chlorhexidine digluconate or diacetate, methyl and propyl
hydroxybenzoate (parabens), phenylethyl alcohol, phenylmercuric
acetate or nitrate, sorbic acid, and thimerosal.
[0204] In one embodiment a second anti-bacterial agent is present
in the bactericidal composition and in one embodiment the second
anti-bacterial agent is one that is naturally present in mammalian
eyes. In one embodiment the second anti-bacterial agent is
lysozyme. In accordance with one embodiment the bactericidal
composition comprises a C-terminal fragment of lacritin and a
second anti-bacterial agent, wherein the ratio of C-terminal
fragment of lacritin and a second anti-bacterial agent is at least
2:1. In one embodiment the bactericidal composition comprises a
C-terminal fragment of lacritin and lysozyme, wherein the weight
ratio of lysozyme to the C-terminal fragment of lacritin is from
4:1 to 3:1. In one embodiment the C-terminal fragment of lacritin
consists of KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7).
[0205] In accordance with one embodiment, a method is provided for
treating infections of the eye. The method comprises the step of
topically administering a composition comprising a lacritin
polypeptide to the eye. In another embodiment, the present
invention provides a novel method of treating a corneal infection,
comprising contacting the cornea of a subject in need thereof with
a bactericidal composition of the present invention. In one
embodiment a peptide consisting of the sequence of the
KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7) is used in the manufacture
of a medicament for the treatment of dry eye or treatment of a
corneal infection.
[0206] In another embodiment, a method of treating a subject
suffering from dry eye by contacting an ocular surface of a subject
found to have active heparanase in their tears with a composition
of the present invention.
[0207] In another embodiment, the present invention provides a
novel container comprising a composition of the present invention,
wherein the composition is in the form of an eye drop and in a
volume sufficient for 1 dosage. In another embodiment, the
composition is in the form of an eye drop and in a volume
sufficient for 1-2 dosages. In another embodiment, the composition
is in the form of an eye drop and in a volume sufficient for up to
1 week, 2 weeks, 3 weeks, or 4 weeks. In another embodiment, the
container is in the form of a single use ampule, a bottle formed to
dispense drops of the composition, or a bottle comprising: a body
and a cap, wherein an eye dropper connect to the cap or part of the
cap.
[0208] The present invention can also be practiced using methods
described in U.S. Pat. Nos. 7,648,964, 7,459,440, 7,320,870, and
7,932,227, and publications WO 98/27205 (Jacobs et al., published
Jun. 25, 1998), Sanghi et al., 2001, J. Mol. Biol., 310:127, Wang
et al., 2006, J. Cell Biol., 174(5):689-700, Epub 2006 Aug. 21, Ma
et al., J. Cell Biol., 2006, 174:7:1097-1106, Zhang et al., J.
Biol. Chem., 2013, 288(17):12090-101: Epub 2013 Mar. 15, the
contents of which are incorporated by reference in their entirety
herein.
[0209] Various aspects and embodiments of the invention are
described in further detail below.
[0210] In accordance with one embodiment a novel mechanism for the
molecular identification of dry eye disease is coupled with a
restorative therapy that addresses cause. In one embodiment the
method of identifying dry eye relates to the discovery that a
.about.90 KDa deglycanated form of syndecan-1 is abundant in tears
of normal individuals but not individuals suffering from dry eye,
whereas a .about.25 kDa syndecan-1 fragment is detectable in dry,
but not normal tears. Also disclosed herein is the discovery that
topical lacritin, the agonist of deglycanated syndecan-1,
sensitizes corneal sensory nerves to drying of the surface of the
eye and increases the neural wet response. Accordingly, one
embodiment of the present invention is directed to a method of
identifying dry eye by detecting abnormally low levels of .about.90
kDa and/or the presence of 25 kDa syndecan-1 in tears. Another
embodiment is directed to a method of increasing the corneal neural
dry and wet responses by administering topical lacritin or lacritin
fragments, synthetic peptides or mimetics.
[0211] Current tear supplements are not popular with subjects, in
part because the relief obtained from such products is very brief
(less than 15 min). Examples of the tear substitution approach
include the use of buffered, isotonic saline solutions, aqueous
solutions containing water soluble polymers that render the
solutions more viscous and thus less easily shed by the eye. Tear
reconstitution is also attempted by providing one or more
components of the tear film such as phospholipids and oils.
Examples of these treatment approaches are disclosed in U.S. Pat.
No. 4,131,651 (Shah et al.), U.S. Pat. No. 4,370,325 (Packman),
U.S. Pat. No. 4,409,205 (Shively), U.S. Pat. Nos. 4,744,980 and
4,883,658 (Holly), U.S. Pat. No. 4,914,088 (Glonek), U.S. Pat. No.
5,075,104 (Gressel et al.) and U.S. Pat. No. 5,294,607 (Glonek et
al.) the disclosures of which are incorporated herein. Existing
ophthalmic formulations may also include TGF-beta, corticosteroids,
or androgens. All are non-specific for the eye and have systemic
effects. In contrast, lacritin is highly restricted to the eye and
is a natural constituent of human tears and the tear film.
[0212] An ophthalmic formulation comprising lacritin, or fragments,
homologs, or derivatives thereof (for example, an artificial tear
fluids containing lacritin), is highly desirable due to the
activity of lacritin and its localized effects. In accordance with
one embodiment of the invention, compositions comprising lacritin,
or bioactive fragments thereof, are used to enhance corneal wound
healing, and/or treat subjects having deficient tear output. The
lacritin compositions of the present invention can be formulated
using standard ophthalmic components, and preferably, the
compositions are formulated as solutions, suspensions, and other
dosage forms for topical administration. Aqueous solutions are
generally preferred, based on ease of formulation, biological
compatibility (especially in view of the malady to be treated,
e.g., dry eye-type diseases and disorders), as well as a subject's
ability to easily administer such compositions by means of
instilling one to two drops of the solutions in the affected eyes.
However, the compositions may also be suspensions, viscous or
semi-viscous gels, or other types of solid or semi-solid
compositions.
[0213] The compositions of the present invention may include
surfactants, preservative agents, antioxidants, tonicity agents,
buffers, preservatives, co-solvents and viscosity building agents.
Various surfactants useful in topical ophthalmic formulations may
be employed in the present compositions. These surfactants may aid
in preventing chemical degradation of the lacritin polypeptide and
also prevent the lacritin polypeptide from binding to the
containers in which the compositions are packaged. Examples of
surfactants include, but are not limited to: Cremophor..TM.. EL,
polyoxyl 20 ceto stearyl ether, polyoxyl 40 hydrogenated castor
oil, polyoxyl 23 lauryl ether and poloxamer 407 may be used in the
compositions. Antioxidants may be added to compositions of the
present invention to protect the lacritin polypeptide from
oxidation during storage. Examples of such antioxidants include,
but are not limited to, vitamin E and analogs thereof, ascorbic
acid and derivatives, and butylated hydroxyanisole (BHA).
[0214] Existing artificial tears formulations can also be used as
pharmaceutically acceptable carriers for the lacritin active agent.
Thus in one embodiment, a lacritin polypeptide is used to improve
existing artificial tear products for Dry Eye syndromes, as well as
develop products to aid corneal wound healing. Examples of
artificial tears compositions useful as carriers include, but are
not limited to, commercial products, such as Tears Naturale.TM.,
Tears Naturale II.TM., Tears Naturale Free.TM., and Bion Tears.TM..
(Alcon Laboratories, Inc., Fort Worth, Tex.). Examples of other
phospholipid carrier formulations include those disclosed in U.S.
Pat. No. 4,804,539 (Guo et al.), U.S. Pat. No. 4,883,658 (Holly),
U.S. Pat. No. 4,914,088 (Glonek), U.S. Pat. No. 5,075,104 (Gressel
et al.), U.S. Pat. No. 5,278,151 (Korb et al.), U.S. Pat. No.
5,294,607 (Glonek et al.), U.S. Pat. No. 5,371,108 (Korb et al.),
U.S. Pat. No. 5,578,586 (Glonek et al.); the foregoing patents are
incorporated herein by reference to the extent they disclose
phospholipid compositions useful as phospholipid carriers of the
present invention. In accordance with one embodiment an topical
ophthalmic formulation is provided comprising a lacritin peptide
consisting of the sequence of SEQ ID NO: 7 and a pharmaceutically
acceptable carrier. In one embodiment the composition further
comprises a phospholipid. In an alternative embodiment the
composition further comprises a surfactant, preservative agent,
antioxidant, tonicity agent, buffer, preservative, co-solvent
and/or viscosity building agents.
[0215] Other compounds may also be added to the ophthalmic
compositions of the present disclosure to increase the viscosity of
the carrier. Examples of viscosity enhancing agents include, but
are not limited to: polysaccharides, such as hyaluronic acid and
its salts, chondroitin sulfate and its salts, dextrans, various
polymers of the cellulose family; vinyl polymers; and acrylic acid
polymers. In general, the phospholipid carrier or artificial tears
carrier compositions will exhibit a viscosity of 1 to 400
centipoises ("cps"). Preferred compositions containing artificial
tears or phospholipid carriers and will exhibit a viscosity of
about 25 cps.
[0216] Topical ophthalmic products are typically packaged in
multidose form. Preservatives are thus required to prevent
microbial contamination during use. Suitable preservatives include:
benzalkonium chloride, chlorobutanol, benzododecinium bromide,
methyl paraben, propyl paraben, phenylethyl alcohol, edetate
disodium, sorbic acid, polyquaternium-1, or other agents known to
those skilled in the art. Such preservatives are typically employed
at a level of from 0.001 to 1.0% w/v. Unit dose compositions of the
present invention will be sterile, but typically unpreserved. Such
compositions, therefore, generally will not contain
preservatives.
[0217] Because the gene promoter regulating lacritin gene
expression is the most specific of any previously described
lacrimal gland gene, the regulatory elements of this gene could be
used to express other gene products in the eye. In particular, the
lacritin gene promoter can be operably linked to a wide variety of
exogenous genes to regulate the expression of the gene products to
the lacrimal gland and/or used as gene therapy to treat Dry Eye
syndromes.
[0218] The peptides of the present disclosure may be readily
prepared by standard, well-established techniques, such as
solid-phase peptide synthesis (SPPS) as described by Stewart et al.
in Solid Phase Peptide Synthesis, 2nd Edition, 1984, Pierce
Chemical Company, Rockford, Ill.; and as described by Bodanszky and
Bodanszky in The Practice of Peptide Synthesis, 1984,
Springer-Verlag, New York. At the outset, a suitably protected
amino acid residue is attached through its carboxyl group to a
derivatized, insoluble polymeric support, such as cross-linked
polystyrene or polyamide resin. "Suitably protected" refers to the
presence of protecting groups on both the .alpha.-amino group of
the amino acid, and on any side chain functional groups. Side chain
protecting groups are generally stable to the solvents, reagents
and reaction conditions used throughout the synthesis, and are
removable under conditions which will not affect the final peptide
product. Stepwise synthesis of the oligopeptide is carried out by
the removal of the N-protecting group from the initial amino acid,
and couple thereto of the carboxyl end of the next amino acid in
the sequence of the desired peptide. This amino acid is also
suitably protected. The carboxyl of the incoming amino acid can be
activated to react with the N-terminus of the support-bound amino
acid by formation into a reactive group such as formation into a
carbodiimide, a symmetric acid anhydride or an "active ester" group
such as hydroxybenzotriazole or pentafluorophenly esters.
[0219] Examples of solid phase peptide synthesis methods include
the BOC method which utilized tert-butyloxcarbonyl as the
.alpha.-amino protecting group, and the FMOC method which utilizes
9-fluorenylmethyloxcarbonyl to protect the .alpha.-amino of the
amino acid residues, both methods of which are well known by those
of skill in the art.
[0220] Incorporation of N- and/or C-blocking groups can also be
achieved using protocols conventional to solid phase peptide
synthesis methods. For incorporation of C-terminal blocking groups,
for example, synthesis of the desired peptide is typically
performed using, as solid phase, a supporting resin that has been
chemically modified so that cleavage from the resin results in a
peptide having the desired C-terminal blocking group. To provide
peptides in which the C-terminus bears a primary amino blocking
group, for instance, synthesis is performed using a
p-methylbenzhydrylamine (MBHA) resin so that, when peptide
synthesis is completed, treatment with hydrofluoric acid releases
the desired C-terminally amidated peptide. Similarly, incorporation
of an N-methylamine blocking group at the C-terminus is achieved
using N-methylaminoethyl-derivatized DVB, resin, which upon HF
treatment releases a peptide bearing an N-methylamidated
C-terminus. Blockage of the C-terminus by esterification can also
be achieved using conventional procedures. This entails use of
resin/blocking group combination that permits release of side-chain
peptide from the resin, to allow for subsequent reaction with the
desired alcohol, to form the ester function. FMOC protecting group,
in combination with DVB resin derivatized with methoxyalkoxybenzyl
alcohol or equivalent linker, can be used for this purpose, with
cleavage from the support being effected by TFA in
dicholoromethane. Esterification of the suitably activated carboxyl
function e.g. with DCC, can then proceed by addition of the desired
alcohol, followed by deprotection and isolation of the esterified
peptide product.
[0221] Incorporation of N-terminal blocking groups can be achieved
while the synthesized peptide is still attached to the resin, for
instance by treatment with a suitable anhydride and nitrile. To
incorporate an acetyl-blocking group at the N-terminus, for
instance, the resin-coupled peptide can be treated with 20% acetic
anhydride in acetonitrile. The N-blocked peptide product can then
be cleaved from the resin, deprotected and subsequently
isolated.
[0222] To ensure that the peptide obtained from either chemical or
biological synthetic techniques is the desired peptide, analysis of
the peptide composition should be conducted. Such amino acid
composition analysis may be conducted using high-resolution mass
spectrometry to determine the molecular weight of the peptide.
Alternatively, or additionally, the amino acid content of the
peptide can be confirmed by hydrolyzing the peptide in aqueous
acid, and separating, identifying and quantifying the components of
the mixture using HPLC, or an amino acid analyzer. Protein
sequenators, which sequentially degrade the peptide and identify
the amino acids in order, may also be used to determine definitely
the sequence of the peptide.
[0223] Prior to its use, the peptide is purified to remove
contaminants. In this regard, it will be appreciated that the
peptide will be purified to meet the standards set out by the
appropriate regulatory agencies. Any one of a number of a
conventional purification procedures may be used to attain the
required level of purity including, for example, reversed-phase
high-pressure liquid chromatography (HPLC) using an alkylated
silica column such as C4-, C8- or C18-silica. A gradient mobile
phase of increasing organic content is generally used to achieve
purification, for example, acetonitrile in an aqueous buffer,
usually containing a small amount of trifluoroacetic acid.
Ion-exchange chromatography can be also used to separate peptides
based on their charge.
[0224] It will be appreciated, of course, that the peptides or
antibodies, derivatives, or fragments thereof may incorporate amino
acid residues which are modified without affecting activity. For
example, the termini may be derivatized to include blocking groups,
i.e. chemical substituents suitable to protect and/or stabilize the
N- and C-termini from "undesirable degradation", a term meant to
encompass any type of enzymatic, chemical or biochemical breakdown
of the compound at its termini which is likely to affect the
function of the compound, i.e. sequential degradation of the
compound at a terminal end thereof.
[0225] Blocking groups include protecting groups conventionally
used in the art of peptide chemistry which will not adversely
affect the in vivo activities of the peptide. For example, suitable
N-terminal blocking groups can be introduced by alkylation or
acylation of the N-terminus. Examples of suitable N-terminal
blocking groups include C1-C5 branched or unbranched alkyl groups,
acyl groups such as formyl and acetyl groups, as well as
substituted forms thereof, such as the acetamidomethyl (Acm) group.
Desamino analogs of amino acids are also useful N-terminal blocking
groups, and can either be coupled to the N-terminus of the peptide
or used in place of the N-terminal reside. Suitable C-terminal
blocking groups, in which the carboxyl group of the C-terminus is
either incorporated or not, include esters, ketones or amides.
Ester or ketone-forming alkyl groups, particularly lower alkyl
groups such as methyl, ethyl and propyl, and amide-forming amino
groups such as primary amines (--NH2), and mono- and di-alkylamino
groups such as methylamino, ethylamino, dimethylamino,
diethylamino, methylethylamino and the like are examples of
C-terminal blocking groups. Descarboxylated amino acid analogues
such as agmatine are also useful C-terminal blocking groups and can
be either coupled to the peptide's C-terminal residue or used in
place of it. Further, it will be appreciated that the free amino
and carboxyl groups at the termini can be removed altogether from
the peptide to yield desamino and descarboxylated forms thereof
without effect on peptide activity.
[0226] Other modifications can also be incorporated without
adversely affecting the activity and these include, but are not
limited to, substitution of one or more of the amino acids in the
natural L-isomeric form with amino acids in the D-isomeric form.
Thus, the peptide may include one or more D-amino acid resides, or
may comprise amino acids which are all in the D-form. Retro-inverso
forms of peptides in accordance with the present invention are also
contemplated, for example, inverted peptides in which all amino
acids are substituted with D-amino acid forms.
[0227] Acid addition salts of the present invention are also
contemplated as functional equivalents. Thus, a peptide in
accordance with the present invention treated with an inorganic
acid such as hydrochloric, hydrobromic, sulfuric, nitric,
phosphoric, and the like, or an organic acid such as an acetic,
propionic, glycolic, pyruvic, oxalic, malic, malonic, succinic,
maleic, fumaric, tataric, citric, benzoic, cinnamie, mandelic,
methanesulfonic, ethanesulfonic, p-toluenesulfonic, salicyclic and
the like, to provide a water soluble salt of the peptide is
suitable for use in the invention.
[0228] The present disclosure also provides for analogs of
proteins. Analogs can differ from naturally occurring proteins or
peptides by conservative amino acid sequence differences or by
modifications which do not affect sequence, or by both.
For example, conservative amino acid changes may be made, which
although they alter the primary sequence of the protein or peptide,
do not normally alter its function. To that end, 10 or more
conservative amino acid changes typically have no effect on peptide
function. In accordance with one embodiment conservative amino acid
substitutions can include substitutions within the following
groups:
[0229] glycine, alanine;
[0230] valine, isoleucine, leucine;
[0231] aspartic acid, glutamic acid;
[0232] asparagine, glutamine;
[0233] serine, threonine;
[0234] lysine, arginine;
[0235] phenylalanine, tyrosine.
[0236] Modifications (which do not normally alter primary sequence)
include in vivo, or in vitro chemical derivatization of
polypeptides, e.g., acetylation, or carboxylation. Also included
are modifications of glycosylation, e.g., those made by modifying
the glycosylation patterns of a polypeptide during its synthesis
and processing or in further processing steps; e.g., by exposing
the polypeptide to enzymes which affect glycosylation, e.g.,
mammalian glycosylating or deglycosylating enzymes. Also embraced
are sequences which have phosphorylated amino acid residues, e.g.,
phosphotyrosine, phosphoserine, or phosphothreonine.
[0237] Also included are polypeptides or antibody fragments which
have been modified using ordinary molecular biological techniques
so as to improve their resistance to proteolytic degradation or to
optimize solubility properties or to render them more suitable as a
therapeutic agent. Analogs of such polypeptides include those
containing residues other than naturally occurring L-amino acids,
e.g., D-amino acids or non-naturally occurring synthetic amino
acids. The peptides of the invention are not limited to products of
any of the specific exemplary processes listed herein.
[0238] The skilled artisan will be aware that, in general, amino
acid substitutions in a peptide typically involve the replacement
of an amino acid with another amino acid of relatively similar
properties (i.e., conservative amino acid substitutions). The
properties of the various amino acids and effect of amino acid
substitution on protein structure and function have been the
subject of extensive study and knowledge in the art.
[0239] For example, one can make the following isosteric and/or
conservative amino acid changes in the parent polypeptide sequence
with the expectation that the resulting polypeptides would have a
similar or improved profile of the properties described above:
[0240] Substitution of alkyl-substituted hydrophobic amino acids:
including alanine, leucine, isoleucine, valine, norleucine,
S-2-aminobutyric acid, S-cyclohexylalanine or other simple
alpha-amino acids substituted by an aliphatic side chain from C1-10
carbons including branched, cyclic and straight chain alkyl,
alkenyl or alkynyl substitutions.
[0241] Substitution of aromatic-substituted hydrophobic amino
acids: including phenylalanine, tryptophan, tyrosine,
biphenylalanine, 1-naphthylalanine, 2-naphthylalanine,
2-benzothienylalanine, 3-benzothienylalanine, histidine, amino,
alkylamino, dialkylamino, aza, halogenated (fluoro, chloro, bromo,
or iodo) or alkoxy-substituted forms of the previous listed
aromatic amino acids, illustrative examples of which are: 2-,3- or
4-aminophenylalanine, 2-,3- or 4-chlorophenylalanine, 2-,3- or
4-methylphenylalanine, 2-,3- or 4-methoxyphenylalanine, 5-amino-,
5-chloro-, 5-methyl- or 5-methoxytryptophan, 2'-, 3'-, or
4'-amino-, 2'-, 3'-, or 4'-chloro-, 2,3, or 4-biphenylalanine,
2',-3',- or 4'-methyl-2, 3 or 4-biphenylalanine, and 2- or
3-pyridylalanine.
[0242] Substitution of amino acids containing basic functions:
including arginine, lysine, histidine, ornithine,
2,3-diaminopropionic acid, homoarginine, alkyl, alkenyl, or
aryl-substituted (from C1-C10 branched, linear, or cyclic)
derivatives of the previous amino acids, whether the substituent is
on the heteroatoms (such as the alpha nitrogen, or the distal
nitrogen or nitrogens, or on the alpha carbon, in the pro-R
position for example. Compounds that serve as illustrative examples
include: N-epsilon-isopropyl-lysine,
3-(4-tetrahydropyridyl)-glycine, 3-(4-tetrahydropyridyl)-alanine,
N,N-gamma, gamma'-diethyl-homoarginine. Included also are compounds
such as alpha methyl arginine, alpha methyl 2,3-diaminopropionic
acid, alpha methyl histidine, alpha methyl ornithine where alkyl
group occupies the pro-R position of the alpha carbon. Also
included are the amides formed from alkyl, aromatic, heteroaromatic
(where the heteroaromatic group has one or more nitrogens, oxygens,
or sulfur atoms singly or in combination) carboxylic acids or any
of the many well-known activated derivatives such as acid
chlorides, active esters, active azolides and related derivatives)
and lysine, ornithine, or 2,3-diaminopropionic acid.
[0243] Substitution of acidic amino acids: including aspartic acid,
glutamic acid, homoglutamic acid, tyrosine, alkyl, aryl, arylalkyl,
and heteroaryl sulfonamides of 2,4-diaminopriopionic acid,
ornithine or lysine and tetrazole-substituted alkyl amino
acids.
[0244] Substitution of side chain amide residues: including
asparagine, glutamine, and alkyl or aromatic substituted
derivatives of asparagine or glutamine.
[0245] Substitution of hydroxyl containing amino acids: including
serine, threonine, homoserine, 2,3-diaminopropionic acid, and alkyl
or aromatic substituted derivatives of serine or threonine. It is
also understood that the amino acids within each of the categories
listed above can be substituted for another of the same group.
[0246] For example, the hydropathic index of amino acids may be
considered (Kyte & Doolittle, 1982, J. Mol. Biol.,
157:105-132). The relative hydropathic character of the amino acid
contributes to the secondary structure of the resultant protein,
which in turn defines the interaction of the protein with other
molecules. Each amino acid has been assigned a hydropathic index on
the basis of its hydrophobicity and charge characteristics (Kyte
& Doolittle, 1982), these are: isoleucine (+4.5); valine
(+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine
(+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4);
threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine
(-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5);
glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine
(-3.9); and arginine (-4.5). In making conservative substitutions,
the use of amino acids whose hydropathic indices are within +/-2 is
preferred, within +/-1 are more preferred, and within +/-0.5 are
even more preferred.
[0247] Amino acid substitution may also take into account the
hydrophilicity of the amino acid residue (e.g., U.S. Pat. No.
4,554,101). Hydrophilicity values have been assigned to amino acid
residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0);
glutamate (+3.0); serine (+0.3); asparagine (+0.2); glutamine
(+0.2); glycine (0); threonine (-0.4); proline (-0.5.+-0.1);
alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine
(-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine
(-2.3); phenylalanine (-2.5); tryptophan (-3.4). Replacement of
amino acids with others of similar hydrophilicity is preferred.
[0248] Other considerations include the size of the amino acid side
chain. For example, it would generally not be preferred to replace
an amino acid with a compact side chain, such as glycine or serine,
with an amino acid with a bulky side chain, e.g., tryptophan or
tyrosine. The effect of various amino acid residues on protein
secondary structure is also a consideration. Through empirical
study, the effect of different amino acid residues on the tendency
of protein domains to adopt an alpha-helical, beta-sheet or reverse
turn secondary structure has been determined and is known in the
art (see, e.g., Chou & Fasman, 1974, Biochemistry, 13:222-245;
1978, Ann. Rev. Biochem., 47: 251-276; 1979, Biophys. J.,
26:367-384).
[0249] Based on such considerations and extensive empirical study,
tables of conservative amino acid substitutions have been
constructed and are known in the art. For example: arginine and
lysine; glutamate and aspartate; serine and threonine; glutamine
and asparagine; and valine, leucine and isoleucine. Alternatively:
Ala (A) leu, ile, val; Arg (R) gln, asn, lys; Asn (N) his, asp,
lys, arg, gln; Asp (D) asn, glu; Cys (C) ala, ser; Gln (Q) glu,
asn; Glu (E) gln, asp; Gly (G) ala; His (H) asn, gln, lys, arg; Ile
(I) val, met, ala, phe, leu; Leu (L) val, met, ala, phe, ile; Lys
(K) gln, asn, arg; Met (M) phe, ile, leu; Phe (F) leu, val, ile,
ala, tyr; Pro (P) ala; Ser (S), thr; Thr (T) ser; Trp (W) phe, tyr;
Tyr (Y) trp, phe, thr, ser; Val (V) ile, leu, met, phe, ala.
[0250] Other considerations for amino acid substitutions include
whether or not the residue is located in the interior of a protein
or is solvent exposed. For interior residues, conservative
substitutions would include: Asp and Asn; Ser and Thr; Ser and Ala;
Thr and Ala; Ala and Gly; Ile and Val; Val and Leu; Leu and Ile;
Leu and Met; Phe and Tyr; Tyr and Trp. (See, e.g., PROWL
Rockefeller University website). For solvent exposed residues,
conservative substitutions would include: Asp and Asn; Asp and Glu;
Glu and Gln; Glu and Ala; Gly and Asn; Ala and Pro; Ala and Gly;
Ala and Ser; Ala and Lys; Ser and Thr; Lys and Arg; Val and Leu;
Leu and Ile; Ile and Val; Phe and Tyr. Various matrices have been
constructed to assist in selection of amino acid substitutions,
such as the PAM250 scoring matrix, Dayhoff matrix, Grantham matrix,
McLachlan matrix, Doolittle matrix, Henikoff matrix, Miyata matrix,
Fitch matrix, Jones matrix, Rao matrix, Levin matrix and Risler
matrix (Idem.)
[0251] In determining amino acid substitutions, one may also
consider the existence of intermolecular or intramolecular bonds,
such as formation of ionic bonds (salt bridges) between positively
charged residues (e.g., His, Arg, Lys) and negatively charged
residues (e.g., Asp, Glu) or disulfide bonds between nearby
cysteine residues.
[0252] Methods of substituting any amino acid for any other amino
acid in an encoded peptide sequence are well known and a matter of
routine experimentation for the skilled artisan, for example by the
technique of site-directed mutagenesis or by synthesis and assembly
of oligonucleotides encoding an amino acid substitution and
splicing into an expression vector construct.
[0253] Substantially pure protein obtained as described herein may
be purified by following known procedures for protein purification,
wherein an immunological, enzymatic or other assay is used to
monitor purification at each stage in the procedure. Protein
purification methods are well known in the art, and are described,
for example in Deutscher et al. (ed., 1990, Guide to Protein
Purification, Harcourt Brace Jovanovich, San Diego).
[0254] The invention also includes a kit comprising the composition
of the invention and an instructional material which describes
administering the composition to a subject. In another embodiment,
this kit comprises a (preferably sterile) solvent suitable for
dissolving or suspending the composition of the invention prior to
administering the composition.
[0255] As used herein, the term "physiologically acceptable" ester
or salt means an ester or salt form of the active ingredient which
is compatible with any other ingredients of the pharmaceutical
composition, which is not deleterious to the subject to which the
composition is to be administered.
[0256] The formulations of the pharmaceutical compositions
described herein may be prepared by any method known or hereafter
developed in the art of pharmacology. In general, such preparatory
methods include the step of bringing the active ingredient into
association with a carrier or one or more other accessory
ingredients, and then, if necessary or desirable, shaping or
packaging the product into a desired single- or multi-dose
unit.
[0257] Although the descriptions of pharmaceutical compositions
provided herein are principally directed to pharmaceutical
compositions which are suitable for ethical administration to
humans, it will be understood by the skilled artisan that such
compositions are generally suitable for administration to animals
of all sorts. Modification of pharmaceutical compositions suitable
for administration to humans in order to render the compositions
suitable for administration to various animals is well understood,
and the ordinarily skilled veterinary pharmacologist can design and
perform such modification with merely ordinary, if any,
experimentation. Subjects to which administration of the
pharmaceutical compositions of the invention is contemplated
include, but are not limited to, humans and other primates, mammals
including commercially relevant mammals such as cattle, pigs,
horses, sheep, cats, and dogs, and to birds including commercially
relevant birds such as chickens, ducks, geese, and turkeys.
[0258] Pharmaceutical compositions that are useful in the methods
of the invention may be prepared, packaged, or sold in formulations
suitable for oral, rectal, vaginal, parenteral, intravenous,
topical, pulmonary, intranasal, buccal, ophthalmic, intrathecal or
another route of administration. Other contemplated formulations
include projected nanoparticles, liposomal preparations, resealed
erythrocytes containing the active ingredient, and
immunologically-based formulations.
[0259] A pharmaceutical composition of the invention may be
prepared, packaged, or sold in bulk, as a single unit dose, or as a
plurality of single unit doses. As used herein, a "unit dose" is
discrete amount of the pharmaceutical composition comprising a
predetermined amount of the active ingredient. The amount of the
active ingredient is generally equal to the dosage of the active
ingredient which would be administered to a subject or a convenient
fraction of such a dosage such as, for example, one-half or
one-third of such a dosage.
[0260] The relative amounts of the active ingredient, the
pharmaceutically acceptable carrier, and any additional ingredients
in a pharmaceutical composition of the invention will vary,
depending upon the identity, size, and condition of the subject
treated and further depending upon the route by which the
composition is to be administered. By way of example, the
composition may comprise between 0.1% and 100% (w/w) active
ingredient.
[0261] In addition to the active ingredient, a pharmaceutical
composition of the invention may further comprise one or more
additional pharmaceutically active agents. Particularly
contemplated additional agents include anti-emetics and scavengers
such as cyanide and cyanate scavengers.
[0262] Controlled- or sustained-release formulations of a
pharmaceutical composition of the invention may be made using
conventional technology.
[0263] Formulations suitable for topical administration include,
but are not limited to, liquid or semi liquid preparations such as
liniments, lotions, oil in water or water in oil emulsions such as
creams, ointments or pastes, and solutions or suspensions.
Topically-administrable formulations may, for example, comprise
from about 1% to about 10% (w/w) active ingredient, although the
concentration of the active ingredient may be as high as the
solubility limit of the active ingredient in the solvent.
Formulations for topical administration may further comprise one or
more of the additional ingredients described herein.
[0264] A pharmaceutical composition of the invention may be
prepared, packaged, or sold in a formulation suitable for
ophthalmic administration. Such formulations may, for example, be
in the form of eye drops including, for example, a 0.1 1.0% (w/w)
solution or suspension of the active ingredient in an aqueous or
oily liquid carrier. Such drops may further comprise buffering
agents, salts, or one or more other of the additional ingredients
described herein. Other opthalmically-administrable formulations
which are useful include those which comprise the active ingredient
in microcrystalline form or in a liposomal preparation.
[0265] As used herein, "additional ingredients" include, but are
not limited to, one or more of the following: excipients; surface
active agents; dispersing agents; inert diluents; granulating and
disintegrating agents; binding agents; lubricating agents;
sweetening agents; flavoring agents; coloring agents;
preservatives; physiologically degradable compositions such as
gelatin; aqueous vehicles and solvents; oily vehicles and solvents;
suspending agents; dispersing or wetting agents; emulsifying
agents, demulcents; buffers; salts; thickening agents; fillers;
emulsifying agents; antioxidants; antibiotics; antifungal agents;
stabilizing agents; and pharmaceutically acceptable polymeric or
hydrophobic materials. Other "additional ingredients" which may be
included in the pharmaceutical compositions of the invention are
known in the art and described, for example in Genaro, ed., 1985,
Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton,
Pa., which is incorporated herein by reference. Typically, dosages
of the compound of the invention which may be administered to a
subject, preferably a human, range in amount from 1 .mu.g to about
100 g per kilogram of body weight of the subject. While the precise
dosage administered will vary depending upon any number of factors,
including but not limited to, the type of subject and type of
disease state being treated, the age of the subject and the route
of administration.
[0266] The invention further provides for identifying a subject
with dry eye. For example, proteins or peptides found in tears can
be detected using various methods, included, but not limited to,
ELISA, immunoassay, immunofluorescence, immunohistochemistry,
immunoprecipitation, and western blot,
[0267] In one embodiment a kit is provided comprising the
composition of the invention and an instructional material which
describes administering the composition to a cell or a tissue of a
subject. In another embodiment, this kit comprises a (preferably
sterile) solvent suitable for dissolving or suspending the
composition of the invention prior to administering the compound to
the subject. As used herein, an "instructional material" includes a
publication, a recording, a diagram, or any other medium of
expression which can be used to communicate the usefulness of the
peptide of the invention in the kit for effecting alleviation of
the various diseases or disorders recited herein. In one embodiment
the kit provides standard curves providing information regarding
the concentration of various peptides in a normal healthy eye.
Optionally, or alternately, the instructional material may describe
one or more methods of alleviation the diseases or disorders in a
cell or a tissue of a subject. The instructional material of the
kit of the invention may, for example, be affixed to a container
which contains the peptide of the invention or be shipped together
with a container which contains the peptide. Alternatively, the
instructional material may be shipped separately from the container
with the intention that the instructional material and the compound
be used cooperatively by the recipient.
Example 1
Identification of Dry Eye Disease
[0268] Procedures
[0269] Cell Culture, Constructs, and Antibodies
[0270] Human corneal epithelial (HCE-T) cells were purchased from
the RIKEN BioResource Center (Tsukuba-shi, Japan) and used between
passages 3 and 15. HCE-T cells were cultured and maintained in
DMEM/F-12 containing 4 mg/ml insulin, 100 .mu.g/ml EGF, 500
.mu.g/ml cholera toxin, and 5 .mu.l/ml DMSO. Primary human corneal
epithelial cells (PCS-700-010) were purchased from ATCC (Manassas,
Va.) and expanded in the suggested medium.
[0271] N-terminal deletions of 45, 65, and 71 amino acids and point
mutants V69S, I73S, I98S, F104S, L108S, L109S, F112S, I68S/I73S,
V91S/L109S, and L108S/L109S/F112S were developed from pLAC. An
constructs were confirmed by DNA sequencing. Lacritin and deletion
or point mutants, including deletion mutant "C-25", were generated
in Escherichia coli and purified as described previously (Wang et
al, (2006) J. Cell Biol. 174, 689-700)) with additional
purification over DEAE in PBS in which lacritin is collected in the
flow-through. Purified lacritin was filter-sterilized and stored
lyophilized
[0272] Polyclonal N and C terminus-specific anti-lacritin
antibodies were respectively generated in New Zealand White rabbits
against keyhole limpet hemocyanin-conjugated EDASSDSTGADPAQEAGTS
("Pep Lac N-Term") as "anti-Pep Lac N-term" and against lacritin
deletion mutant N-65 as "anti-N-65 Lac C-term" (Bio-Synthesis Inc.,
Lewisville, Tex.) and characterized. Monoclonal N terminus-specific
anti-lacritin antibodies were generated (University of Virginia
Lymphocyte Culture Center) in mice against keyhole limpet
hemocyanin-conjugated DPAQEAGTSKPNEEIS and screened through three
rounds of cloning against the lacritin deletion mutant C-59 as
1F5-C9-F4 ("1F5"; IgG1).
[0273] Tears and Viability Analyses
[0274] Tears were collected from 0.5% proparacaine-anesthetized
eyes from a total of normal or dry eye individuals by insertion of
a filter wicking "Schirmer" strip with millimeter gradations
between the lid and eye and individually stored at -70.degree. C.
Prior to elution, the total normal or dry eye tear volume was
estimated from millimeters of tears drawn into each strip. This
defined the final volume of PBS respectively used for elution.
Pooled normal or pooled dry eye tears were stored at -70.degree. C.
until use.
[0275] For FOXO3 translocation assays, HCE-T cells were grown in
triplicate to subconfluence (.about.50%) on coverslips in
.alpha.-MEM (5.54 mm glucose), sensitized overnight in IFNG (100
units/ml; Roche Applied Science), and treated for 15 min with
normal or dry eye tears diluted 1:100 in .alpha.-MEM together with
TNF (50 ng/ml; PeproTech, Rocky Hill, N.J.) without or with 10 nm
lacritin or C-25. Cells were washed, fixed with 4%
paraformaldehyde, and immunostained for FOXO3 (1:200; Millipore,
Billerica, Mass.) followed by goat anti-rabbit secondary antibody
and visualization on a Zeiss LSM 700 microscope.
[0276] Some experiments were performed with normal tears that had
been immunodepleted of lacritin. For immunodepletion, rabbit
anti-Pep Lac N-term and anti-N-65 Lac C-term were jointly
immobilized on protein A beads and washed. A rabbit preimmune
column was similarly prepared for mock-depleted tears. The
flow-through from overnight incubation of each with normal tears
was collected and assayed in triplicate on IFNG-sensitized cells
with TNF as described above. For validation, the acid eluant from
each column was separated by SDS-PAGE, transferred to
nitrocellulose, and blotted for lacritin using mouse anti-lacritin
antibody 1F5 and a mouse-specific, peroxidase-labeled secondary
antibody followed by chemiluminescence detection.
[0277] Viability was monitored using the
3-(4,5-dimethyl-2-yl)-2,5-diphenyltetrazolium bromide) (MTT)
reduction assay (Invitrogen) or a Nucleocounter (New Brunswick
Scientific, Edison, N.J.). Cells were seeded overnight in 24-well
plates at a density of 500 cells/mm2 to give rise to .about.80%
confluence the next day. Then cells were sensitized overnight in
IFNG (100 units/ml) in .alpha.-MEM and treated in triplicate for 15
min with 10 nm lacritin or lacritin deletion or point mutants or
with different lacritin doses in .alpha.-MEM together with TNF as
described above.
[0278] Inclusion of inhibitors was simultaneous with the addition
of lacritin or C-25 in all viability and other experiments except
where otherwise noted. Inhibitors included PI103 (0.5 .mu.m; EMD,
Darmstadt, Germany), rapamycin (10 and 100 nm; EMD), and
cyclosporin A (0.1 .mu.m; EMD). One exception was
4-methylumbelliferyl-.beta.-d-xylopyranoside ("xyloside"; 70 and 80
nm; Sigma), which was added during IFNG sensitization and during
treatment with TNF and lacritin. The assay was completed by
addition of MTT (5 mg/ml) to each well (at 37.degree. C. for 4 h)
followed by isopropanol with 0.04 n HCl and measurement at 570 nm
using a reference wavelength of 630 nm. Viability was assayed in a
Nucleocounter (New Brunswick Scientific).
[0279] Results
[0280] Tears accumulate on the avascular corneal epithelium, and
vascularized conjunctiva, as a translucent film rich in proteins,
lipids and metabolites. Beyond its capacity to lubricate the lid,
tears are essential for the refraction of light. Equally important
and irreplaceable by drugs or drops is the role of tears in
promoting corneal epithelial health. When tears are chronically
insufficient the epithelium becomes stressed and releases
inflammatory cytokines that further exacerbate the situation. Dry
eye affects 5-6% of the general population, rising to 6-9.8% and as
high as 34%, respectively in postmenopausal women and the elderly.
Although the most common eye disease, there is no single gold
standard diagnostic test, nor effective treatment. Current
approaches include: a) subject questionnaires, b) rose bengal or
lissamine green staining of ocular surface damage, c) Schirmer
strip measurement of tear volume, d) tear break up time, e) tear
evaporation rate, f) tear meniscus height or radius, g) tear film
index or turnover rate, h) tear osmolarity, i) lysozyme or
lactoferrin assay, and j) tear ferning analysis, each of which have
numerous shortcomings.
[0281] The tear proteome is estimated to comprise 1,543 proteins,
with over half designated as `intracellular` by Gene Ontology,
implying that cell death from normal epithelial renewal may be a
contributor. The only growth factor-like molecule downregulated in
mild to severe aqueous deficiency was lacritin. Comparison of tears
from 73 normals to 129 individuals suffering from aqueous deficient
dry eye by 2-D SDS PAGE revealed lacritin to be downregulated in
95% of aqueous deficient dry eye. Lacritin promotes basal tearing
when added topically in rabbits. Another tear protein found to be
downregulated in dray eye was lipocalin-1. Lipocalin-1 cleanses the
ocular surface of lipids that would otherwise interfere with ocular
surface wetting. Lacritin was the most severely downregulated
protein in contact lens-related dry eye--perhaps in part because it
is readily adsorbed on contact lenses. It is also deficient in
blepharitis, a common inflammation of the eyelid, associated with
evaporative dry eye. However, 2-D SDS PAGE prior to mass
spectrometry is necessary to distinguish lacritin downregulation, a
method not practical for clinical use.
[0282] Several molecules are necessary for lacritin activity. An
unusual deglycanated form of syndecan-1 (SDC1) was discovered to be
the main cell surface binding protein for lacritin by mass
spectrometric sequencing of cell surface proteins bound to lacritin
columns at physiological salt. Validation was by affinity
precipitation. SDC1 is a widely expressed cell surface heparan
sulfate proteoglycan with a carboxy terminal end anchored in the
plasma membrane with short cytoplasmic tail, and an ectodomain
substituted proximally with chondroitin sulfate chain(s) at serines
184 and 194 (human SDC1; numbering excludes the signal peptide),
and distally with up to three heparan sulfate chains (serines 15,
23, 25)--without or with a short chondroitin sulfate chain.
Lacritin's C-terminal .alpha.-helix binds a domain within SDC1
amino acids 1-50, with binding dependent on prior heparanase
deglycanation of heparan sulfate. SiRNA knockdown of SDC1 abrogates
lacritin dependent mitogenic activity, as does depletion of
heparanase (but not heparanase-2), but can be rescued by addition
of exogenous heparanase or with bacterial heparitinase. The binding
domain has been narrowed to hydrophobic amino acids 20-30 that
enhances lacritin C-terminal .alpha.-helicity. Binding was also
dependent on substitution of S23 and S25 (and possibly S15) with
both heparan sulfate and chondroitin sulfate as a novel hybrid
domain of hydrophobic core protein, heparanase cleaved heparan
sulfate and adjacent chondroitin sulfate. Heparanase is not widely
expressed. N-terminal substitution of SDC1 with chondroitin sulfate
is uncommon.
[0283] We looked for SDC1 in tears using a highly sensitive
chemoluminescent approach. Tears were collected onto Schirmer
strips from 146 individuals who were then subjected to vision
corrective photorefractive keratectomy or LASIK surgery, with
further tear collection 1 day, 1 week, and 1 month later. Tears
were stored at -70.degree. C., eluted with a tear equivalent volume
of PBS, pooled by time and whether normal (.gtoreq.15 mm) vs dry
eye (.ltoreq.5 mm) tears, and then separated by SDS-PAGE. Separated
tear proteins were transferred to nitrocellulose and blotted with
anti-SDC1 mab A-38B. Secondary abs were precleared over a tear
column, and ab C-term was precleared over C-59 lacritin truncation
mutant. Normal tears were unexpectedly enriched in the rare,
heparanase deglycanated form of SDC1 (FIG. 1) targeted by lacritin.
Little of the deglycanated form of SDC1 was apparent in dry eye
tears. Deglycanated SDC1 can vary in molecular weight from
.about.90 (FIG. 1) to .about.80 kDa or even .about.60
kDa--dependent on the level of O-glycosylation that can vary among
different epithelia. One day after photorefractive keratectomy or
LASIK surgery tear .about.90 kDa SDC1 was indistinguishable between
normal and dry eye--in keeping with surgery-induced dry eye. A new
.about.25 kDa SDC1 fragment became apparent in those originally
designated as dry eye (FIG. 1). Deglycanated SDC1 and tearing was
restored in normal individuals 1 week and 1 month later. However,
the dry eye--associated .about.25 kDa band remained (FIG. 1)
throughout the assayed timeframe. Thus, .about.90 kDa syndecan in
tears is a marker of normalcy. Those lacking .about.90 kDa syndecan
have dry eye. Further, the .about.25 kDa form distinguishes dry eye
individuals who underwent PRK or LASIK.
[0284] Blotting for the inactive lacritin-c splice variant in tears
also proved to be indicative of dry eye (FIG. 2A). Lacritin-c lacks
sequence from exons 4 and 5 encoding the C-terminus and has an
additional sequence not present in native lacritin. Instead, an
inactive novel C-terminus from intron 3 is spliced in. We further
discovered differences in tear heparanase with more latent
heparanase in normal tears (with the exception of one day after
photorefractive keratectomy or LASIK surgery; FIG. 3), whereas
active heparanase was abundant in dry eye tears. Secretion of
heparanase that has been processed from its latent 65 kDa to active
58 kDa heterodimeric forms is stimulated by UTP. UTP is a proposed
treatment for dry eye via a mechanism thought to involve the
production of mucins. These observations suggest a potential
linkage between lacritin, UTP and heparanase in ocular surface
physiology.
[0285] Taken together, aqueous deficient dry eye tears are
associated with dramatically less deglycanated SDC1 and latent
heparanase, but substantially more SDC1 fragment and chronically
active heparanase, as well as inactive lacritin-c splice variant at
the expense of normal active lacritin. These conditions are
appropriate for the exacerbation or initiation of dry eye that can
be reversed by topically restoring lacritin.
Identification-Specific Treatment of Dry Eye Disease
[0286] Commonly used `artificial tears` temporarily alleviate
symptoms associated with dry eye without addressing the cause of
those symptoms. An ophthalmic formulation of the anti-inflammatory
agent cyclosporine is now in wide use. It and other
anti-inflammatory agents are in clinical trials, but generally
benefit only .about.15% of dry eye subjects. Rather than focusing
on inflammatory sequelae, or applying drugs developed for other
organ systems, there is benefit in considering the natural biology
of the ocular surface and what is missing in dry eye.
Downregulation of lacritin monomer, a natural tear protein that
promotes basal tearing when added topically to normal rabbit eyes,
may be an upstream instigator of dry eye disease. Why is there less
lacritin monomer in dry eye? Lacritin monomer is cross-linked into
inactive multimers by tissue transglutaminase (TGM2) in tears. This
was demonstrated by immunodepleting all lacritin monomer, multimer
and fragment from human tears. Recombinant lacritin spiked into
immunodepleted tears formed dimers, trimers and tetramers after
overnight incubation at 37.degree. C. In the negative control
without tears, a small amount of dimer formed. Crosslinking
involves glutamine 106 within the lacritin mitogenic domain (amino
acids 100-109) that targets syndecan-1. Cross-linked lacritin binds
syndecan-1 substantially less and is less active (FIG. 5; right two
bars). Blotting suggests that normal human tears contain 0.6 .mu.M
TGM2, that thus appears to act as a negative regulator of monomeric
lacritin. Human corneal epithelial cells express both TGM1 and TGM2
mRNA's. mRNA expression of both increases with hyperosmolar stress,
particularly TGM1, however TGM1 has not been detected in tears.
Thus, lacritin may be subjected to enhanced cross-linking and
deactivation in dry eye.
[0287] To define the lacritin domain necessary for regulation of
homeostasis, truncation and point mutants were generated.
Inactivity of the C-25 truncation mutant defined a cytoprotective
domain in the C-terminus of lacritin that was previously shown to
be .alpha.-helical and likely amphipathic, and accordingly ordered.
The hydrophobic face of amphipathic .alpha.-helices can mediate
high affinity agonist--receptor or co-receptor interactions. To
assay this possibility, hydrophobic residues were singly, doubly,
or triply mutated. Also generated were truncations, and the
C-terminus (`I3`) of the lacritin-c splice variant with completely
different sequence from wild type. Amino acid numbering throughout
is of mature protein without signal peptide. Hydrophobic face
mutants I98S, F104S, L108S/L109S/F112S, and F112S were
significantly less active (Wang et al, '13). Activity was
unaffected by mutations L65S, I68S/I78S, V69S, and I73S in an
adjacent .alpha.-helix. Deleting 45, 65 or 71 N-terminal amino
acids had no effect, and I3 was inactive. L108, L109 and F112
interact with the syndecan-1 core protein sequence GAGAL.
[0288] Basal tears from normal individuals and from those diagnosed
with dry eye were incubated with human corneal epithelial cells
stressed with the inflammatory cytokines interferon-.gamma. (INFG)
and tumor necrosis factor (TNF)--much like their in vivo dry eye
counterparts. Nuclear--cytoplasmic translocation of the corneal
transcription factor FOXO3 served as a simple readout for cellular
stress, with cytoplasmic FOXO3 indicative of restored homeostasis.
Nuclear FOXO3 largely transcribes for cell stress or death. In
stressed cells treated with normal tears, FOXO3 translocated to the
cytoplasm). However with dry eye tears, FOXO3 remained nuclear.
Next, lacritin was immunodepleted from normal tears, although
normal tears have other growth factors that might compensate. Also
dry eye tears were spiked with lacritin. Dry eye tears are both
hyperosmolar and inflammatory cytokine-rich. Mock-depleted tears
translocated FOXO3 to the cytoplasm, whereas FOXO3 remained nuclear
in cells treated with lacritin depleted tears. Dry eye tears spiked
with lacritin, but not those spiked with lacritin truncation mutant
C-25 (lacking C-terminal 25 amino acids), translocated FOXO3 to the
cytoplasm. Lacritin, but not C-25, also translocated FOXO3 in
INFG/TNF stressed primary human corneal epithelial cells. Thus,
lacritin is the master protector of normal tears.
[0289] This test was repeated using a bioactive C-terminal fragment
of lacritin (LACRIPEP; SEQ ID NO: 7). Cultured human corneal
epithelial cells were treated with inflammatory cytokines to induce
stress as described above, and cells were treated with 10 nM of an
inactive lacritin truncation mutant (C-25), lacritin or LACRIPEP.
Measurements of cytoplasmic staining in the FOXO3 assay (wherein
nuclear FOXO3 staining is indicative of cell death) reveal LACRIPEP
is equally active as lacritin (See FIG. 4A) in enhancing cell
survival relative to the negative control (C-25). Accordingly,
applicants anticipate that LACRIPEP can substitute for lacritin for
all applications.
[0290] Autoimmune regulator (Aire)-deficient [Aire.sup.-/-] mice
spontaneously develop dry eye without need for dry chambers or
scopolamine Aire.sup.-/- mice were dosed three times daily for
three weeks with 10 .mu.l of 50 .mu.g/ml lacritin, or in controls
with PBS. Several different assays monitored the consequences. A
bioactive fragment of lacritin, LACRIPEP (SEQ ID NO: 7), prevents
loss of tearing as dry eye disease develops in Aire(-/-) dry eye
mice (FIG. 4B; closed circles) relative to topically administered
PBS (opened circles), and reduced inflammation of the lacrimal
gland. Topical lacritin reduced CD4+T cell infiltration into
lacrimal glands measured as the number of lymphocytic foci/per
millimeter square area of lacrimal gland tissue (3.68.+-.0.65 per
mm sq lacritin vs. 9.7+1.5 per mm sq PBS; P=0.01), but had no
apparent effect on the pattern or distribution of CD4+T cells into
either the corneal stroma (14.6.+-.1.6 lacritin vs 12.4.+-.2.1 PBS)
or the limbus (29.6.+-.2.5 lacritin vs 34.6.+-.2.9 PBS.
[0291] To assess ocular surface mucosal damage from dry eye, eyes
of Aire(-/-) dry eye mice were topically administered lissamine
green that increasingly stained PBS-treated eyes with time (See
FIG. 4C). In contrast, topical lacritin significantly decreased
staining (-0.417.+-.0.06 lacritin vs 0.125.+-.0.07 PBS; p=0.02.
Further, lacritin diminished levels of keratin 10 (skin epidermal
marker), indicating a capacity to block corneal keratinization
associated with chronic inflammation, whereas keratin 12)
expression (corneal marker) remained stable (80.1.+-.4.8% lacritin
vs 85.6.+-.1.8%; P>0.10). In addition, Aire(-/-) dry eye mice
administered LACRIPEP were also found to have less corneal
staining, which is an indicator of cell death, as dry eye disease
develops (FIG. 4C; closed circles) relative to PBS (opened
circles). Thus, topical lacritin, and its bioactive fragments
thereof, diminished lacrimal gland inflammation and corneal
staining in dry eye, and promoted ocular surface differentiation.
Importantly, suppression of inflammation and promotion of tearing
was achieved without direct contact with inflammatory cells nor
with tear producing cells.
[0292] Topical lacritin stimulates tearing even without physical
access to lacrimal acinar cells. The rapidity of the response is in
keeping with corneal sensory nerve activation. Individual corneal
sensory nerve activity was monitored at the level of the trigeminal
ganglion in rats via previously described methods. Emerging from
these studies was the observation that topical lacritin is neural
stimulatory. Topical lacritin enhanced the neural `dry response`,
and to a lesser extent the neural `wet response`. The `dry
response` refers to neural activation as a consequence of drying of
the cornea, which is thought to be a critical TRPM8-mediated
stimulus for tearing, while the `wet response` occurs when the
agonist is present at the corneal nerve terminals. Neither of these
responses was affected by negative control truncation mutant C-25,
supporting the importance of the C-terminal .alpha.-helix in both
neural stimulation and tearing. It is likely that the enhanced dry
response by lacritin, is due to a modulation of TRPM8 channels:
ranging from a fully inhibited TRPM8 state during wet cornea (with
lacritin on board) by adrenergic .alpha..sub.2A and/or
.alpha..sub.2C receptors to a completely disinhibited (activated)
state during dry cornea (with lacritin removed). Apparent
inhibition of the action potentials by lacritin during wet cornea
was small because the TRPM8 activity during wet cornea is low to
begin with, while it reaches optimal level during dry cornea when
dynamic cooling of the ocular surface is taking place. Lacritin may
also increase TRPM8 neural density.
[0293] Stimulation of the dry response could be by indirect or
direct mechanisms. Lacritin stimulation of the corneal epithelium
could indirectly target sensory neurons via junctional-like
complexes between the two cell types. However, these are thought to
be rare. Arguing against a direct mechanism are epithelial tight
junctions that would impede lacritin access to nerve endings.
However Ca.sup.2+ and some growth factors can loosen tight
junctions. PDGF permeabilizes tight junctions between cultured
kidney cells within minutes, as does VEGF of endothelial tight
junctions, whereas chronic permeabilization of surface cells of the
stratified corneal epithelium is observed in MMP9- or inflammatory
cytokine-linked inflammation and in bacterial infection from
endotoxin challenge. Lacritin dependent Ca.sup.2+ mobilization may
be sufficient to promote rapid and acute permeabilization for
neural access. We expect that a two-step process is involved.
First, lacritin or lacritin peptide targeting of superficial
corneal epithelial cells promotes subtle loosening of tight
junctions, perhaps by transiently increased trafficking of occludin
into early endosomes, or by lacritin dependent calcium signaling of
the corneal epithelium since calcium regulates tight junction
permeability. We expect that the process is activated within 1 min,
as per lacritin-stimulated calcium signaling within 20 sec, and
lacritin stimulated autophagy by 1 min. In this manner, lacritin or
peptide gains entry. Subsequent neural stimulation may be
sufficient to trigger reclosure of tight junctions, as per the
importance of neural stimulation in corneal wound healing.
[0294] Syndecan-1 is a cell surface heparan sulfate proteoglycan
that mediates lacritin targeting of cells, but only after
heparanase (Ma et al, '06) has exposed GAGAL nestled among heparan
sulfate chains. Heparanase also generates heparan sulfate stubs
that appear to be required for lacritin binding, suggesting a
hybrid GAGAL/heparan sulfate-binding site. To assess the role of
this interaction, cells were cultured overnight in
4-methylumbelliferyl-b-D-xylopyranoside (`xyloside`) to
competitively suppress heparan and chondroitin sulfate assembly.
Xyloside completely abrogated lacritin cytoprotective activity.
Thus, these activities are dependent on a region in its C-terminus
that includes the syndecan-1 binding domain. Further lacritin
activities appear to be entirely embodied within the sequences
KQFIENGSEFAQKLLKKFS (`N-94/C-6`; SEQ ID NO: 5) (Wang et al., 2006)
or KQFIENGSEFAQKLLKKFSLLKPWA (`N-94`; SEQ ID NO: 7) (Zhang et al.,
2013) that when generated synthetically is as potent as
lacritin.
[0295] Lacritin targeting of corneal sensory neurons. Adrenergic
.alpha..sub.2C selective antagonist MK912 inhibits lacritin
accelerated autophagy in HCE-T cells, as does the syndecan-1
inhibitor xyloside. Both also inhibit lacritin stimulated FOXO3
phosphorylation. Activity profiles of corneal neurons before,
during and 1 hr during/after 10 .mu.M lacritin reveal a small
inhibition (from .about.12 to .about.8 spikes/s) follows
immediately after the application of lacritin presumably due to
.alpha..sub.2 adrenergic receptor activation which inhibits TRPM8
channels. Removal of this inhibition after 1 hr of lacritin and
washout causes an enhanced excitation of dry (from .about.20 to
.about.23 spikes/s) and wet response (from .about.12 to .about.16
spikes/s).
Example 2
[0296] The monomeric form of tear lacritin is a multifunctional
factor responsible for alleviating ocular surface stress. It is
also an agonist for basal tearing. Monomeric lacritin targets a
heparanase (HPSE) deglycanated form of cell surface syndecan-1
(SDC1). However, polymerized lacritin and the lacritin-C splice
variant are both unable to target SDC1 and are therefore inactive.
We investigated whether either SDC1 or HPSE might displace
monomeric lacritin in dry eye tears, and if SDC1 or HPSE may be
inadequate.
[0297] Methods:
[0298] Tears were collected onto Schirmer strips from 146
individuals before, and 1 day, 1 week and 1 month after
photorefractive keratectomy. Tears were stored at -70.degree. C.,
and later eluted with a tear equivalent volume of PBS, and pooled
by time and normal (.gtoreq.15 mm) vs dry eye (.ltoreq.5 mm) tears.
Tears were separated by SDS-PAGE and blotted with anti-N-terminal
specific lacritin mab 1F5, anti-C-terminal specific lacritin ab `ab
C-term`, anti-lacritin-C splice variant mab 4G6, anti-SDC1 mab
A-38B, and with anti-heparanase abs #733 and #1453. Secondary abs
were precleared over a tear column, and ab C-term was precleared
over C-59 lacritin truncation mutant.
[0299] Results:
[0300] Ab C-term detected less lacritin monomer in dry eye vs
normal tears, a deficiency apparently compensated in dry eye by
enhanced lacritin-C splice variant. The 1F5 mab epitope is shared
by both forms, and thus the presumed hybrid band appeared greater
in dry eye. Normal tears were enriched in latent (uncleaved) HPSE
and deglycanated SDC1. One day after PRK, lacritin-C was further
increased in dry eye, and both SDC1 and HPSE less in normals.
Return to pre-PRK conditions was apparent by 1 month.
[0301] Conclusions:
[0302] Aqueous deficient dry eye tears are associated with
decreased lacritin monomer, increased lacritin-C splice variant,
and less deglycanated SDC1 and latent HPSE. These conditions are
appropriate for the exacerbation or initiation of dry eye.
Example 3
Stability of the 25 Amino Acid C-Terminal Fragment of Lacritin
[0303] A limitation of most synthetic peptide drugs is their
protease sensitivity. Only HIV protease retropepsin and cathepsin K
appear capable of cleaving LACRIPEP according to PROSPER (Protease
specificity prediction server) analysis, with the former cutting in
the middle and the latter removing the last alanine. Retropepsin
would inactivate LACRIPEP, while cathepsin K would have no effect.
However neither protease is found in normal human tears.
Nonetheless, tears are rich in other proteases. We therefore
incubated LACRIPEP in normal human tears at 37.degree. C. for 2, 4,
6 and 16 hr. For immunoblotting, we first removed all endogenous
lacritin by immunodepletion. Remarkably, LACRIPEP was stable for at
least 16 hr as indicated in FIG. 6A, representing immunoblots of a
protease sensitive positive control `SN pep` from a different
protein and LACRIPEP (`N-94`) after incubation in lacritin-depleted
human tears for 2-16 hr at 37.degree. C. Mass spectrometric
analysis of the SN pep, Lacripep (`N-94`), and Lacripep without six
C-terminal amino acids (`N-94/C-6`) demonstrated the relative
stability of the three peptides after incubation in lacritin
depleted tears for 4 hr at 37.degree. C. (FIG. 6B). Surprisingly,
the smaller C-terminal fragment of lacritin (N-94/C-6; SEQ ID NO:
5) was found to be not as stable as the LACRIPEP peptide (SEQ ID
NO: 7). Although mass spec analysis suggests that Lacripep
(`N-94`), and Lacripep without six C-terminal amino acids
(`N-94/C-6`) have similar stability in tears, and Lacripep without
six C-terminal amino acids (`N-94/C-6`) was stable in phosphate
buffered saline for 29 days at 62.degree. C. (FIG. 6B),
immunoblotting reveals that N-94/C-6 loses epitopes after
incubation in lacritin depleted tears for 4 hr at 37.degree. C.
whereas Lacripep (`N-94`) does not. Accordingly, the final 6 amino
acids of native lacritin have relevance in enhancing the stability
of bioactive fragments of lacritin making N-94 a superior
pharmaceutical peptide relative to N-94/C-6.
[0304] Another advantage of LACRIPEP is its low dose optimum. In
human cell culture its optimal dose is 1-10 nM. In animal studies,
.about.4 .mu.M (0.0012%) is optimum (FIGS. 7A & 7B). 4 .mu.M
LACRIPEP has also been found to be bactericidal, but not hemolytic.
Lacritin as a whole protein does not have bactericidal
activity.
[0305] To monitor LACRIPEP in whole body toxicity studies, LACRIPEP
was synthesized with a single C-terminal tyrosine for iodination to
form .sup.125I-Lacripep-Y. Rats administered a single 4 .mu.M dose
of .sup.125I-Lacripep-Y demonstrated high retention in eye tears
with minimal levels detected in the blood and serum (see FIG.
8).
Example 4
A Cleavage-Potentiated Fragment of Tear Lacritin is
Bactericidal
[0306] Experimental Procedures
[0307] Tears and Tear Immunodepletion--Normal human basal tears
were collected.
[0308] Briefly, tears from 0.5% proparacaine anesthetized eyes were
collected onto preweighed wicks and flash-frozen for "70.degree. C.
storage. Tears were eluted by immersion of each strip in 30 #1 of
PBS for 20 min, followed by centrifugation. For immunodepletion,
10-fold diluted tears were incubated overnight (4.degree. C.) or
for 1 h at room temperature with protein A beads (0.2 ml, NAb Spin
Kit, Peirce/Thermo Scientific) saturated with "anti-N-65 Lac
C-term" or preimmune Ig. N-65 is a lacritin truncation mutant
lacking 65 N-terminal amino acids. The tear flow-through after
centrifugation (5000 # g for 1 min) was then assayed for
antibacterial activity.
[0309] Lacritin Constructs, Purification, Synthetic Peptides, and
Mass Spectrometry--Lacritin N-terminal truncations N-55, N-65,
N-71, and N-75 were generated by PCR from parent cDNA pLAC, as
described previously (Zhang et al, (2013) J. Biol. Chem. 288,
12090-12101). N-terminal deletions of 80 (N-80) and 86 (N-86) amino
acids were generated using forward primers
GGTGGTCATATGAAAGCAGGAAAAGGAATGCACGG (SEQ ID NO: 9) and
GGTGGTCATATGCACGGAGGCGTGCCAGGTGG (SEQ ID NO: 10) 3$, respectively,
and common reverse primer GGTGGTCATATGTATATCTCCTTCTTAAAG (SEQ ID
NO: 11). All constructs were verified by sequencing. Bacterial
protein expression and purification of recombinant lacritin and
lacritin truncations were performed as described previously (Zhang
et al, (2013) J. Biol. Chem. 288, 12090-12101). Briefly, cleared
cell (ER2566 or BL21-CP) lysates were loaded on chitin columns
(IMPACT-CN System; New England Biolabs Inc., Beverly, Mass.)
equilibrated with 50 mM Tris, 0.5 M NaCl (pH 8), followed by 20
column volumes of washing, elution with 50 mM 2-mercaptoethanol for
16 h at room temperature in the same buffer, extensive dialysis
against PBS (4.degree. C.), and protein quantitation. Further DEAE
purification removed a .about.9-kDa lacritin proteolytic fragment
and bacterial contaminants in which lacritin was collected as the
flow through with 140 mM NaCl in phosphate buffer, pH 7.2.
Synthetic peptides N-80/C-25, N-94, N-94/C-6, N-94/C-10, N-94/C-15,
N-99, and N-104 were synthesized by Genscript (Piscataway, N.J.)
with acetylated Ntermini. Purity was 95%. C-termini of all were
amidated, with the exception of lacritin C-terminal N-94, N-99, and
N-104. N-64/C-31 was neither amidated nor acetylated and was
synthesized by the University of Virginia Biomolecular Research
Facility. The nature of the lacritin .about.9-kDa fragment was
pursued by Western blotting. Briefly, lacritin before and after
DEAE separation was separated by SDS-PAGE and then transferred and
blotted with anti-Pep Lac N-terminal and anti-N-65 Lac C-terminal
antibodies, respectively diluted 1:200 or 1:400 in PBS containing
0.3% Tween 20. Detection was with ECL.
[0310] For fragment purification, chitin-enriched lacritin was
dialyzed against phosphate buffer containing 14 mM NaCl (pH 7.2).
Following incubation with DEAE equilibrated in the same buffer, the
.about.9-kDa fragment was collected in the flow-through, whereas
intact (18 kDa) lacritin was eluted with 140 mM NaCl in phosphate
buffer, pH 7.2. After determination of protein concentration (BCA
assay), both were aliquoted, lyophilized, and stored at -70.degree.
C. Analysis was by SDS-PAGE on 4-20% gradient gels. The identity of
the .about.9-kDa fragment was determined by mass spectrometry.
[0311] Bacterial Growth, SYTOX Green Assays, and on Column
Cleavage--E. coli (ATCC (Manassas Va.) catalog no. 10536), S.
epidermidis (ATCC catalog no. 12228), and P. aeruginosa (ATCC
catalog no. 9027) were grown to mid-log phase in 50 ml of
Luria-Bertani (LB) medium and washed three times in phosphate
buffer containing 10 mM NaCl (pH 7.2; PB-NaCl) with centrifugation.
Pellets were resuspended in 1 ml of PB-NaCl.
[0312] For lacritin inhibition assays, 50 ul of bacterial pellets
each diluted 1:100 in PB-NaCl were incubated for 1.5 h (37.degree.
C.) with 100 ul of lacritin, lacritin truncations, or synthetic
peptides at a final concentration of 0.1-6 uM. Mixtures were
diluted 1:10 in PB-NaCl before plating 100 ul in quadruplicate on
LB agar plates for overnight growth at 37.degree. C. Colonies were
manually counted. In other experiments, mid-log E. coli was treated
at 37.degree. C. for 0, 1, 2, or 3 h with 2 uM lacritin or lacritin
truncations or with ampicillin (5 uM) or tetracycline (2 uM). After
each treatment, 100 ul was centrifuged, resuspended in 1 ml of
PB-NaCl, and plated (100 ul) onto LB agar for overnight growth
(37.degree. C.) and colony counting.
[0313] For salt sensitivity studies, pelleted and washed mid-log
phase E. coli, S. epidermidis, or P. aeruginosa were resuspended in
1 ml of PB-NaCl and then treated as above with PB-NaCl or with 3 uM
N-65 in 130, 280, or 380 mosmol/liter PB-NaCl for 1.5 h (37.degree.
C.). Mixtures were diluted 1:10 in PB-NaCl before plating 100 ul of
each in quadruplicate on LB agar plates for overnight growth at
37.degree. C. Colonies were manually counted.
[0314] For bacterial permeability assays, pelleted and washed
midlog phase E. coli were resuspended in 1 ml of PB-NaCl and then
treated as above with 3 uM lacritin, N-65, or C-25 or with 10%
Triton X-100. Similarly, washed mid-log phase S. epidermidis were
resuspended in 1 ml of PB-NaCl and then treated with lacritin or
C-25 or a .about.9-kDa purified lacritin fragment. Later, 1 ul of
0.5 mM SYTOX Green was added to each well of 96-well fluorescent
microtiter plates. Readings were taken at 5-min intervals at
respective excitation and emission wavelengths of 485 and 538 nm
using a Fluoroskan Ascent FL fluorometer (Thermo Fisher
Scientific). In parallel, SYTOX Green internalization was
visualized by confocal microscopy after 1 h of 10% Triton X-100,
PB-NaCl, or 3 uM N-65 treatment of washed mid-log phase E.
coli.
[0315] For cell-free synthesis without glycosylation, full-length
lacritin cDNA in pLacSL was PCR-amplified and subcloned into pTXB1
supplied by the manufacturer (New England Biolabs, Ipswich, Mass.).
Cell-free synthesis and subsequent removal of ribosomes, followed
by metal affinity resin adsorption of His-tagged factors, was
performed as per the manufacturer's instructions (New England
Biolabs; PURExpress) Immediately following expression, an aliquot
was stored at -60.degree. C. Other aliquots were incubated at
37.degree. C. for 24 and 48 h. Each was separated by SDS-PAGE,
transferred, and blotted with anti-N-65 Lac C-terminal
antibodies.
[0316] For lacritin cleavage assays, supernatants from saturated
50-ml overnight cultures of S. epidermidis were collected by
centrifugation (10 min; 11,000 rpm). Each supernatant was then
incubated for 4, 16, and 20 h (37.degree. C.) in PB-NaCl with
chitin beads containing lacritin-intein immobilized via N-termini
C-terminal cleavage products were collected by PBNaCl washing,
separated by SDS-PAGE, transferred, and blotted with anti-N-65 Lac
C-terminal antibodies. In some experiments, supernatants and
lysates from overnight cultures of S. epidermidis, Staphylococcus
aureus, P. aeruginosa, and E. coli were incubated overnight
(37.degree. C.) with lacritin in solution in PB-NaCl. Mixtures were
then separated by SDS-PAGE, transferred, and blotted with anti-N-65
Lac C-terminal antibodies. Parallel studies monitored the integrity
of chitin-intein-immobilized lacritin in PB-NaCl at 37.degree. C.
for 0, 24, 48, and 72 h or for 24 h (37.degree. C.) with 1 uM
pepstatin, 10 uM bestatin, 100 uM antipain, 1 mM 4-benzenesulfonyl
fluoride hydrochloride, 100 uM chymostatin, 10 uM E64, 100 uM
leupeptin, or 10 mM phosphoramidon or for 24 h after boiling for 5
min at 100.degree. C.
[0317] Hemolysis Assay--The method of Cerovsky' et al. was followed
with some modifications. Washed sheep red blood cell pellets (MP
Biomedicals, Santa Ana, Calif.) were suspended for 1 h at
37.degree. C. in 565 ul of PBS plus 100 ul of lacritin, N-55, N-65,
N-71, N-75, N-80, or C-25 at a final concentration of 2 uM or with
N-65, N-64/C-31, N-80/C-25, N-94, N-94/C-6, N-94/C-10, N-94/C-15,
N-99, or N-104 at a final concentration of 6 uM. As respective
positive and negative controls, Triton X-100 (final concentration
of 5%) or PBS was included in place of lacritin or lacritin
fragments. After centrifugation (250.times.g; 5 min), the
absorbances of supernatants at 540 nm were monitored.
[0318] Metabolome Analysis--Washed mid-log E. coli were incubated
with 6 uM N-65 or PB-NaCl for 15 min at 37.degree. C. in replicates
of six, each at 1.times.10.sup.8 cells/replicate. Cells were then
washed once, and pellets were flash-frozen for storage at
-70.degree. C. Unbiased metabolite analysis was performed by
Metabolon Inc. (Durham, N.C.) using GC/MS and LC/MS/MS. 78
metabolites were identified.
[0319] Statistical Analyses--With the exception of the single
metabolomic analysis, all experiments were performed at least three
times. Statistical analysis of metabolite data was performed, where
raw data values were first log transformed to be closely
distributed as a normal distribution and then assessed by a
non-parametric Wilcoxon test and two-sample t test. For both tests
with p & 0.05, metabolites were considered significantly
different and further analyzed by hierarchical clustering for their
association patterns. Data are reported as the mean+/-S.E.
Results
[0320] Lacritin Bactericidal Activity in Tears--Tears protect the
surface of the eye against environmental pathogens and are enriched
in the prosecretory mitogen lacritin, which flows onto the eye
during basal and reflex tearing. Lacritin is 21% identical to
dermcidin, whose proteolytically processed C terminus contributes
to the bactericidal activity of human sweat. We sought to determine
whether lacritin or a lacritin fragment(s) have bactericidal
activity. Half-diluted basal tears completely blocked E. coli
growth and E. coli is a significant contributor to bacterial
conjunctivitis in the developing world, as is P. aeruginosa. We
tested tears that had been passed over immobilized anti-N-65 Lac
C-terminal antibodies (ab C-term) to immunodeplete both lacritin
and C-terminal lacritin fragments, or over preimmune Ig
(mock-depleted). Both were diluted 10-fold for dose-dependent
challenge of E. coli and P. aeruginosa. Mock-depleted tears
suppressed E. coli and P. aeruginosa colonies in a tear
volume-dependent manner. This contrasted with C-terminal
antibody-immunodepleted tears, which were as ineffective as the
phosphate buffer negative control.
[0321] Lacritin's C Terminus Contains a Bactericidal
Domain--Lacritin's C terminus contains three predicted
.alpha.-helices each validated by circular dichroism. The most
C-terminal .alpha.-helix is amphipathic and targets syndecan-1 as
an initiator of corneal epithelial cell proliferation and survival,
largely via hydrophobic face residues. Association of amphipathic
.alpha.-helices with bacterial membranes can be destabilizing. To
explore whether these or other lacritin domains are bactericidal,
we generated recombinant lacritin and lacritin truncations. Each
was generated as an intein fusion protein, purified on chitin to
also remove the intein tag and then on DEAE to exclude bacterial
contaminants. Lacritin and truncations were then assayed in
equimolar (2 uM) amounts in the presence of mid-log E. coli, P.
aeruginosa, or S. epidermidis. P. aeruginosa is an eye pathogen
often responsible for keratitis in contact lens wear. S.
epidermidis is a common cause of conjunctivitis and keratitis and
is abundant in blepharitis, an eyelid inflammation associated with
slightly altered tear composition, including selectively less
lacritin. Lacritin without truncation had no effect on the
appearance of colonies, with numbers equivalent to the phosphate
buffer negative control. However, few colonies were apparent with
lacritin lacking 65 (N-65) or 80 (N-80) amino acids from the
N-terminus, an effect completely or partly negated by removing six
additional amino acids (N-86) in E. coli or P. aeruginosa but not
S. epidermidis. Amino acids 81-86 comprise the sequence LAKAGKG
(SEQ ID NO: 12), which aligns with a sequence in a potent dermcidin
fragment SSL-25 with an amino acid identity of 44%.
[0322] To determine whether the LAKAGKG (SEQ ID NO: 12) region was
responsible, we generated AKAGKGMHGGVPGG (SEQ ID NO: 13; amino
acids 81-94; N-80/C-25), comprising the truncation-narrowed portion
of the SSL-25 homologous region. Also generated were partially
overlapping LKSIVEKSILLTEQALAKAGKGMH (SEQ ID NO: 14; amino acids
65-88; N-64/C-31) and C-terminal KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID
NO: 7; amino acids 95-119; N-94). Unexpectedly, colonies were
abundant with N-80/C-25 and N-64/C-31, whereas few or no colonies
were apparent with N-94, a region only 12.5% identical with the
C-terminus of dermcidin. To narrow this site, we generated
synthetic peptides with amino acids sequentially removed from the
carboxy terminus N-94/C-6, N-94/C-10, N-94/C-15 and N-99
ENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 15), and N-104 (FAQKLLKKFSLLKPWA
(SEQ ID NO: 16). N-94 and N-104 were fully active but not the other
peptides, although N-94/C-6 (SEQ ID NO: 5) was slightly so. N-65 is
bactericidal and equipotent to ampicillin. In dose response
studies, N-104 was almost as effective as N-65, with a half-maximal
inhibition of about luM for E. coli and about 1-1.5 uM for P.
aeruginosa, a dose range common to antimicrobial peptides.
[0323] Discussion
[0324] The rationale for exploring whether lacritin might be
bactericidal was its 21% identity with dermcidin, whose
proteolytically processed C terminus contributes to the
bactericidal activity of human sweat and is in tears. Surprisingly,
dermcidin primary sequence homology was not the source of lacritin
activity. Only 40.7% identity is shared between dermcidin's
bactericidal SSL-25 peptide and the homologous lacritin region that
as a synthetic peptide was inactive. Instead, lacritin N-104
fragment with 7% dermcidin identity embodies the core activity, a
hybrid domain consisting of an N-terminal amphipathic helix and
hydrophobic C-terminal coiled coil tail, together appropriate for
bacterial membrane contact and insertion, as was apparent by rapid
entry of membrane-impermeable SYTOX Green in N-65-treated cells.
Surprisingly, a C-terminal 25 amino acid fragment
KQFIENGSEFAQKLLKKFSLLKPWA (SEQ ID NO: 7; amino acids 95-119; N-94)
was found to be fully active, wherein removal of 6 terminal amino
acids (e.g. KQFIENGSEFAQKLLKKFS; SEQ ID NO: 5) substantially
reduced the bactericidal activity of the peptide.
Example 5
[0325] Although topical application of ophthalmic products has
remained the most popular and well-tolerated administration route
for patient compliance, the bioavailability of eye drops is
severely hindered by blinking, baseline and reflex lacrimation, and
nasolacrimal drainage. One solution to enhance the therapeutic
index of topical treatments is through the application of polymeric
nanoparticles as drug carriers.
[0326] One solution to enhance the therapeutic index of topical
treatments is through the application of polymeric nanoparticles as
drug carriers. Polymeric nanoparticles displaying therapeutic
ligands at the corona can interact with complex biomolecular
architectures through multiple simultaneous interactions
(multivalency) and exhibit the well-defined sizes required for
efficient tissue penetration. One such material capable of being
employed as the scaffold are thermo-responsive elastin-like
polypeptides (ELPs). ELPs are composed of the repetitive
pentapeptide motif (Val-Pro-Gly-Xaa-Gly)n (SEQ ID NO: 24) and
exhibit unique reversible inverse phase transition temperatures,
Tt, below which they solubilize and above which they phase
separate. Tt can be modulated through guest residue (Xaa) selection
and changes in the number of pentameric repeats, n.
[0327] Inspired by the motivation to further explore lacritin's
function on the ocular surface, enhance its bioavailability, and
better target the corneal epithelium, we utilized a diblock ELP
(SI) nanoparticle scaffold to bioengineer LSI nanoparticles with
multivalent presentation of lacritin at the surface.
Materials and METHODS
[0328] Materials and Equipment
[0329] TB DRY.RTM. Powder Growth Media was purchased from MO BIO
Laboratories, Inc. (Carlsbad, Calif.). NHS-rhodamine was purchased
from Thermo Fisher Scientific (Rockford, Ill.). SV40-Adeno vector
transformed cornea cells (RCB 2280, HCE-T) were purchased from
Riken Cell Bank, Japan. Keratinocyte-SFM medium supplied with
Bovine Pituitary Extract (BPE) and prequalified human recombinant
Epidermal Growth Factor 1-53 (EGF) was purchased from Gibco
Invitrogen (Life Technologies, NY). Calcium Indicator Fluo-4, AM,
cell permeant was purchased from Life Technologies (NY). Algerbrush
II with a 0.5 mm burr was purchased from The Alger Company, Inc.,
TX. In vivo studies were conducted using in house bred 12 week
female non-obese diabetic (NOD) (Taconic Farms, Germantown/NY, USA)
mice.
[0330] Construction of LSI Nanoparticles
[0331] Genes encoding for ELPs (SI) were synthesized by recursive
directional ligation in pET25b(+) vector. A sequence encoding human
lacritin without secretion signal peptide was designed using the
best E. coli codons in EditSeq (DNAStar Lasergene, Wis.). A
thrombin cleavage site was designed between the lacritin sequence
and ELP tag via insertion at the BseRI site. Lacritin gene flanked
by Ndel and BamHI restriction digestion sites at the 5' and 3' ends
was purchased in the pIDTSmart-KAN vector from Integrated DNA
Technologies (IDT) as follows:
TABLE-US-00006 (SEQ ID NO: 25)
CATATGGAAGACGCTTCTTCTGACTCTACCGGTGCTGACC
CGGCTCAGGAAGCTGGTACCTCTAAACCGAACGAAGAAATCTC
TGGTCCGGCTGAACCGGCTTCTCCGCCGGAAACCACCACCACC
GCTCAGGAAACCTCTGCTGCTGCTGTTCAGGGTACCGCTAAAG
TTACCTCTTCTCGTCAGGAACTGAACCCGCTGAAATCTATCGTT
GAAAAATCTATCCTGCTGACCGAACAGGCTCTGGCTAAAGCTG
GTAAAGGTATGCACGGTGGTGTTCCGGGTGGTAAACAGTTCAT
CGAAAACGGTTCTGAATTCGCTCAGAAACTGCTGAAAAAATTCT
CTCTGCTGAAACCGTGGGCTGGTCTGGTTCCGCGTGGTTCTG
GTTACTGATCTCCTCGGATCC.
The above gene was subcloned into the pET25b(+) vector and the LSI
gene was synthesized by ligation of ELP SI gene via the BseRI
restriction site. Correct cloning of the fusion protein gene was
confirmed by DNA sequencing. LSI fusion proteins were expressed in
BLR (DE3) E. coli (Novagen Inc., Milwaukee, Wis.) for 24 h in an
orbital shaker at 37.degree. C. at 250 rpm and purified via inverse
phase transition cycling.
[0332] Characterization of LSI Phase Behavior and Nanoparticle
Formation
[0333] The phase diagram for LSI fusion protein was characterized
by optical density change at 350 nm as a function of solution
temperature using a DU800 UV-Vis Spectrophotometer (Beckman
Coulter, Brea, Calif.). Tt was defined at the point of the maximum
first derivative. Self-assembly of nanoparticles was measured using
dynamic light scattering (DLS) using a DynaPro-LSR Plate Reader
(Wyatt Technology, Santa Barbara, Calif.). Light scattering data
were collected at regular temperature intervals (1.degree. C.) as
solutions were heated from 5 to 50.degree. C. The results were
analyzed using a Rayleigh sphere model and fitted into a cumulant
algorithm based on the sum-of-squares value. The critical micelle
temperature (CMT) was defined as the lowest temperature at which
the Rh is significantly greater than the average monomer Rh.
[0334] TEM Imaging of LSI Nanoparticles
[0335] The TEM imaging was carried out on a FEI Tecnai 12 TWIN
microscope (Hillsboro, Oreg.) at 100 kV. Briefly, a 100 uM solution
(5 uL) was initially deposited on a copper grid with carbon film
(CF400-Cu, Election Microscopy Sciences, Hatfield, Pa.). After
removing the excess amount of solution with filter paper, the
samples were negatively stained with 2% uranyl acetate, followed by
removing excess uranyl acetate after 30 s. bThe samples were then
dried under room temperature for at least 3 h before use in
imaging.
[0336] SV40-Immortalized Human Corneal Epithelial Cell (HCET)
Culture
[0337] SV40-immortalized HCE-T cells (Riken Cell Bank, Japan) were
grown in keratinocyte-SFM media (KSFM, Life Technologies,
Rockville, Md.) containing bovine pituitary extract (BPE, 50 mg/ml)
and epidermal growth factor (EGF, 5 ng/ml). Cell passages 4-6 were
used for Ca2+ imaging, scratch and uptake assays in 35 mm
coverslip-bottomed dishes. To optimize responsiveness upon stimuli,
cells were starved with EGF and BPE free medium for 24 h before
experimentation.
[0338] Ca2+ Imaging
[0339] HCE-Ts were rinsed twice with Ca2+ and Mg2+ free phosphate
buffer saline (PBS) and incubated at 37.degree. C. for 20 min fresh
KSFM medium containing 2.5 mM calcium probe Fluo-4AM(Invitrogen
Life technologies, NY). The cells were then rinsed twice with NaCl
Ringer buffer (145 mM NaCl, 5 mM KCl, 1 mM CaCl.sub.2, 1 mM KH2PO4,
1 mM MgCl.sub.2, 10 mM glucose, and 10 mM HEPES, osmolarity 300, pH
7.4) and kept in the same buffer at room temperature for 30 m. For
Ca2+ free medium, 1 mM Ca2+ was replaced with 0.5 mM EGTA. The
cells were illuminated at 488 nm, and their emission was monitored
every 3.15 s at 510 nm using Zeiss LSM 510 Meta confocal microscope
system. The field of interest contained 24 to 45 cells, and the
fluorescent intensity change was calculated for each region with
image-analysis software. Ca2+ dynamics were evaluated using the
changes in fluorescence intensity of Fluo-4AM. The data are
presented as percentage change in fluorescence intensity at each
time point (Ft) to the first time point (F0) reading:
(Ft-F0)/F0.times.100%.
[0340] In Vitro Scratch Closure Assay
[0341] For a scratch assay, confluent HCE-T monolayers were scraped
in a straight line to create a scratch wound with a p200 pipet tip.
Cells were rinsed with KSFM medium without BPE or EGF to remove
debris and then incubated with fresh KSFM medium containing BPE (50
mg/ml) and EGF (5 ng/ml), LSI, or medium without growth factors (No
treat). Phase contrast images of the wound at the beginning and
after 24 h treatment were captured using Zeiss LSM 510 Meta
confocal microscope system.
[0342] Exogenous Cell Uptake Assay
[0343] SI and LSI nanoparticles were conjugated with NHS-rhodamine
(Thermo Fisher Scientific Inc, Rockford, Ill.) via covalent
modification of the amino terminus. Conjugation was performed in
100 mM borate buffer (pH 8.0) for 2 h (LSI) or overnight (SI) at
4.degree. C. followed by desalting on a PD10 column (GE Healthcare,
Piscataway, N.J.) to remove free dye. Briefly, after the cells were
rinsed with fresh medium without BPE and EGF, 10 mM rhodamine
labeled proteins were added into the dish. After incubation at
37.degree. C. for different time points, the cells were rinsed and
images were acquired using Zeiss LSM 510 Meta confocal microscope
system.
[0344] Murine Corneal Abrasion and Recovery Study
[0345] Briefly, 12 week female NOD mice were anesthetized with an
i.p. injection of xylaxine/ketamine (60-70 mg+5 mg/kg) and placed
on a heating pad. After cleaning the ocular surface with eye wash
(OCuSOFT, Inc., TX), the corneal epithelium of the right eye was
removed down to the basement membrane using an algerbrush II (The
Alger Company, Inc., TX); the left eye was left intact as a contra
lateral control. Mice were allowed to heal for 24 h with 2 doses (5
ml) of KSFM medium containing BPE (50 mg/ml) and EGF (5 ng/ml), 100
mM LSI, 100 mM SI, or no treatment at 12 h intervals. After
staining the ocular surface with 5 ml 0.6 mg/ml fluorescein (Akorn,
Ill.), images of the abrasion wound were captured using a Moticam
2300 camera after 12 h and 24 h.
[0346] Statistics
[0347] All experiments were replicated at least three times.
Maximum fluorescence intensity change in Ca2+-mediated fluorescence
was analyzed using a non-paired t-test. Scratch wound healing
quantification was analyzed using a one-way ANOVA followed by
Tukey's post hoc test. HCE-T uptake was analyzed using two-way
ANOVA followed by Bonferroni post-test and murine corneal
epithelium recovery from abrasion wound were analyzed using
Kruskal-Wallis non-parametric ANOVA. Corneal wound healing
comparison between LSI and LS96 after 12 h treatment was analyzed
using Mann-Whitney U test. A p value less than 0.05 was considered
statistically significant.
[0348] Results and Discussion
[0349] The ELP lacritin fusion called LSI forms thermoresponsive
nanoparticles
[0350] Two derivatives of lacritin were formed, each comprising an
ELP tag:
TABLE-US-00007 LSI (SEQ ID NO: 26)
GEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAV
QGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIE
NGSEFAQKLLKKFSLLKPWAGLVPRGSG(VPGSG).sub.48(VPGIG).sub.48Y; and LS96
(SEQ ID NO: 27) GEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAV
QGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIE
NGSEFAQKLLKKFSLLKPWAGLVPRGSG(VPGSG).sub.96Y.
[0351] LSI and LS96 were cloned into a pET25(+) vector, expressed
in E. coli, and purified using inverse phase transition cycling.
LSI was expected to undergo thermally-mediated assembly similar to
SI and form nanoparticles above its phase transition temperature
(Tt), while LS96, with lacritin gene fused to the soluble
macromolecule S96, was developed as a control that does not phase
separate until significantly above physiological temperatures.
After confirming the purity and molecular weight of expressed
proteins, their phase diagrams were characterized using optical
density as a function of temperature. While monomeric ELPs undergo
a single phase transition from solubility to coacervate, certain
ELP diblock copolymers display two steps of assembly in response to
heating: (i) soluble monomers assemble into stable nanoparticles
above Tt1; and (ii) at a higher temperature, Tt2, the nanoparticles
themselves coacervate. For ELPs such as LSI, Tt1 is thus defined as
the critical micelle temperature (CMT) above which nanoparticles
are favorable (32.3.degree. C. at 25 mM). Tt2, or the bulk phase
transition temperature, represents the temperature at which these
nanoparticles further assemble into coacervates. In striking
contrast to its SI scaffold, LSI only shows one phase transition at
18.4.degree. C. (25 mM). Moreover, LSI illustrated less
concentration dependent phase transition compared to the SI
scaffold, as demonstrated by a decreased slope when Tt was fit by
the equation: Tt=m log[C.sub.ELP]+b, where C.sub.ELP is the
concentration, m is the slope, and b is the transition temperature
at 1 mM. Eqn (1) permits the estimation of Tt over a broad range of
concentrations, which may be encountered in vivo. In our recent
reports, suppression of the ELP concentration dependence correlates
with assembly mediated by the fusion domain itself, which we have
reported in fusion between a single chain antibody and also a
disintegrin. Based on the unexpected observation that LSI exhibits
a single phase transition, dynamic light scattering (DLS) was used
to determine whether particles form above or below this Tt.
[0352] Both constructs were thus compared by DLS to monitor the
temperature dependent assembly process. Surprisingly, LSI
preassembled into 30-40 nm nanoparticles even below Tt. Above Tt,
it began to favor larger nanoparticles ranging from 130-140 nm. SI
remained as 20-30 nm micelles at physiologically relevant
temperatures. In combination with the optical density data, this
suggests that lacritin itself mediates partial assembly of small
aggregates that proceed to assemble larger structures above the Tt1
mediated by SI. To further examine the dominant structures formed
by LSI and SI, we observed their morphologies when dried from room
temperature using transmission electron microscopy (TEM).
Consistent with DLS, while SI formed a mono-dispersed micelle
structure with an average diameter of 36.5+/-5.8 nm and LSI formed
larger nanoparticles that exhibit average diameters of 67.1+/-11.5
nm. Regardless, both SI and LSI appear capable of forming
nanostructures.
[0353] LSI nanoparticles exhibit mitogenic activity using SV-40
transduced human corneal epithelial cells.
[0354] Upon injury, one of the earliest reactions of many
epithelial cells is a transient Ca2+ wave spreading across the
monolayer cell sheet. The Ca2+ wave triggers downstream signaling
pathways responsible for cell migration, proliferation and other
events associated with wound repair. Lacritin has been reported as
stimulating Ca2+ wave propagation throughout HCE-Ts and further
studies have confirmed that this Ca2+ signal is associated with
lacritin's protection of HCE cells stressed with benzalkonium
chloride and maintenance of cultured corneal epithelia homeostasis.
To confirm whether LSI maintains mitogenic activity of lacritin, we
tested both calcium transients and scratch wound healing assays
based on the reported HCE-T model. We first tested intracellular
Ca2+ wave propagation in HCE-T cells loaded with Fluo-4 AM under
either LSI or SI treatment. The fields of interest containing 24 to
45 cells were chosen and the fluorescent intensity change of ten
individual cells was calculated using LSM 510 image-analysis
software. Percentage change in fluorescence intensity at each time
point (Ft) to the first time point (F0) reading:
(Ft-F0)/F0.times.100% was used to quantify Ca2+ signal. The signal
triggered by SI was negligible, evoking only a 0.054+/-0.049 fold
maximum fluorescence intensity change compared to baseline. The
addition of LSI nanoparticles, however, resulted in a significantly
rapid calcium influx into the cells with a maximum fluorescence
intensity 4.399+/-1.043 fold of F0 (p<0.0001). Moreover, HCE-T
cells appeared to have `memory` for exogenous LSI treatment, as
treating the same group of cells for the second time with the same
concentration resulted in a broader peak for Ca2+ influx, which
extended peak duration from 40 to 70 s. Downstream of Ca2+ mediated
signaling, HCE-Ts are known to initiate more rapid motility and
proliferation, which can be visualized during the closure of a
scratch made on a confluent sheet of cells.
[0355] To visualize the in vitro effect of LSI, we applied a
scratch to a sheet of cells and captured the timelapse healing
process. Each treatment was performed in triplicate and four
independent wound distances in each well were measured for
analysis. After 24 h of treatment, a very low concentration of LSI
(10 nM) significantly accelerated scratch wound healing compared to
plain medium without growth factors (***p<0.001). This effect
was comparable to a positive control containing BPE and EGF.
[0356] LSI Nanoparticles Undergo Uptake into HCE-Ts
[0357] Encouraged by LSI's in vitro mitogenic activity, we further
explored whether exogenous LSI can enter the HCE-Ts. The cells were
thus incubated with NHS-rhodamine labeled LSI and SI nanoparticles
for different time points. Consistent with lacritin-mediated
uptake, LSI underwent cell uptake into HCE-Ts in a time dependent
manner Significant cell entry was observed 10 m following
incubation, and after 1 h, LSI nanoparticles accumulated within the
peri-nuclear region. Upon quantification, LSI exhibited
significantly higher cytosolic fluorescence than SI nanoparticles
(p<0.0001). Nanomaterials of different sizes, shapes, and
charges have been widely used in biomedical imaging, tissue
targeting, and cell uptake. More recently, the use of nanoparticles
to crosslink membrane receptors more efficiently to regulate
downstream signaling has attracted enormous attention, especially
in antibody mediated receptor crosslinking.
[0358] LSI Nanoparticles Heal a Corneal Abrasion on Non-Obese
Diabetic (NOD) Mice
[0359] We proceeded to investigate LSI nanoparticles in vivo
efficacy via topical eye drops. In this study, we developed a
corneal epithelial abrasion model on female NOD mice to assess the
wound-healing effect of LSI nanoparticles. Non-obese diabetic (NOD)
mice are frequently used as an animal model for impaired wound
healing in humans. Reduced cell proliferation, retarded onset of
the myofibroblast phenotype, reduced procollagen I mRNA expression,
and aberrant control of apoptotic cell death were observed in NOD
group. The NOD mouse model was selected for evaluation of the in
vivo activity of LSI nanoparticles. Brifly, a circular abrasion
wound with a diameter of around 2 mm was created on the right eye
of the animal with an algerbrush II without damaging the limbal
region Immediately after imaging, 5 ml of 100 mMLSI nanoparticles,
SI nanoparticles, or control EGF+BPE were topically administered to
the ocular surface, and this treatment was repeated once 12 h after
wound initiation. Images of the wound were captured at time 0, 12
h, and 24 h using fluorescein staining under cobalt blue light. The
initial wound healing comparison study included 4 mice under each
treatment group, with the left eye intact as a contralateral
control. After experimentation, wound-healing images were analyzed
using ImageJ. Mean fluorescein intensity, wound area, total
fluorescein (total=mean fluorescein intensity.times.wound area),
fluorescein percentage of initial value, wound area percentage of
initial value (PctArea), and total fluorescein percentage of
initial value were determined by a blind reviewer and compared
between groups at 12 h and 24 h using Kruskal-Wallis non-parametric
testing. No significant inflammation or any other adverse effects
were observed upon treatments. Notably, LSI at both 12 and 24 hours
significantly decreased the percentage of initial wound area
(PctArea) compared to SI (p=0.001), EGF+BPE (p=0.001), and no
treatment groups (p=0.001), suggesting that LSI is the best
formulation to accelerate recovery of the corneal epithelium. To
corroborate the fluorescein imaging result, we further processed
the corneal epithelium after 24 h for histology analysis. Briefly,
corneas were fixed, sectioned across the defect, and stained by
hematoxylin and eosin.
[0360] Pathology of Corneal Epithelium (EP);
[0361] Bowman's Membrane (BM); Stroma (ST); Descenet's Membrane
[0362] (DM); endothelium (EN) was evaluated. Remarkably, the
corneal epithelium of the LSI treatment group showed complete
recovery with a smooth, reconstituted surface, absent of
inflammation. While the fluorescein test revealed partial
resistance to staining at 24 h in the SI group, the regenerated
corneal epithelium did not complete differentiation. Having
demonstrated that the mitogenic lacritin protein remains active
when decorated on a protein polymer nanoparticle, we next
investigated whether ELP-mediated particle assembly is required to
achieve this result. To address the significance of ELP assembly in
vivo, the efficacy of LSI nanoparticles can be directly compared
with a thermally nonresponsive lacritin fusion protein called LS96.
Both LSI and LS96 contain the lacritin sequence followed by an ELP
containing 96 total pentameric repeats; however, the ELP S96 does
not phase separate until above physiological temperatures. Optical
density measurements, in fact, revealed that LS96 does not display
any observable phase transitions in phosphate buffered saline. In
addition, DLS confirmed that LSI has a much larger hydrodynamic
radius than LS96 at 37.degree. C.
[0363] Using these two related formulations of lacritin ELPs, the
corneal defect study in NOD mice was both to confirm the ability of
LSI to close the epithelium after 12 h and compare this closure
with that of LS96. To better evaluate our experimental observation,
we further increased the sample size to eight mice per group, with
all right eyes receiving the abrasion procedure. Interestingly, LSI
healed the abrasion wound significantly (p<0.05) faster than the
non thermo-responsive LS96 fusion. This finding directly supports
the contention that ELP-mediated assembly is involved with the
enhancement of LSI.
CONCLUSIONS
[0364] To accelerate the corneal wound healing process, a
multivalent ELP nanoparticle was used as a means of delivering a
candidate biopharmaceutical, the mitogen lacritin, to the ocular
surface. This lacritin ELP fusion, LSI, displays thermoresponsive
self-assembly properties similar to the unmodified SI nanoparticle
and presents accessible lacritin at its corona at physiologically
relevant temperatures. LSI nanoparticles trigger calcium dependent
cell signaling, internalize into cells, and facilitate scratch
closure in monolayers of a human corneal epithelial cell line
(HCE-Ts). When topically applied on the ocular surface of NOD mice
following removal of the corneal epithelium, LSI nanoparticles
promoted faster wound healing compared to SI and untreated groups.
Most importantly, the LSI nanoparticles produce faster regeneration
of the corneal epithelium compared to a control lacritin ELP
fusion, called LS96, that does not undergo thermally-mediated
assembly. Overall, this study highlights the potential of ELPs as
nanoparticle scaffolds to effectively deliver protein therapeutics
to the ocular surface and repair abrasion wounds.
[0365] The disclosures of each and every patent, patent
application, and publication cited herein are hereby incorporated
by reference herein in their entirety.
[0366] Headings are included herein for reference and to aid in
locating certain sections. These headings are not intended to limit
the scope of the concepts described therein under, and these
concepts may have applicability in other sections throughout the
entire specification.
[0367] While this invention has been disclosed with reference to
specific embodiments, it is apparent that other embodiments and
variations of this invention may be devised by others skilled in
the art without departing from the true spirit and scope of the
invention.
Sequence CWU 1
1
281138PRTHomo sapiens 1Met Lys Phe Thr Thr Leu Leu Phe Leu Ala Ala
Val Ala Gly Ala Leu 1 5 10 15 Val Tyr Ala Glu Asp Ala Ser Ser Asp
Ser Thr Gly Ala Asp Pro Ala 20 25 30 Gln Glu Ala Gly Thr Ser Lys
Pro Asn Glu Glu Ile Ser Gly Pro Ala 35 40 45 Glu Pro Ala Ser Pro
Pro Glu Thr Thr Thr Thr Ala Gln Glu Thr Ser 50 55 60 Ala Ala Ala
Val Gln Gly Thr Ala Lys Val Thr Ser Ser Arg Gln Glu 65 70 75 80 Leu
Asn Pro Leu Lys Ser Ile Val Glu Lys Ser Ile Leu Leu Thr Glu 85 90
95 Gln Ala Leu Ala Lys Ala Gly Lys Gly Met His Gly Gly Val Pro Gly
100 105 110 Gly Lys Gln Phe Ile Glu Asn Gly Ser Glu Phe Ala Gln Lys
Leu Leu 115 120 125 Lys Lys Phe Ser Leu Leu Lys Pro Trp Ala 130 135
2310PRTHomo sapiens 2Met Arg Arg Ala Ala Leu Trp Leu Trp Leu Cys
Ala Leu Ala Leu Ser 1 5 10 15 Leu Gln Pro Ala Leu Pro Gln Ile Val
Ala Thr Asn Leu Pro Pro Glu 20 25 30 Asp Gln Asp Gly Ser Gly Asp
Asp Ser Asp Asn Phe Ser Gly Ser Gly 35 40 45 Ala Gly Ala Leu Gln
Asp Ile Thr Leu Ser Gln Gln Thr Pro Ser Thr 50 55 60 Trp Lys Asp
Thr Gln Leu Leu Thr Ala Ile Pro Thr Ser Pro Glu Pro 65 70 75 80 Thr
Gly Leu Glu Ala Thr Ala Ala Ser Thr Ser Thr Leu Pro Ala Gly 85 90
95 Glu Gly Pro Lys Glu Gly Glu Ala Val Val Leu Pro Glu Val Glu Pro
100 105 110 Gly Leu Thr Ala Arg Glu Gln Glu Ala Thr Pro Arg Pro Arg
Glu Thr 115 120 125 Thr Gln Leu Pro Thr Thr His Gln Ala Ser Thr Thr
Thr Ala Thr Thr 130 135 140 Ala Gln Glu Pro Ala Thr Ser His Pro His
Arg Asp Met Gln Pro Gly 145 150 155 160 His His Glu Thr Ser Thr Pro
Ala Gly Pro Ser Gln Ala Asp Leu His 165 170 175 Thr Pro His Thr Glu
Asp Gly Gly Pro Ser Ala Thr Glu Arg Ala Ala 180 185 190 Glu Asp Gly
Ala Ser Ser Gln Leu Pro Ala Ala Glu Gly Ser Gly Glu 195 200 205 Gln
Asp Phe Thr Phe Glu Thr Ser Gly Glu Asn Thr Ala Val Val Ala 210 215
220 Val Glu Pro Asp Arg Arg Asn Gln Ser Pro Val Asp Gln Gly Ala Thr
225 230 235 240 Gly Ala Ser Gln Gly Leu Leu Asp Arg Lys Glu Val Leu
Gly Gly Val 245 250 255 Ile Ala Gly Gly Leu Val Gly Leu Ile Phe Ala
Val Cys Leu Val Gly 260 265 270 Phe Met Leu Tyr Arg Met Lys Lys Lys
Asp Glu Gly Ser Tyr Ser Leu 275 280 285 Glu Glu Pro Lys Gln Ala Asn
Gly Gly Ala Tyr Gln Lys Pro Thr Lys 290 295 300 Gln Glu Glu Phe Tyr
Ala 305 310 3229PRTHomo sapiens 3Gln Ile Val Ala Thr Asn Leu Pro
Pro Glu Asp Gln Asp Gly Ser Gly 1 5 10 15 Asp Asp Ser Asp Asn Phe
Ser Gly Ser Gly Ala Gly Ala Leu Gln Asp 20 25 30 Ile Thr Leu Ser
Gln Gln Thr Pro Ser Thr Trp Lys Asp Thr Gln Leu 35 40 45 Leu Thr
Ala Ile Pro Thr Ser Pro Glu Pro Thr Gly Leu Glu Ala Thr 50 55 60
Ala Ala Ser Thr Ser Thr Leu Pro Ala Gly Glu Gly Pro Lys Glu Gly 65
70 75 80 Glu Ala Val Val Leu Pro Glu Val Glu Pro Gly Leu Thr Ala
Arg Glu 85 90 95 Gln Glu Ala Thr Pro Arg Pro Arg Glu Thr Thr Gln
Leu Pro Thr Thr 100 105 110 His Gln Ala Ser Thr Thr Thr Ala Thr Thr
Ala Gln Glu Pro Ala Thr 115 120 125 Ser His Pro His Arg Asp Met Gln
Pro Gly His His Glu Thr Ser Thr 130 135 140 Pro Ala Gly Pro Ser Gln
Ala Asp Leu His Thr Pro His Thr Glu Asp 145 150 155 160 Gly Gly Pro
Ser Ala Thr Glu Arg Ala Ala Glu Asp Gly Ala Ser Ser 165 170 175 Gln
Leu Pro Ala Ala Glu Gly Ser Gly Glu Gln Asp Phe Thr Phe Glu 180 185
190 Thr Ser Gly Glu Asn Thr Ala Val Val Ala Val Glu Pro Asp Arg Arg
195 200 205 Asn Gln Ser Pro Val Asp Gln Gly Ala Thr Gly Ala Ser Gln
Gly Leu 210 215 220 Leu Asp Arg Lys Glu 225 4543PRTHomo sapiens
4Met Leu Leu Arg Ser Lys Pro Ala Leu Pro Pro Pro Leu Met Leu Leu 1
5 10 15 Leu Leu Gly Pro Leu Gly Pro Leu Ser Pro Gly Ala Leu Pro Arg
Pro 20 25 30 Ala Gln Ala Gln Asp Val Val Asp Leu Asp Phe Phe Thr
Gln Glu Pro 35 40 45 Leu His Leu Val Ser Pro Ser Phe Leu Ser Val
Thr Ile Asp Ala Asn 50 55 60 Leu Ala Thr Asp Pro Arg Phe Leu Ile
Leu Leu Gly Ser Pro Lys Leu 65 70 75 80 Arg Thr Leu Ala Arg Gly Leu
Ser Pro Ala Tyr Leu Arg Phe Gly Gly 85 90 95 Thr Lys Thr Asp Phe
Leu Ile Phe Asp Pro Lys Lys Glu Ser Thr Phe 100 105 110 Glu Glu Arg
Ser Tyr Trp Gln Ser Gln Val Asn Gln Asp Ile Cys Lys 115 120 125 Tyr
Gly Ser Ile Pro Pro Asp Val Glu Glu Lys Leu Arg Leu Glu Trp 130 135
140 Pro Tyr Gln Glu Gln Leu Leu Leu Arg Glu His Tyr Gln Lys Lys Phe
145 150 155 160 Lys Asn Ser Thr Tyr Ser Arg Ser Ser Val Asp Val Leu
Tyr Thr Phe 165 170 175 Ala Asn Cys Ser Gly Leu Asp Leu Ile Phe Gly
Leu Asn Ala Leu Leu 180 185 190 Arg Thr Ala Asp Leu Gln Trp Asn Ser
Ser Asn Ala Gln Leu Leu Leu 195 200 205 Asp Tyr Cys Ser Ser Lys Gly
Tyr Asn Ile Ser Trp Glu Leu Gly Asn 210 215 220 Glu Pro Asn Ser Phe
Leu Lys Lys Ala Asp Ile Phe Ile Asn Gly Ser 225 230 235 240 Gln Leu
Gly Glu Asp Phe Ile Gln Leu His Lys Leu Leu Arg Lys Ser 245 250 255
Thr Phe Lys Asn Ala Lys Leu Tyr Gly Pro Asp Val Gly Gln Pro Arg 260
265 270 Arg Lys Thr Ala Lys Met Leu Lys Ser Phe Leu Lys Ala Gly Gly
Glu 275 280 285 Val Ile Asp Ser Val Thr Trp His His Tyr Tyr Leu Asn
Gly Arg Thr 290 295 300 Ala Thr Lys Glu Asp Phe Leu Asn Pro Asp Val
Leu Asp Ile Phe Ile 305 310 315 320 Ser Ser Val Gln Lys Val Phe Gln
Val Val Glu Ser Thr Arg Pro Gly 325 330 335 Lys Lys Val Trp Leu Gly
Glu Thr Ser Ser Ala Tyr Gly Gly Gly Ala 340 345 350 Pro Leu Leu Ser
Asp Thr Phe Ala Ala Gly Phe Met Trp Leu Asp Lys 355 360 365 Leu Gly
Leu Ser Ala Arg Met Gly Ile Glu Val Val Met Arg Gln Val 370 375 380
Phe Phe Gly Ala Gly Asn Tyr His Leu Val Asp Glu Asn Phe Asp Pro 385
390 395 400 Leu Pro Asp Tyr Trp Leu Ser Leu Leu Phe Lys Lys Leu Val
Gly Thr 405 410 415 Lys Val Leu Met Ala Ser Val Gln Gly Ser Lys Arg
Arg Lys Leu Arg 420 425 430 Val Tyr Leu His Cys Thr Asn Thr Asp Asn
Pro Arg Tyr Lys Glu Gly 435 440 445 Asp Leu Thr Leu Tyr Ala Ile Asn
Leu His Asn Val Thr Lys Tyr Leu 450 455 460 Arg Leu Pro Tyr Pro Phe
Ser Asn Lys Gln Val Asp Lys Tyr Leu Leu 465 470 475 480 Arg Pro Leu
Gly Pro His Gly Leu Leu Ser Lys Ser Val Gln Leu Asn 485 490 495 Gly
Leu Thr Leu Lys Met Val Asp Asp Gln Thr Leu Pro Pro Leu Met 500 505
510 Glu Lys Pro Leu Arg Pro Gly Ser Ser Leu Gly Leu Pro Ala Phe Ser
515 520 525 Tyr Ser Phe Phe Val Ile Arg Asn Ala Lys Val Ala Ala Cys
Ile 530 535 540 519PRTHomo sapiens 5Lys Gln Phe Ile Glu Asn Gly Ser
Glu Phe Ala Gln Lys Leu Leu Lys 1 5 10 15 Lys Phe Ser 619PRTHomo
sapiens 6Lys Gln Phe Ile Glu Asn Gly Ser Glu Phe Ala Asn Lys Leu
Leu Lys 1 5 10 15 Lys Phe Ser 725PRTHomo sapiens 7Lys Gln Phe Ile
Glu Asn Gly Ser Glu Phe Ala Gln Lys Leu Leu Lys 1 5 10 15 Lys Phe
Ser Leu Leu Lys Pro Trp Ala 20 25 825PRTHomo sapiens 8Lys Gln Phe
Ile Glu Asn Gly Ser Glu Phe Ala Asn Lys Leu Leu Lys 1 5 10 15 Lys
Phe Ser Leu Leu Lys Pro Trp Ala 20 25 935DNAArtificial
SequencePrimer 9ggtggtcata tgaaagcagg aaaaggaatg cacgg
351035DNAArtificial SequencePrimer 10ggtggtcata tgaaagcagg
aaaaggaatg cacgg 351130DNAArtificial SequencePrimer 11ggtggtcata
tgtatatctc cttcttaaag 30127PRTHomo sapiens 12Leu Ala Lys Ala Gly
Lys Gly 1 5 1314PRTHomo sapiens 13Ala Lys Ala Gly Lys Gly Met His
Gly Gly Val Pro Gly Gly 1 5 10 1424PRTHomo sapiens 14Leu Lys Ser
Ile Val Glu Lys Ser Ile Leu Leu Thr Glu Gln Ala Leu 1 5 10 15 Ala
Lys Ala Gly Lys Gly Met His 20 1521PRTHomo sapiens 15Glu Asn Gly
Ser Glu Phe Ala Gln Lys Leu Leu Lys Lys Phe Ser Leu 1 5 10 15 Leu
Lys Pro Trp Ala 20 1616PRTHomo sapiens 16Phe Ala Gln Lys Leu Leu
Lys Lys Phe Ser Leu Leu Lys Pro Trp Ala 1 5 10 15 1725PRTPan
troglodytes 17Lys Gln Phe Ile Glu Asn Gly Ser Glu Phe Ala Gln Lys
Leu Leu Lys 1 5 10 15 Lys Phe Ser Leu Leu Lys Pro Trp Ala 20 25
1826PRTOtolemur crassicaudatus 18Lys Gln Leu Val Glu Gly Gly Ser
Asp Phe Leu Gln Gln Met Met Lys 1 5 10 15 Lys Leu His Pro Leu Lys
Phe Trp Phe Ser 20 25 1925PRTGorilla gorilla 19Lys Gln Phe Ile Glu
Asn Gly Ser Glu Val Ala Gln Lys Leu Leu Lys 1 5 10 15 Lys Phe Ser
Leu Leu Lys Pro Trp Ala 20 25 2025PRTMacaca arctoides 20Lys Gln Phe
Ile Glu Asn Gly Asn Glu Phe Ala Lys Lys Leu Leu Lys 1 5 10 15 Lys
Phe Gly Leu Pro Lys Pro Trp Ala 20 25 2125PRTCallithrix jacchus
21Lys Gln Phe Phe Glu Ser Arg Asn Glu Ala Ala Gln Lys Leu Leu Lys 1
5 10 15 Arg Phe Gly Leu Thr Lys Leu Trp Asn 20 25 2225PRTMicrocebus
coquereli 22Lys Lys Leu Val Gly Asp Gly Asn Asp Phe Val Gln Gln Leu
Met Lys 1 5 10 15 Lys Trp His Pro Leu Lys Met Trp Phe 20 25
2325PRTPongo pygmaeus 23Lys Gln Phe Ile Glu Asn Gly Ser Glu Phe Ala
Gln Lys Leu Leu Lys 1 5 10 15 Lys Phe Ser Leu Leu Lys Pro Trp Ala
20 25 245PRTartificial sequenceelastin-like
polypeptideMISC_FEATURE(4)..(4)Xaa at position 4 is serine or
isoleucine 24Val Pro Gly Xaa Gly 1 5 25406DNAArtificial
Sequencesynthetic lacritin with restriction sties added
25catatggaag acgcttcttc tgactctacc ggtgctgacc cggctcagga agctggtacc
60tctaaaccga acgaagaaat ctctggtccg gctgaaccgg cttctccgcc ggaaaccacc
120accaccgctc aggaaacctc tgctgctgct gttcagggta ccgctaaagt
tacctcttct 180cgtcaggaac tgaacccgct gaaatctatc gttgaaaaat
ctatcctgct gaccgaacag 240gctctggcta aagctggtaa aggtatgcac
ggtggtgttc cgggtggtaa acagttcatc 300gaaaacggtt ctgaattcgc
tcagaaactg ctgaaaaaat tctctctgct gaaaccgtgg 360gctggtctgg
ttccgcgtgg ttctggttac tgatctcctc ggatcc 40626139PRTArtificial
SequenceELP lacritin fusion constructMISC_FEATURE(129)..(133)the
sequence VPGSG is directly repeated 48
timesMISC_FEATURE(134)..(138)The sequence VPGIG is directly
repeated 48 times 26Gly Glu Asp Ala Ser Ser Asp Ser Thr Gly Ala Asp
Pro Ala Gln Glu 1 5 10 15 Ala Gly Thr Ser Lys Pro Asn Glu Glu Ile
Ser Gly Pro Ala Glu Pro 20 25 30 Ala Ser Pro Pro Glu Thr Thr Thr
Thr Ala Gln Glu Thr Ser Ala Ala 35 40 45 Ala Val Gln Gly Thr Ala
Lys Val Thr Ser Ser Arg Gln Glu Leu Asn 50 55 60 Pro Leu Lys Ser
Ile Val Glu Lys Ser Ile Leu Leu Thr Glu Gln Ala 65 70 75 80 Leu Ala
Lys Ala Gly Lys Gly Met His Gly Gly Val Pro Gly Gly Lys 85 90 95
Gln Phe Ile Glu Asn Gly Ser Glu Phe Ala Gln Lys Leu Leu Lys Lys 100
105 110 Phe Ser Leu Leu Lys Pro Trp Ala Gly Leu Val Pro Arg Gly Ser
Gly 115 120 125 Val Pro Gly Ser Gly Val Pro Gly Ile Gly Tyr 130 135
27134PRTArtificial SequenceELP lacritin fusion
constructMISC_FEATURE(129)..(133)the sequence VPGSG is directly
repeated 96 times 27Gly Glu Asp Ala Ser Ser Asp Ser Thr Gly Ala Asp
Pro Ala Gln Glu 1 5 10 15 Ala Gly Thr Ser Lys Pro Asn Glu Glu Ile
Ser Gly Pro Ala Glu Pro 20 25 30 Ala Ser Pro Pro Glu Thr Thr Thr
Thr Ala Gln Glu Thr Ser Ala Ala 35 40 45 Ala Val Gln Gly Thr Ala
Lys Val Thr Ser Ser Arg Gln Glu Leu Asn 50 55 60 Pro Leu Lys Ser
Ile Val Glu Lys Ser Ile Leu Leu Thr Glu Gln Ala 65 70 75 80 Leu Ala
Lys Ala Gly Lys Gly Met His Gly Gly Val Pro Gly Gly Lys 85 90 95
Gln Phe Ile Glu Asn Gly Ser Glu Phe Ala Gln Lys Leu Leu Lys Lys 100
105 110 Phe Ser Leu Leu Lys Pro Trp Ala Gly Leu Val Pro Arg Gly Ser
Gly 115 120 125 Val Pro Gly Ser Gly Tyr 130 2810PRTArtificial
SequenceELP lacritin fusion constructMISC_FEATURE(1)..(5)the
sequence VPGSG is directly repeated 48
timesMISC_FEATURE(6)..(10)The sequence VPGIG is directly repeated
48 times 28Val Pro Gly Ser Gly Val Pro Gly Ile Gly 1 5 10
* * * * *