U.S. patent application number 15/457269 was filed with the patent office on 2017-10-19 for phosphorylation of histones and uses thereof.
The applicant listed for this patent is H. LEE MOFFITT CANCER CENTER AND RESEARCH INSTITUTE, INC.. Invention is credited to Kiran Mahajan, Nupam P. Mahajan.
Application Number | 20170299599 15/457269 |
Document ID | / |
Family ID | 47599168 |
Filed Date | 2017-10-19 |
United States Patent
Application |
20170299599 |
Kind Code |
A1 |
Mahajan; Kiran ; et
al. |
October 19, 2017 |
PHOSPHORYLATION OF HISTONES AND USES THEREOF
Abstract
Phosphorylation of histones was observed at certain tyrosine
residues which have not been associated with epigenetic
modification. These sites include H2B Tyr37, H4 Tyr88 and Tyr 51
and H3 Tyr99. Kinases responsible for the phosphorylation as well
as downstream genes regulated by such phosphorylation were also
identified. Antibodies that are specific to such phosphorylated
histones have been generated, which are useful for detecting the
phosphorylation and related events. With such findings, the present
disclosure provides compositions and methods for disease diagnosis,
prognosis and therapy selection, in particular for cancer, obesity
and diabetes.
Inventors: |
Mahajan; Kiran; (Tampa,
FL) ; Mahajan; Nupam P.; (Tampa, FL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
H. LEE MOFFITT CANCER CENTER AND RESEARCH INSTITUTE, INC. |
Tampa |
FL |
US |
|
|
Family ID: |
47599168 |
Appl. No.: |
15/457269 |
Filed: |
March 13, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14322587 |
Jul 2, 2014 |
9594084 |
|
|
15457269 |
|
|
|
|
PCT/US2013/020395 |
Jan 4, 2013 |
|
|
|
14322587 |
|
|
|
|
61583864 |
Jan 6, 2012 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12Q 2600/106 20130101;
G01N 2440/14 20130101; C07K 2317/34 20130101; C12Q 2600/118
20130101; C07K 7/08 20130101; G01N 33/57484 20130101; C12Q 1/485
20130101; G01N 33/573 20130101; C12Q 2600/158 20130101; C07K 16/18
20130101; G01N 33/57496 20130101; G01N 2333/912 20130101; G01N
33/57407 20130101; C12Q 1/6886 20130101 |
International
Class: |
G01N 33/574 20060101
G01N033/574; G01N 33/573 20060101 G01N033/573; C07K 7/08 20060101
C07K007/08; C12Q 1/68 20060101 C12Q001/68; G01N 33/574 20060101
G01N033/574; G01N 33/574 20060101 G01N033/574; C07K 16/18 20060101
C07K016/18; C12Q 1/48 20060101 C12Q001/48 |
Claims
1. A method for detecting the activity of a WEE1 protein in a
sample, comprising: contacting the sample with a polypeptide
comprising an amino acid sequence of SEQ ID NO: 62
(KRSRKESYSVYVYKVL) or an amino acid sequence having at least about
95% sequence identity to SEQ ID NO: 62, wherein the Y(Tyr)8 residue
is unphosphorylated, under conditions allowing the WEE1 protein to
phosphorylate the Tyr8 residue; and detecting phosphorylation at
the Tyr8 residue, wherein detected phosphorylation indicates WEE1
protein activity in the sample.
2. The method of claim 1, wherein the phosphorylation is detected
with a probe that specifically recognizes the polypeptide with the
phosphorylated Tyr8 residue.
3. The method of claim 2, wherein the probe comprises an
antibody.
4. The method of claim 3, wherein the antibody is a phosphospecific
antibody having specificity to the polypeptide with the
phosphorylated Tyr8 residue.
5. The method of claim 1, wherein the sample comprises a cancer
cell or a cell isolated from a subject suspected of having
cancer.
6. An isolated polypeptide comprising an amino acid sequence of SEQ
ID NO: 63 (KRSRKESpYSVYVYKVL) or an amino acid sequence having at
least about 95% sequence identity to SEQ ID NO: 63, wherein the
Y(Tyr)8 residue is phosphorylated and a carrier.
7. An isolated antibody that specifically recognizes SEQ ID NO: 63
(KRSRKESpYSVYVYKVL), wherein the Y(Tyr)8 residue is phosphorylated,
with the proviso that the antibody is not a polyclonal antibody or
an isolated naturally occurring antibody.
8. An isolated antibody that specifically recognizes a histone H2B
protein comprising a phosphorylated Tyr37 residue, with the proviso
that the antibody is not a polyclonal antibody or an isolated
naturally occurring antibody.
9. A method for identifying a cell with an activated WEE1 protein,
comprising detecting phosphorylation of a histone H2B protein at
the Tyr37 residue in the cell, wherein phosphorylation of the Tyr37
residue indicates presence of an activated WEE1 protein in the
cell.
10. A method for identifying a subject as having cancer or at risk
of developing cancer and further progressing to metastatic disease,
comprising: detecting one or more of: (a) phosphorylation of a
histone H2B protein at the Tyr37 residue in a cell isolated from a
subject; (b) expression of one or more genes in the Hist1 gene
cluster of cell; or (c) expression of one or more microRNA selected
from the group consisting of Mir26b, Mir149, Mir346, Mir350,
Mir491, Mir599, Mir670, Mir708, Mir760, Mir879, Mir1192, Mir1965,
Mir3058 and Mir5098; or (d) expression of one or more genes
selected from the group consisting of IDH2, DNMT3B, JARID2, EYA3,
JMJD2c, JMJD1C, CREBBP, SOX4 and SOX18, and identifying that the
subject has cancer or is at risk of developing cancer if: (e) the
phosphorylation is detected in the cell; (f) the expression of the
genes in the Hist1 gene cluster is decreased as compared to a
suitable control sample; (g) the expression of the microRNA is
different as compared to a suitable control sample; or (h) the
expression of the genes of (d) is different as compared to a
suitable control sample.
11. A method for selecting a cancer patient for a therapy
comprising a WEE1 kinase inhibitor, comprising: detecting one or
more of: (a) phosphorylation of a histone H2B protein at the Tyr37
residue in a cell isolated from a cancer patient; (b) expression of
one or more genes in the Hist1 gene cluster of cell; or (c)
expression of one or more microRNA selected from the group
consisting of Mir26b, Mir149, Mir346, Mir350, Mir491, Mir599,
Mir670, Mir708, Mir760, Mir879, Mir1192, Mir1965, Mir3058 and
Mir5098; or (d) expression of one or more genes selected from the
group consisting of IDH2, DNMT3B, JARID2, EYA3, JMJD2c, JMJD1C,
CREBBP, SOX4 and SOX18, and selecting the cancer patient for the
therapy if: (e) the phosphorylation is detected in the cell; (f)
the expression of the genes in the Hist1 gene cluster is decreased
as compared to a suitable control sample; (g) the expression of the
microRNA is different as compared to a suitable control sample; or
(h) the expression of the genes of (d) is different as compared to
a suitable control sample.
12. The method of claim 11, further comprising administering the
therapy to the cancer patient.
13. The method of claim 11 or 12, wherein the cancer patient
suffers from brain cancer, glioblastomas, breast cancer, melanoma,
lung cancer, prostate cancer, ovarian cancer, pancreatic cancer,
lymphoma, or leukemia.
14. An isolated polypeptide comprising an amino acid sequence of
SEQ ID NO: 65 (TVTAMDVVpYALKRQGRT) or an amino acid sequence having
at least about 95% sequence identity to SEQ ID NO: 65, wherein the
Y(Tyr)9 residue is phosphorylated and a carrier.
15. An isolated antibody that specifically recognizes SEQ ID NO: 65
(TVTAMDVVpYALKRQGRT), wherein the Y(Tyr)9 residue is
phosphorylated, with the proviso that the antibody is not a
polyclonal antibody or an isolated naturally occurring
antibody.
16. An isolated antibody that specifically recognizes a histone H4
protein comprising a phosphorylated Tyr88 residue, with the proviso
that the antibody is not a polyclonal antibody or an isolated
naturally occurring antibody.
17. A method for detecting the activity of a WEE1 protein or an
Ack1 protein in a sample, comprising: contacting the sample with a
polypeptide comprising an amino acid sequence of SEQ ID NO: 64
(TVTAMDVVYALKRQGRT) or an amino acid sequence having at least about
95% sequence identity to SEQ ID NO: 64, wherein the Y(Tyr)9 residue
is unphosphorylated, under conditions allowing the WEE1 protein or
the Ack1 protein to phosphorylate the Tyr9 residue; and then
detecting phosphorylation at the Tyr9 residue, wherein detected
phosphorylation indicates that WEE1 protein activity and/or Ack1
protein activity is likely present in the sample.
18. A method for identifying a cell with an activated WEE1 protein
or an activated Ack1 protein, comprising detecting phosphorylation
of a histone H4 protein at the Tyr88 residue in the cell, wherein
phosphorylation of the Tyr88 residue indicates likely presence of
an activated WEE1 protein and/or an activated Ack1 protein in the
cell.
19. A method for identifying a subject as having cancer or at risk
of developing cancer, comprising detecting phosphorylation of a
histone H4 protein at the Tyr88 residue in a cell isolated from the
subject, and identifying that the subject has cancer or is at risk
of developing cancer if phosphorylation of the Tyr88 residue is
detected.
20. A method for selecting a cancer patient for a therapy
comprising a WEE1 kinase inhibitor, an Ack1 inhibitor and/or an
EGFR inhibitor, comprising detecting phosphorylation of a histone
H4 protein at the Tyr88 residue in a cell isolated from the
subject, and selecting the cancer patient for the therapy if
phosphorylation of the Tyr88 residue is detected.
21-50. (canceled)
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 14/322,587, filed Jul. 2, 2014, which is a continuation-in-part
of International Application No. PCT/US2013/020395, filed Jan. 4,
2013, which in turn claims the benefit under 35 U.S.C. .sctn.119(e)
of U.S. Provisional Application No. 61/583,864, filed Jan. 6, 2012,
which is incorporated by reference in its entirety.
FIELD OF THE DISCLOSURE
[0002] The disclosure is generally related to compositions and
methods for detecting phosphorylated histones and determining
activities of kinases regulating such phosphorylation. Also
disclosed are methods of disease diagnosis, prognosis and therapy
selection based on such detection and determination.
BACKGROUND
[0003] Histones are abundant and highly essential eukaryotic
proteins that are basic in nature. Two molecules of each of the
four core histones, H2A, H2B, H3 and H4, constitute the histone
octamer, around which 147 base pairs of DNA are wrapped to form the
nucleosome core particle. The core particle is the fundamental
repeating unit of eukaryotic chromatin. A linker histone, also
known as histone H1, is present in higher eukaryotes and seals two
full turns of the DNA to form the complete nucleosome. The major
function of nucleosome was appreciated early--this nucleosomal
structure is repeated until the entire genomic DNA is packaged into
chromatin fibers. The chromatin fibers undergo further compaction
to form chromosomes, the basic units of genetic information in all
living eukaryotes. In last decade or so it became apparent that
histones and chromatin structure regulate access to the information
contained within the DNA. And this information plays a crucial role
in majority of cellular and metabolic processes e.g. transcription,
replication, recombination and DNA damage and repair. This truly
has opened the door for the deeper understanding of how histone
modification and subsequent changes in chromatin regulates normal
human physiology. But the most critical issue is how this process
is involved in various diseases e.g. cancer, diabetes and
aging.
[0004] It is becoming clear that post-translational modifications
of histones are important. So far, the core histones have been
shown to be phosphorylated, acetylated, methylated, sumoylated,
ribosylated and ubiquitylated at various amino acid residues,
forming a `histone code` or `epigenetic code`. The histone code
suggests that histone modifications not only alter the affinity of
histones for DNA but importantly act as recognition or binding
sites for various factors or proteins to assemble at the site of
modification. This results in relay of information that leads to
initiation or suppression of specific cellular event or process.
Interestingly, the epigenetic code also results in crosstalk
between the different modifications, e.g. phosphorylation,
methylation, acetylation and ubiquitination.
[0005] Histone modifications are the epigenetic changes. It is now
known that in addition to genetic defects, epigenetic defects can
also result in disease. Epigenetics is also thought to play a major
role in the pathogenesis of common, multifactorial disorders. For
example, there is evidence suggesting that the primary (idiopathic)
disorders like schizophrenia and bipolar disorder are epigenetic
defects rather than genetic defects. Epigenetic factors have also
been shown to be involved in aging, in rare monogenic disorders
like fragile-X mental retardation, and in lymphomas.
SUMMARY
[0006] In one embodiment, the present disclosure provides a method
for detecting the activity of a WEE1 protein in a sample,
comprising contacting the sample with a polypeptide comprising an
amino acid sequence of SEQ ID NO: 62 (KRSRKESYSVYVYKVL) or an amino
acid sequence having at least about 95% sequence identity to SEQ ID
NO: 62, wherein the Y(Tyr)8 residue is unphosphorylated, under
conditions allowing the WEE1 protein to phosphorylate the Tyr8
residue; and detecting phosphorylation at the Tyr8 residue, wherein
detected phosphorylation indicates WEE1 protein activity in the
sample.
[0007] In some aspects, the phosphorylation is detected with a
probe that specifically recognizes the polypeptide with the
phosphorylated Tyr8 residue. In some aspects, the probe comprises
an antibody. In some aspects, the antibody is a phosphospecific
antibody having specificity to the polypeptide with the
phosphorylated Tyr8 residue.
[0008] In some aspects, the sample comprises a cancer cell or a
cancer stem cell isolated from a subject suspected of having
cancer.
[0009] Also provided, in one embodiment, is an isolated polypeptide
comprising an amino acid sequence of SEQ ID NO: 63
(KRSRKESpYSVYVYKVL) or an amino acid sequence having at least about
95% sequence identity to SEQ ID NO: 63, wherein the Y(Tyr)8 residue
is phosphorylated.
[0010] Also provided, in one embodiment, is an isolated antibody
that specifically recognizes SEQ ID NO: 63 (KRSRKESpYSVYVYKVL),
wherein the Y(Tyr)8 residue is phosphorylated. Also provided, in
another embodiment, is an isolated antibody that specifically
recognizes a histone H2B protein comprising a phosphorylated Tyr37
residue.
[0011] Another embodiment provides a method for identifying a cell
with an activated WEE1 protein, comprising detecting
phosphorylation of a histone H2B protein at the Tyr37 residue in
the cell, wherein phosphorylation of the Tyr37 residue indicates
presence of an activated WEE1 protein in the cell.
[0012] A method is provided, in one embodiment, for identifying a
subject as having cancer or at risk of developing cancer,
comprising detecting one or more of (a) phosphorylation of a
histone H2B protein at the Tyr37 residue in a cell isolated from a
subject; (b) expression of one or more genes in the Hist1 gene
cluster of cell; or (c) expression of one or more microRNA selected
from the group consisting of Mir26b, Mir149, Mir346, Mir350,
Mir491, Mir599, Mir670, Mir708, Mir760, Mir879, Mir1192, Mir1965,
Mir3058 and Mir5098, or (d) expression of one or more genes
selected from the group consisting of IDH2, DNMT3B, JARID2, EYA3,
JMJD2c, JMJDIC, CREBBP, SOX4 and SOX18, and identifying that the
subject has cancer or is at risk of developing cancer if: (e) the
phosphorylation is detected in the cell; (f) the expression of the
genes in the Hist1 gene cluster is decreased as compared to a
suitable control sample; (g) the expression of the microRNA is
different as compared to a suitable control sample; or (h) the
expression of the genes of (d) is different as compared to a
suitable control sample.
[0013] In one embodiment, provided is a method for selecting a
cancer patient for a therapy comprising a WEE1 kinase inhibitor,
comprising: detecting one or more of: (a) phosphorylation of a
histone H2B protein at the Tyr37 residue in a cell isolated from a
cancer patient; (b) expression of one or more genes in the Hist1
gene cluster of cell; or (c) expression of one or more microRNA
selected from the group consisting of Mir26b, Mir149, Mir346,
Mir350, Mir491, Mir599, Mir670, Mir708, Mir760, Mir879, Mir1192,
Mir1965, Mir3058 and Mir5098, or (d) expression of one or more
genes selected from the group consisting of IDH2, DNMT3B, JARID2,
EYA3, JMJD2c, JMJDIC, CREBBP, SOX4 and SOX18, and selecting the
cancer patient for the therapy if: (e) the phosphorylation is
detected in the cell; (f) the expression of the genes in the Hist1
gene cluster is decreased as compared to a suitable control sample;
(g) the expression of the microRNA is different as compared to a
suitable control sample; or (h) the expression of the genes of (d)
is different as compared to a suitable control sample.
[0014] In some aspect, the method further comprises administering
the therapy to the cancer patient. In some aspects, the cancer
patient suffers from brain cancer, glioblastomas, breast cancer,
melanoma, lung cancer, prostate cancer, pancreatic cancer, ovarian
cancer, lymphoma, or leukemia.
[0015] Another embodiment provides an isolated polypeptide
comprising an amino acid sequence of SEQ ID NO: 65
(TVTAMDVVpYALKRQGRT) or an amino acid sequence having at least
about 95% sequence identity to SEQ ID NO: 65, wherein the Y(Tyr)9
residue is phosphorylated.
[0016] Provided also is an isolated antibody that specifically
recognizes SEQ ID NO: 65 (TVTAMDVVpYALKRQGRT), wherein the Y(Tyr)9
residue is phosphorylated. Provided also is an isolated antibody
that specifically recognizes a histone H4 protein comprising a
phosphorylated Tyr88 residue.
[0017] In one embodiment, provided is a method for detecting the
activity of a WEE1 protein or an Ack1 protein in a sample,
comprising: contacting the sample with a polypeptide comprising an
amino acid sequence of SEQ ID NO: 64 (TVTAMDVVYALKRQGRT) or an
amino acid sequence having at least about 95% sequence identity to
SEQ ID NO: 64, wherein the Y(Tyr)9 residue is unphosphorylated,
under conditions allowing the WEE1 protein or the Ack1 protein to
phosphorylate the Tyr9 residue; and then detecting phosphorylation
at the Tyr9 residue, wherein detected phosphorylation indicates
that WEE1 protein activity and/or Ack1 protein activity is likely
present in the sample.
[0018] Yet another embodiment provides a method for identifying a
cell with an activated WEE1 protein or an activated Ack1 protein,
comprising detecting phosphorylation of a histone H4 protein at the
Tyr88 residue in the cell, wherein phosphorylation of the Tyr88
residue indicates likely presence of an activated WEE1 protein
and/or an activated Ack1 protein in the cell.
[0019] Also provided is a method for identifying a subject as
having cancer or at risk of developing cancer, comprising detecting
phosphorylation of a histone H4 protein at the Tyr88 residue in a
cell isolated from the subject, and identifying that the subject
has cancer or is at risk of developing cancer if phosphorylation of
the Tyr88 residue is detected.
[0020] One embodiment of the disclosure provides a method for
selecting a cancer patient for a therapy comprising a WEE1 kinase
inhibitor, an Ack1 inhibitor and/or an EGFR inhibitor, comprising
detecting phosphorylation of a histone H4 protein at the Tyr88
residue in a cell isolated from the subject, and selecting the
cancer patient for the therapy if phosphorylation of the Tyr88
residue is detected. In some aspects, the method further comprises
administering the therapy to the cancer patient. In some aspects,
the cancer patient suffers from brain cancer, breast cancer,
prostate cancer, pancreatic cancer, melanoma or lung cancer.
[0021] Provided, in one embodiment, is an isolated polypeptide
comprising an amino acid sequence of SEQ ID NO: 67
(KRISGLIpYEETRGVL) or an amino acid sequence having at least about
95% sequence identity to SEQ ID NO: 67, wherein the Y(Tyr)8 residue
is phosphorylated and wherein the polypeptide does not include a
histone H4 protein.
[0022] Also provided is an isolated antibody that specifically
recognizes SEQ ID NO: 67 (KRISGLIpYEETRGVL), wherein the Y(Tyr)8
residue is phosphorylated. Also provided is an antibody that
specifically recognizes a histone H4 protein comprising a
phosphorylated Tyr51 residue.
[0023] A method is provided for detecting the activity of an Ack1
protein, an EGFR protein or an insulin receptor in a sample,
comprising: contacting the sample with a polypeptide comprising an
amino acid sequence of SEQ ID NO: 66 (KRISGLIYEETRGVL) or an amino
acid sequence having at least about 95% sequence identity to SEQ ID
NO: 66, wherein the Y(Tyr)8 residue is unphosphorylated, under
conditions allowing the Ack1 protein, the EGFR protein or the
insulin receptor to activates phosphorylation of the Tyr8 residue;
and then detecting phosphorylation at the Tyr8 residue, wherein
detected phosphorylation indicates that Ack1 protein activity, EGFR
protein activity or insulin receptor activity is likely present in
the sample.
[0024] Yet provided, in one embodiment, is a method for identifying
a cell with an activated Ack1 protein, EGFR protein or insulin
receptor, comprising detecting phosphorylation of a histone H4
protein at the Tyr51 residue in the cell, wherein phosphorylation
of the Tyr51 residue indicates likely presence of an activated Ack1
protein, EGFR protein and/or insulin receptor protein in the
cell.
[0025] Provided also is a method for identifying a subject as
having cancer or at risk of developing cancer, comprising detecting
phosphorylation of a histone H4 protein at the Tyr51 residue in a
cell isolated from the subject, and identifying that the subject
has cancer or is at risk of developing cancer if phosphorylation of
the Tyr51 residue is detected.
[0026] One embodiment provides a method for selecting a cancer
patient for a therapy comprising an Ack1 inhibitor, an EGFR
inhibitor and/or an insulin receptor inhibitor, comprising
detecting phosphorylation of a histone H4 protein at the Tyr51
residue in a cell isolated from the subject, and selecting the
cancer patient for the therapy if phosphorylation of the Tyr51
residue is detected. In some aspects, the method further comprises
administering the therapy to the cancer patient. In some aspects,
the cancer patient suffers from brain cancer, breast cancer,
melanoma, prostate cancer, pancreatic cancer or lung cancer.
[0027] One embodiment provides an isolated polypeptide comprising
an amino acid sequence of SEQ ID NO: 69 (ALQEACEApYLVGLFED) or an
amino acid sequence having at least about 95% sequence identity to
SEQ ID NO: 69, wherein the Y(Tyr)9 residue is phosphorylated and
wherein the polypeptide does not include a histone H3 protein.
[0028] One embodiment provides an isolated antibody that
specifically recognizes SEQ ID NO: 69 (ALQEACEApYLVGLFED), wherein
the Y(Tyr)9 residue is phosphorylated. Another embodiment provides
an isolated antibody that specifically recognizes a histone H3
protein comprising a phosphorylated Tyr99 residue.
[0029] Another embodiment provides a method for detecting the
activity of an Ack1 protein, an EGFR protein, an FGFR protein or an
insulin receptor in a sample, comprising: contacting the sample
with a polypeptide comprising an amino acid sequence of SEQ ID NO:
68 (ALQEACEAYLVGLFED) or an amino acid sequence having at least
about 95% sequence identity to SEQ ID NO: 68, wherein the Y(Tyr)9
residue is unphosphorylated, under conditions allowing the Ack1
protein, the EGFR protein, the FGFR protein or the insulin receptor
to activate phosphorylation of the Tyr9 residue; and then detecting
phosphorylation at the Tyr9 residue, wherein detected
phosphorylation indicates that Ack1 protein activity, EGFR protein
activity, FGFR activity or insulin receptor activity is likely
present in the sample.
[0030] In another embodiment, provided is a method for identifying
a cell with an activated Ack1 protein, EGFR protein, FGFR protein
or insulin receptor, comprising detecting phosphorylation of a
histone H3 protein at the Tyr99 residue in the cell, wherein
phosphorylation of the Tyr99 residue indicates likely presence of
an activated Ack1 protein, EGFR protein, FGFR protein and/or
insulin receptor protein in the cell.
[0031] Also provided is a method for identifying a subject as
having cancer or at risk of developing cancer, comprising detecting
phosphorylation of a histone H3 protein at the Tyr99 residue in a
cell isolated from the subject, and identifying that the subject
has cancer or is at risk of developing cancer if phosphorylation of
the Tyr99 residue is detected.
[0032] Also provided is a method for selecting a cancer patient for
a therapy comprising an Ack1 inhibitor, an EGFR inhibitor, an FGFR
inhibitor and/or an insulin receptor inhibitor, comprising
detecting phosphorylation of a histone H3 protein at the Tyr99
residue in a cell isolated from the subject, and selecting the
cancer patient for the therapy if phosphorylation of the Tyr99
residue is detected. In some aspects, the method further comprises
administering the therapy to the cancer patient. In some aspects,
the cancer patient suffers from prostate cancer, pancreatic cancer,
breast cancer, melanoma or lung cancer.
[0033] Provided is a method for reducing the body weight or
treating obesity or diabetes in a subject, comprising administering
to the subject an Ack1 inhibitor or an agent that decrease the
expression or activity of Ack1. In one aspect, the Ack1 inhibitor
is a small molecule inhibitor or siRNA. In one aspect, the Ack1
inhibitor comprises AIM-100 or an isolated Ack1 antibody.
[0034] Applicants provide methods for selecting a cancer patient
for a therapy comprising a WEE1 inhibitor, by determining the
expression level of the WEE1 protein and IDH2 protein in a sample
isolated from the patient, wherein a) overexpression of WEE1
protein and b) underexpression of IDH2 protein in the sample as
compared to a control for the WEE1 protein expression level and a
control for the IDH2 protein, respectively, selects the cancer
patient for the therapy and neither a) nor b) does not select the
patient for the therapy. The method can, in one aspect, further
comprise, or alternatively consist essentially of, or yet further
consist of, administering an effective amount of the WEE1 inhibitor
to the cancer patient. Such therapies are known in the art and are
described herein.
[0035] Suitable cancer patients for this method include for
example, a cancer patient suffers from brain cancer, glioblastoma,
GBM, melanoma and prostate cancer.
[0036] Samples for use in the method comprise, or alternatively
consist essentially of, or yet further consist of, one or more of a
cancer or tumor cell isolated from the patient.
[0037] Any appropriate method for determining the expression level
of the WEE1 protein can be used. Non-limiting examples of such
include a method comprising determining the amount of mRNA encoding
the WEE1 protein in the sample or a method comprising
immunohistochemistry, e.g., using an antibody that specifically
recognizes the WEE1 protein. These antibodies are known in the art
and described herein. In one aspect, the antibody is not a
polyclonal or naturally-occurring antibody.
[0038] Yet further, the expression level of the IDH2 protein is
determined by a method comprising determining the amount of mRNA
encoding the IDH2 protein in the sample or by a method comprising
immunohistochemistry. In one aspect the immunohistochemical method
comprises the use of an anti-IDH2 specific antibody. These
antibodies are known in the art. In one aspect, the antibody is not
a polyclonal or naturally-occurring antibody.
[0039] The method may be repeated after the anti-WEE1 therapy is
initiated and based on the second or subsequent measurement, the
therapy can be adjusted as needed and as determined by the treating
physician or veternarian.
[0040] Kits are also provided. In one aspect, the kit comprises (a)
one or more proteins selected from: (i) a polypeptide comprising an
amino acid sequence of SEQ ID NO: 62 (KRSRKESYSVYVYKVL) or an amino
acid sequence having at least about 95% sequence identity to SEQ ID
NO: 62, wherein the Y(Tyr)8 residue is unphosphorylated; (ii) a
polypeptide comprising an amino acid sequence of SEQ ID NO: 64
(TVTAMDVVYALKRQGRT) or an amino acid sequence having at least about
95% sequence identity to SEQ ID NO: 64, wherein the Y(Tyr)9 residue
is unphosphorylated; (iii) a polypeptide comprising an amino acid
sequence of SEQ ID NO: 66 (KRISGLIYEETRGVL) or an amino acid
sequence having at least about 95% sequence identity to SEQ ID NO:
66, wherein the Y(Tyr)8 residue is unphosphorylated; or (iv) a
polypeptide comprising an amino acid sequence of SEQ ID NO: 68
(ALQEACEAYLVGLFED) or an amino acid sequence having at least about
95% sequence identity to SEQ ID NO: 68, wherein the Y(Tyr)9 residue
is unphosphorylated, and (b) one or more antibodies that
specifically recognize the one or more proteins of (a). In some
aspects, the one or more proteins are affixed on a scaffold.
[0041] Hybridomas for producing the antibodies of the present
disclosure are also provided, in some embodiments.
BRIEF DESCRIPTION OF THE DRAWINGS
[0042] Provided as embodiments of this disclosure are drawings
which illustrate by exemplification only, and not limitation.
[0043] FIGS. 1A-1F show relevant data._FIG. 1A is a diagram
illustrating the position of histone genes in mouse Hist1
subcluster 1 showing two pTyr37-H2B binding sites. Starting
nucleotide position is shown above. Subcluster1 is conserved
between human and mouse. FIG. 1B-1D are bar graphs showing Native
Chromatin immunoprecipitation (ChIP) (% input DNA) in synchronized
MEFs treated with WEE1 inhibitor or untreated and harvested at 0
and 6.30 hours post-release. Native ChIP was performed using
pTyr37-H2B or IgG antibodies followed by quantitative PCR using
primers corresponding to Site I (FIG. 18), Site 11 (FIG. 1C) and
control site (FIG. 1D). Data shown are representative of three
independent experiments. *p=0.001, **p=0.006. FIG. 1E is bar graph
showing ChIP in synchronized MEFs harvested at 0 and 6.30 hours
post-release using WEE1 or IgG antibodies followed by quantitative
PCR using primers corresponding to Site II. Data shown are
representative of three independent experiments. ***p=0.02. FIG. 1F
is bar graph showing ChIP in cells transfected with control or WEE1
siRNAs performed using pTyr37-H2B antibodies followed by
quantitative PCR using primers corresponding to Site II. Data shown
are representative of three independent experiments.
****p=0.001.
[0044] FIGS. 2A-2G show histone RNA levels. FIG. 2A is a graph
showing synchronized histone RNA levels (relative to actin) in MEFs
harvested at 0, 2, 4, 5, 6.30, 7, 8, and 8.30 hours post-release.
Total RNA was prepared followed by quantitative RT-PCR for H2B1,
H2Ai, H3h, H2Bm, H2Ak and H2Bn transcripts. Data are representative
of three independent experiments. FIG. 2B-2G are graphs showing
histone RNA levels (relative to actin) in synchronized MEFs treated
with WEE1 inhibitor, MK1775 (0.625 .mu.M, 14 hr) or untreated and
harvested at indicated time points post-release. Total RNA was
prepared followed by quantitative RT-PCR. Data are representative
of three independent experiments. *p=0.027; **p=0.031, ***p=0.0059;
****p=0.002; *****p=0.017, ******p=0.0012.
[0045] FIGS. 3A-3L show relevant data. FIG. 3A is an alignment of
H2B protein sequences indicating that tyrosine residue at 37 is
invariant from human to yeast. FIG. 3B-3F are graphs showing
histone RNA (relative to actin) in wildtype (WT) and Y40A mutant
yeast cells treated with a-factor for 3 hours, washed and harvested
at indicated time points post-release. Total RNA was prepared
followed by qRT-PCR for histones transcripts. FAGS analysis of
yeast cells was performed to determine exit of cells from GO stage
(0 minutes) and entry into cell cycle. Data are representative of
three independent experiments. The p values for 30 minutes are as
follows: #p=0.024; ##p=0.008; ###p=0.0083; ####p=0.037. FIG. 3G to
3H are graphs showing ChIP (% input DNA) in synchronized MEFs
treated with WEE1 inhibitor or untreated and harvested 6.30 hours
post-release. ChIP was performed using NPAT and IgG antibodies
(FIG. 3G) or RNA Pol II and IgG (FIG. 3H) followed by qPCR using
primers corresponding to Site II. *p=0.0018, **p=0.01. FIG. 31 is
an immunoblot showing total histones prepared from synchronized WT
(first three columns) and Y40A mutant yeast cells (last three
columns) 0, 20, and 30 minutes post release that were
immunoprecipitated with pTyr37-H2B antibodies and immunoblotted
with yeast H2B antibodies (upper panel) or yeast tubulin antibodies
(bottom panel). FIG. 3J is an immunoblot showing total histones
prepared from WT and swe1LI mutant yeast cells subjected to
SOS-PAGE followed by immunoblotting with pTyr37-H2B (top panel) and
H2B (bottom panel) antibodies. FIG. 3K is an immunoblot showing
synchronized MEFs untreated (left column) or treated with WEE1
inhibitor (right column) that were harvested 6.30 hours
post-release and immunoblotted with antibodies to pTyr37-H2B (first
row), NPAT (second row), pTyr15-Cdc2 (third row), H2B (fourth row),
or Tubulin (bottom row). FIG. 3L is an immunoblot showing
immobilized unmodified and Tyr37-phosphorylated H2B (25-49)
peptides that were incubated with HEK293 cell lysates followed by
immunoblotting with NPAT antibody (top panel) or staining with
coommassie blue (middle panel).
[0046] FIG. 4A-4C are histograms identifying the histone H2B
Tyr37-phosphorylation site. Histones were purified from HEK293
cells, followed by trypsin/chymotrypsin digestion. The peptide was
detected at 21.7 mins in the total ion chromatogram (FIG. 4A) with
mass-to-charge ratio 609.2303 (FIG. 4C). The tandem mass spectrum
matched the sequence, ESpYSVYVYK (SEQ ID NO:1) indicating that the
tyrosine 37 was phosphorylated; the detection of the y6 and y7 is
consistent with this localization (FIG. 4C). The assignment was
made with Sequest with XCorr 2.34 and .DELTA.CN: 0.27.
[0047] FIGS. 5A-5D are flow cytometry plots showing percentage of
synchronized MEFs cells in S phase (EdU-Alexa 488 uptake) untreated
or after treatment with WEE1 inhibitor harvested at 0 hours or 6.30
hours post-release into the media. EdU was added and cells were
harvested 6.30 hours post-release. Cells were fixed and `Click-it`
reaction (Invitrogen) was performed followed by flow cytometry.
[0048] FIG. 5E is an immunoblot showing histones harvested 0 and
6.30 hours post-release from synchronized MEFs and immunoblotted
with pTyr37-H2B antibodies (top panel), immunoblotted with H2B
antibodies (middle panel), or stained with Ponceau (bottom
panel).
[0049] FIGS. 6A and 6B are line graphs showing yeast Swe1 mutant
(swe1A) exhibits increased transcription of histones HTA1 (FIG. 6A)
and HTB1 (FIG. 6B). The WT and swe1A mutant yeast cells were
treated with .alpha.-factor for 3 hours, washed and cells were
released in YPD media and harvested at indicated time points
post-release. Total RNA was prepared followed by qRT-PCR for
histones transcripts. Data are representative of three independent
experiments. The p values are as follows: *p=0.00001,
**p=0.037.
[0050] FIGS. 7A and 7B are bar graphs showing RNA Pol II is not
present at site II in NPAT depleted cells. a and b, The
synchronized MEFs were a. treated with WEE1 inhibitor or untreated,
b. transfected with control or NPAT siRNAs, were harvested 6.30
hours post-release. ChIP was performed using RNA Pol II (FIG. 7A)
or NPAT (FIG. 7B) followed by qPCR using primers corresponding to
Site II. *p=0.052, **p=0.04.
[0051] FIG. 8A-8C are bar graphs showing Ack1 inhibition by AIM-100
suppressed recruitment of pTyr-AR to PSA (FIG. 8A), NKX3.1 (FIG.
8B) and TMPRSS2 (FIG. 8C) promoters. LAPC4 cells were treated with
DHT (5 nM, 16 hr) or EGF (10 ng/ml, 1 hr), and AIM-100 (0.8 .mu.M,
16 hr) and ChIP analysis for pTyr267-AR binding to the PSA, NKX3.1
and TMPRSS2 AREs was performed followed by qPCR. *p=0.001,
**p=0.006, ***p=0.014.
[0052] FIG. 9 is a line graph showing prostate xenograft tumor
volume (mm.sup.3) in castrated nude male mice treated with AIM-100
Ack1 inhibitor or DMSO control. Castrated nude male mice were
injected with LNCaP-caAck expressing cells. Mice were injected with
AIM-100 (4 mg/kg of body weight per injection) on five times (n=8)
and tumor volumes were measured.
[0053] FIG. 10A-10C are histograms identifying the histone H4
Tyr51-phosphorylation site. The peptide was detected at 22.9
minutes in the total ion chromatogram (FIG. 10A) with
mass-to-charge ratio 630.7919 (FIG. 10B). The tandem mass spectrum
matched the following sequence, ISGLIYEETR (SEQ ID NO:56)
indicating that the tyrosine was phosphorylated; the detection of
the b5 and b6 is consistent with this localization (FIG. 10C). The
assignment was made with Sequest with XCorr 3.26 and .DELTA.CN:
0.31.
[0054] FIG. 11 is an alignment of H4 protein sequences indicating
that tyrosine residue at 51 is invariant from human to yeast.
[0055] FIG. 12 is an immunoblot of cell lysates from 293T cells
transfected with FLAG-tagged H3 (columns 1 and 2) or Y99F mutant
(columns 3 and 4) and treated with AIM-100 (columns 2 and 4) that
were either immunoprecipitated with FLAG antibodies and
immunoblotted with H3K27 pan-antibodies (top panel) or
immunoblotting with H3K27 pan-antibodies without
immunoprecipitation (bottom panel).
[0056] FIGS. 13A-13G show relevant data. FIG. 13A is an immunoblot
showing lysates from synchronized MEFs immunoprecipitated with
pTyr37-H2B antibodies followed by immunoblotting with pTyr37-H2B
antibody (top panel) or H2B antibody (bottom panel). FIG. 13B is an
immunoblot showing cell lysates 6.30 hours post-release from H1975
cells synchronized by double thymidine alone (first column) or with
0.31 .mu.M (second column), 0.62 .mu.M (third column) and 1.25
.mu.M (fourth column) MK1775 WEE1 inhibitor that were
immunoprecipitated with pTyr37-H2B antibodies followed by
immunoblotting with pTyr37-H2B, H2B, pTyr15-Cdc2, or Cdc2
antibodies. FIG. 13C is an immunoblot showing lysates collected at
0 and 6.30 hours post-release from synchronized MEFs transfected
with control (first two columns) or WEE1 (last two columns) siRNAs
that were immunoprecipitated with pTyr37-H2B antibodies followed by
immunoblotting with pTyr37-H2B (top panel), H2B (second panel),
WEE1 (third panel), or PTyr15-Cdc2 (bottom panel) antibodies. FIG.
13D is an immunoblot showing equimolar amounts of purified WEE1
(last three columns) and H2B (first three columns) proteins
incubated in the presence (third column) or absence of WEE1
inhibitor (MK1775, 0.625 .mu.M) for 1 hour at 30.degree. C. and
immunoblotted with pTyr37-H2B (top panel), H2B (middle panel), and
WEE1 (bottom panel) antibodies. FIG. 13E is an immunoblot showing
equimolar amounts of purified WEE1 and H2A (first column), H2B
(second column), H3 (third column) or H4 (fourth column) proteins
that were either incubated for 1 hour at 30.degree. C. and
immunoblotted with pTyr37-H2B (top panel) or immunoblotted with H2A
(second panel), H2B (third panel), H3 (fourth panel), H4 (fifth
panel), or WEE1 (sixth panel) antibodies. FIG. 13F is an immunoblot
showing lysates from MEFs untreated (first and third columns) or
treated (second and fourth columns) with WEE1 inhibitor (0.625
.mu.M, 14 hour) that were either immunoprecipitated with pTyr37-H2B
antibodies and immunoblotted with WEE1 antibodies (top panel) or
immunoblotted with pTyr37-Cdc2 (second panel), Cdc2 (third panel),
WEE1 (fourth panel), or H2B (fifth panel) without
immunoprecipitation. FIG. 13G is an immunoblot showing lysates from
MEFs co-expressing Myc-tagged WEE1 (WT, first three columns) or KD
mutant WEE1 (last three columns) and either vector (first and third
columns), FLAG-tagged H2B (second and fifth columns) or Y37F mutant
H2B (third and sixth columns) that were serum-starved 24 hrs and
either immunoprecipitated with pTyr37-H2B antibodies and
immunoblotted with FLAG antibody (top panel) or immunoblotted with
anti-FLAG antibodies (middle panel) or anti-myc antibodies (bottom
panel) without immunoprecipitation.
[0057] FIG. 14 is an immunoblot of 1 nM (column 1), 2 nM (column
2), 3 nM (column 3), or 4 nM (column 4) H2B peptide spanning Tyr37
(Tyr37-H2B; SRKESYSVYVYK, SEQ ID NO:59; top row), the same peptide
phosphorylated at Tyr37 (pTyr37-H2B; SRKESpYSVYVYK, SEQ ID NO:60;
bottom row), or the same peptide with a Tyr37-to-Phe mutation
(SRKESFSVYVYK, SEQ ID NO:61; middle row) immunoblotted with
pTyr37-H2B antibody.
[0058] FIGS. 15A-15B show immunoblot data._FIG. 15A is an
immunoblot of pTyr37-H2B phosphopeptide (column 1), Tyr37-H2B
peptide (column 2), non-specific H3 derived peptide (column 3), and
H4 derived peptide (column 4) immunoblotted with pTyr37-H2B
antibody (top panel) or pTyr37-H2B antibody pre-incubated with the
Tyr37-H2B phosphopeptide (bottom panel). FIG. 15B is an immunoblot
of 0.5 ng (column 1), 1 ng (column 2), 2 ng (column 3), and 4 ng
(column 4) pTyr37-H2B phosphopeptide immunoblotted with pTyr37-H2B
antibody (top panel) or pTyr37-H2B antibody pre-incubated with the
Tyr37-H2B phosphopeptide (bottom panel).
[0059] FIG. 16 is an immunoblot of 384 unique histone modification
combinations (MODified.TM. Histone Peptide Array, Active Motif,
Inc.) immunoblotted with pTyr37-H2B (top panel) or H3K9me3
antibodies (bottom panel).
[0060] FIG. 17 is an immunoblot of lysates from synchronized MEFs
immunoprecipitated with pTyr37-H2B antibodies and immunoblotted
with pTyr37-H2B (top panel) or actin (bottom panel) antibodies.
[0061] FIG. 18 is an immunoblot of equimolar amounts of purified
WEE1 (first, fourth, and fifth columns), Tyr37-H2B peptide (third
and fourth columns), and/or Tyr37-to-Phe mutant peptide (first and
second columns) that were incubated for 30 min at 30.degree. C.,
spotted on nitrocellulose membrane, and immunoblotted with
pTyr37-H2B antibody.
[0062] FIG. 19 is an immunoblot of lysates from HEK293T cells
transfected with myc-tagged WEE1 expressing construct (column 2) or
empty vector (column 1) and either immunoprecipitated with anti-myc
antibodies and then immunoblotted with H2B antibodies (top panel)
or immunoblotted with anti-myc antibodies (middle panel) or H2B
antibodies (bottom panel) without immunoprecipitation.
[0063] FIG. 20 is an immunoblot of 3 nM (column 1), 1 nM (column
2), or 0 nM (column 3) H2B(25-49) peptides (top row) or
pY37-H2B(25-49) peptides (bottom row) spotted on nitrocellulose
membrane, dried, blocked with BSA, and incubated overnight at
4.degree. C. with HEK293 cell lysates, washed, and immunoblotted
with NPAT antibodies.
[0064] FIG. 21 is a histogram identifying the histone H3
Tyr99-phosphorylation site. The peptide was detected at 32.7
minutes in the total ion chromatogram with mass-to-charge ratio
1208.8928. The tandem mass spectrum matched the following sequence,
FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK (SEQ ID NO:55) indicating that the
tyrosine was phosphorylated; the detection of the y16 and y17 is
consistent with this localization. The assignment was made with
Mascot with a score of 92.
[0065] FIG. 22 is an immunoblot of lysates from LAPC4 cells that
were untreated (column 1), treated with EGF (column 2), or treated
with EGF and AIM-100 (0.8 uM, 16 hr) (column 3) that were
immunoblotted with androgen receptor (AR) (row 3), Ack1 (row 4),
pEGFR(Tyr) (row 5), Tubulin (row 6), pTyr267-AR (top row), or
pTyr284-Ack1 (row 2) antibodies.
[0066] FIG. 23 is an immunoblot of purified histone H3 (all
columns) and Ack1 (columns 2 and 3) incubated at 37.degree. C. for
1 hour with AIM-100 (column 3) or without AIM-100 (columns 1 and 2)
that were immunoblotted with pTyr99-H3 (top row), H3 (middle row)
or Ack1 (bottom row) antibodies.
[0067] FIG. 24 is an immunoblot of cell lysates from NIH3T3 cells
(columns 1-4) treated with FGF for 0 minutes (column 1), 10 minutes
(column 2), 20 minutes (column 3), or 40 minutes (column 4), MCF-7
cells (columns 5-8) treated with insulin for 0 minutes (column 5),
10 minutes (column 6), 20 minutes (column 7), or 40 minutes (column
8), or 293T cells (columns 9-12) treated with EGF for 0 minutes
(column 9), 10 minutes (column 10), 20 minutes (column 11), or 40
minutes (column 12) that were immunoprecipitated with pTyr99-H3
antibodies and immunoblotted with H3 pan-antibodies (top panel) or
immunoblotted with H3 pan-antibodies without immunoprecipitation
(bottom panel).
[0068] FIG. 25 is an immunoblot of lysates from LAPC4 cells that
were untreated (column 1), treated with EGF (column 2), or treated
with EGF and AIM-100 (column 3) that were immunoblotted with H3K9
dimethyl (top panel), H3K27 (middle panel), or H3 (bottom panel)
antibodies.
[0069] FIGS. 26A-D show immunoblot data. FIG. 26A is an immunoblot
of cell lysates from serum starved HEK293T cells treated with EGF
(column 2), EGF+AIM-100 (column 3), or untreated (column 1) that
were either immunoprecipitated with pTyr51-H4 antibodies and
immunoblotted with H4 antibody (top panel), immunoblotted with H4
antibody (2nd panel), immunoblotted with pTyr284-Ack1 antibody (3r
Panel), or immunoblotted with Ack1 antibody (4th panel). FIG. 26B
is an immunoblot of equimolar amounts of purified constitutively
active E346K-Ack1 (column 2) or kinase dead K158R-Ack1 (column 1)
and H4 proteins were incubated in the presence (column 3) or
absence (columns 1 and 2) of Ack11 inhibitor AIM-100 (5 .mu.M for 1
hour at 30.degree. C.) and immunoblotted with pTyr51-H4 (top
panel), H4 (middle panel) and pTyr284-Ack1 (bottom panel)
antibodies. FIG. 26C is an immunoblot of cell lysates from HEK293
cells untreated, treated with EGF (column 2), or treated with
EGF+AIM-100 (5 .mu.M, 14 hour) (column 3) that were
immunoprecipitated with Ack1 antibodies and immunoblotted with H4
antibodies. FIG. 26D is an immunoblot of cell lysates from
serum-starved (24h) HEK293 cells transfected with E346K-Ack1
(column 1) or FRK kinase (column 2) cells that were
immunoprecipitated with pTyr51-H4 antibodies and immunoblotted with
H4 antibodies.
[0070] FIGS. 27A-27E show immunoblot data._FIGS. 27A and 27B are
immunoblots of cell lysates from serum starved HEK293T (FIG. 27A)
and LNCaP (FIG. 27B) cells treated with EGF ligand for 0 minutes
(column 1), 10 minutes (column 2), 20 minutes (column 3), or 40
minutes (column 4) that were either immunoprecipitated with
pTyr51-H4 antibodies and immunoblotted with H4 antibody (top panel)
or immunoblotted with H4 antibody without immunoprecipitation
(bottom panel). FIG. 27C is an immunoblots of cell lysates from
serum starved MCF-7 cells treated with insulin ligand for 0 minutes
(column 1), 15 minutes (column 2), 30 minutes (column 3), or 45
minutes (column 4) that were either immunoprecipitated with
pTyr51-H4 antibodies and immunoblotted with H4 antibody (top panel)
or immunoblotted with H4 antibody without immunoprecipitation
(bottom panel).
[0071] FIG. 27D is an immunoblot of cell lysates from HEK293T cells
transfected with FLAG-tagged H4 and treated with EGF ligand for 0
minutes (column 1), 10 minutes (column 2), 20 minutes (column 3),
30 minutes (column 4), or 40 minutes (column 5) that were either
immunoprecipitated with pTyr51-H4 antibodies and immunoblotted with
FLAG antibody (top panel) or immunoblotted with FLAG antibody
without immunoprecipitation (bottom panel).
[0072] FIG. 27E is an immunoblot of cell lysates from HEK293T cells
transfected with FLAG-tagged H4 (columns 1, 2, 5, and 6) or Y51F
mutant (columns 3, 4, 7, and 8) and treated with EGF (columns 2, 4,
6, and 8) that were either immunoprecipitated with pTyr51-H4
antibodies and immunoblotted with FLAG antibody (top panel) or
immunoblotted with FLAG antibody without immunoprecipitation
(bottom panel).
[0073] FIGS. 28A-C show that Tyrosine 88 residue is phosphorylated
in histone H4. The peptide was detected at 23 minutes in the total
ion chromatogram (FIG. 28A) with mass-to-charge ratio 767.8536
(FIG. 28B). The tandem mass spectrum matched the following
sequence, (R)KTVTAMDVVIALK(R) (SEQ ID NO: 81; residues 2-14
literally disclosed in FIG. 28C) indicating that the C-terminal
tyrosine was phosphorylated; the detection of the phosphotyrosine
b10 and b11 is consistent with this localization (FIG. 28C). The
assignment was made with Sequest XCorr 3.31 and LICN 0.25.
[0074] FIG. 29 shows the results of ELISA assay for antibody
validation. Biotinylated unphosphorylated and Tyr88-phosphorylated
H4 peptides were immobilized on streptavidin 96-well plates. Plates
were incubated with pY88 monoclonal antibodies for 60 min at 37 C.
ELISA was performed as described in text. Antibodies did not
recognize unphosphorylated H4 peptide, however,
Tyr88-phosphorylated peptide was recognized.
[0075] FIG. 30 shows that WEE1 and Ack1 kinases phosphorylate
histone H4 at Tyr88. Biotinylated unphosphorylated and
Tyr88-phosphorylated H4 peptides were immobilized on streptavidin
96-well plates. Purified WEE1 or Ack1 were added with or without
WEE1 inhibitor MK-1775 or Ack1 inhibitor, AIM-100 for 60 min at 37
C. ELISA was performed as described in text. Antibodies recognized
phosphorylated H4 peptide, however, when incubated with WEE1 or
Ack1 inhibitors, H4 Tyr88-phosphorylation was significantly
reduced.
[0076] FIGS. 31A-C show Ack1 data. FIG. 31a shows the generation of
Ack1 KO mice and activation. Wild type (+/+), heterozygous (+/-)
and knockout or KO (-/-) mice were euthanized and spleens were
isolated. Immunoblotting of equal amount of spleen lysates was
performed with Ack1 and tubulin antibodies. Wild type mice exhibit
Ack1 expression which is significantly reduced in heterozygous mice
(mice that has only one copy of the gene) and completely lost in
knockout mice. The tubulin antibodies were used as a control to
indicate equal amount of protein.
[0077] FIG. 31b shows that Ack1 KO mice are lean. Wild type (+/+)
and knockout (-/-) mice are shown; the KO mice are significantly
smaller and weigh lesser than their wild type counterpart.
[0078] FIG. 31c shows that Ack1 regulates histone H3
Tyr99-phosphorylation and negatively regulates H3 K9
trimethylation. The equal amount of testis lysates of Wild type
(+/+) and knockout (-/-) mice were subjected to immunoblotting with
H3-pTyr99 and H3K9me3 antibodies. Loss of Ack1 resulted in
significant loss of H3 Tyr99-phosphorylation and increase in H3 K9
trimethylation. The histone H3 antibodies were used as a control to
indicate equal amount of protein.
[0079] FIG. 31d shows that Ack1 inhibition upregulates H3 K9
trimethylation. The prostate cancer derived cells, LAPC4 were
treated with AIM-100 (7 uM, 16 hours). The equal amount of cell
lysates were subjected to immunoblotting with H3K9me3 and histone
H3 antibodies. Loss of Ack1 activity by AIM-100 resulted in
significant increase in H3 K9 trimethylation. The histone H3
antibodies were used as a control to indicate equal amount of
protein.
[0080] FIG. 32 shows that Ack1 KO mice were significantly lighter
in weight than the wild-type counterparts.
[0081] FIG. 33a-33h show a 8-histone gene signature. a-h,
Synchronized cells treated with WEE1 inhibitor, MK1775 (0.6 uM, 14
hr) were harvested at indicated time points post-release. Total RNA
was prepared followed by quantitative RT-PCR for 8 histone
genes.
[0082] FIG. 34 shows the results of the Peptide Immuno sandwich
Assay (PIA). Purified WEE1 or cell lysates were incubated with H2B
peptide with or without WEE1 inhibitor MK-1775 for 2 hours at
37.degree. C. H2B Tyr37-phosphorylation was determined as described
in the text.
[0083] FIG. 35 presents the results from PIA performed using
lysates prepared from Glioblastoma Multiforme (GBM) and normal
brain samples treated with or without MK-1775. Threshold interval
is shown.
[0084] FIG. 36 shows the suppression of IDH2 and DNMT3b expression
in GBM. Total RNA was prepared from normal and tumor samples
followed by quantitative RT-PCR using primers corresponding H2Bm,
IDH2 and DNMT3b.
[0085] FIG. 37 shows images for monitoring neurosphere formation of
patient derived GBM cell line BTIC5.
[0086] FIG. 38 shows the monitoring of xenograft growth of mice
injected with brain cancer cells. Mice were injected with U52-luc
cells and scanned every 7 days for the growth of the tumor.
[0087] FIG. 39a-39d show that budding Yeast H2B Y40 phosphorylation
suppresses transcription of histone genes The WT and Y40A mutant
yeast cells (FIGS. 39a and 39b) and the WT and swe1.DELTA. mutant
yeast cells (FIGS. 39c and 39d) were synchronized, RNA was prepared
followed by qRT-PCR for histone transcripts.
[0088] FIG. 40 shows that Yeast H2BY40A mutants display marked
sensitivity to MMS. Wt and H2BY40A mutants were serially diluted
and spotted on YPD plates in the absence or presence of MMS and
growth was assessed 72 h post-plating.
[0089] FIG. 41 presents a proposed model for epigenetic regulation
of DNA alkylation repair. The DNA replication checkpoint kinase ATR
is activated in response to replication stress such as stalled
replication forks, which phosphorylates the checkpoint kinase Chk1
that arrest cells in intra-S phase. Chk1 in turn phosphorylates and
activates WEE1 which marks damaged chromatin with pY37H2B. pY37-H2B
recruits the DNA alkyl transferases (AGT or MGMT) or the nucleotide
excision repair machinery (ERCC1/XPF) to the DNA damage caused by
alkylating agents to promote repair.
[0090] FIG. 42a-42f show that inhibition of WEE1 increases IDH2
gene transcription. (FIG. 42a-42e) RNA was isolated from cells
treated with WEE1 inhibitor (or siRNA) followed by qRT-PCR using
IDH2 and actin primers. (FIG. 42f) MK-1775 treated cells were
subjected to qRT-PCR using histone H2A and actin primers *p=0.005,
**p=0.001, ***p=0.001, ****p=0.04, *****p=0.03.
[0091] FIG. 43 shows that inhibition of WEE1 kinase increases 5-hmC
levels. SBC12, T98G and HEK293 cells were treated with WEE1
inhibitor, MK1775 (0.6 .mu.M, 24 hr). Blots were incubated with
5-hmC and 5-mC antibodies.
[0092] FIG. 44a-44f show H2B Tyr37-phosphorylation marks are
deposited within IDH2. WEE1 epigenetic footprint (pY37-H2B) is
observed in the body of the (FIG. 44a) IDH2 gene in but not at
(FIG. 44b) the control site in (FIG. 44c) HEK293 overexpressing
WEE1 but not vector alone and (FIG. 44d) In the GBM derived cell
line U87, but not in cells treated with the WEE1 specific inhibitor
MK-1775 erased pY88-H2B marks. *p=0.001, **p=0.028. ***p=0.002.
(FIG. 44e) In T98G cells treated with the WEE1 specific inhibitor
MK-1775, pY88-H2B marks were erased. Low levels of pY37-H2B mark
deposition was seen at control site. ****p=0.0001 (FIG. 44f)
Melanoma cell lines, IPC298 and WM1366 were treated with the WEE1
specific inhibitor MK-1775 and cell proliferation was assessed.
[0093] FIGS. 45A and 45B show upregulation of WEE1 and suppression
of IDH2 expression in GBMs. qRT-PCR of normal brain and GBM tumor
RNA (patient #1-27) in triplicates. Relative expression of WEE1
(FIG. 45A) and IDH2 (FIG. 45B) is shown.
[0094] FIGS. 46A and 46B show that removal of pY37-H2B epigenetic
marks following DNA DSBs. FIG. 46A shows H1975 cells were either
un-irradiated or exposed to 15GY IR and lysates were immunoblotted
with indicated Abs. FIG. 46B shows H1975 were irradiated (15GY) in
the presence and absence of ATM (Ku55393) and WEE1 inhibitor
(MK-1775). Whole cell extracts were immunoblotted with indicated
antibodies.
[0095] FIG. 47 shows proposed mechanism for HIST1 and IDH2
transcriptional suppression by WEE1 epigenetic activity.
[0096] Some or all of the figures are schematic representations for
exemplification; hence, they do not necessarily depict the actual
relative sizes or locations of the elements shown. The figures are
presented for the purpose of illustrating one or more embodiments
with the explicit understanding that they will not be used to limit
the scope or the meaning of the claims that follow below.
DETAILED DESCRIPTION OF THE DISCLOSURE
I. Definitions
[0097] The term "phosphospecific probe" refers to a composition
that specifically binds a target antigen in its phosphorylated
state but does not specifically bind the antigen when it is not
phosphorylated. The probe is preferably an antibody (i.e., a
phosphospecific antibody).
[0098] The term "antibody" refers to a polyclonal, monoclonal,
recombinant, or synthetic immunoglobulin molecule that specifically
binds a target antigen. In one aspect, monoclonal antibodies are
excluded. The term includes intact immunoglobulin molecules,
fragments or polymers of those immunoglobulin molecules, chimeric
antibodies containing sequences from more than one species, class,
or subclass of immunoglobulin, and human or humanized versions of
immunoglobulin molecules or fragments thereof containing a least
the idiotype of an immunoglobulin that specifically binds the
target antigen.
[0099] The term "idiotype" refers to the portion of an
immunoglobulin molecule that confers the molecule's ability to bind
an antigen. The idiotype of an antibody is determined by the
complementarity determining regions (CDRs) of the immunoglobulin
variable domains (V.sub.L and V.sub.H).
[0100] The term "peptide" or "polypeptide" can be used to refer to
a natural or synthetic molecule comprising two or more amino acids
linked by the carboxyl group of one amino acid to the alpha amino
group of another. The peptide is not limited by length; thus
"peptide" can include polypeptides and proteins.
[0101] The term "peptidomimetic" refers to a mimetic of a peptide
which includes some alteration of the normal peptide chemistry.
Peptidomimetics typically enhance some property of the original
peptide, such as increase stability, increased efficacy, enhanced
delivery, increased half life, etc.
[0102] The term "aptamer" refers to an oligonucleic acid molecule
that specifically binds to a target molecule.
[0103] As used herein, the term "small molecule" refers to a
compound having a molecular weight of less than 1000 Daltons, and
typically between 300 and 700 Daltons. The term may include
monomers or primary metabolites, secondary metabolites, a
biological amine, a steroid, or synthetic or natural, non-peptide
biological molecule(s). In the context of targeted imaging probes
that are small molecules, the small molecule can specifically bind
the molecular or cellular target.
[0104] The term "specifically recognizes" or "specifically binds"
refers to the recognition or binding of a molecule to a target
molecule, such as an antibody to its cognate antigen, while not
significantly binding to other molecules. Preferably, a molecule
"specifically binds" to a target molecule with an affinity constant
(Ka) greater than about 10.sup.5 mol.sup.-1 (e.g., 10.sup.6
mol.sup.-1, 10.sup.7 mol.sup.-1, 10.sup.8 mol.sup.-1, 10.sup.9
mol.sup.-1, 10.sup.10 mol.sup.-1, 10'' mol.sup.-1, and 10.sup.12
mol.sup.-1 or more) with the target molecule.
[0105] The term "neoplasm" refers to a cell undergoing abnormal
cell proliferation. The growth of neoplastic cells exceeds and is
not coordinated with that of the normal tissues around it. The
growth typically persists in the same excessive manner even after
cessation of the growth or other stimuli, and typically causes
formation of a tumor. Neoplasms may be benign, premalignant, or
malignant.
[0106] The term "cancer" or "malignant neoplasm" refers to a cell
that displays uncontrolled growth, invasion upon adjacent tissues,
and often metastasizes to other locations of the body.
[0107] The term "subject" or "patient" refers to any individual who
is the target of administration. The subject can be a vertebrate,
for example, a mammal. Thus, the subject can be a human. The
subject can be domesticated, agricultural, or zoo- or
circus-maintained animals. Domesticated animals include, for
example, dogs, cats, rabbits, ferrets, guinea pigs, hamsters, pigs,
monkeys or other primates, and gerbils. Agricultural animals
include, for example, horses, mules, donkeys, burros, cattle, cows,
pigs, sheep, and alligators. Zoo- or circus-maintained animals
include, for example, lions, tigers, bears, camels, giraffes,
hippopotamuses, and rhinoceroses. The term does not denote a
particular age or sex.
[0108] By "treatment" and "treating" is meant the medical
management of a subject with the intent to cure, ameliorate,
stabilize, or prevent a disease, pathological condition, or
disorder. This term includes active treatment, that is, treatment
directed specifically toward the improvement of a disease,
pathological condition, or disorder, and also includes causal
treatment, that is, treatment directed toward removal of the cause
of the associated disease, pathological condition, or disorder. In
addition, this term includes palliative treatment, that is,
treatment designed for the relief of symptoms rather than the
curing of the disease, pathological condition, or disorder;
preventative treatment, that is, treatment directed to minimizing
or partially or completely inhibiting the development of the
associated disease, pathological condition, or disorder; and
supportive treatment, that is, treatment employed to supplement
another specific therapy directed toward the improvement of the
associated disease, pathological condition, or disorder. It is
understood that treatment, while intended to cure, ameliorate,
stabilize, or prevent a disease, pathological condition, or
disorder, need not actually result in the cure, ameliorization,
stabilization or prevention. The effects of treatment can be
measured or assessed as described herein and as known in the art as
is suitable for the disease, pathological condition, or disorder
involved. Such measurements and assessments can be made in
qualitative and/or quantitative terms. Thus, for example,
characteristics or features of a disease, pathological condition,
or disorder and/or symptoms of a disease, pathological condition,
or disorder can be reduced to any effect or to any amount.
[0109] The term "isolated" as used herein refers to molecules or
biological or cellular materials being substantially free from
other materials. In one aspect, the term "isolated" refers to
nucleic acid, such as DNA or RNA, or protein or polypeptide, or
cell or cellular organelle, or tissue or organ, separated from
other DNAs or RNAs, or proteins or polypeptides, or cells or
cellular organelles, or tissues or organs, respectively, that are
present in the natural source. The term "isolated" also refers to a
nucleic acid or peptide that is substantially free of cellular
material, viral material, or culture medium when produced by
recombinant DNA techniques, or chemical precursors or other
chemicals when chemically synthesized. Moreover, an "isolated
nucleic acid" is meant to include nucleic acid fragments which are
not naturally occurring as fragments and would not be found in the
natural state. The term "isolated" is also used herein to refer to
polypeptides which are isolated from other cellular proteins and is
meant to encompass both purified and recombinant polypeptides. In
other embodiments, the term "isolated or recombinant" means
separated from constituents, cellular and otherwise, in which the
cell, tissue, polynucleotide, peptide, polypeptide, protein,
antibody or fragment(s) thereof, which are normally associated in
nature. For example, an isolated cell is a cell that is separated
from tissue or cells of dissimilar phenotype or genotype. An
isolated polynucleotide is separated from the 3' and 5' contiguous
nucleotides with which it is normally associated in its native or
natural environment, e.g., on the chromosome. As is apparent to
those of skill in the art, a non-naturally occurring
polynucleotide, peptide, polypeptide, protein, antibody or
fragment(s) thereof, does not require "isolation" to distinguish it
from its naturally occurring counterpart. The term "isolated" is
also used herein to refer to cells or tissues that are isolated
from other cells or tissues and is meant to encompass both cultured
and engineered cells or tissues.
[0110] It is to be inferred without explicit recitation and unless
otherwise intended, that when the present invention relates to a
polypeptide, protein, polynucleotide or antibody, an equivalent or
a biologically equivalent of such is intended within the scope of
this invention. As used herein, the term "biological equivalent
thereof" is intended to be synonymous with "equivalent thereof"
when referring to a reference protein, antibody, fragment,
polypeptide or nucleic acid, intends those having minimal homology
while still maintaining desired structure or functionality. Unless
specifically recited herein, it is contemplated that any
polynucleotide, polypeptide or protein mentioned herein also
includes equivalents thereof. In one aspect, an equivalent
polynucleotide is one that hybridizes under stringent conditions to
the polynucleotide or complement of the polynucleotide as described
herein for use in the described methods. In another aspect, an
equivalent antibody or antigen binding polypeptide intends one that
binds with at least 70%, or alternatively at least 75%, or
alternatively at least 80%, or alternatively at least 85%, or
alternatively at least 90%, or alternatively at least 95% affinity
or higher affinity to a reference antibody or antigen binding
fragment. In another aspect, the equivalent thereof competes with
the binding of the antibody or antigen binding fragment to its
antigen under a competitive ELISA assay. In another aspect, an
equivalent intends at least about 80% homology or identity and
alternatively, at least about 85%, or alternatively at least about
90%, or alternatively at least about 95%, or alternatively 98%
percent homology or identity and exhibits substantially equivalent
biological activity to the reference protein, polypeptide or
nucleic acid. In one aspect, a biological equivalent of an antibody
means one having the ability of the antibody to selectively bind
its epitope protein or fragment thereof as measured by ELISA or
other suitable methods. Biologically equivalent antibodies include,
but are not limited to, those antibodies, peptides, antibody
fragments, antibody variant, antibody derivative and antibody
mimetics that bind to the same epitope as the reference
antibody.
[0111] A polynucleotide or polynucleotide region (or a polypeptide
or polypeptide region) having a certain percentage (for example,
80%, 85%, 90%, or 95%) of "sequence identity" to another sequence
means that, when aligned, that percentage of bases (or amino acids)
are the same in comparing the two sequences. The alignment and the
percent homology or sequence identity can be determined using
software programs known in the art, for example those described in
Current Protocols in Molecular Biology (Ausubel et al., eds. 1987)
Supplement 30, section 7.7.18, Table 7.7.1. Preferably, default
parameters are used for alignment. A preferred alignment program is
BLAST, using default parameters. In particular, preferred programs
are BLASTN and BLASTP, using the following default parameters:
Genetic code=standard; filter=none; strand=both; cutoff=60;
expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH
SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS
translations+SwissProtein+SPupdate+PIR. Details of these programs
can be found at the following Internet address:
ncbi.nlm.nih.gov/cgi-bin/BLAST. Sequence identity and percent
identity were determined by incorporating them into clustalW.
[0112] "Homology" or "identity" or "similarity" refers to sequence
similarity between two peptides or between two nucleic acid
molecules. Homology can be determined by comparing a position in
each sequence which may be aligned for purposes of comparison. When
a position in the compared sequence is occupied by the same base or
amino acid, then the molecules are homologous at that position. A
degree of homology between sequences is a function of the number of
matching or homologous positions shared by the sequences. An
"unrelated" or "non-homologous" sequence shares less than 40%
identity, or alternatively less than 25% identity, with one of the
sequences of the present invention.
[0113] "Homology" or "identity" or "similarity" can also refer to
two nucleic acid molecules that hybridize under stringent
conditions.
[0114] "Hybridization" refers to a reaction in which one or more
polynucleotides react to form a complex that is stabilized via
hydrogen bonding between the bases of the nucleotide residues. The
hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein
binding, or in any other sequence-specific manner. The complex may
comprise two strands forming a duplex structure, three or more
strands forming a multi-stranded complex, a single self-hybridizing
strand, or any combination of these. A hybridization reaction may
constitute a step in a more extensive process, such as the
initiation of a PCR reaction, or the enzymatic cleavage of a
polynucleotide by a ribozyme.
[0115] Examples of stringent hybridization conditions include:
incubation temperatures of about 25.degree. C. to about 37.degree.
C.; hybridization buffer concentrations of about 6.times.SSC to
about 10.times.SSC; formamide concentrations of about 0% to about
25%; and wash solutions from about 4.times.SSC to about
8.times.SSC. Examples of moderate hybridization conditions include:
incubation temperatures of about 40.degree. C. to about 50.degree.
C.; buffer concentrations of about 9.times.SSC to about
2.times.SSC; formamide concentrations of about 30% to about 50%;
and wash solutions of about 5.times.SSC to about 2.times.SSC.
Examples of high stringency conditions include: incubation
temperatures of about 55.degree. C. to about 68.degree. C.; buffer
concentrations of about 1.times.SSC to about 0.1.times.SSC;
formamide concentrations of about 55% to about 75%; and wash
solutions of about 1.times.SSC, 0.1.times.SSC, or deionized water.
In general, hybridization incubation times are from 5 minutes to 24
hours, with 1, 2, or more washing steps, and wash incubation times
are about 1, 2, or 15 minutes. SSC is 0.15 M NaCl and 15 mM citrate
buffer. It is understood that equivalents of SSC using other buffer
systems can be employed.
[0116] When a genetic marker, e.g., overexpression of WEE1, is used
as a basis for selecting a patient for a treatment described
herein, the genetic marker is measured before and/or during
treatment, and the values obtained are used by a clinician in
assessing any of the following: (a) probable or likely suitability
of an individual to initially receive treatment(s); (b) probable or
likely unsuitability of an individual to initially receive
treatment(s); (c) responsiveness to treatment; (d) probable or
likely suitability of an individual to continue to receive
treatment(s); (e) probable or likely unsuitability of an individual
to continue to receive treatment(s); (f) adjusting dosage; (g)
predicting likelihood of clinical benefits; or (h) toxicity. As
would be well understood by one in the art, measurement of the
genetic marker in a clinical setting is a clear indication that
this parameter was used as a basis for initiating, continuing,
adjusting and/or ceasing administration of the treatments described
herein.
[0117] "Cancer" is a known medically as a malignant neoplasm, is a
broad group of diseases involving unregulated cell growth. In
cancer, cells divide and grow uncontrollably and in one aspect,
forming malignant tumors, and invade nearby parts of the body.
Non-limiting examples include colon cancer, colorectal cancer,
gastric cancer, esophogeal cancer, head and neck cancer, breast
cancer, lung cancer, stomach cancer, liver cancer, gall bladder
cancer, or pancreatic cancer or leukemia.
[0118] A "composition" as used herein, intends an active agent,
such as a compound as disclosed herein and a carrier, inert or
active. The carrier can be, without limitation, solid such as a
biotin, a bead or a resin, or liquid, such as phosphate buffered
saline.
[0119] An "effective amount" is an amount sufficient to effect
beneficial or desired results. An effective amount can be
administered in one or more administrations, applications or
dosages. Such delivery is dependent on a number of variables
including the time period for which the individual dosage unit is
to be used, the bioavailability of the therapeutic agent, the route
of administration, etc. It is understood, however, that specific
dose levels of the therapeutic agents disclosed herein for any
particular subject depends upon a variety of factors including the
activity of the specific compound employed, bioavailability of the
compound, the route of administration, the age of the animal and
its body weight, general health, sex, the diet of the animal, the
time of administration, the rate of excretion, the drug
combination, and the severity of the particular disorder being
treated and form of administration. In general, one will desire to
administer an amount of the compound that is effective to achieve a
serum level commensurate with the concentrations found to be
effective in vivo. These considerations, as well as effective
formulations and administration procedures are well known in the
art and are described in standard textbooks. Consistent with this
definition and as used herein, the term "therapeutically effective
amount" is an amount sufficient to treat a specified disorder or
disease or alternatively to obtain a pharmacological response.
[0120] When a genetic marker, e.g., overexpression of WEE1, is used
as a basis for selecting a patient for a treatment described
herein, the genetic marker is measured before and/or during
treatment, and the values obtained are used by a clinician in
assessing any of the following: (a) probable or likely suitability
of an individual to initially receive treatment(s); (b) probable or
likely unsuitability of an individual to initially receive
treatment(s); (c) responsiveness to treatment; (d) probable or
likely suitability of an individual to continue to receive
treatment(s); (e) probable or likely unsuitability of an individual
to continue to receive treatment(s); (f) adjusting dosage; (g)
predicting likelihood of clinical benefits; or (h) toxicity. As
would be well understood by one in the art, measurement of the
genetic marker in a clinical setting is a clear indication that
this parameter was used as a basis for initiating, continuing,
adjusting and/or ceasing administration of the treatments described
herein.
[0121] WEE1 gene or polynucleotide encodes a nuclear protein, which
is a tyrosine kinase, belonging to the Ser/Thr family of protein
kinases. The gene and the protein it encodes have been
characterized. The amino acid of the human sequence is deposited at
NP_001137448, and the mouse amino acid sequence NP_033542. The
sequence of the mRNA encoding the human protein is available at
GenBank NM_001143976 and the mouse mRNA is available at GenBank
NM_009516. Monoclonal antibodies that specifically recognize and
bind the proteins, for immunohistochemical analysis; can be
purchased from Santa Cruze Biotechnology (sc-5285) or generated
using methods known in the art.
[0122] Isocitrate dehydrogenase is an enzyme that is encoded in
humans the IDH2 gene. The amino acid sequence for the human protein
is available at GenBank NP_002159 and the mouse protein is
available at NP_66599. The mRNA encoding the proteins are available
at GenBank NM_002168 (human) and NM_173011 (mouse). Antibodies that
specifically recognize and bind the protein can be made using well
known methods or purchased from abcam (ab131263).
II. Detailed Description
[0123] It is discovered herein that certain tyrosine residues of
various histone proteins, which are not known to be subject to
epigenetic modifications, can be phosphorylated in cells. Such
amino acid residues include H2B Tyr37, H4 Tyr88 and Tyr 51 and H3
Tyr99. The present disclosure further provides experimental data to
reveal the kinases that can phosphorylate these residues, the
impact of such phosphorylation to a cell including gene expression
changes, and their clinical implications.
[0124] A. pY37-H2B
[0125] The present disclosure identified a new phosphorylation
event, tyrosine 37 in histone H2B (pY37-H2B) mediated by WEE1
tyrosine kinase. The identification was facilitated and confirmed
by newly generated pY37-H2B specific antibodies. Chromatin
immunoprecipitation followed by sequencing (ChIP-sequencing)
revealed that WEE1 mediated H2B Tyr37-phosphorylation occurred at
multiple places in chromatin including upstream of histone cluster
1, Hist1 and negatively regulated global histone transcriptional
output.
[0126] The genes for the five core histones H1/H2A/H2B/H3/H4 are
clustered together in the genome of all metazoans. There are 10-20
functional copies of the genes for each of the histone proteins and
each individual gene encodes a small fraction of the total histone
protein. The Hist1 cluster contains majority of the histone coding
genes. The data unveiled a previously unknown mechanism wherein
marking major histone gene cluster with H2B Y37-phosphorylation by
WEE1 suppressed transcription of histone genes by excluding binding
of the transcriptional coactivator NPAT and RNA polymerase II and
recruiting histone chaperone HIRA upstream of the Hist1
cluster.
[0127] Loss of WEE1 kinase expression by siRNA or inhibition by
MK-1775 abrogated H2B Y37-phosphorylation with a concomitant
increase in histone transcription in both mammalian and yeast
cells. As all eukaryotic cells need to maintain histone levels
precisely, any alterations in histone levels leads to genetic
instability, loss of chromosome fidelity and increased sensitivity
to DNA damaging agents. Thus, these studies have uncovered a new
evolutionarily conserved function of WEE1 as an epigenetic
modulator that is important for maintaining histone mRNA
levels.
[0128] In accordance with such discovery, the present disclosure,
in one embodiment, provides methods and compositions for detecting
WEE1 activity in a cell by either determining the amount of
pY37-H2B in the cell. Alternatively, the WEE1 activity can be
detected by first incubating the WEE1 with an H2B protein or a
fragment of the protein that contains an unphosphorylated Y37
residue, allowing the WEE1 to phosphorylate the protein, and then
measuring the phosphorylation of the Y37 residue.
[0129] Determination of WEE1 activity has clinical applications. It
has been observed that elevated levels of WEE1 significantly
correlated with cancer progression (e.g., brain cancer such as
GBM), breast cancer such as triple negative breast cancer, melanoma
and lung cancer). Therefore, detection of the WEE1 activity can
help detection of cancer and prognosis of cancer treatments.
Further, cancer treatments that target WEE1 can be selected for
those cancer patients that have aberrant WEE1 activities.
[0130] Further, the data shows that phosphorylated Y37-H2B
modulates the expression of many downstream genes, and thus such
downstream genes can also serve as biomarkers for the detection of
WEE1 activity. Without limitation, these genes include all the 51
histone genes in the Hist1 gene cluster (e.g., H2B1, H2Ai, H3h,
H2Aj, H2Bm, H4j, H4k, H2Ak, H2bn, H2B1, H3h, H4j, H2Ai, H2Ak and
H2Bk H1b, H3i, H2Ah, H2Bp, H2Bq, H2Ao, H4m, H2Ap, H2Br, H2Ah, H4i,
H2Ag, H2Bj, H4h, H4h, H2Af, H3g, H2Bh, H3f, H4f, H1d, H3e, H2Ae,
H2Bg, H2Bf, H2Ad, H4d, H2Be, H1e, H2Ac, H2Bc, H2t, H4c, H1c, H3c,
H2Bb, H2Ab, H3b, H4b, H4a and HH3g), microRNA including Mir26b,
Mir149, Mir346, Mir350, Mir491, Mir599, Mir670, Mir708, Mir760,
Mir879, Mir1192, Mir1965, Mir3058 and Mir5098, and IDH2, DNMT3B,
JARID2, EYA3, JMJD2c, JMJDIC, CREBBP, SOX4 and SOX18.
[0131] B. pY88-H4
[0132] It is shown that the Tyr88 residue of H4 can be
phosphorylated by the WEE1 or Ack1 kinase. Such phosphorylation can
occur in certain cancer cells, including brain cancer cells (e.g.,
GBM), breast cancer cells (e.g., triple negative breast cancer),
prostate cancer, pancreatic cancer, melanoma and lung cancer cells
that display activation of WEE1 or Ack1. Therefore, by detecting
the Y88-H4 phosphorylation, a cell can be assayed for its WEE1 or
Ack1 kinase activity and assessed for its status in carcinogenesis,
as well as its suitability for a treatment targeting these
kinases.
[0133] C. pY51-H4
[0134] The histone H4 Tyr51 residue is yet another site newly
discovered to undergo phosphorylation in certain cancer cells. The
phosphorylation of Y51-H4, as the data shows, can be activated by
WEE1, Ack1, EGFR and the insulin receptor, and modulates a number
of downstream genes. Therefore, measurement of pY51-H4 can be used
to determine the activity of WEE1, Ack1, EGFR or the insulin
receptor.
[0135] Like Y88-H4, Y51-H4 can be phosphorylated by more than one
factor, and thus the detection of phosphorylation of either of
these sites suggests that one or more of these factors are active.
When used together or alternatively in combination with other
phosphorylation targets, these phosphorylation sites can help
ascertain which of these factors are actually active. For instance,
for a cell, if Y37-H2B is not phosphorylated but Y88-H4 and Y51-H4
are phosphorylated, one can conclude that WEE1 may not be active in
the cell, but Ack1 is.
[0136] D. pY99-H3
[0137] The Tyr99 residue of histone H3 was shown to be
phosphorylated by Ack1, EGFR, FGFR and the insulin receptor.
Inhibition of this phosphorylation increases dimethylation and
trimethylation of Lys 9 of histone H3 and mitigate cancer
progression.
[0138] It is interesting to note that mice lacking Y99-H3
phosphorylation, through knock out of the Ack1 gene, were healthy
but had significant less body weight as compared to the wild-type
animals. These data indicate that, in addition to its role in
cancer development, pY99-H3 also plays an important role in body
weight control or metabolism. By modulating the activity of Ack1 or
the phosphorylation of Y99-H3 and dimethylation and trimethylation
of Lys 9 of histone H3, therefore, the present disclosure
contemplates methods to treat obesity and related diseases, such as
diabetes.
III. Compositions
Phosphospecific Probes
[0139] Phosphospecific probes that specifically bind tyrosine
residues in Histone H2B, H3, or H4 when phosphorylated are
provided. The phosphospecific probe preferably specifically binds
histone H2B at phosphorylated tyrosine 37 residue (H2B-Tyr37),
Histone H4 at phosphorylated tyrosine 51 residue (H4-Tyr51) or
tyrosine 88 residue (H4-Tyr88), or Histone H3 at phosphorylated
tyrosine 99 residue (H3-Tyr99).
1. Antibodies
[0140] In preferred embodiments, the phosphospecific probes are
antibodies. Antibodies that can be used in the disclosed
compositions and methods include whole immunoglobulin (i.e., an
intact antibody) of any class, fragments thereof, and synthetic
proteins containing at least the antigen binding variable domain of
an antibody. The variable domains differ in sequence among
antibodies and are used in the binding and specificity of each
particular antibody for its particular antigen. However, the
variability is not usually evenly distributed through the variable
domains of antibodies. It is typically concentrated in three
segments called complementarity determining regions (CDRs) or
hypervariable regions both in the light chain and the heavy chain
variable domains. The more highly conserved portions of the
variable domains are called the framework (FR). The variable
domains of native heavy and light chains each comprise four FR
regions, largely adopting a beta-sheet configuration, connected by
three CDRs, which form loops connecting, and in some cases forming
part of, the beta-sheet structure. The CDRs in each chain are held
together in close proximity by the FR regions and, with the CDRs
from the other chain, contribute to the formation of the antigen
binding site of antibodies. Preferred CDRs are the CDRs in the
example phosphospecific antibodies described in the Examples.
[0141] Antibodies for use in the disclosed compositions and methods
can be of any isotype, including IgG, IgA, IgE, IgD, and IgM. IgG
isotype antibodies can be further subdivided into IgG1, IgG2, IgG3,
and IgG4 subtypes. IgA antibodies can be further subdivided into
IgA1 and IgA2 subtypes.
[0142] Also disclosed are fragments of antibodies which have
bioactivity. The fragments, whether attached to other sequences or
not, include insertions, deletions, substitutions, or other
selected modifications of particular regions or specific amino
acids residues, provided the activity of the fragment is not
significantly altered or impaired compared to the nonmodified
antibody or antibody fragment. Fab is the fragment of an antibody
that contains a monovalent antigen-binding fragment of an antibody
molecule. A Fab fragment can be produced by digestion of whole
antibody with the enzyme papain to yield an intact light chain and
a portion of one heavy chain. Fab' is the fragment of an antibody
molecule can be obtained by treating whole antibody with pepsin,
followed by reduction, to yield an intact light chain and a portion
of the heavy chain. Two Fab' fragments are obtained per antibody
molecule. Fab' fragments differ from Fab fragments by the addition
of a few residues at the carboxyl terminus of the heavy chain CH1
domain including one or more cysteines from the antibody hinge
region. (Fab').sub.2 is the fragment of an antibody that can be
obtained by treating whole antibody with the enzyme pepsin without
subsequent reduction. F(ab').sub.2 is a dimer of two Fab' fragments
held together by two disulfide bonds. Fv is the minimum antibody
fragment that contains a complete antigen recognition and binding
site. This region consists of a dimer of one heavy and one light
chain variable domain in a tight, non-covalent association
(V.sub.H-V.sub.L dimer). It is in this configuration that the three
CDRs of each variable domain interact to define an antigen-binding
site on the surface of the V.sub.H-V.sub.L dimer. Collectively, the
six CDRs confer antigen-binding specificity to the antibody.
However, even a single variable domain (or half of an Fv comprising
only three CDRs specific for an antigen) has the ability to
recognize and bind antigen, although at a lower affinity than the
entire binding site.
[0143] Techniques can also be adapted for the production of
single-chain antibodies specific for the cellular targets. Single
chain antibody ("SCA"), defined as a genetically engineered
molecule containing the variable region of the light chain
(V.sub.L), the variable region of the heavy chain (V.sub.H), linked
by a suitable polypeptide linker as a genetically fused single
chain molecule. Such single chain antibodies are also referred to
as "single-chain Fv" or "sFv" antibody fragments. Generally, the Fv
polypeptide further comprises a polypeptide linker between the
V.sub.H and V.sub.L domains that enables the sFv to form the
desired structure for antigen binding. Methods for the production
of single-chain antibodies are well known to those of skill in the
art. A single chain antibody can be created by fusing together the
variable domains of the heavy and light chains using a short
peptide linker, thereby reconstituting an antigen binding site on a
single molecule. Single-chain antibody variable fragments (scFvs)
in which the C-terminus of one variable domain is tethered to the
N-terminus of the other variable domain via a 15 to 25 amino acid
peptide or linker have been developed without significantly
disrupting antigen binding or specificity of the binding. The
linker is chosen to permit the heavy chain and light chain to bind
together in their proper conformational orientation.
[0144] Divalent single-chain variable fragments (di-scFvs) can be
engineered by linking two scFvs. This can be done by producing a
single peptide chain with two V.sub.H and two V.sub.L regions,
yielding tandem scFvs. ScFvs can also be designed with linker
peptides that are too short for the two variable regions to fold
together (about five amino acids), forcing scFvs to dimerize. This
type is known as diabodies. Diabodies have been shown to have
dissociation constants up to 40-fold lower than corresponding
scFvs, meaning that they have a much higher affinity to their
target. Still shorter linkers (one or two amino acids) lead to the
formation of trimers (triabodies or tribodies). Tetrabodies have
also been produced. They exhibit an even higher affinity to their
targets than diabodies. Preferably, if the antibody is to be
administered to humans, the antibody is a human antibody or is a
"humanized" antibody derived from a non-human animal.
2. Peptides
[0145] In some embodiments, the phosphospecific probe can be a
peptide. In some embodiments, the peptide can contain the idiotype
of an antibody, such as those described above. In other
embodiments, the peptide can be identified by screening a library
of peptides against the phosphorylated histone.
3. Peptidomimetics
[0146] In some embodiments, the phosphospecific probe can be a
peptidomimetic. In some embodiments, the peptidomimetic can mimic
the idiotype of an antibody, such as those described above. In
other embodiments, the peptidomimetic can be identified by
screening a library of peptidomimetic against the phosphorylated
histone.
[0147] A peptidomimetic is a small protein-like chain designed to
mimic a peptide. They typically arise either from modification of
an existing peptide, or by designing similar systems that mimic
peptides, such as peptoids and .beta.-peptides. Irrespective of the
approach, the altered chemical structure is designed to
advantageously adjust the molecular properties such as, stability
or biological activity. This can have a role in the development of
drug-like compounds from existing peptides. These modifications
involve changes to the peptide that will not occur naturally (such
as altered backbones and the incorporation of nonnatural amino
acids).
[0148] Peptidomimetics can have a non-amino acid residue with
non-amide linkages at a given position. Some non-limiting examples
of unnatural amino acids which may be suitable amino acid mimics
include .mu.-alanine, L-.alpha.-amino butyric acid, L-.gamma.-amino
butyric acid, L-.alpha.-amino isobutyric acid, L-.epsilon.-amino
caproic acid, 7-amino heptanoic acid, L-aspartic acid, L-glutamic
acid, N-.epsilon.-Boc-N-.alpha.-CBZ-L-lysine,
N-.epsilon.-Boc-N-.alpha.-Fmoc-L-lysine, L-methionine sulfone,
L-norleucine, L-norvaline, N-.alpha.-Boc-N-.delta.CBZ-L-ornithine,
N-.delta.-Boc-N-.alpha.-CBZ-L-ornithine,
Boc-p-nitro-L-phenylalanine, Boc-hydroxyproline, and
Boc-L-thioproline.
4. Aptamers
[0149] In some embodiments, the phosphospecific probe is an
aptamer. Aptamers are single-stranded RNA or DNA oligonucleotides
15 to 60 base in length that bind with high affinity to specific
molecular targets. Most aptamers to proteins bind with Kds
(equilibrium constant) in the range of 1 .mu.M to 1 nM, similar to
monoclonal antibodies. These nucleic acid ligands bind to nucleic
acid, proteins, small organic compounds, and even entire
organisms.
[0150] Aptamers can be selected by incubating the target molecule
in a large (e.g., 1010 to 1020) pool of oligonucleotide (usually 40
to 60mers). The large pool size of the oligonucleotide ensures the
selection and isolation of the specific aptamer. Aptamers can
distinguish between closely related but non-identical members of a
protein family, or between different functional or conformational
states of the same protein. The protocol called systematic
evolution of ligands by exponential enrichment (SELEX) is generally
used with modification and variations for the selection of specific
aptamers. Using this process, it is possible to develop new
aptamers in as little as two weeks.
Phosphorylated Histone or Histone Fragments
[0151] The present disclosure provides new phosphorylation sites of
histones H2B, H3 and H4. Accordingly, one embodiment provides
isolated H2B, H3 or H4 proteins or protein fragments that contain
one or more of these sites.
[0152] In one embodiment, provided is an isolated polypeptide that
includes an amino acid sequence as shown below or one that has at
least about 80%, 85%, 90%, 95%, 98% or 99% sequence identity to the
sequence shown:
TABLE-US-00001 (SEQ ID NO: 62) KRSRKESYSVYVYKVL (SEQ ID NO: 63)
KRSRKESpYSVYVYKVL (SEQ ID NO: 64) TVTAMDVVYALKRQGRT (SEQ ID NO: 65)
TVTAMDVVpYALKRQGRT (SEQ ID NO: 66) KRISGLIYEETRGVL (SEQ ID NO: 67)
KRISGLIpYEETRGVL (SEQ ID NO: 68) ALQEACEAYLVGLFED (SEQ ID NO: 69)
ALQEACEApYLVGLFED,
wherein a lowercase letter "p" indicates that the amino acid
following it is phosphorylated.
[0153] The unphosphorylated peptides here can be used as substrate
to measure the activities of kinases responsible for
phosphorylation of one of these sites. The phosphorylated one, on
the other hand, can be used to generate or verify antibodies or
other types of probes that specifically recognize or bind them. In
some aspects, the peptides do not include (e.g., are shorter than)
the entire histone protein.
Kits
[0154] One or more of the compositions described herein can be
assembled in kits. Printed instructions, either as inserts or as
labels, indicating quantities of the components to be administered,
guidelines for administration, and/or guidelines for mixing the
components, can also be included in the kit. Kits of the disclosure
can optionally include pharmaceutically acceptable carriers and/or
diluents.
[0155] The disclosed kit can contain, for example, phosphospecific
probes, such as antibodies, that specifically bind one, two, three,
or more of H2B-Tyr37, H4-Tyr88, H4-Tyr51, and H3-Tyr99.
[0156] In some aspects, the probes are provided on a platform, such
as a microarray, to form a panel. In some aspects, the panel
further contains probes for other histones or proteins useful for
disease detection or prognosis, as known in the art.
Actions Based on Identifications
[0157] The disclosed methods include the determination,
identification, indication, correlation, diagnosis, prognosis, etc.
(which can be referred to collectively as "identifications") of
subjects, diseases, conditions, states, etc. based on measurements,
detections, comparisons, analyses, assays, screenings, etc. For
example, detection of phosphorylation of H2B-Tyr37, H4-Tyr88,
H4-Tyr51, or H3-Tyr99 in a sample from the subject is a type of
identification. Such identifications are useful for many reasons.
For example, and in particular, such identifications allow specific
actions to be taken based on, and relevant to, the particular
identification made. For example, diagnosis of a particular disease
or condition in particular subjects (and the lack of diagnosis of
that disease or condition in other subjects) has the very useful
effect of identifying subjects that would benefit from treatment,
actions, behaviors, etc. based on the diagnosis. For example,
treatment for a particular disease or condition in subjects
identified is significantly different from treatment of all
subjects without making such an identification (or without regard
to the identification). Subjects needing or that could benefit from
the treatment will receive it and subjects that do not need or
would not benefit from the treatment will not receive it.
[0158] Accordingly, also disclosed herein are methods comprising
taking particular actions following and based on the disclosed
identifications. For example, disclosed are methods comprising
creating a record of an identification (in physical--such as paper,
electronic, or other--form, for example). Thus, for example,
creating a record of an identification based on the disclosed
methods differs physically and tangibly from merely performing a
measurement, detection, comparison, analysis, assay, screen, etc.
Such a record is particularly substantial and significant in that
it allows the identification to be fixed in a tangible form that
can be, for example, communicated to others (such as those who
could treat, monitor, follow-up, advise, etc. the subject based on
the identification); retained for later use or review; used as data
to assess sets of subjects, treatment efficacy, accuracy of
identifications based on different measurements, detections,
comparisons, analyses, assays, screenings, etc., and the like. For
example, such uses of records of identifications can be made, for
example, by the same individual or entity as, by a different
individual or entity than, or a combination of the same individual
or entity as and a different individual or entity than, the
individual or entity that made the record of the identification.
The disclosed methods of creating a record can be combined with any
one or more other methods disclosed herein, and in particular, with
any one or more steps of the disclosed methods of
identification.
[0159] As another example, disclosed are methods comprising making
one or more further identifications based on one or more other
identifications. For example, particular treatments, monitoring,
follow-ups, advice, etc. can be identified based on the other
identification. For example, identification of a subject as having
a disease or condition with a high level of a particular component
or characteristic can be further identified as a subject that could
or should be treated with a therapy based on or directed to the
high level component or characteristic. A record of such further
identifications can be created (as described above, for example)
and can be used in any suitable way. Such further identifications
can be based, for example, directly on the other identifications, a
record of such other identifications, or a combination. Such
further identifications can be made, for example, by the same
individual or entity as, by a different individual or entity than,
or a combination of the same individual or entity as and a
different individual or entity than, the individual or entity that
made the other identifications. The disclosed methods of making a
further identification can be combined with any one or more other
methods disclosed herein, and in particular, with any one or more
steps of the disclosed methods of identification.
[0160] As another example, disclosed are methods comprising
treating, monitoring, following-up with, advising, etc. a subject
identified in any of the disclosed methods. Also disclosed are
methods comprising treating, monitoring, following-up with,
advising, etc. a subject for which a record of an identification
from any of the disclosed methods has been made. For example,
particular treatments, monitoring, follow-ups, advice, etc. can be
used based on an identification and/or based on a record of an
identification. For example, a subject identified as having a
disease or condition with a high level of a particular component or
characteristic (and/or a subject for which a record has been made
of such an identification) can be treated with a therapy based on
or directed to the high level component or characteristic. Such
treatments, monitoring, follow-ups, advice, etc. can be based, for
example, directly on identifications, a record of such
identifications, or a combination. Such treatments, monitoring,
follow-ups, advice, etc. can be performed, for example, by the same
individual or entity as, by a different individual or entity than,
or a combination of the same individual or entity as and a
different individual or entity than, the individual or entity that
made the identifications and/or record of the identifications. The
disclosed methods of treating, monitoring, following-up with,
advising, etc. can be combined with any one or more other methods
disclosed herein, and in particular, with any one or more steps of
the disclosed methods of identification.
[0161] The disclosed measurements, detections, comparisons,
analyses, assays, screenings, etc. can be used in other ways and
for other purposes than those disclosed. Thus, the disclosed
measurements, detections, comparisons, analyses, assays,
screenings, etc. do not encompass all uses of such measurements,
detections, comparisons, analyses, assays, screenings, etc.
IV. Methods
Biomedical Research and Clinical Testing
[0162] Histone tyrosine phosphorylation antibodies raised against
H2B-Tyr37, H4-Tyr88, H4-Tyr51 and/or H3-Tyr99 can be highly useful
in biomedical research which involves sensitive techniques such as
immunoassays (e.g., immunoblotting, immunoprecipitation,
immunohistochemistry), Chip-on-CHIP and ChIP-sequencing.
[0163] For example, immunoblotting can be used in research and
clinical setting to determine which biological samples contain the
disclose phosphorylations that may correlate with disease
occurrence, development or progression. Antibodies can also be used
in immunoprecipitation experiments to identify interacting proteins
or proteins that partner with them to regulate specific biological
processes, such as proteins required for cell cycle.
[0164] Chromatin Immunoprecipitation followed by hybridization
(Chip-on-CHIP) and Chip-sequencing can be used to determine the
localization of this modification at specific genomic locations and
to determine which genes are targeted and turned on and off in a
variety of diseases and disorders such as cancer, diabetes, obesity
and diet related disorders.
[0165] Histone H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99
antibodies can be used for analysis of cellular response to growth
and proliferation signals of normal and cancer cell types, based on
the phosphorylation patterns. The examples are: (a) Response to
insulin and insulin like growth factors in cancer, obesity related
disorders and in diabetes; and (b) Response to platelet derived
growth factors in bone marrow transplants. Blood and tissue
biopsies obtained from known cancer, diabetes or obese patients can
be screened with the antibodies to detect differences in expression
profiles. Significant alterations can be correlated with disease
progression.
[0166] Stem cells offer great promise for new medical treatments
and will highly benefit a number of people afflicted with a variety
of disorders or diseases. However, at the present time very limited
markers exist which can identify whether a cell in question is a
stem cell. Stem cells have the ability to differentiate into any
cell type and they have unlimited renewal capacity and can
therefore be used in regenerative medicine. Histones are
fundamental protein entities and the disclosed histone
modifications are highly responsive to growth signals. In some
embodiments, these modifications occur in undifferentiated or
differentiated stem cells. The H2B-Tyr37, H4-Tyr88, H4-Tyr51 and
H3-Tyr99 antibodies can be used to identify and categorize the
different stem cell populations.
[0167] The histone antibodies can be used to determine if stem
cells have changed into specific clonal lineages (lymphoid-immune
system, erythroid-blood cell, neuronal cells-nerve, muscle, organ
specific such as liver, pancreas, heart or kidney), cancer stem
cells (these cells may have the capacity to grow in an uncontrolled
fashion and demonstrate resistance to many drugs that kill
differentiated cancer cells). H2B-Tyr37, H4-Tyr88, H4-Tyr51 and
H3-Tyr99 antibodies can be used to define drug resistant cancer
stem cells and cancer cell types and may be used to predict
response to treatment.
[0168] H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99 antibodies can be
used to analyze patient samples after radiotherapy and chemotherapy
to determine the effect of the treatment on gene expression and
cellular proliferations.
[0169] Tagged H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99 antibodies
can be used to isolate protein complexes of interest that may be
required for specific biological process such as embryo development
or patterning in various organisms, such as yeasts, worms, flies,
fishes, frogs, mice, and humans.
[0170] H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99 antibodies can be
used in global genomic, metabolomic and proteomics studies to
identify candidate genes that are regulated by the histone
modification in various organisms, such as yeasts, worms, flies,
fishes, frogs, mice, and humans.
[0171] H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99 antibodies can be
used to study X chromosome imprinting. Mammals such as mice and
humans achieve dosage compensation by inactivating one of the X
chromosomes in females. Expression profiling with H2B-Tyr37,
H4-Tyr88, H4-Tyr51 and H3-Tyr99 antibodies in blood or tissue
samples can reveal whether any disease is a consequence of loss of
X chromosome imprinting.
[0172] Genes associated with phosphorylated H2B-Tyr37, H4-Tyr88,
H4-Tyr51 and/or H3-Tyr99 can be identified and assessed. For
example, changes in expression of genes associated with
phosphorylated H2B-Tyr37, H4-Tyr88, H4-Tyr51 and/or H3-Tyr99 can be
used to detect, diagnose, prognose, etc. cancer and other diseases.
Examples of genes and genomic sequences associated with
phosphorylated H2B-Tyr37, H4-Tyr88, H4-Tyr51 and/or H3-Tyr99 are
observed. As described herein, association of phosphorylated
H2B-Tyr37, H4-Tyr88, H4-Tyr51 and/or H3-Tyr99 with genes affects
expression of these genes and can thus affect disease. Thus, for
example, detection of certain expression levels and/or changes in
expression levels of genes associated with phosphorylated
H2B-Tyr37, H4-Tyr88, H4-Tyr51 and/or H3-Tyr99 can be used in all of
the ways and for all of the purposes disclosed herein for detection
of associated with phosphorylated H2B-Tyr37, H4-Tyr88, H4-Tyr51
and/or H3-Tyr99.
[0173] All of the methods disclosed herein can be used in and with
any relevant cells, tissues, organs, organisms, etc. to assess, for
example, histone phosphorylation, gene and chromatin associations
of phosphorylated histones, and the effect of histone
phosphorylation and gene association on gene expression, epigenetic
phenotypes, physiology, and disease conditions, progression, etc.
The disclosed phosphospecific probes, such as the disclosed
antibodies, are especially useful for studying epigenetic effects
of histone phosphorylation at a basic level in experimental
organisms.
Immunoassays
[0174] In some embodiments, the disclosed phosphospecific probes
are antibodies, which are used in an immunoassay to detect a
phosphorylated histone. Immunoassays, in their most simple and
direct sense, are binding assays involving binding between
antibodies and antigen. Many types and formats of immunoassays are
known and all are suitable for detecting the disclosed biomarkers.
Examples of immunoassays are enzyme linked immunosorbent assays
(ELISAs), radioimmunoassays (RIA), radioimmune precipitation assays
(RIPA), immuoprecipitation assay (IP), immunobead capture assays,
Western blotting, dot blotting, gel-shift assays, ChIP,
ChIP-on-CHIP, ChIP-sequencing, flow cytometry, protein arrays,
antibody arrays, multiplexed bead arrays, magnetic capture, in vivo
imaging, fluorescence resonance energy transfer (FRET), and
fluorescence recovery/localization after photobleaching
(FRAP/FLAP).
[0175] Immunoassays can include methods for detecting or
quantifying the amount of a molecule of interest (such as
phosphorylated histones) in a sample, which generally involves the
detection or quantitation of any immune complexes formed during the
binding process. In general, the detection of immunocomplex
formation is well known in the art and can be achieved through the
application of numerous approaches. These methods are generally
based upon the detection of a label or marker, such as any
radioactive, fluorescent, biological or enzymatic tags or any other
known label.
B. Diagnosing, Prognosing, and Treating Disease
[0176] Methods for diagnosing a disease in a subject are provided
that involve assaying a sample from the subject for phosphorylation
of human Histone H2B tyrosine 37 residue, human Histone H4 tyrosine
51 residue, or human Histone H3 tyrosine 99 residue.
[0177] In some embodiments, the disclosed epigenetic changes can be
reversed by drugs and therefore are good targets for the prevention
and treatment of disease. The field of epigenetics is inspiring the
discovery of new drugs, and is gaining importance as part of
toxicology testing during drug development. Epigenetic therapy, the
use of drugs to correct epigenetic defects, is relatively new and
rapidly developing area of pharmacology. Epigenetic therapy is a
potentially very useful form of therapy because epigenetic defects,
when compared to genetic defects, are thought to be more easily
reversible with pharmacological intervention. In addition to
holding promise as therapeutic agents, epigenetic drugs may also be
able to prevent disease.
[0178] To assess the effect of histone H2B-Tyr37, H4-Tyr88,
H4-Tyr51 and H3-Tyr99 phosphorylations on health and disease,
epigenetic variations were catalogued across the genome or
epigenome in different tissues and at various stages of
development. Epigenetic changes can be detected in several ways.
One method uses chromatin immunoprecipitation, or ChIP. This
involves crosslinking DNA with its associated proteins and then
shearing the DNA. The fragments that contain H2B-Tyr37, H4-Tyr88,
H4-Tyr51 and H3-Tyr99 phosphorylations are extracted by
immunoprecipitation with antibodies specific for H2B-Tyr37,
H4-Tyr88, H4-Tyr51 and H3-Tyr99 phosphorylations. The
immunoprecipitated DNA is purified and labeled with a fluorescent
tag. This is then applied to the surface of a DNA microarray
containing a set of probes--a procedure commonly referred to as
ChIP-on-chip. The purified ChIP-DNA can also be sequenced, called
as ChIP-sequencing.
[0179] Using ChIP-on-CHIP and ChIP-sequencing approach, about 3500
distinct sites in genome which have histone H2B-Tyr37
phosphorylation were identified. Further, about 500 distinct sites
in genome which have histone H4-Tyr51 phosphorylation were
identified. The genes proximal to these sites (in some cases sites
are located within genes) are likely to be modulated by H2B-Tyr37
or H4-Tyr51 phosphorylations, respectively.
[0180] Availability of highly specific antibodies and the knowledge
of the sites at which histone are modified would allow us to
identify inhibitors (drugs) that suppresses H2B-Tyr37, H4-Tyr88,
H4-Tyr51 and H3-Tyr99 phosphorylations in epigenome.
[0181] The kinase WEE1 is primarily responsible for histone
phosphorylations at H2B-Tyr37. The tyrosine kinases Ack1 and EGFR
are primarily responsible for histone phosphorylations at H4-Tyr51
and H3-Tyr99. The specific inhibitors that suppress ability of WEE1
and Ack1 to phosphorylate H2B at Tyr37 and H3 atTyr99 would
therefore be therapeutically useful, especially in those patients
where phosphorylation of regulatory regions of genes is an
established epigenetic change known to occur. This `personalized
therapy` would bring in high benefits and reduce tumor related
deaths.
[0182] Therefore, also disclosed is a personalized method of
treating a disease in a subject. The method involves first assaying
a sample from the subject for phosphorylation of human Histone H2B
tyrosine 37 residue, human Histone H4 tyrosine 88, human Histone H4
tyrosine 51 residue, or human Histone H3 tyrosine 99 residue.
[0183] In this method, detection of phosphorylation at human
Histone H2B tyrosine 37 residue is an indication that the therapy
selected should include an inhibitor of WEE1 kinase. Detection of
phosphorylation at human Histone H3 tyrosine 99 residue is an
indication that the therapy selected should include an inhibitor of
Ack1 or EGFR or FGFR or insulin receptor kinase. Detection of
phosphorylation human Histone H4 tyrosine 51 or tyrosine 88 residue
is an indication that the therapy selected should include an
inhibitor of WEE1 or EGFR kinase and/or Ack1 kinase.
[0184] The disclosed method system can further involve the use of a
computer system to compare levels of the one or more of the
disclosed biomarkers to control values. For example, the computer
system can use an algorithm to compare levels of two or more
biomarkers and provide a score representing the risk of disease
onset based on detected differences. Therefore, also provided is an
apparatus for use in diagnosing, prognosing, or selecting a therapy
in a subject that includes an input means for entering
phosphorylated histone level values from a sample of the subject, a
processor means for comparing the values to control values, an
algorithm for giving weight to specified parameters, and an output
means for giving a score representing the risk of disease
onset.
1. Cancer
[0185] Most cancers are a mixture of genetic and epigenetic
changes. Although it is now well recognized that in most of cancers
the epigenetics changes play a crucial role, the identities of
precise histone phosphorylation events were not known, and the
tools, e.g., phosphorylation-specific antibodies, were not
available.
[0186] Four histone tyrosine phosphorylation events, H2B-Tyr37,
H4-Tyr88, H4-Tyr51 and H3-Tyr99, are disclosed and characterized.
These four epigenetic changes contribute to the development and
progression of cancer. H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99
phosphorylations regulate gene expression without changing the DNA
sequence. Further, these four epigenetic deregulations are involved
in tumor cell biology, including cell growth, differentiation, and
cell death, and therefore can be linked to patient prognosis.
[0187] Significant increase in H2B-Tyr37 phosphorylation was seen
in prostate (LNCaP), ovarian (A2780-CP), lymphoma (Raji), leukemia
(Jurkat) and melanoma (WM35) derived cell lines using
immunoprecipitation with phosphospecific antibodies. Significant
increase in H4-Tyr51 phosphorylation was seen in the breast cancer
derived MCF-7 cells and prostate cancer derived LAPC4 cells using
immunoprecipitation with phosphospecific antibodies.
[0188] Assessment of histone phosphorylation can be performed in
any sample and can be performed on samples of or derived from any
particular cells, tissues, and/or organs or combinations of
particular cells, tissues and/or organs.
[0189] Activated Ack1 (e.g. pTyr284-Ack1) phosphorylates histone H3
at tyrosine 99. Ack1 phosphorylation of H3 at Tyr99 was
significantly compromised upon Ack1-specific small molecule
inhibitor, AIM-100. Notably, AIM-100 suppressed
testosterone-independent expression of PSA, NKX3,1 and TMPRSS2
genes and mitigated the growth of prostate xenograft tumors. Thus,
marking of chromatin within androgen receptor or AR-target gene
promoters with H3-Tyr99-phosphorylation is required for its
transcriptional activation in androgen-deprived environment of
castration-resistant prostate tumors. The disclosed (actually, not
yet published) study uncovered a previously unknown mechanism of
regulation of Tyr-phosphorylated AR or pTyr-AR-target gene
expression, which can be therapeutically reversed by suppression of
Ack1/AR/H3-Tyr99 signaling by Ack1 inhibitor.
[0190] There was a positive relationship between tumor
differentiation and H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99
phosphorylations. In some embodiments, expression of H2B-Tyr37,
H4-Tyr88, H4-Tyr51 and/or H3-Tyr99 phosphorylations is a survival
predictor for patients with certain cancers, such as brain,
melanoma, CML, breast, prostate, and lung cancers.
[0191] Aberrations in post-translational modifications of histones
e.g. H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99 phosphorylations,
occur not only at individual promoters, but also occur over large
regions of chromatin including small non-coding RNA coding regions,
repetitive sequences and non-promoter sequences.
[0192] Changes in global levels of individual histone modifications
are also associated with cancer and these changes are predictive of
clinical outcome. Through immunohistochemical staining of primary
prostatectomy tissue samples, the percentage of cells that stained
for the histone H2B-Tyr37, H4-Tyr88, H4-Tyr51 and H3-Tyr99
phosphorylations was determined. Grouping of samples with similar
patterns of modifications identified two disease subtypes with
distinct risks of tumor recurrence in patients with low-grade
prostate cancer. These histone modification patterns were
predictors of outcome independently of tumor stage, preoperative
prostate-specific antigen levels, and capsule invasion. Thus,
widespread changes in specific histone modifications indicate
previously undescribed molecular heterogeneity in prostate, breast,
brain and lung cancer and underlie the broad range of clinical
behavior in cancer patients.
[0193] Collectively, these data indicate that histone H2B-Tyr37,
H4-Tyr88, H4-Tyr51 and H3-Tyr99 phosphorylations patterns serve as
outcome predictors for patients undergoing resection for brain,
lung, melanoma, breast and prostate cancers. Further, these results
indicate that these three histone modifications are associated with
increased gene activity and the aggressiveness of cancer
phenotype.
[0194] Therefore, the disclosed methods can be used to diagnose,
prognose, and/or treat cancer. In some embodiments, the cancer of
the disclosed methods can be any cell in a subject undergoing
unregulated growth. In preferred embodiments, the cancer is any
cancer cell capable of metastasis. For example, the cancer can be a
sarcoma, lymphoma, leukemia, carcinoma, blastoma, or germ cell
tumor. A representative but non-limiting list of cancers that the
disclosed compositions can be used to detect include lymphoma, B
cell lymphoma, T cell lymphoma, mycosis fungoides, Hodgkin's
Disease, myeloid leukemia, bladder cancer, brain cancer, nervous
system cancer, head and neck cancer, squamous cell carcinoma of
head and neck, kidney cancer, lung cancers such as small cell lung
cancer and non-small cell lung cancer, neuroblastoma/glioblastoma,
ovarian cancer, pancreatic cancer, prostate cancer, skin cancer,
liver cancer, melanoma, squamous cell carcinomas of the mouth,
throat, larynx, and lung, colon cancer, cervical cancer, cervical
carcinoma, breast cancer, epithelial cancer, renal cancer,
genitourinary cancer, pulmonary cancer, esophageal carcinoma, head
and neck carcinoma, large bowel cancer, hematopoietic cancers;
testicular cancer; colon and rectal cancers, prostatic cancer, and
pancreatic cancer.
[0195] Disclosed are methods of treating cancer in a subject that
involves first contacting a cancer sample from the subject with one
of more of the disclosed phosphospecific probes or antibodies. In
patients where phosphorylated H2B-Tyr37 is detected in the cancer
sample, the method further involves administering to the subject a
WEE1 inhibitor. In patients where phosphorylated H3-Tyr99 is
detected in the cancer sample, the method further involves
administering to the subject a Ack1 inhibitor. Also disclosed are
methods of treating cancer in a subject that involves administering
a WEE1 inhibitor to a subject in which phosphorylated H2B-Tyr37 was
detected. Also disclosed are methods of treating cancer in a
subject that involves administering an Ack1 inhibitor to a subject
in which phosphorylated H3-Tyr99, H4-Tyr51 was detected.
##STR00001##
[0196] Inhibitors for WEE1 and Ack1 are known in the art; so are
methods of preparing them. For instance, to prepare AIM-100, an
Ack1 inhibitor, synthesis can start from comercially available
compound 1 (shown above). (a) Ac2O, HCOOH, 60.degree. C., 6 hr,
followed by slow addition of 1 at 0.degree. C. then rt 12 hr, 90%;
(b) AcOH, microwave heating at 200.degree. C., 60 min, 75%; (c)
POCl3, 55.degree. C., 2 hr, under argon, 100%; (d)
(S)-(+)-Tetrahydrofurfurylamine, EtOH, reflux, 5 hr, 87%.
EXAMPLES
Example 1: Phosphorylation of Histone H2B at Tyrosine 37 Suppresses
Expression of Core Histone Genes in Hist1 Cluster
[0197] Core histone mRNA levels are exquisitely regulated within
cells. Histone transcription is initiated at the G1/S phase and is
actively downregulated in the G2 phase to avoid overproduction soon
after completion of DNA synthesis in S phase (Osley, M. A. (1991)
Annual Review of Biochem., 60:827-861; Borun, T. W. et al. (1975)
Cell 4:59-67; Hereford, L. et al. (1982) Cell 30:305-310; Hereford,
L. M. et al. (1981) Cell 24:367-375; Osley, M. A. et al. (1982)
Proc. Nat. Acad. Sci. U.S.A., 79:7689-7693; Osley, M. A. et al.
(1987) Mol. Cell. Biol., 7:4204-4210). While the rapid decrease in
histone transcript levels are accomplished by increasing mRNA
turnover of the replication-dependent histone mRNAs that encode the
bulk of the histone proteins in metazoan (Marzluff, W. F. et al.
(2008) Nature Reviews, 9:843-854), in Schizosaccharomyces pombe,
degradation of a transcriptional activator for histone
transcription maintains the histone pool (Takayama, Y. et al.
(2010) Developmental Cell, 18:385-396). However, the precise
mechanistic details of cessation of histone mRNA synthesis have not
been clear.
[0198] This example demonstrates that histone H2B phosphorylation
at tyrosine 37 (Tyr37) is critical for suppression of core histone
mRNA synthesis. Native Chromatin immunoprecipitation (ChIP)
followed by hybridization revealed that H2B Tyr37 phosphorylation
occurs upstream of histone cluster 1, Hist1, in S phase which
resulted in transcriptional suppression of multiple histone
encoding genes. WEE1, a tyrosine kinase, was identified to be the
kinase that phosphorylates H2B at Tyr37. Knockdown or inhibition of
WEE1 resulted in significant decrease in H2B Tyr37 phosphorylation
and concomitant increase in transcription of core histone genes.
Consistently, Saccharomyces cerevisiae point mutant lacking this
Tyr-phosphorylation site (H2B Y40A) also lost the ability to
suppress histone transcription. Moreover, WEE1 mediated H2B Tyr37
phosphorylation excluded binding of the transcriptional coactivator
NPAT and RNA polymerase II upstream of Hist1 cluster downregulating
histone mRNA synthesis. Taken together, these data unveil a
previously unknown mechanism wherein marking chromatin with
H2B-Tyr37-phosphorylation inhibits histone gene transcription
thereby lowering the burden on histone mRNA turnover machinery to
degrade these abundant mRNAs.
Materials and Methods
[0199] Cell Culture, Recombinant Histones, siRNAs and
Antibodies
[0200] Mouse embryo fibroblasts (MEFs) and HEK293 cell lines were
grown in DMEM supplemented with 10% FBS and antibiotics. H1975
human lung cancer cell line was grown in RPMI supplemented with 10%
FBS and antibiotics. The following antibodies and inhibitor were
used: WEE1 monoclonal antibody (Abnova), WEE1 polyclonal antibody
(Biovision), WEE1 inhibitor MK1775 (Calbiochem), anti-NPAT (BD
Biosciences), anti-RNA Pot II (Active Motif), anti-tubulin
(Santacruz), anti-H2A, anti-H2B, anti-H3, anti-H4, anti-Cdc2Y15,
anti-Cdc2 antibodies (Cell signaling), anti-yeast H2B (Active
Motif) and anti-myc antibody (Invitrogen). Purified human H2A, H2B,
H3 and H4 recombinant proteins were purchased from NEB and
recombinant GST-WEE1 protein was purchased from Invitrogen. NPAT
and WEE1 siRNAs were purchased from Santacruz. WEE1 KD and WEE1 WT
constructs were obtained. WT and swe1.DELTA. mutant yeast (S.
cerevisiae), WT and H2B Y40A mutant yeast were obtained.
Mass Spectrometric Identification of H2B Tyr-Phosphorylation
Sites
[0201] Total histones were purified from HEK293 cells using histone
minipurification kit (Active motif) as per manufacturer's
instructions. The purified histones were subjected to SDS-PAGE
electrophoresis (18%) and the gel was stained Coomassie Brilliant
Blue-R250 (BioRad). A prominent band of .about.14 kDa was excised,
and treated with Tris(2-carboxy-ethyl) phosphine hydrochloride
(TCEP) and iodoacetamide. Trypsin in-gel digestion was carried on
at 37.degree. C. overnight. The extracted peptides were analyzed by
LC-MS/MS. A nanoflow liquid chromatograph (U3000, Dionex,
Sunnyvale, Calif.) coupled to an electrospray ion trap mass
spectrometer (LTQ-Orbitrap, Thermo, San Jose, Calif.) was used for
tandem mass spectrometry peptide sequencing experiments. The sample
was first loaded onto a pre-column (5 mm.times.300 .mu.m ID packed
with C18 reversed-phase resin, 5 .mu.m, 100 .ANG.) and washed for 8
minutes with aqueous 2% acetonitrile and 0.04% trifluoroacetic
acid. The trapped peptides were eluted onto the analytical column
(C18, Pepmap 100, Dionex, Sunnyvale, Calif.).
[0202] The 120-minute gradient was programmed as: 95% solvent A (2%
acetonitrile+0.1% formic acid) for 8 minutes, solvent B (90%
acetonitrile+0.1% formic acid) from 5% to 50% in 35 minutes, then
solvent B from 50% to 90% B in 2 minutes and held at 90% for 5
minutes, followed by solvent B from 90% to 5% in 1 minute and
re-equilibrate for 10 minutes. The flow rate on analytical column
was 300 nl/min. Five tandem mass spectra were collected in a
data-dependent manner following each survey scan. The MS scans were
performed in Orbitrap to obtain accurate peptide mass measurement
and the MS/MS scans were performed in linear ion trap using 60
second exclusion for previously sampled peptide peaks. Sequest
(Yates, J. R., 3rd et al. (1995) Anal. Chem., 67:1426-1436,
3202-3210) and Mascot (Perkins, D. N. et al. (1999)
Electrophoresis, 20:3551-3567) searches were performed against the
Swiss-Prot human database. Two trypsin missed cleavages were
allowed, the precursor mass tolerance was 1.08 Da. MS/MS mass
tolerance was 0.8 Da. Dynamic modifications included
carbamidomethylation (Cys), oxidation (Met) and phosphorylation
(Ser/Thr/Tyr). Both MASCOT and SEQUEST search results were
summarized in Scaffold 2.0.
Generation and Affinity Purification of pTyr37-H2B Monoclonal and
Polyclonal Antibody
[0203] Two H2B peptides coupled to immunogenic carrier proteins
were synthesized as shown below and pTyr37-H2B antibodies were
custom synthesized by 21.sup.st century Biochemicals, MA.
TABLE-US-00002 The phosphopeptide: (SEQ ID NO: 11)
Ac-KRSRKES[pY]SVYVYKVL-Ahx-C-amide. The non-phospho peptide: (SEQ
ID NO: 12) Ac-KRSRKESYSVYVYKVL-Ahx-C-amide.
[0204] In brief, two rabbits were immunized twice with the
phosphopeptide, several weeks apart, and enzyme-linked
immunosorbent assay was performed to determine the relative titer
of sera against phosphorylated and nonphosphorylated peptides. The
titer against phosphorylated peptides (1:40,000) was much greater
than nonphosphorylated peptide (1:2000). The sera were affinity
purified. Two antigen-affinity columns were used to purify the
phospho-specific antibodies. The first column was the
non-phosphopeptide affinity column. Antibodies recognizing the
unphosphorylated residues of the peptide bound to the column and
were eluted as pan-specific antibodies. The flow-through fraction
was collected and then applied to the second column, the
phosphopeptide column. Antibodies recognizing the phospho-residue
bound to the column and were eluted as phospho-specific antibodies.
The antibodies were extensively validated for its specificity by
immunoblottings as shown in manuscript.
[0205] Antibodies against H3 Tyr99 and H4 Tyr51 and Tyr88 were
produced using the same techniques (but substituting appropriate H3
and H4 peptides, respectively, for immunization of rabbits).
Cell Synchronization Using a Double Thyimidine Block
[0206] MEFs or H1975 were grown to 60-70% confluency in serum rich
media. Thymidine is added at a final concentration of 2 mM and
incubated for 17 hours. Cells were washed three times with
phosphate buffered saline (PBS) and fresh serum containing media
was added. After 10 hours, thymidine was added again to 2 mM final
concentration. The cells were incubated for 17 hours and washed
three times with PBS, replaced with serum containing media and time
points were collected.
EdU Staining
[0207] For rapid detection of DNA synthesis in proliferating cells
we used the chemical method of Salic and Mitchison which is based
on the incorporation of 5-ethynyl-2'-deoxyuridine (EdU) and its
subsequent detection by a fluorescent azide through a
Cu(I)-catalyzed [3+2] cycloaddition reaction ("click" chemistry)
(Salic, A. et al. (2008) Proc. Nat. Acad. Sci. U.S.A.,
105:2415-2420). Reagents are available as a kit from Invitrogen
(Cat#350002). EdU was added at a final concentration of 10 .mu.M
and cells were harvested at the indicated timepoints. EdU-labeled
cells were fixed with 4% paraformaldehyde and cells were processed
for measuring DNA synthesis as described in the Click-it-EdU Alexa
Flour 488 Flow Cytometry Assay protocol (Invitrogen). Samples were
analyzed using the FACS Calibur flowcytometer, 20,000 events were
collected and analysis was carried out using the FloJo
software.
Cell Fractionation and Immunoprecipitations
[0208] Chromatin extraction was performed as described (Mendez, J.
et al. (2000) Mol. Cell. Biol., 20:8602-8612). The cells were
resuspended in Buffer A (10 mM HEPES pH7.9, 10 mM KCl, 1.5 mM
MgCl.sub.2, 0.34 M sucrose, 10% Glycerol, 1 mM DTT, protease and
phosphatase inhibitor cocktail). Triton X-100 was added to a final
concentration of 0.1% and the cells were incubated on ice for 5
minutes. The tubes were centrifuged at 1300 g, 4.degree. C. Nuclei
were collected in the pellet, and lysed in Buffer B (Buffer A plus
3 mM EDTA, 0.2 mM EGTA, 1 mM DTT, protease and phosphatase
inhibitors including sodium fluoride and sodium vanadate).
Insoluble chromatin was collected by centrifugation for 4 minutes
at 1700 g, washed once in buffer B and centrifuged. The final
chromatin pellet was resuspended in buffer, sonicated for
subsequent steps. For immunoprecipitations, cells were lysed in
receptor lysis buffer (RLB) containing 25 mmol/L HEPES (pH 7.5),
500 mmol/L NaCl, 1% Triton X-100, 10% glycerol, phosphatase
inhibitors (10 mmol/L NaF, 1 mmol/L Na.sub.2VO.sub.4), and protease
inhibitors) (Mahajan, K. et al. PLoS One 5, e9646 (2010)). For
co-immunoprecipitation, cells were lysed in low salt RLB buffer
containing 25 mmol/L HEPES (pH 7.5), 225 mmol/L NaCl, 1% Triton
X-100, 10% glycerol, phosphatase inhibitors (10 mmol/L NaF, 1
mmol/L Na.sub.2VO.sub.4), and protease inhibitor mix (Roche).
In Vitro Kinase Assay
[0209] For the in vitro kinase assay, 340 ng of purified GST-WEE1
(Invitrogen) and 1 .mu.g of H2A/H2B/H3/H4 (NEB) were incubated in
the presence or absence of WEE1 inhibitor in WEE1 kinase assay
buffer containing 50 mM HEPES (pH 7.5), 15 mM MgCl.sub.2, 1 mM
EGTA, 10% glycerol, 10 mM DTT and 0.1 mM ATP at 30.degree. C. After
60 mins, the reaction separated on SDS-PAGE (18%) followed by
immunoblottings with pTyr37-H2B, H2B, H2A, H3, H4 and WEE1
antibodies.
Quantitative RT-PCR
[0210] All RT reactions were done (Mahajan, K. et al. (2010) PLoS
One, 5:e9646) at the same time so that the same reactions could be
used for all gene studies. For the construction of standard curves,
serial dilutions of pooled sample RNA were used (50, 10, 2, 0.4,
0.08, and 0.016 ng) per reverse transcriptase reaction. One "no
RNA" control and one "no Reverse Transcriptase" (No RT) controls
were included for the standard curve. Three reactions were
performed for each sample: 10 ng, 0.8 ng, and a No RT (10 ng)
control. Real-time quantitative PCR analyses were performed using
the ABI PRISM 7900HT Sequence Detection System (Applied
Biosystems). All standards, the no template control (H.sub.2O), the
No RNA control, the no Reverse Transcriptase control, and the no
amplification control (Bluescript plasmid) were tested in six wells
per gene (2 wells/plate.times.3 plates/gene). All samples were
tested in triplicate wells each for the 10 ng and 0.8 ng
concentrations. The no RT controls were tested in duplicate wells.
PCR was carried out with SYBR Green PCR Master Mix (Applied
Biosystems) using 2 .mu.l of cDNA and the primers in a 20 .mu.l
final reaction mixture. After 2-min incubation at 50.degree. C.,
AmpliTaq Gold was activated by 10-min incubation at 95.degree. C.,
followed by 40 PCR cycles consisting of 15 s of denaturation at
95.degree. C. and hybridization of primers for 1 min at 55.degree.
C. Dissociation curves were generated for each plate to verify the
integrity of the primers. Data were analyzed using SDS software
version 2.2.2 and exported into an Excel spreadsheet. The actin
data were used for normalizing the gene values; i.e., ng gene/ng
actin per well. The primer sequences for qRT-PCRs are shown in
Table 1.
TABLE-US-00003 TABLE 1 The primer sequences for real-time PCRs Site
I F ATCCCCTCTATTAATCACATGGAACCTGAT SEQ ID NO: 13 Site I R
CACTGGCAAAAGAGCTTCTTGTACATAAAG SEQ ID NO: 14 Site II F
CAAAGCCAGGACTTGACCCTATGGGACACA SEQ ID NO: 15 Site II R
TAGTGTTAGAAAGAGTTGAGCATCCTATCC SEQ ID NO: 16 Control Site F
CTGGGTGACTTTCTTTAAAAGAGCACTCTT SEQ ID NO: 17 Control SiteR
GCAACGTAAAAACAGAATTCTAGGCCTTTA SEQ ID NO: 18 mActin F
CATTGCTGACAGGATGCAGAAGG SEQ ID NO: 19 mActin R
TGCTGGAAGGTGGACAGTGAGG SEQ ID NO: 20 Hist1 h2ai F
GCGACAACAAGAAGACGCGCAT SEQ ID NO: 21 Hist1 h2ai R
CTGGATGTTGGGCAGGACGCC SEQ ID NO: 22 Hist1 h2bI F
AAGAAGGACGGCAAGAAGCGCA SEQ ID NO: 23 Hist1 h2bI R
CGCTCGAAGATGTCGTTCACGA SEQ ID NO: 24 Hist1 h3h F
CTGATCCGCAAGCTGCCGTTC SEQ ID NO: 25 Hist1 h3h R
GTTGGTGTCCTCAAACAGACCC SEQ ID NO: 26 Hist1 h2bm F
GAAGGATGGCAAGAAGCGCAAG SEQ ID NO: 27 Hist1 h2bm R
CGCTCGAAGATGTCGTTCACGA SEQ ID NO: 28 Hist1 h4k F
AACATCCAGGGCATCACCAAGC SEQ ID NO: 29 Hist1 h4k R
GTTCTCCAGGAACACCTTCAGC SEQ ID NO: 30 Hist1 h2bn F
AAGAAGGACGGCAAGAAGCGCA SEQ ID NO: 31 Hist1 h2bn R
CGCTCGAAGATGTCGTTCACGA SEQ ID NO: 32 YACT1 F
GAAAAGATCTGGCATCATACCTTC SEQ ID NO: 33 YACT1 R AAAACGGCTTGGATGGAAAC
SEQ ID NO: 34 YHTB1 F GGTAAGAAGAGAAGCAAGGCTAGAA SEQ ID NO: 35 YHTB1
R GACTTCTTGTTATACGCAGCCA SEQ ID NO: 36 YHTA1 F TGTCTTGGAATATTTGGCCG
SEQ ID NO: 37 YHTA1 R TGGATGTTTGGCAAAACACC SEQ ID NO: 38 YHTB2 F
GTCGATGGTAAGAAGAGATCTAAGG SEQ ID NO: 39 YHTB2 R
GTGGATTTCTTGTTATAAGCGGC SEQ ID NO: 40 YHTA2 F
GCTGTCTTAGAATATTTGGCTGC SEQ ID NO: 41 YHTA2 R GGCAACAAGTTTTGGTGAATG
SEQ ID NO: 42 YHHT1 F GCTTTGAGAGAAATCAGAAGATTCC SEQ ID NO: 43 YHHT1
R GCAGCCAAGTTGGTATCTTCAA SEQ ID NO: 44 YHHT2 F
CTGTTGCCTTGAGAGAAATTAGAAG SEQ ID NO: 45 YHHT2 R
GCAGCCAGATTAGTGTCTTCAAAC SEQ ID NO: 46 YHHF1 F
TAAAGGTCTAGGAAAAGGTGGTGC SEQ ID NO: 47 YHHF1 R
TAACAGAGTCCCTGATGACGGATT SEQ ID NO: 48
Native Chromatin Immunoprecipitation (ChIP)
[0211] As a first step, extensive standardization of pTyr37-H2B
antibodies were performed for its usage in ChIP. CHIP was performed
using the Active Motif kit as per manufacturer's instructions. For
ChIP synchronized MEFs were harvested at 0 and 6.30 hour post
thymidine release (5.times.10.sup.7 cells). Cells pellets were
lysed in RLB buffer (Mahajan, N. P. et al. (2007) Proc. Nat. Acad.
Sci. U.S.A., 104:8438-8443; Mahajan, K. et al. (2010) Prostate,
70:1274-1285) on ice for 10 minutes and sonicated for 25 seconds to
shear DNA to an average length of 300-500 bp. The soluble chromatin
was incubated overnight at 4.degree. C. with pTyr37-H2B antibody.
20 .mu.l of protein-A agarose was added and the beads were washed
sequentially and DNA was eluted. Genomic DNA (Input) was prepared
by treating aliquots of chromatin with RNase, proteinase-K followed
by ethanol precipitation. Pellets were resuspended and the
resulting DNA was quantified on a NanoDrop spectrophotometer.
Extrapolation to the original chromatin volume allowed quantitation
of the total chromatin yield. An aliquot of chromatin (20-30 .mu.g)
was pre-cleared with protein-A agarose beads (Invitrogen). Genomic
DNA regions of interest were isolated using pTyr37-H2B antibody.
After incubation at 4.degree. C. overnight, protein-A agarose beads
were used to isolate the immune complexes. Complexes were washed,
eluted from the beads with SDS buffer, and subjected to RNase and
proteinase-K treatment and ChIP DNA was purified by
phenol-chloroform extraction and ethanol precipitation.
ChIP-On-Chip
[0212] ChIP and Input DNAs were amplified by whole-genome
amplification (WGA) using the GenomePlex WGA Kit (Sigma). The
resulting amplified DNAs were purified, quantified, and tested by
QPCR at the same specific genomic regions as the original ChIP DNA
to assess quality of the amplification reactions. Amplified DNAs
were fragmented and labeled using the DNA Terminal Labeling Kit
from Affymetrix, and then hybridized to Affymetrix GeneChip Tiling
or Promoter arrays at 45.degree. C. overnight. Arrays were washed
and scanned, and the resulting CEL files were analyzed using
Affymetrix TAS software. Thresholds were selected, and the
resulting BED files were analyzed (using Genpathway proprietary
software) that provides comprehensive information on genomic
annotation, peak metrics and sample comparisons for all peaks
(intervals).
Native ChIP-Sequencing and Analysis
[0213] The native ChIP was performed as described above. The 0 and
6.30 hrs post thymidine release chromatin immunoprecipitated DNAs
were subjected to sequencing. Sequencing yield was very good with
almost 40 million reads in each sample, of which 27.7 and 23.6
million for samples 6.30 hr and 0 hr, respectively, mapped uniquely
to the mouse mm9 genome.
[0214] a. Sequence Analysis:
[0215] The 36-nt sequence reads ("tags") identified by the
Sequencing Service (using Illumina's Genome Analyzer 2) are mapped
to the genome using the ELAND algorithm. Alignment information for
each tag is stored in the output file *_export.txt. Only tags that
map uniquely, have no more than 2 mismatches, and that pass quality
control filtering are used in the subsequent analysis.
[0216] b. Determination of Fragment Density:
[0217] Since the 5''-ends of the sequence tags represent the end of
ChIP/IP-fragments, the tags were extended in silico (using Active
Motif software) at their 3''-ends to a length of 110-200 bp,
depending on the average fragment length in the size selected
library. To identify the density of fragments (extended tags) along
the genome, the genome was divided into 32-nt bins and the number
of fragments in each bin was determined. This information was
stored in a BAR (Binary Analysis Results) file that can be viewed
in a browser such as Affymetrix' Integrated Genome Browser
(IGB).
[0218] c. Interval Analysis ("Peak Finding"):
[0219] An Interval is a discrete genomic region, defined by the
chromosome number and a start and end coordinate. Intervals
represent the locations of fragment density peaks. For each BAR
file, Intervals are calculated and compiled into BED files (Browser
Extensible Data). A typical threshold setting is in the range of
10-20, but may be adjusted depending on the number of tags
sequenced or based on information on positive and negative test
sites, independent estimates for the false discovery rate (FDR),
and/or the intent to generate a stringent or relaxed analysis. The
applied threshold can be found in the Assay Results Report. For an
Interval to be called, it must contain 3 consecutive bins with
fragment densities greater than the threshold.
[0220] d. Alternative and/or Optional Analysis Steps:
[0221] 1. Tag Normalization: When samples had uneven tag counts,
the tag numbers of all the samples were truncated to the number of
tags present in the smallest sample.
[0222] 2. False Peak Filtering: Input or IgG control sample (which
represent false peaks) were used to remove corresponding Intervals
in ChIP samples, or to mark them as likely false positives.
[0223] 3. MACS: This alternative, model-based peak finding
algorithm (Zhang, Y. et al. (2008) Genome Biol., 9:R137) was used
if an Input or IgG control sample was available.
[0224] e. Active Region Analysis:
[0225] To compare peak metrics between 2 or more samples,
overlapping Intervals were grouped into "Active Regions", which
were defined by the start coordinate of the most upstream Interval
and the end coordinate of the most downstream Interval (=union of
overlapping Intervals). In locations where only one sample had an
Interval, this Interval defined the Active Region. Active Regions
were useful to consider because the locations and lengths of
Intervals were rarely exactly the same when comparing different
samples.
[0226] f. Annotations:
[0227] After defining the Intervals and Active Regions, their exact
locations along with their proximities to gene annotations and
other genomic features were determined and presented in Excel
spreadsheets. In addition, average and peak fragment densities
within Intervals and Active Regions were compiled.
Pull Down and Filter Binding Assay
[0228] Two human histone H2B peptides spanning amino acids 25-49
were synthesized with Tyr37 at middle of the peptide. The sequences
are as follows:
TABLE-US-00004 H2B(25-49): (SEQ ID NO: 49)
DGKKRKRSRKESYSVYVYKVLKQVH pY37-H2B(25-49): (SEQ ID NO: 50)
DGKKRKRSRKESpYSVYVYKVLKQVH
[0229] Both the peptides were biotinylated at C-terminus and
immobilized on streptavidin-sepharose beads. The beads were
incubated with HEK293 cell lysates made in TGN buffer containing 50
mmol/L Tris (pH 7.5), 50 mmol/L Glycine, 150 mmol/L NaCl, 1% Triton
X-100, 10% glycerol, phosphatase inhibitors (10 mmol/L NaF, 1
mmol/L Na.sub.2VO.sub.4), and protease inhibitor mix (Roche). The
beads were extensively washed with TGN buffer and bound NPAT was
resolved by SDS-PAGE followed by immunoblotting with NPAT
antibodies. Equal loading of peptide was determined by Coomassie
blue staining.
[0230] NPAT binding to unphosphorylated H2B was confirmed by filter
binding assay. Two concentrations of H2B(25-49) or pY37-H2B(25-49)
peptides were spotted on nitrocellulose membrane which was
incubated with HEK293 cell lysates prepared in TGN buffer. Blot was
washed extensively followed by immunoblotting with NPAT
antibodies.
Yeast Strains, Culture Conditions and Cell Synchronization
[0231] The yeast strains used in this study are pp30-Swe1HA
(SWE1HA6-HIS3MX6) and pp30-swe1.DELTA. (SWE1HIS3MX6) (Mollapour, M.
et al. (2010) Mol. Cell 37:333-343). WT (MATa
(hta1-htb1).DELTA.::LEU2, (hta2-htb2).DELTA.::TRP1, his3.DELTA.200
leu2.DELTA.1 ura3-52 trp1.DELTA.63
lys2-128.DELTA.<pZS145-HTA1-Flag-HTB1-HIS3>) and H2B-Y40A
mutant of Saccharomyces cerevisiae were obtained (Nakanishi, S. et
al. (2008) Nature Struct. & Mol. Biol., 15:881-888). Yeast
cells were grown in YPD media at 30.degree. C. for 24 hours. The
culture was diluted 1:20 and grown for 1 hour followed by addition
of .alpha.-factor for 3 hours. Cells were harvested by
centrifugation (5000 rpm for 5 min), washed with sterile water and
resuspended in fresh media. Cells were harvested at different time
points.
Yeast Protein Isolation
[0232] S. cerevisiae cells were grown as described above and
spheroplasts were obtained as per manufacturer's protocol (Zymo
Research). In brief, cells were centrifuged and resuspended in 130
.mu.l digestion buffer containing 5 .mu.l of Zymolyase (5
units/.mu.l). Cells were incubated at 37.degree. C. for 1 hour,
spheroplasts were resuspended in RLB buffer (Mahajan, K. et al.
(2010) PLoS One, 5:e9646) and sonicated for 10 sec. Lysates were
centrifuged (12,000 rpm for 10 min) and supernatants were
quantitated followed by immunoblotting or immunoprecipitation.
Yeast RNA Isolation
[0233] S. cerevisiae cells were grown and spheroplasts were
obtained as described above. The RNAs were isolated using YeaStar
RNA kit as per manufacturer's protocol (Zymo Research). To obtain
ultra clean RNA that is DNA free, RNAs were passed through
Fast-spin columns (DNA-Free RNA kit) as per manufacturer's protocol
(Zymo Research). RNAs were quantitated and used for qRT-PCRs.
Yeast FACS Analysis
[0234] 10 ml of WT and Y40A mutant yeast cells (1.times.10.sup.7)
were harvested at different time points after release from
.alpha.-factor and washed with water. Collected cells were fixed
with 70% ice cold ethanol overnight at -20.degree. C. Next day the
tubes were centrifuged, fixative was removed and the cells were
resuspended in 1 ml water and centrifuged at 14,000 rpm for 1 min.
The cell pellet was resuspended in 0.5 ml 1 mg/ml RNase solution
and incubated for 3 hours at 37.degree. C. The cells were collected
by centrifugation and resuspended in 0.2 ml protease solution (0.5
mg/ml pepsin) and incubated for 30 minutes at 37.degree. C. The
treated cells were collected by centrifugation at 14,000 rpm for 1
minute, the supernatant was discarded and the cell pellet was
resuspended in 0.5 ml 50 mM Tris-HCl pH 8.0. 0.1 ml of the cell
suspension was transferred to a FACS tube containing 1 ml of 1
.mu.M SYTOX Green staining solution. The cell clumps were dispersed
by brief sonication on low power. The cells were analyzed by FLOW
cytometry with 488 nm excitation and 523 nm emission. 20,000 events
were collected and analysis was carried out using the Modfit
software for DNA analysis.
Yeast Histone Purification
[0235] S. cerevisiae cells were grown and spheroplasts were
obtained as described earlier. The spheroplasts were resuspended in
extraction buffer (Active Motif) and chromatin bound core histones
were purified as per manufacturer's instructions. Purified core
histones were electrophoresed on 18% SDS-PAGE followed by Coomassie
blue staining or immunoblotting with yeast H2B antibodies.
Results
[0236] The decoration of histones by post-translational
modifications (PTM), including acetylation, phosphorylation,
methylation, ubiquitylation and SUMOylation has emerged as a major
regulatory mechanism of temporal gene expression (Berger, S. L.
(2007) Nature, 447:407-412). To delineate functional consequences
of histone tyrosine phosphorylation, purified histones were
subjected to mass spectrometry based PTM identification.
Phosphorylation at tyrosine 37 in histone H2B was identified (FIGS.
4A-4C). Since the functional role of Tyr37-phosphorylated H2B
(pTyr37-H2B) was unknown, phospho-antibodies were raised against
pTyr37-H2B and extensively validated (FIGS. 13C-13E, 13G, 14-16,
18). Recognition of peptides by pTyr37-H2B antibodies were compared
and it was observed that only the H2B phosphopeptide that was
phosphorylated at Tyr37 was recognized whereas the
non-phosphorylated H2B peptide or H2B harboring a Tyr37 to Phe
(Y37F) substitution was not reactive (FIG. 14). Further,
competition of pTyr37-H2B antibodies with phosphopeptide resulted
in almost complete loss of recognition of pTyr37-H2B
phosphopeptides (FIG. 15). Moreover, pTyr37-H2B antibodies were
screened for cross-reactivity against 59 distinct acetylation,
methylation, phosphorylation, and citrullination modifications on
core histones using Histone Peptide Arrays. The pTyr37-H2B antibody
did not cross-react with any of these PTMs, however when the same
blots were hybridized with H3K9me3 antibodies, it revealed expected
pattern of hybridization (FIG. 16). Collectively, these data
indicate that the antibodies are selective for
pTyr37-phosphorylation on histone H2B.
[0237] Mass spectrometry based analysis revealed that in
asynchronously growing cultures, pTyr37-H2B levels are 0.21% of
total H2B protein (Table 2), which indicated that H2B is
Tyr-phosphorylated transiently during cell cycle followed by rapid
dephosphorylation. NMC refers to a trypsin missed cleavage at the
N-terminus of the peptide. 1+ and 2+ refer to the charge of the
peptide. Sequest database search scores e.g. XCorr and delta CN
score are shown.
TABLE-US-00005 TABLE 2 Mass spectrometry based analysis in
asynchronously growing cultures Delta Peptide XCore CN precursor
Sequence score score m/z mass H2B-Y37 (K)ESYSVYVYK(V) 1.81 0.4506
569.276 1,136.54 (SEQ ID NO: 51) H2B-Y37-NMC_1+ (R)KESYSVYVYK(V)
2.05 0.2016 1,265.64 1,264.64 (SEQ ID NO: 52) H2B-Y37-NMC_2+
(R)KESYSVYVYK(V) 3.37 0.4804 633.3239 1,264.63 (SEQ ID NO: 53)
H2B-pY37 (K)ESySVYVYK(V) 2.34 0.2713 609.2303 1,216.44 (SEQ ID NO:
54) peptide peptide delta delta start stop Peak Charge mass ppm
position position Area H2B-Y37 2 -0.00248 -2.18 36 44 451415266
H2B-Y37-NMC_1+ 1 0.001518 1.199 35 44 9699792 H2B-Y37-NMC_2+ 2
-0.00166 -1.309 35 44 217955845 H2B-pY37 2 -0.06024 -49.48 36 44
1490065 % of pY37 0.218946585
[0238] To assess cell cycle specific pTyr37-phosphorylation of H2B,
mouse embryo fibroblasts (MEFs) were synchronized by double
thymidine, released in fresh media and aliquots were collected at
different time intervals. The pTyr37-H2B was detected at 6.15-6.45
hours post-release, peaking at 6.30 hours post-release (FIGS. 13A,
17). Synchronized H1975, a human lung cancer cell line also showed
H2B pTyr37-phosphorylation 6.30 hours post thymidine release.
EdU-incorporation assay of 6.30 hours post-release cells revealed
that significant proportion of these cells were in S phase (FIG.
5). During S phase, temporal regulation of WEE1 kinase expression
and tyr-phosphorylation of its substrate, Cdc2 is well established
(Russell, P. et al. (1987) Cell, 49:559-567; Heald, R. et al.
(1993) Cell, 74:463-474; Lundgren, K. et al. (1991) Cell,
64:1111-1122; McGowan, C. H. et al. (1995) The EMBO Journal,
14:2166-2175). To examine whether H2B is a WEE1 kinase substrate,
cells were treated with increasing concentrations of WEE1
inhibitor, MK-1775 (Hirai, H. et al. (2009) Mol. Cancer Ther.,
8:2992-3000). Even a 0.3 .mu.M concentration of WEE1 inhibitor
treatment resulted in complete loss of pTyr37-phosphorylation of
H2B (FIG. 13B). Similarly, transfection of cells with WEE1 siRNA
resulted in complete loss of H2B pTyr37-phosphorylation (FIG. 13C).
To test whether WEE1 directly phosphorylates H2B, in vitro kinase
assay (Mahajan, K. et al. (2010) PLoS One, 5:e9646) was performed.
When purified WEE1 and H2B were incubated, H2B was
Tyr37-phosphorylated, however, WEE1 inhibitor abrogated H2B
pTyr37-phosphorylation (FIG. 13D). Further, WEE1 phosphorylated H2B
peptide, however, Y37F mutant peptide was not phosphorylated (FIG.
18). Moreover, WEE1 specifically phosphorylated H2B and failed to
phosphorylate other three core histones, H2A, H3 and H4 (FIG. 13E).
Co-immunoprecipitation experiment revealed that WEE1 binds to
endogenous H2B (FIG. 19) and phosphorylates it as seen by
WEE1/pTyr37-H2B complex formation (FIG. 13F). To further validate
H2B as a substrate for WEE1 kinase in vivo, FLAG-tagged H2B and
Y37F mutant-H2B expressing constructs were generated. Coexpression
with wild-type (WT) WEE1 or kinase dead (KD)-WEE1 kinase revealed
that the WT-WEE1 specifically phosphorylated H2B but failed to
phosphorylate Y37F mutant (FIG. 13G). Collectively, these data
indicate that WEE1 kinase specifically phosphorylates H2B at
Tyr37.
[0239] To identify regions in chromatin where H2B
Tyr37-phosphorylation occurs, this study performed native
ChIP-coupled DNA microarray analysis (ChIP-on-chip) (Kim, T. H. et
al. (2005) Nature, 436:876-880) and native ChIP-sequencing. The
sheared chromatin from synchronized MEFs (0 and 6.30 hours
post-release) was immunoprecipitated using a pTyr37-H2B antibody
followed by sequencing. It lead to the identification of 3524
potential sites/regions where pTyr37-H2B is present in mouse
genome; 1240 of which were present within genes while 351 sites
were present upstream and 326 sites were downstream of genes.
ChIP-on-chip revealed two pTyr37-H2B-containing sites, named here
as Site I and II, upstream of histone encoding genes, the histone
cluster 1 or Hist1, opening an intriguing possibility of histone
expression regulation by modified histone itself.
[0240] The genes for the five histones H1/H2A/H2B/H3/H4 are
clustered together in the genome in all metazoans. There are 10-20
functional copies of the genes for each of the histone proteins and
each individual gene encodes a small fraction of the total histone
protein. In mammals there are two loci, each containing multiple
histone genes. The largest cluster, HIST1, is located on chromosome
6 in humans and chromosome 13 in mice (Albig, W. et al. (1997)
Human Genetics, 101:284-294; Albig, W. et al. (1997) Genomics,
40:314-322; Wang, Z. F. et al. (1996) Genome Research, 6:688-701).
The mouse and human histone gene clusters have strikingly similar
gene numbers and organization. The mouse Hist1 cluster contains
majority of histone coding genes, i.e., 45 core histone genes and 6
histone H1 genes (Marzluff, W. F. et al. (2002) Genomics,
80:487-498). The histone genes in the Hist1 cluster are arranged in
three subclusters. About a third of histone genes, closest to site
I and II are located in Subcluster 1 (FIG. 1A), some of these genes
have been analyzed in this study.
[0241] To validate the presence of pTyr37-H2B upstream of the Hist1
cluster, sheared chromatin from synchronized MEFs (0 and 6.30 hours
post-release) was immunoprecipitated using the pTyr37-H2B antibody
followed by quantitative polymerase chain reaction or ChIP-qPCR
(Mahajan, K. et al. (2010) Prostate, 70:1274-1285). It revealed
that pTyr37-H2B is present at both the sites, site I and II,
however, upon WEE1 inhibitor treatment, occurrence of pTyr37-H2B at
these sites was significantly reduced (FIGS. 1B and 1C). Presence
of pTyr37-H2B appears to be specific for site I and II, because
pTyr37-H2B was not detected within the Hist1 gene cluster (control
site, FIG. 1D). To assess whether WEE1 regulates H2B
Tyr37-phosphorylation upstream of the Hist1 cluster, ChIP-qPCR was
performed using WEE1 antibodies. The amount of WEE1 at site II was
significantly increased in 6.30 hours post-release MEFs (FIGS. 1E
and 13A). To further validate the role of WEE1, cells were
transfected with WEE1 or control siRNAs and ChIP-qPCR was performed
using pTyr37-H2B antibodies. Significant decrease in site II
specific ChIP-DNA was observed in WEE1 siRNA transfected sample as
compared to the control siRNA transfected sample (FIG. 1F),
indicating a functional, WEE1 kinase-dependent pTyr37-H2B
association with the Hist1 gene cluster.
[0242] Modification of core histones has been demonstrated to
regulate transcription (Berger, S. L. (2007) Nature, 447:407-412;
Laribee, R. N. et al. (2007) Genes & Development, 21:737-743),
however, transcription of histone themselves were not known to be
regulated by histone phosphorylation. Expression of histone RNA was
assessed in synchronized MEFs demonstrating that core histone RNA
levels peaked within 2 hours post-release. However, at 6.30 hours
post-release, when H2B is Tyr37-phosphorylated, a sharp decline was
observed (FIG. 2A). To investigate whether pTyr37-H2B plays a
direct role in regulating histone gene transcription, synchronized
MEFs were treated (or untreated) with WEE-1 specific inhibitor.
Total RNA was isolated and qRT-PCR was performed. In untreated
cells, rapid decrease in transcripts of multiple core histone genes
was observed after 6.30 hours post-release (FIGS. 2B-2G). However,
upon WEE1 inhibitor treatment, histone mRNA levels did not decrease
after 6.30 hours post-release; instead, a significant increase was
observed (FIGS. 2B-2G, compare 8.30 hours post-release). These data
indicate that pTyr37-H2B phosphorylation may have repressive effect
on transcription of core histone genes located in Hist1
cluster.
[0243] To validate the role of H2B Tyr37-phosphorylation in histone
transcriptional suppression, budding yeast S. cerevisiae was
utilized. Tyr37 is evolutionarily conserved from humans to
unicellular eukaryotes e.g. Tyr40 in S. cerevisiae (FIG. 3A). In S.
cerevisiae, histones are transcribed from four sets of gene pairs,
HTA1-HTB1 and HTA2-HTB2 for H2A and H2B, and HHT1-HHF1 and
HHT2-HHF2 for H3 and H4 (Hereford, L. et al. (1982) Cell,
30:305-310; Hereford, L. M. et al. (1981) Cell, 24:367-375; Osley,
M. A. et al. (1982) Proc. Nat. Acad. Sci. U.S.A., 79:7689-7693).
Similar to metazoan, the transcription is activated at the G1/S
transition and repressed in G1 and G2/M phases of the cell cycle
(Osley, M. A. et al. (1982) Proc. Nat. Acad. Sci. U.S.A.,
79:7689-7693; Osley, M. A. et al. (1987) Mol. Cell. Biol.,
7:4204-4210; Sutton, A. et al. (2001) Genetics, 158:587-596; Cross,
S. L. et al. (1988) Mol. and Cell. Biol., 8:945-954). To assess
whether H2B Tyr40-phosphorylation regulates histone gene
transcription, WT and H2B-Y40A mutant cells (Nakanishi, S. et al.
(2008) Nature Struct. & Mol. Biol., 15:881-888) of S.
cerevisiae were synchronized by adding .alpha.-factor, resuspended
in fresh media and harvested at different time-points. H2B
Tyr40-phosphorylation was observed 20-30 min post .alpha.-factor
release, in contrast, H2B Tyr40-phosphorylation was abrogated in
Y40A mutant yeast (FIG. 31). To examine histone RNA levels, total
RNA was isolated from WT and H2BY40A mutant yeast followed by
qRT-PCR. The WT cells exhibited peak histone RNA synthesis at 20
minutes post .alpha.-factor release followed by rapid decrease
(FIGS. 3B-3F, 3J). In contrast, HTA1, HTB1, HHF1 and HHT1 mRNA
levels continue to increase peaking at 30 minutes in the Y40A
mutant (FIGS. 3B-3F, 3J, compare 30 minutes). Overall mRNA levels
of HHT2 did not increase significantly in Y40A mutant, however,
they did peak at 30 minutes as seen in case of HTA1, HTB1, HHF1,
and HHT1 (FIGS. 3E and 3F).
[0244] A homolog of WEE1 in S. cerevisiae is SWE1, which is the
only tyrosine kinase in budding yeast (Booher, R. N. et al. (1993)
Embo. J., 12:3417-3426). SWE1 mutant (swe1.DELTA.) failed to
phosphorylate H2B at Tyr40, indicating that SWE1 mediated
Tyr37-phosphorylation of H2B is conserved in yeast. To determine
whether loss of SWE1 kinase activity and thus loss of Tyr40
phosphorylation of H2B would also lead to loss of transcriptional
suppression of yeast histones, total RNA isolated from WT and
swe1.DELTA. mutant were subjected to qRT-PCR. As seen in mammalian
cells (in FIGS. 2B-2G), loss of SWE1 activity in yeast too resulted
in significant increase in HTA1 and HTB1 levels (FIG. 6). Taken
together, these data indicate that histone transcription
suppression caused by SWE1 mediated by H2B Tyr40-phosphorylation is
conserved in S. cerevisiae.
[0245] FACS analysis was performed to determine whether the
increase in histone gene expression is due to an altered cell cycle
profile of the Y40A mutant cells. Synchronized WT and Y40A mutant
S. cerevisiae were released into YPD media, harvested at the
indicated time intervals, stained with Sytox green followed by flow
cytometry. WT and Y40A mutant cells exhibited similar cell cycle
kinetics (FIGS. 7A and 7B), indicating that increased histone RNA
levels observed in H2B Y40A mutant is not due to altered cell cycle
profile.
[0246] To understand the potential mechanism of repression of
histone transcription the role of NPAT was assessed. NPAT has been
shown to play an essential role in the transcriptional activation
of histone genes by its recruitment along with RNA polymerase II at
both Hist1 clusters (Miele, A. et al. (2005) Mol. and Cell. Biol.,
25:6140-6153; Wei, Y. et al. (2003) Mol. and Cell. Biol.,
23:3669-3680; Zhao, J. et al. (1998) Genes & Development,
12:456-461; Zhao, J. et al. (2000) Genes & Development,
14:2283-2297). Chromatin from synchronized MEFs at 6.30 hours
post-release was immunoprecipitated with NPAT or RNA polymerase II
antibodies, respectively, followed by qPCR. While recruitment of
NPAT and RNA polymerase II was not observed when H2B
Tyr37-phosphorylation was optimal, binding was detected when the
phosphorylation was abrogated by treatment with WEE1 inhibitor
(FIGS. 3G-3H). To confirm that RNA polymerase II presence at site
II is dependent on NPAT, MEFs were transfected with control and
NPAT siRNAs and chromatin was immunoprecipitated with RNA
polymerase II antibodies followed by qPCR. RNA polymerase II
presence at site II was significantly decreased upon depletion of
NPAT (FIGS. 7A and 7B).
[0247] To understand the mechanism underlying loss of NPAT binding
to site II when H2B is Tyr37-phosphorylated, pull-down assay were
performed with biotin-conjugated H2B peptides spanning amino acids
25-49. The unphosphorylated or H2B(25-49) and pY37-H2B(25-49)
peptides were immobilized on streptavidin-Sepharose beads followed
by incubation with HEK293 whole cell extract. Beads were washed and
bound protein was analyzed by immunoblotting with NPAT antibodies.
While NPAT specifically bound to unmodified H2B peptide, the
binding was abolished when the peptide was phosphorylated at Tyr37
(FIG. 3L). The specificity of NPAT for unphosphorylated H2B was
further confirmed by filter binding assay (FIG. 20). Taken
together, these data indicate that H2B Tyr37-phosphorylation
excluded the ability of NPAT to bind upstream of Hist1 cluster.
[0248] Collectively, these data unveil previously unknown mechanism
wherein marking chromatin specifically upstream of major histone
gene cluster Hist1 with H2B Tyr37-phosphorylation suppressed
transcription of histone genes. This mechanism appears to be
conserved, including in yeast where H2B-Tyr40-phosphorylation
suppressed histone transcription. Further, it uncovers a new
function of SWE1/WEE1, i.e. maintaining histone mRNA levels.
Overall, whether in mammals or yeast, H2B-Tyr37-phosphorylation
appears to be vital to cellular homeostasis as in combination with
histone mRNA turnover, histone transcription repression could
efficiently and rapidly lower the transcript levels, eliminating
overload of core histones after DNA synthesis.
Example 2: Phosphorylation of Histone H3 at Tyrosine 99:
Implications in Prostate Cancer
[0249] Despite androgen deprivation, prostate cancer progresses to
castration resistant prostate cancer (CRPC) stage which no longer
responds to androgen ablation therapy. The epigenetic modifications
underlying CRPC growth are not clear. The non-receptor tyrosine
kinase, Ack1, phosphorylates androgen receptor (AR) at Tyr267 and
Tyr-363. ChIP-qPCR analysis revealed specific recruitment of
pTyr284-Ack1/pTyr267-AR or pTyr363-AR to PSA, NKX3,1 and TMPRSS2
gene promoters in the absence of androgen, leading to growth of
CRPC tumors. However, precise mechanistic details of
transcriptional regulation are not clear.
[0250] The discovery was made that Ack1 phosphorylates histone H3
at tyrosine 99. To delineate functional consequences of H3
Ty99-phosphorylation, phospho-antibodies were raised. Treatment of
cell lines with variety of ligands resulted in activation of
cognate RTKs which in turn activated Ack1. Ack1 phosphorylated H3
at Tyr99, which was significantly compromised upon Ack1-specific
small molecule inhibitor, AIM-100 treatment. Notably, AIM-100
suppressed recruitment of pTyr-AR to PSA, NKX3,1 and TMPRSS2
promoters and mitigated the growth of CRPC xenograft tumors.
Further, AIM-100 treatment increased H3K9 and K27 dimethylation and
trimethylation. H3 Y99F mutant also exhibited increased H3K27
dimethylation and trimethylation. Thus, marking of chromatin with
H3-Tyr99-phosphorylation within AR-target gene promoters may
suppress repressive dimethylation leading to transcriptional
activation in androgen-deprived environment of CRPC tumors. This
study uncovers a previously unknown mechanism of regulation of
pTyr267-AR-target gene expression, which can be therapeutically
reversed by suppression of Ack1/AR/pTyr99-H3 signaling by
AIM-100.
Results
[0251] Tyrosine 99 is phosphorylated in Histone H3 (FIG. 21). The
peptide was detected at 32.7 minutes in a total ion chromatogram
with mass-to-charge ratio of 1208.8928. The tandem mass spectrum
matched the following sequence, FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK
(SEQ ID NO:55) indicating that the tyrosine was phosphorylated; the
detection of the y16 and y17 is consistent with this localization.
The assignment was made with Mascot with a score of 92.
[0252] LAPC4 cells were treated with EGF or EGF and AIM-100 and the
lysates were immunoblotted with H3K9 dimethyl and H3K27 dimethyl
antibodies. Thus, marking of chromatin with
H3-Tyr99-phosphorylation within AR-target gene promoters may
suppress repressive dimethylation leading to transcriptional
activation in androgen-deprived environment of prostate tumors.
Ack1 inhibition by AIM-100 treatment increased H3K9 and K27
dimethylation (FIG. 25).
[0253] LAPC4 cells were treated with DHT (5 nM, 16 hr), EGF (10
ng/ml, 1 hr), or EGF and AIM-100 (0.8 .mu.M, 16 hr) and ChIP
analysis for pTyr267-AR binding to the PSA, NKX3.1 and TMPRSS2 AREs
was performed followed by qPCR. Ack1 inhibition by AIM-100
suppressed recruitment of pTyr-AR to PSA, NKX3,1 and TMPRSS2
promoters (FIGS. 8A-8C).
[0254] Purified histone H3 and Ack1 were incubated at 37.degree. C.
for 1 hour with or without AIM-100 followed by immunoblotting with
indicated antibodies. Ack1 directly phosphorylates histone H3 at
Tyr99 (FIG. 23).
[0255] Ack1 phosphorylated H3 at Tyr99. The cell lines NIH3T3,
MCF-7, 293T were treated with ligands (FGF, insulin, or EGF,
respectively) and cell lysates were immunoprecipitated with
pTyr99-H3 antibodies followed by immunoblotting with H3
pan-antibodies. Treatment of cancer derived cell lines with variety
of ligands resulted in activation of cognate receptor tyrosine
kinases which in turn activated Ack1 (FIG. 24).
[0256] LAPC4 cells were treated with EGF or EGF and AIM-100 and the
lysates were immunoblotted with H3K9 and H3K27 antibodies. Thus,
marking of chromatin with H3-Tyr99-phosphorylation within AR-target
gene promoters may suppress repressive dimethylation leading to
transcriptional activation in androgen-deprived environment of
prostate tumors. Ack1 inhibition by AIM-100 treatment increased
H3K9 and K27 dimethylation (FIG. 25).
[0257] 293T cells were transfected with FLAG-tagged H3 or Y99F
mutant. Lysates were immunoprecipitated with FLAG antibodies
followed by immunoblotting with H3K27 pan-antibodies. H3 Y99F
mutant exhibited increased H3K27 dimethylation (FIG. 12).
[0258] Castrated nude male mice were injected with LNCaP-caAck
expressing cells. Mice were injected with AIM-100 (4 mg/kg of body
weight per injection) on five times (n=8) and tumor volumes were
measured. Ack1 inhibition by AIM-100 partially suppresses prostate
xenograft tumor growth (FIG. 9).
[0259] Inhibition of Ack1 abrogates H3Y99 phosphorylation and
increases dimethylation of Histone H3 at lysine 9 and 27, two
epigenetic modifications that are linked to gene silencing.
Ack1/pTyr-AR complex is likely to regulate gene expression by
multiple epigenetic changes, e.g., H3 phosphorylation at Y99 and
dimethylation and trimethylation at K9 and K27 at specific
promoters that confer survival and castration resistance in
prostate cancer. Ack1 phosphorylates histone H3 at Y99 in response
to various growth factor stimulations.
Example 3: Histone H4 Tyrosine 51-Phosphorylation Regulates Embryo
Development
[0260] Gastrulation involves of a series of coordinated cell
movements to organize the germ layers and establish the major body
axes of the embryo. One of the gastrulation movements which
involves the thinning and spreading of a multilayered cell sheet is
called epiboly. Epiboly plays a crucial role in all vertebrate
gastrulation. Significant studies relevant to epiboly have been
performed which revealed basic cellular properties and mechanisms
of morphogenesis that are widely used in vertebrate development.
Although significant progress has been made to understand cellular
changes leading to epiboly, the epigenetic changes that are
involved in driving this process are not clear.
[0261] The following example demonstrates that histone H4
phosphorylation at tyrosine 51 (Tyr51) is critical for epiboly. RNA
isolation followed by Microarray analysis revealed that H4 Tyr51
phosphorylation regulates multiple genes involved in development.
Ack1, a non-receptor tyrosine kinase, was identified to be the
kinase that phosphorylates H4 at Tyr51. Knockdown or inhibition of
Ack1 resulted in significant decrease in H4 Tyr51 phosphorylation.
Xenopus embryos injected with antibodies raised against
Tyr51-phosphorylated H4 or Ack1 inhibitor, AIM-100 exhibited
epiboly block or involution failure in 51% of surviving embryos and
a partial "reduced epiboly" phenotype appearing in an additional
14%. All the affected embryos were unable to close the blastopore,
and the embryo did not progress further in gastrulation due to the
developmental arrest. Taken together, these data unveil a
previously unknown mechanism wherein marking chromatin with
H4-Tyr51-phosphorylation is required for transcription of
developmentally regulated genes that are critical for
gastrulation.
Results
[0262] The histone octamers are wrapped around with 147 base pairs
of DNA to form a nucleosome, which is subjected to at least eight
distinct types of post-translational modifications including
phosphorylation (Kouzarides, T. (2007) Cell, 128:693-705). A
variety of histone modifications constitute a `histone code` that
can be recognized by different chromatin regulatory proteins, which
in turn affect the chromatin structure and regulate the gene
expression. The histone modifications are carefully regulated and
can have major consequences when altered (Berger, S. L. (2007)
Nature, 447:407-412). To understand functional consequences of
histone tyrosine phosphorylation, histones were purified from human
cell line HEK293 cells and histones were subjected to mass
spectrometry based phosphorylation identification. A novel
phosphorylation at tyrosine 51 in histone H4 was identified (FIG.
10). Tyr51 is evolutionarily conserved from humans to unicellular
eukaryotes e.g. in S. cerevisiae (FIG. 11). Since the functional
role of Tyr51-phosphorylated H4 (pTyr51-H4) is unknown,
phosphospecific antibodies were raised against pTyr51-H4 (Methods
section). pTyr51-H4 antibodies were validated in multiple cell
lines.
[0263] Various human cell lines e.g. HEK293, LNCaP and MCF-7 cells
were treated with EGF and insulin ligands and cell lysates were
immunoprecipitated with pTyr51-H4 antibodies followed by
immunoblotting with H4 antibodies. Specifically, serum starved
HEK293T, LNCaP, and MCF-7 cells were treated with EGF or insulin
ligand for indicated time and cells were harvested. Equal amounts
of cell lysates were immunoprecipitated with pTyr51-H4 antibodies
followed by immunoblotting with H4 antibody. Equal amounts of
lysates were immunoblotted with H4 antibody. Tyr51-phosphorylated
H4 was specifically identified upon 10 and 20 min of EGF treatment
in LNCaP and HEK 293 cells, respectively (FIGS. 27A and 27B, top
panels). Further, 30-45 min of insulin treatment of MCF-7 cells
resulted in Tyr51-phosphorylation of H4 (FIG. 27C, top panel).
[0264] pTyr51-H4 antibodies were further validated by transfecting
HEK293 cells with FLAG-tagged H4. Cells were treated with EGF
ligand and cell lysates were immunoprecipitated with pTyr51-H4
antibodies followed by immunoblotting with FLAG antibodies.
Specifically, HEK293T cells were transfected with FLAG-tagged H4,
48 hours later lysates were immunoprecipitated with pTyr51-H4
antibodies followed by immunoblotting with FLAG antibody.
Tyr51-phosphorylated H4 was specifically identified upon 20 min of
EGF treatment (FIG. 27D, top panel). Moreover, pTyr51-H4 antibodies
were screened for its cross-reactivity against unphosphorylated H4
by transfecting HEK293 cells with FLAG-tagged H4 or Tyr51 to Phe
(Y51F) point mutant of H4. Specifically, HEK293T cells were
transfected with FLAG-tagged H4 or Y51F mutant. 48 hours later,
cells were treated with EGF (or untreated) and lysates were
immunoprecipitated with pTyr51-H4 antibodies followed by
immunoblotting with FLAG antibody. EGF treatment and
immunoprecipitation with pTyr51-H4 antibodies followed by
immunoblotting with FLAG antibodies revealed H4
Tyr51-phosphorylation only in H4 transfected samples but not Y51F
mutant H4 transfected samples. As a control immunoprecipitation
with IgG was performed. Collectively, these data indicate that the
antibodies are selective for pTyr51-phosphorylation on histone
H4.
[0265] Ack1, a nonreceptor tyrosine kinase has emerged as a
critical early transducer of variety of extracellular growth factor
stimuli including heregulin, insulin, EGF and PDGF signaling
(Manser, E. et al. (1993) Nature, 363:364-367; Mahajan, N. P. et
al. (2005) Cancer Res., 65:10514-10523; Mahajan, N. P. et al.
(2007) Proc. Natl. Acad. Sci. U.S.A., 104:8438-8443; Yokoyama, N.
et al. (2003) J. Biol. Chem., 278:47713-47723; Galisteo, M. L. et
al. (2006) Proc. Natl. Acad. Sci. U.S.A., 103:9796-9801). Ack1 is
ubiquitously expressed and primarily phosphorylated at Tyr284
leading to its kinase activation (Mahajan, N. P. et al. (2005)
Cancer Res., 65:10514-10523; Yokoyama, N. et al. (2003) J. Biol.
Chem., 278:47713-47723). Applicants' earlier studies demonstrated
that Ack1 interacts with nuclear hormone receptor, androgen
receptor (AR), translocates to nucleus and interacts with chromatin
regulating PSA and hK2 gene expression (Mahajan, N. P. et al.
(2005) Cancer Res., 65:10514-10523; Mahajan, N. P. et al. (2007)
Proc. Natl. Acad. Sci. U.S.A., 104:8438-8443; Mahajan, K. et al.
(2010) Prostate, 70(12):1274-1285). Ack1 gene is also shown to be
amplified in primary lung, ovarian and prostate tumors which
correlated with poor prognosis (van der Horst, E. H. et al. (2005)
Proc. Natl. Acad. Sci. U.S.A., 102:15901-15906). Further, a novel
mechanism of Ack1 mediated AKT activation has been identified
wherein phosphorylation of Tyrosine 176 in the AKT kinase domain
resulted in its translocation to the plasma membrane and subsequent
kinase activation. To examine whether H4 is a Ack1 kinase
substrate, cells were treated with EGF or EGF+ Ack1 inhibitor,
AIM-100 (Mahajan, K. et al. (2010) Prostate, 70:1274-1285).
Specifically, serum starved HEK293T were treated with EGF or
EGF+AIM-100 and cells were harvested. Equal amounts of cell lysates
were immunoprecipitated with pTyr51-H4 antibodies followed by
immunoblotting with H4 antibody (top panel). Equal amounts of
lysates were immunoblotted with H4 antibody or pTyr284-Ack1
antibody. Ack1 inhibitor treatment resulted in almost complete loss
of H4 pTyr51-phosphorylation (FIG. 26A). A somatic autoactivating
mutation in Ack1, E346K, has been identified (Mahajan, K. et al.
(2010) PLoS One, 5:e9646). E346K mutation cause constitutive
activation of Ack1 kinase activity. Using site-directed
mutagenesis, HA-tagged E346K point mutant was generated and
purified. As a control, HA-tagged Ack1 K154L mutation was
generated, which has lost kinase activity.
[0266] To test whether Ack1 directly phosphorylates H4, in vitro
kinase assay (Mahajan, K. et al. (2010) PLoS One, 5:e9646) was
performed. Specifically, equimolar amounts of purified
constitutively active E346K-Ack1 or kinase dead K158R-Ack1 and H4
proteins were incubated in the presence (or absence) of Ack11
inhibitor AIM-100, 5 uM for 1 hour at 30.degree. C. and reaction
mix was subjected to immunoblotting with pTyr51-H4, H4 and
pTyr284-Ack1 antibodies. HEK293 cells were treated with EGF or
EGF+AIM-100 (5 uM, 14 hour) and lysates were immunoprecipitated
with Ack1 antibodies followed by immunoblotting with H4 antibodies.
HEK293 cells were transfected with E346K-Ack1 or FRK kinase, cells
were serum-starved (24h) and lysates were immunoprecipitated with
pTyr51-H4 antibodies followed by immunoblotting with H4 antibody.
When purified E346K-Ack1 and H4 were incubated, H4 was
Tyr51-phosphorylated, however, Ack1 inhibitor AIM-100 abrogated H4
pTyr51-phosphorylation (FIG. 26B). Co-immunoprecipitation
experiment revealed that Ack1 binds to endogenous H4 (FIG. 26C).
Moreover, Ack1-E346K when transfected in HEK293 cells, specifically
phosphorylated H4 (FIG. 26D). Collectively these data indicates
that Ack1 specifically phosphorylates H4 at Tyr51.
[0267] To identify regions in chromatin where H4
Tyr51-phosphorylation occurs and regulate gene expression, native
ChIP-coupled DNA microarray analysis (ChIP-on-chip) was performed
(Kim, T. H. et al. (2005) Nature, 436:876-880). The sheared
chromatin from Xenopus laevis embryos injected with pTyr51-H4
antibodies or IgG was immunoprecipitated using a with pTyr51-H4
antibody followed by hybridization with Xenopus chip. It lead to
the identification of .about.550 potential sites/regions where
pTyr51-H4 is present in xenopus genome. Many genes whose expression
was upregulated multiple fold were developmentally regulated genes
which indicated that H4 Tyr51-phosphorylation may have role to play
in early development of embryos.
[0268] During gastrulation, cell movements result in a massive
reorganization of the embryo from a simple spherical ball of cells,
the blastula, into a multi-layered organism. During gastrulation,
many of the cells at or near the surface of the embryo move to a
new, more interior location. Epiboly is a cell movement that occurs
in the early embryo, at the same time as gastrulation. It is one of
many movements in the early embryo that allow for dramatic physical
restructuring or morphogenesis. The movement is generally
characterized as being a thinning and spreading of cell layers.
Epibolic movements have been conserved in vertebrates and have been
extensively studied in zebrafish and Xenopus laevis.
[0269] The onset of gastrulation in Xenopus is marked by the
formation of a pigment line, which represents the formation of the
dorsal blastopore lip and the beginning of specific morphogenetic
movements (invagination and involution) of the mesoderm. This
pigment line normally forms at the dorsal midline .about.45.degree.
below the embryonic "equator"; as gastrulation progresses, it
extends laterally and vegetally until the two ends join at the
ventral midline to form a complete circle. The dorsal blastopore
lip also moves steadily vegetalward, as a result of two other
morphogenetic movements. The first of these is the spreading of the
ectoderm in the animal cap region, referred to as epiboly. The
second is a radial intercalation of internal mesoderm cells above
the region of involution, which expands the surface area in the
dorsal region below the "equator".
[0270] To understand physiological role of H4
pTyr51-phosphorylation, Xenopus laevis embryos were injected with
pTyr51-H4 antibodies or AIM-100. In embryos injected with the
pTyr51-H4 antibodies, epiboly was effectively blocked. The darkly
pigmented animal cap cells remain in the animal region, instead of
spreading vegetalward. As a result, the dorsal lip of the
blastopore formed close to the equator, much higher than it
normally does, and it did not move toward the vegetal pole.
Although the blastopore lip eventually formed around the entire
circumference, as it does normally, the mesoderm did not involute
properly, and thus the embryo was unable to close the blastopore
lip. Development was arrested at the early midgastrula stage. This
phenotype appeared in 78% of surviving embryos injected with this
antibody.
[0271] Embryos injected with Ack1 inhibitor AIM-100 too showed this
epiboly block/involution failure in .about.51% of surviving
embryos, with a partial "reduced epiboly" phenotype appearing in an
additional 14%. In the partial phenotype, the blastopore lip formed
at a lower position, and the embryo progressed further in
gastrulation before developmental arrest occurred. The affected
embryos were unable to close the blastopore, however. The complete
or partial inhibition of epiboly was not observed in any of the
control-treated embryos.
[0272] While failure to close the blastopore is a common
gastrulation defect that can arise from a wide range of causes, it
is rare to see embryos in which epiboly is affected. Failure of
involution is also rare, hence the disruption of epiboly as a
reference for this phenotype was used summarized in Tables 3 and
4.
[0273] Effects of pTyr51-H4 antibodies or AIM-100 inhibitor on
Xenopus Development, encompassing 9 independent experiments, are
summarized in Table 3 and 4. The chief finding is that introduction
of either the pTyr51-H4 antibodies or AIM-100 inhibitor resulted in
a specific (and unusual) gastrulation defect. These treatments did
not alter the timing or pattern of early cleavages. Embryos
injected with either pTyr51-H4 (H4), pTyr37-H2B (H2B), or IgG show
mortality rates of 22-25% by the onset of gastrulation (.about.20
hours after microinjection at the 2-cell stage, embryos maintained
at 16.degree. C.). Embryos injected with either AIM-100 or DMSO
alone showed a mortality rate of 43-45% by this stage. Neither
pTyr51-H4 nor AIM-100 lead to increased mortality at this stage;
survival at subsequent stages is low because of the failure to
complete gastrulation. Table 4 provides the phenotype distribution
for surviving embryos (raw data are identical to those in Table
3).
[0274] In summary, these data demonstrate for the first time that
Ack1 directly phosphorylates histone H4 at Tyr51 site which in turn
regulates expression of multiple genes that are developmentally
regulated. These genes plays a critical role in gastrulation
especially epiboly formation, opening an exciting possibility that
vertebrate embryo development is regulated by Tyr51-phosphorylated
histone H4.
TABLE-US-00006 TABLE 3 Results of pTyr51-H4 antibodies and AIM-100
injections epib epib abn/ Sample conc. # norm. blk red delay dead
total pTyr37-H2B 200 3 49 0 0 19 23 91 ng/em (54%) (21%) (25%) IgG
200 3 44 0 0 10 17 71 ng/em (62%) (14%) (24%) pTyr51-H4 200 5 15 73
0 4 26 119 ng/em (13%) (61%) (3.3%) (22%) AIM-100 200 5 24 65 18 15
97 225 pM/em (11%) (29%) (8%) (6.7%) (43%) DMSO 20 5 48 0 0 48 80
176 nl/em (27%) (27%) (45%) "epib blk", epiboly block phenotype;
"epib red", partial phenotype; "abn/delay", gastrulation is
abnormal or delayed.
TABLE-US-00007 TABLE 4 Phenotypes of Surviving Embryos Tot sur-
Sample normal epib blk epib red abn/delay vivors pTyr37- 49 (72%) 0
0 19 (28%) 68 H2B IgG 44 (81%) 0 0 .sup. 10 (18.5%) 54 pTyr51- 15
(16%) 73 (78.5%) 0 .sup. 4 (4.3%) 93 H4 AIM 100 24 (19%) 65 (51%)
18 (14%) 15 (12%) 128 DMSO 48 (50%) 0 0 48 (50%) 96
Example 4: Phosphorylation of Histone H2B at Tyrosine 37 Modulates
MicroRNA Expression
[0275] With the experimental procedure as described in Example 1,
this study identified a miRNA signature that is modulated
specifically by WEE1 kinase, through phosphorylation of Y37-H2B.
Such miRNAs include Mir26b, Mir149, Mir346, Mir350, Mir491, Mir599,
Mir670, Mir708, Mir760, Mir879, Mir1192, Mir1965, Mir3058, and
Mir5098, which are downregulated by pY37-H2B in cancer cells.
Example 5: Phosphorylation of Histone H4 at Tyrosine 88
[0276] HEK 293T cells were lysed in receptor lysis buffer (RLB)
containing 25 mmol/L Tris (pH 7.5), 225 mmol/L NaCl, 1% Triton
X-100, 1 mmol/L DTT, 10% glycerol, phosphatase inhibitors (10
mmol/L NaF, 1 mmol/L Na2VO4), and protease inhibitor mix (Roche).
Following immunoprecipitation with pTyr-antibody beads (SantaCruz),
beads were subjected to SDS PAGE electrophoresis and the gel was
stained Coomassie Brilliant Blue-R250 (BioRad). A prominent band of
.about.11 kDa was excised, washed once with water and twice with 50
mM ammonium bicarbonate in 50% aqueous methanol. Proteins were
reduced and alkylated with 2 mM Tris(2-carboxyethyl)phosphine
hydrochloride (TCEP) (Sigma, St. Louis, Mo.) and 20 mM
iodoacetamide (GE Healthcare, Pittsburgh, Pa.), respectively.
Samples were digested overnight with modified sequencing grade
trypsin (Promega, Madison, Wis.), Glu-C (Worthington, Lakewood,
N.J.), or chymotrypsin (Roche, Switzerland). Peptides were
extracted from the gel slices, phosphopeptides were enriched using
IMAC spin columns (Pierce, Rockford, Ill.) or TiO2 Mono tip (GL
Science, Japan). A nanoflow liquid chromatograph (Ultimate3000, LC
Packings/Dionex, Sunnyvale, Calif.) coupled to an electrospray
hybrid ion trap mass spectrometer (LTQ Orbitrap, Thermo, San Jose,
Calif.) was used for tandem mass spectrometry peptide sequencing
experiments. Peptides were separated with a C18 reverse phase
column (LC Packings C18Pepmap) using a 40 min gradient from 5% B to
50% B (B: 90% acetonitrile/0.1% formic acid). The flow rate on the
analytical column was 300 nl/min.
[0277] Five tandem mass spectra were acquired for each MS scan
using 60 sec exclusion for previously sampled peptide peaks (Spray
voltage 2.3 kV, 30% normalized collision energy, scanning m/z
450-1,600). FIG. 28 shows the mass spectrum of histone H4 Tyrosine
88-phosphorylated peptide. Sequences were assigned using Sequest
(Thermo) and Mascot database searches against SwissProt protein
entries of the appropriate species. Oxidized methionine,
deamidation, carbamidomethyl cysteine, and phosphorylated serine,
threonine and tyrosine were selected as variable modifications, and
as many as 3 missed cleavages were allowed. The precursor mass
tolerance was 1.08 Da and MS/MS mass tolerance was 0.8 Da.
Assignments were manually verified by inspection of the tandem mass
spectra and coalesced into Scaffold reports.
Generation and Purification of pY88-H4 Phospho-Antibody
[0278] Two histone H4 peptides were synthesized:
TABLE-US-00008 The phosphopeptide: (SEQ ID NO: 65)
TVTAMDVVpYALKRQGRT The non-phospho peptide: (SEQ ID NO: 64)
TVTAMDVVYALKRQGRT.
[0279] The monoclonal pY88-H4 antibody expressing hybridoma was
custom generated by ProMab Biotechnologies, CA. In brief, mice were
immunized twice with phosphopeptide, several weeks apart. The sera
were affinity-purified. Antibodies recognizing the phospho-residue
bound to the column which was eluted as phospho-specific
antibodies.
Validation of pY88 Monoclonal Antibodies
[0280] To validate specificity of pY88 monoclonal antibodies, this
example performed enzyme-linked immunosorbent assay or ELISA was
performed. In brief, the Streptavidin coated 96-well plates
(R&D systems) were incubated with biotinylated H4-derived
unphosphorylated peptide TVTAMDVVYALKRQGRT (SEQ ID NO: 64, Y88 site
is underlined) or biotinylated phosphorolated peptide
TVTAMDVVpYALKRQGRT (SEQ ID NO: 65) for 1 hour.
[0281] The plates were washed with phosphate buffered saline
containing 0.1% Tween 20 (PBST) and blocked in 3% BSA. The pY88-H4
antibodies (at 1:500 dilution) were added and incubated for 1 hour.
Unbound antibodies were washed and HRP-conjugated anti-mouse
secondary Antibodies (1:2000) were added. Magnitude of
phosphorylation was detected using developer solution (OPD tablets,
Sigma) and the plates were read at 450 nm. As a negative control,
no peptide reactions were used. The pTyr antibodies were used as a
positive control.
[0282] The pY88 monoclonal antibodies did not recognize
unphosphorylated H4 peptide, however, Tyr88-phosphorylated peptide
was recognized by monoclonal antibody (FIG. 29). These data
validates the monoclonal antibody for its specificity towards
histone H4 Tyr88-phosphorylation.
WEE1 and Ack1 Kinases Phosphorylate H4 at Tyr88
[0283] WEE1 and Ack1 are two non-receptor tyrosine kinases or NRTKs
that have known nuclear functions. To determine whether WEE1 and
Ack1 can directly target H4 for Tyr88-phosphorylation, this study
performed in vitro kinase assay. In brief, the Streptavidin coated
96-well plates (R&D systems) were incubated with biotinylated
H4-derived peptide TVTAMDVVYALKRQGRT (SEQ ID NO: 64) for 1 hour.
The plates were washed and the purified WEE1 or Ack1 were added in
kinase buffer (20 mM HEPES, 150 mM NaCl, 0.5% Triton X-100, 10%
Glycerol, phosphatase and protease inhibitors) containing ATP and
MgCl2. After 2 hours of incubation, plates were washed with
phosphate buffered saline containing 0.1% Tween 20 (PBST) and
blocked in 3% BSA. The pY88-H4 antibodies (at 1:500 dilution) were
added and incubated for 1 hour. Unbound antibodies were washed and
HRP-conjugated anti-mouse secondary Antibodies (1:2000) were added.
Magnitude of phosphorylation was detected using developer solution
(OPD tablets, Sigma) and the plates were read at 450 nm. As a
negative control, no kinase and no peptide reactions were used. The
biotinylated phosphopeptide TVTAMDWpYALKRQGRT (SEQ ID NO: 65) was
used as a positive control.
[0284] Incubation of H4 peptide with WEE1 and Ack1 protein resulted
in robust H4 Tyr88-phosphorylation, which was detected by pY88
antibodies (FIG. 30). H4 Tyr88-phosphorylation was significantly
decreased upon incubation of the reaction with WEE1 inhibitor,
MK-1775 and Ack1 inhibitor AIM-100 (FIG. 30). Collectively, these
data validates the monoclonal antibody for its specificity towards
histone H4 Tyr88-phosphorylation and establishes rapid, accurate
and relatively easy H4 Tyr88-phosphorylation detection method.
Further, it indicates that WEE1 and Ack1 are the kinases that
target histone H4 for Tyr88-phosphorylation. Moreover, small
molecule inhibitors such as WEE1 inhibitor, MK-1775 or Ack1
inhibitor such as AIM-100 can suppress H4
Tyr88-phosphorylation.
Yeast Strain Lacking Tyrosine 88 Exhibits Lethal Phenotype
[0285] Histone residues within nucleosomes are evolutionarily
conserved, e.g. the amino acid residues in histones H2A and H2B are
more than 70% conserved from yeast to humans, and in histones H3
and H4 more than 90% are conserved. High evolutionary conservation
can predict which amino acid is essential for cell survival by
introducing mutations followed by assessing whether the mutation is
lethal in yeast cells. Tyr88 mutations exhibited significant
lethality in GRF167 background. Interestingly, a cluster of
residues near the C terminus of histone H4 which include Tyr88,
Leu90 and Tyr98, confer slow growth in more than one background.
These residues form an important surface inside the nucleosome
core. These residues could serve as a molecular spring that
maintains tensile strength in the lower half of the nucleosome.
Tyrosine 88 of H4 stacks on tyrosine 86 of H2B in the structure,
forming a spring-like structure.
Example 6: Loss of Phosphorylation of Histone H3 at Tyrosine 99
Resulted in Loss of Weight
[0286] Ack1 kinase targets histone H3 for Tyr99-phosphorylation. To
understand the role of Ack1/H3-pTyr99 signaling, this example
generated knockout (KO) mice that lacked Ack1 genes (FIG. 31a).
These Ack1 KO mice exhibited almost complete loss of H3
Tyr99-phosphorylation (FIG. 31c). Further, significant loss of
weight, in some mice upto 50% weight loss was observed in these KO
mice (FIG. 31b and FIG. 32). Significantly, apart from weight loss,
Ack1 KO mice do not show any other problems or developmental
defects.
[0287] Moreover, FIG. 31c shows that Ack1 regulates histone H3
Tyr99-phosphorylation and negatively regulates H3 K9
trimethylation. Additionally, upon inhibition of Ack1 with AIM-100,
H3 K9 trimethylation was increased (FIG. 31d).
Example 7: Mechanistic and Clinical Studies of Phosphorylation of
Histone H2B Tyrosine 37
[0288] WEE1 Mediated pTyr37-H2B Phosphorylation Suppresses Histone
mRNA Synthesis
[0289] Modification of core histones has been demonstrated to
regulate transcription, however, transcription of histone
themselves were not known to be regulated by histone
phosphorylation. To investigate whether pY37-H2B plays a direct
role in regulating histone gene transcription, synchronized cells
were treated (or untreated) with WEE1 inhibitor, MK-1775 and total
RNA was isolated followed by qRT-PCR. Human cells have 55 distinct
histone genes each encoding a fraction of core histones. This study
determined histone levels using 20 of these genes. In untreated
cells, rapid decrease in transcripts of all of these histone genes
was observed when RNA levels of 6.30 hours post-release samples
(late S phase) were compared with 8.30 hours post-release (G2/M
phase) samples (FIGS. 33a-33h).
[0290] However, upon WEE1 inhibitor treatment, histone mRNA levels
did not decrease in 8.30 hours post-release, indeed in some cases
an increase was observed (FIGS. 33a-33h). Collectively, these data
indicate that Y37-H2B phosphorylation represses transcription of
the core histone genes located in Hist1 cluster. Based on extensive
transcriptional profiling of 20 histone genes, this study
identified 8 genes (H2Bm, H2bn, H2B1, H3h, H4j, H2Ai, H2Ak and
H2Bk) as being representative of global histone transcriptional
output, termed as the 8-histone gene signature.
Peptide Immunosandwich Assay (PIA)
[0291] Rapid and accurate detection of WEE1 activation and histone
mRNA levels in GBM biopsies is an essential step towards developing
a reliable companion diagnostic for WEE1 inhibitor MK-1775. Using
the high specificity monoclonal antibodies, this study developed a
Peptide Immunosandwich Assay that detects WEE1 epigenetic activity
with high sensitivity even from small tumor resections.
[0292] In brief, Streptavidin coated 96-well plates (R&D
systems) were incubated with biotinylated human histone H2B derived
peptides KRSRKESYSVYVYKVL (SEQ ID NO: 62, Y37 site is underlined).
H2B derived phospho-peptide KRSRKESpYSVYVYKVL (SEQ ID NO: 63) was
used as positive control. Any unbound areas on the plate were
blocked with 3% BSA. Next, purified WEE1 protein (100 ng) prepared
in kinase buffer (20 mM HEPES, 225 mM NaCl, 1% Triton X-100, 10%
glycerol, phosphatase and protease inhibitors) supplemented with 1
uM ATP and 1 uM MgCl.sub.2. After 2 hours of incubation, plates
were washed with phosphate buffered saline containing 0.1% Tween 20
(PBST) and reblocked in 3% BSA. The pY37-H2B or pTyr antibodies (at
1:1000 dilution) were added and incubated for 1 hour. Unbound
antibodies were washed and HRP-conjugated anti-mouse secondary
antibodies (1:5000) were added. The magnitude of phosphorylation
was detected using developer solution (OPD tablets, Sigma) and
after 20 minutes of incubation, the plates were read at 450 nm.
[0293] The Peptide Immunosandwich Assay was first validated using
purified WEE1 protein (100 ng) and cancer derived cell lines (50
ug). Purified WEE1 exhibited robust H2B Tyr37-phosphorylation and a
significant decrease in pY37-H2B levels was observed upon
incubation with 5 uM of MK-1775 (FIG. 34). PIA was also validated
using cancer derived cells lines MDA-MB231 (low WEE1 activity) and
LAPC4 cells (high WEE1 activity). As expected, MDA-MB231 cell
lysates exhibited significantly lower levels of H2B
Tyr37-phosphorylation as compared LAPC4 (FIG. 34). As negative
controls, H2B peptide alone or WEE1 enzyme alone were used.
Tyr37-phosphorylated peptide was used as a positive control (FIG.
34). All the reactions were performed in triplicates and the data
shown is from three distinct biological repeats. The Peptide
Immunosandwich Assay assay was also validated by simultaneously
performing it with HRP-conjugated pTyr antibodies (pY20-HRP Ab,
Santacruz). Near identical results were obtained with pTyr
antibodies.
[0294] To assess the WEE1 epigenetic activity in GBM patients,
lysates were prepared from 8 GBM tumor biopsies and 3 normal brain
samples as a control. The lysates were quantitated and 100 ug of
lysates was used per reaction. Each reaction was performed in
triplicates. GBM and normal brain lysates were incubated with
either DMSO or MK-1775 (10 uM) for 30 minutes followed by Peptide
Immunosandwich Assay as described above. A Student's t-test and
Mantel-Haenszel .chi.2 test was performed to examine whether there
is an increasing trend for WEE1/pTyr37-H2B expression with respect
to normal versus GBM tumors. It led to determination of
`threshold-interval` of OD of 1.1, suggesting that those tumors
that exhibit more than 1.1 OD in PIA assay possess high WEE1
epigenetic activity. It revealed that 4 out of 8 GBM samples
(patient#3, 6, 7 and 8) exhibited significant increase in H2B
Tyr37-phosphorylation as compared to normal brain samples
(patient#32, 33 and 34). Further, WEE1 activity in GBM tumor
lysates was significantly reduced upon MK-1775 treatment (FIG. 35).
The increased WEE1 epigenetic activity in tumors of patient#3, 6, 7
and 8 was also confirmed by immunoblotting using pY37-H2B
antibodies (data not shown).
[0295] Collectively, these data established rapid, accurate,
sensitive and relatively easy detection method for WEE1 epigenetic
activity in human brain tumor samples. Further, it indicates that
loss of WEE1 activation by MK-1775 can also be efficiently
monitored by assessing H2B Tyr37-phosphorylation levels
post-treatment.
Quantitative Measurement of WEE1 Epigenetic Activity in GBM Using
Peptide Immunosandwich Assay (PIA)
[0296] The data indicates that WEE1 directly phosphorylates H2B and
regulates histone transcriptional activation. Although WEE1
inhibitor MK-1775 is FDA approved, it has not been widely used for
GBM treatment. One of the reasons is that to date a molecular test
that can accurately assess WEE1/pY37-H2B signaling in GBMs is not
available. One of the objectives of this proposal is to develop a
companion diagnostic test for detection of WEE1/pY37-H2B signaling
in GBM samples which can facilitate MK-1775 therapeutic regimen.
The PIA test developed is comparatively inexpensive, relatively
easy to perform and can be rapidly performed by trained technicians
in most laboratories and cancer centers. Successful completion of
this project would lead to establishment of a reliable and
relatively easy companion diagnostic kit that can accurately detect
WEE1 epigenetic activation in GBM samples.
[0297] PIA test performed at smaller scale, using 11 human brain
samples (preliminary results shown in FIG. 4) revealed that PIA can
accurately detect increased WEE1 epigenetic activity in a subset of
GBM patients. Deciphering of optimal `threshold-interval` is
critical for PIA to be used widely a companion diagnostic. This can
only be accomplished by rigorous testing of PIA in a larger cohort
of GBM and normal samples. The first specific aim of this proposal
is geared towards achieving this goal. This study has acquired 50
GBM samples and 15 normal samples. 100 more tumor and normal biopsy
samples will be made available upon first initial screening under
the same protocol. The lysates will be prepared from 65 brain
samples (50 GBM samples and 15 normal brain samples) followed by
quantitation of WEE1 epigenetic activity by PIA as described above.
Purified WEE1 and extracts of cell lines, MDA-MB231 and LAPC4
cells, will be used as controls. As a negative control, MK-1775
treated cell lysates or reaction will be used. A range of
concentrations of purified WEE1 (0.1-10 uM) will also be used to
obtain a standard curve. Each GBM or normal brain sample (100 and
200 ug of protein) will be assayed in triplicate. Comparison of the
above reading with readings from standard curve will allow us to
precisely quantitate activated WEE1 levels in tumors and normal
samples. Using multiple GBM samples, a range of WEE1 activation
level will be deciphered, defined as `threshold-interval`, that is
indicative of activated status of WEE1 kinase in tumors.
[0298] For compilation and analysis of the quantitative data to
determine whether the biopsy demonstrates activation of WEE1/H2B
signaling pathway and responsive to WEE1 inhibitor regimen
(Standard development) data from 50 GBM samples will be used.
Initially the samples will be evaluated in a non-blinded manner to
address the question of whether tumor samples possess significantly
higher levels of WEE1 expression as compared to normal brain
samples. Subsequently additional GBM and normal brain samples with
unknown WEE1 status will be evaluated in a blinded manner.
[0299] Using a two-sided two-sample T-test, this study can achieve
100% power to detect the difference between groups with a stringent
alpha level set at 0.01 (when adjusting for multiplicity). Further,
the Mantel-Haenszel .chi.2 test will be performed to examine
whether there is an increasing trend for WEE1/pTyr37-H2B expression
with respect to normal/benign versus GBM tumors. Analysis of
variance will be performed to examine whether the expression levels
of WEE1 differ among normal/benign versus different stages of GBM
tumors. Boxplots will be used to summarize the intensity
distribution at each progression stage. The statistical analyses
will be carried out using software SAS, R, and Matlab when
appropriate.
[0300] WEE1 overexpression has also been observed in Triple
Negative Breast Cancer (TNBC) tumors. TNBCs are those breast
cancers that do not express the genes for estrogen receptor (ER),
progesterone receptor (PR) or Her2/neu. These are known to be more
aggressive with poor prognosis and often occur in younger
women.
Quantitative Measurement of Histone mRNA Levels in GBM by
qRT-PCR
[0301] It is important that activation of WEE1/pY37-H2B signaling
in GBM biopsies is further confirmed by another independent method.
Towards this goal, this study will assess corresponding decrease in
global histone mRNA levels upon overexpression of WEE1 in GBM tumor
samples. This study has standardized the quantitative RT-PCR
strategy for 8 histone genes (shown in FIG. 33a-33h), which is
representative of global histone transcription. In this specific
aim, this study will assess this 8-histone gene signature in GBM
samples.
[0302] For the construction of standard curves, serial dilutions of
GBM or normal sample RNA will be used (50, 10, 2, 0.4, 0.08, and
0.016 ng) per reverse transcriptase reaction. One "no RNA" control
and one "no Reverse Transcriptase" (No RT) controls will be
included for the standard curve. Three reactions will be performed
for each sample: 10 ng, 0.8 ng, and a No RT (10 ng) control.
Real-time quantitative PCR analyses will be performed using the ABI
PRISM 7900HT Sequence Detection System (Applied Biosystems). All
samples will be tested in triplicate wells each for the 10 ng and
0.8 ng concentrations. PCR will be carried out with SYBR Green PCR
Master Mix (Applied Biosystems) using 2 .mu.l of cDNA and the
primers in a 20-.mu.l final reaction mixture. Dissociation curves
will be generated for each plate to verify the integrity of the
primers and RNA. Data will be analyzed using SDS software version
2.2.2 and exported into an Excel spreadsheet. The actin data will
be used for normalizing the gene values; i.e., ng gene/ng actin per
well.
[0303] The 65 samples used for PIA will also be used for RNA
isolation followed by qRT-PCR. It is expected that those tumors
that exhibit significant WEE1 expression would also have lower
levels of histones. Correlation between WEE1 activation and histone
downregulation will be explored using Spearman ranked correlation
analysis. Statistical differences between the tumor and normal
samples will be determined using log-rank test. The association of
the WEE1-positive tumors exhibiting lower histone levels will also
be assessed for survival by using the Kaplan-Meier method as
described in Applicants' previous publications. This study has
survival information of all the 65 individuals from whom the
biopsies are taken, which overall would provide us correlation
between WEE1 overexpression, downregulation of histone gene
expression and disease progression.
[0304] To additionally confirm that modulation in 8-histone gene
signature is dependent on WEE1 epigenetic activity, this study will
utilize five primary GBM tumors. These cells will be treated with
MK-1775 or DMSO, RNA will be isolated and upregulation in 8-histone
gene signature in MK1775 treated cells will be validated.
Examining the Use of PIA & Histone Signature to Follow Response
of GBMs to MK-1775 Treatment
[0305] The purpose of this study is to determine whether
WEE1-positive GBM tumors, identified by PIA and 8-histone gene
signature display sensitivity to the potent WEE1 inhibitor,
MK-1775. This would validate PIA and 8-histone gene signature as
`companion diagnostics` for MK-1775 therapy--a foundation for
personalized medicine approach for brain cancer patients for the
first time.
[0306] To accomplish this, this study established five distinct GBM
cell lines, derived from brain cancer patients. Second,
WEE1-positive nature of these cell lines was confirmed by
immunoblotting for pY37-H2B marker, PIA and qRT-PCR of core histone
mRNA. Two of these brain tumor derived cell lines are WEE1-positive
and three are found to be negative. These cell lines will be
utilized in this specific aim.
GBM Xenograft Studies
[0307] To determine the antitumor efficacy of MK-1775 on GBM
progression in vivo, this study will first implant I million GBM
cells subcutaneously (SC) into nude mice and the mice will be
injected with various doses of MK-1775 (0, 20, 50 .mu.M) 20 days
after tumor cells implantation. 5 injections will be performed on
alternate days and tumor growth (and its inhibition upon MK-1775
injection) will be monitored for 8 weeks. Tumors will be removed
and analyzed for inhibition of WEE1-mediated pY37-H2B
phosphorylation by PIA and Western blotting. Further, increased
histone mRNA levels will be assessed by qRT-PCR.
In Vivo Analysis Using the U251 and E98 Orthotopic GBM Mouse
Models
[0308] In addition to subcutaneous injection of GBM cells, one
million human GBM cells will also be injected intracranially into
nude mice. GBMs derived established cell lines, U251MG and E98,
which are transduced to express Fluc and mCherry will be used.
U251-FM and E98-FM cells will be treated daily with MK-1775 or DMSO
via an intraperitoneal (IP) injection starting at day 14 after
injection of the GBM cells. Mice will be injected for 10 days at
the dose of MK-1775 (0, 20, 50 .mu.M) and tumor growth will be
monitored for 8 weeks by using bioluminescence imaging
(IACUC#4151R). It is expected that the mice treated with MK-1775
would exhibit a significant tumor regression after WEE1-inhibitor
injections. MK-1775 induced G2 checkpoint arrest and cell death
will also be determined by mitosis-specific staining of xenograft
tumor sections using immunohistochemistry.
Assess the Epigenetic Landscape Orchestrated by Aberrant WEE1
Signaling in GBMs
[0309] Glioblastoma multiforme (GBM), a tumor of the glial cells,
is the most common malignant brain cancer in adults, accounting for
.about.13,000 deaths per year in U.S. alone. Currently, GBM is
treated by surgical removal of tumor, followed by radiation and
chemotherapy. Regrettably, most patients die within a year from new
secondary tumor foci forming within a centimeter of the resected
area. The molecular basis of GBM is unknown, which has made
research into understanding the biology of GBM and identification
of therapeutic targets the areas of intense interest in the
scientific community. Recently, gene expression profiling revealed
that the WEE1 kinase is overexpressed in GBMs. Further, MK-1775, a
potent WEE1-specific inhibitor has been shown to selectively induce
apoptosis in WEE1 expressing cancer cell lines.
[0310] To understand molecular pathogenesis of WEE1 overexpression,
this study first evaluated the genomic loci marked with H2B
Tyr37-phosphorylation in normal eukaryotic cells. Native
ChIP-sequencing was performed using synchronized mouse embryo
fibroblasts (MEFs) in late S phase, i.e., 6.5 hrs post-thymidine
release when cells exhibit peak H2B Tyr37-phosphorylation. As a
control, MEFs were harvested from G1 phase that lack expression of
H2B Tyr37-phosphorylation. ChIP with pY37-H2B antibodies in these
cells lead to the identification of 3524 potential sites/regions
where pY37-H2B marks are present; 1240 of which were present within
genes while 351 sites were present upstream and 326 sites were
downstream of genes. Interestingly, two classes of genes emerged to
be specifically marked by pY37-H2B phosphorylation marks; these
were DNA and histone modifying genes. Interestingly, a few genes
involved in stemness were also identified. A partial list of these
genes is shown in Table 5.
TABLE-US-00009 TABLE 5 Chromatin modifying and stemness genes
marked by pY37-H2B epigenetic mark Gene Functional role Fold
changes IDH2 In gliomas and melanomas, pY37-H2B down-regulates IDH2
increased histone IDH2 levels by at least methylation and decreased
5 fold in gliomas and 5-hydroxylmethylcytosine metastatic melanomas
DNMT3B DNA methyltransferase pY37-H2B down-regulates DNMT3B levels
by at least 3 fold in gliomas and metastatic melanomas JARID2
Transcriptional represser pY37-H2B down-regulates interacts with
the Polycomb JARID2 levels by at least repressive complex 2, 2 fold
in gliomas and regulates H3K27 metastatic melanomas trimethylation
EYA3 Phosphatase, involved in pY37-H2B down-regulates DNA
damage-induced de- EYA3 levels by at least phosphorylation of Tyr-
2 fold in gliomas and 142 of H2A.X metastatic melanomas JMJD2c
Histone demethylase, pY37-H2B down-regulates converting specific
trimeth- JMJD2c levels by at least ylated histone residues 2 fold
in gliomas and to the dimethylated form metastatic melanomas JMJD1C
Histone demethylase pY37-H2B down-regulates JMJD1c levels by at
least 2 fold in gliomas and metastatic melanomas CREBBP Histone
acetyl transferase pY37-H2B down-regulates and scaffolding protein
CREBBP levels by at least 2 fold in gliomas and metastatic
melanomas SOX 4 Essential for glioma- pY37-H2B down-regulates and
18 initiating cells to retain SOX4 and 18 levels by at least their
stemness 2 fold in gliomas and metastatic melanomas
[0311] This study used two methods (CHIP-seq and RNA-seq) that are
complementary, and integration of these two data sets provided the
comprehensive insight into pathways altered in invasive cancers
such as GBM.
[0312] This study used ChIP-sequencing and RNA sequencing
techniques followed by integrative bioinformatics analysis to
obtain the epigenetic signature of WEE1/pY37-H2B signaling in GBM
tumors. Using 60 GBM tumors obtained from patients, the inventors
have generated multiple `GBM patient-derived cell lines` under
neurosphere condition, also known as `Brain tumor initiating cells`
or BTIC. We have also developed a qRT-PCR based approach to
accurately determine increased WEE1/pY37-H2B signaling in a given
GBM tumor tissue. One such example is shown in FIG. 36 wherein RNA
was isolated from a pair of normal and brain metastatic tumor
samples followed by qRT-PCR for histone H2Bm, IDH2 and DNMT3b. As
expected, increased WEE1/pY37-H2B signaling resulted in decrease in
not only histone H2B mRNAs but also DNA modifying enzymes e.g. IDH2
and DNMT3b.
[0313] To identify WEE1 regulated epigenetic signature, two
WEE1/pY37-H2B signaling positive GBM patient-derived cell lines
will be treated with 0.6 .mu.M of WEE1 inhibitor MK-1775 or DMSO
and will be subjected to native ChIP-sequencing as described in
Applicants' publication. In brief, GBM patient-derived cell lines
will be lysed in RLB buffer and sonicated for 25 seconds to shear
DNA to an average length of 300-500 bp. The soluble chromatin will
be incubated overnight at 4.degree. C. with pY37-H2B antibody or
IgG antibodies (control) and protein-G magnetic beads (Active
motif). The complexes will be washed, eluted and chromatin
immunoprecipitated DNAs will be first analyzed for the presence of
site II region of Hist1 cluster by PCR. The inventors have
previously established site II as a recurring region at which
pY37-H2B marks are deposited by WEE1. Once enrichment of Site II in
GBM chromatin immunoprecipitates is confirmed, the samples will be
subjected to sequencing on the Illumina Genome analyzer as
described in Applicants' publication.
[0314] It is shown that WEE1 overexpression could result in
constitutive suppression of histone synthesis, decrease in global
histone levels, which could result in loss of
heterochromatinization, activating a distinct transcription
program. Therefore, deciphering the unique transcriptional program
modulated by WEE1's epigenetic alteration of chromatin will provide
significant understanding at molecular level for initiation and
progression of disease. Towards this goal, this study will analyze
global expression patterns of polyadenylated transcripts in the
four WEE1/pY37-H2B signaling-positive GBM tumor samples and equal
number of normal biopsies by RNA sequencing (RNA-Seq). In addition,
RNA will also be prepared from GBM patient-derived cell lines
treated with MK-1775 (0.6 .mu.M for 24 hours) or DMSO. In brief,
total RNA will be isolated from tumor or normal tissues using
TRIzol Reagent. Sequencing libraries will be prepared according to
Illumina RNA-Seq library kit. Paired-end RNA-Seq 36 base pair reads
will be aligned and DESeq will be used to normalize raw read counts
and analyze differential gene expression. USeq 7.0 will be used to
generate gene-level read counts and estimate RPKM (reads per
kilobase of exon per million reads mapped). Only genes with
expression values >1 RPKM in at least one tumor will be
considered for subsequent analysis. Expression will be normalized
to the interquartile range across the time course; interquartile
numbers will then be used for clustering using a cosine angle
distance metric and the HOPACH clustering.
[0315] ChIP-Sequencing yield is expected to be .about.40 million
reads in each sample, of which .about.27 million are expected to be
mapped uniquely to the human genome. The 36-nt sequence reads (tags
identified by using Illumina's Genome Analyzer 2) will be mapped to
the genome using the ELAND algorithm. `Peaks` will be calculated
and compiled into BED files (Browser Extensible Data). A typical
threshold setting is in the range of 10-20, but may be adjusted
depending on the number of tags sequenced or based on the
information on positive and negative test sites, independent
estimates for the false discovery rate (FDR), and/or the intent to
generate a stringent or relaxed analysis. Using the MEME program
unique motifs in ChIP data will be identified. FIMO will be used to
map motifs found in MEME onto the peaks revealing genes that could
be potentially regulated by H2B Tyr37-phosphorylation. Moreover,
MetaCore (from GeneGo Inc) enrichment analysis will be used to
cluster genes, which are adjacent to ChIP-sequencing peaks. This
enrichment analysis clusters the genes based on their functional
role.
[0316] For RNA-sequencing, the data will be analyzed in similar
manner as described above. It is expected that .about.13,000 genes
are expressed in tumor tissues. Genes will be clustered by
expression pattern using HOPACH, yielding distinct clusters
including groups of genes specifically expressed at each stage
(e.g., Clusters A, L, N, and S). The stage-specific clusters will
be enriched for expected Gene Ontology (GO) terms and tabulated as
described in Applicants' publication.
[0317] One study will focus on the eight genes identified above,
collectively referred to as candidate genes'. IDH2 and DNMT3B
identified in earlier pY37-H2B ChIP-sequencing and six additional
DNA and histone modifying genes chosen from ChIP-sequencing and
RNA-sequencing of GBM tumors, described above. The rationale behind
studying IDH2 and DNMT3B genes is described below:
IDH2 or Isocitrate Dehydrogenase 2
[0318] DNA methylation at the 5 position of cytosine (5-mC) is a
key epigenetic mark that is critical for various biological and
pathological processes. 5-mC is converted to
5-hydroxymethylcytosine (5-hmC) by the ten-eleven translocation
(TET) family of DNA hydroxylases. IDH2 catalyzes the production of
.alpha.-ketoglutarate, which is an essential cofactor in the
reaction catalyzed by TET. The loss of 5-hmC has been identified to
be the epigenetic hallmark in melanoma, and downregulation of
isocitrate dehydrogenase 2 (IDH2) and TET family enzymes has
emerged as a critical step underlying 5-hmC loss. Reintroduction of
the 5-hmC by active TET2 or IDH2 suppressed tumor growth and
increases tumor-free survival in animal models. It is contemplated
that in GBMs tumor cells overexpressing WEE1, pY37-H2B may
epigenetically suppress expression of IDH2 gene, to prevent
formation 5-hmC facilitating tumor growth and proliferation.
DNMT3B
[0319] DNMT3B, a member of the DNA methyl transferase family,
methylates cytosine at 5 position to epigenetically regulate gene
expression. Often, cancer cells, including GBMs, are characterized
by global DNA hypomethylation due to the aberrant activity of DNA
methyl transferases. Hypomethylation at pericentric chromatin
associated with chromosomal instability was observed in cells
expressing DNMT3B splice variant. It is contemplated that by
placing pY37-H2B marks in DNMT3B upstream regulatory sequences,
GBMs may suppress DNMT3B levels imposing aberrant DNA methylation
patterns within pericentric heterochromatin leading to genetic
instability.
Directed ChIP-PCR to Validate Presence of WEE1 and pY37-H2B at the
Promoter and Enhancer Regions of Candidate DNA and Histone
Modifying Genes
[0320] To validate the regulation of DNA and histone modifying
genes by WEE1 mediated H2B Y37-phosphorylation, ChIP followed by
real time PCR will be performed as described earlier in Applicants'
publication. In brief, chromatin will be prepared from GBM
patient-derived cell lines treated with 0.6 .mu.M of WEE1
inhibitor, MK-1775 or DMSO. ChIP will be performed using pY37-H2B
antibodies (IgG as a control) followed by qPCR of
immunoprecipitated DNA with primers corresponding to upstream
promoter, enhancer and intragenic regions of 8 candidate DNA and
histone modifying genes. This experiment will validate whether
specific inactivation of WEE1 kinase activity would lead to loss of
pY37-H2B epigenetic marks upstream of (or within) candidate genes,
unleashing their transcriptional activity.
Validation and Quantitative Analysis of Candidate Gene Expression
in GBMs
[0321] To examine whether reorganization of chromatin landscape by
WEE1 mediated H2B Y37-phosphorylation suppresses expression,
qRT-PCR will be performed using candidate gene specific primers. In
brief, total RNA prepared from 50 freshly frozen GBM tumors and 10
normal brain samples will be subjected to qRT-PCR. In addition,
this study will also use 5 GBM patient-derived cell lines treated
with 0.6 .mu.M of WEE1 inhibitor, MK-1775 or DMSO. Real time RT-PCR
is expected to reveal relative decrease in candidate gene
transcription levels in tumor samples as compared to normal brain
samples. Further, MK-1775 treated GBM cell lines are expected to
exhibit significant increase in candidate gene transcription due to
loss of WEE1/pY37-H2B signaling. In addition to qRT-PCR, modulation
in expression of candidate genes will be assessed by immunoblotting
with specific antibodies in GBM cell lines that were treated with
MK-1775 or DMSO (as a control).
[0322] In terms of further validation, there is a "matched set" of
200 GBM samples has been generated at Moffitt on which gene
expression arrays and targeted exome sequencing data for 1326 genes
(including WEE1, IDH2, DNMT3B and Sox4 and 18) is available along
with extensive clinical data e.g. survival, treatment etc. This
highly informative and useful data set will also be utilized to
assess aberrant expression (and mutational) status of the candidate
genes and its association with survival and treatment
responses.
TMA Staining of GBMs to Correlate WEE1/pY37-H2B Signaling to
Correlate Expression with Severity of Disease
[0323] To examine the role of WEE1/pY37-H2B signaling in GBM, this
study will perform immunohistochemical (IHC) staining of TMA. The
study has generated TMA comprised of clinically annotated GBM
(n=325) tumor samples, which has been extensively validated by
staining with multiple IHC-validated antibodies. This TMA has been
constructed from a prospective Case-Control Cohort study that has
extensive clinical follow up and quality control. This study will
section the GBM TMA and perform IHC staining with WEE1, pY37-H2B,
IDH2, DNMT3B, and 6 other candidate gene antibodies.
[0324] A significant increase in expression of WEE1 and pY37-H2B is
expected in GBM cancers compared to normal controls. In contrast, a
significant decrease in expression of IDH2, DNMTB3B and other 4
candidate genes is expected in GBM samples as compared to normal
brain tissues. This study will perform ANOVA analysis to determine
whether WEE1, pY37-H2B IDH2, DNMTB3B and other 6 candidate gene
expressions differed significantly among different stages (p value
less than 0.05 will be considered to be significant) as described
in earlier papers from Applicants' laboratory This study will also
perform Tukey-Kramer analysis to examine all pairwise differences
between different stages; the expression levels WEE1 and pY37-H2B
are expected to be significantly higher in GBM than those of normal
or earlier tumor stages. This study will perform Kaplan-Meir
analysis, which is expected to reveal whether patients with high
expression of WEE1 and pY37-H2B are at a higher risk for
cancer-related deaths. Furthermore, this study will determine
whether expression of WEE1 is significantly correlated with
pY37-H2B in situ by calculating Spearman rank correlation
coefficient (p=0.5 or above will be considered significant).
Functional and Mechanistic Characterization of WEE1/pY37-H2B
Targets
[0325] To further investigate and validate the molecular role of
WEE1/pY37-H2B epigenetic signaling in GBM pathogenesis, this study
will study the requirement of these genes in specific cellular
processes. This will allow us to address whether specific
alterations in epigenetic landscape contribute to the invasive
phenotype of GBM. This study will specifically assess the following
processes:
Effect of Depletion of Candidate Genes on GBM Cell
Proliferation
[0326] The expression of individual candidate target genes will be
downregulated in GBM patient-derived cell lines using specific
small-interfering RNA (RNAi) and confirmed by immunoblotting with
specific antibodies. To determine the effect of candidate target
depletion on cell proliferation, the ability of cells to synthesize
DNA will be assayed using the chemical method of incorporation of
5-ethynyl-2'-deoxyuridine (EdU) and its subsequent detection by a
fluorescent azide through a Cu(I)-catalyzed [3+2] cycloaddition
reaction. In brief, Edu will be added at a final concentration of
10 uM for 2h, cells will be fixed with 4% paraformaldehyde and
cells will be processed for measuring DNA synthesis as described in
the Click-it-Edu Alexa Flour 488 Flow Cytometry Assay protocol
(Invitrogen). Decrease in Edu incorporation in RNAi treated cells
but not control cells will be suggestive of loss of proliferative
capacity, and will indicate that the particular candidate gene is
essential for glioblastoma cell growth.
Effect of Depletion of Candidate Genes on Cell Cycle
Progression
[0327] GBM patient-derived cell lines transfected with control or
target specific siRNA, will be harvested after 48 hours, and
processed for flow cytometric analysis as described above. As an
additional control, primary GBM cell lines will be treated with
MK-1775 or DMSO (as control). Samples will be analyzed using the
FACS Calibur flowcytometer, and cell cycle analysis was carried out
using the ModFit program. If the cells are found to arrest at
specific stages of the cell cycle in the control cells but not in
the MK-1775 cells, then this study will conclude that this could be
one potential mechanism by which WEE1 regulates glioblastoma
progression.
WEE1/pY37-H2B Signaling in Maintaining Neurosphere Formation
[0328] Neurospheres are free-floating clusters that contain neural
stem cells. ChIP-sequencing revealed that genes such as Sox4 and
Sox18 that are essential for glioma-initiating cells to retain
their stemness are marked by pY37-H2B. Towards the goal of
examining role of the WEE1-pY37-H2B signaling in maintaining
stemness, neurosphere assay will be performed. This assay
interrogates three fundamental characteristics of neural stem
cells: proliferation, self-renewal, and multipotency. This study
has developed 4 distinct GBM patient-derived cell lines that form
neurospheres when cultured in specially reconstituted stem cell
culture media (FIG. 37). It shows neurosphere formed by BTIC5 cell
line transfected with pLVX-ZsGreen (panel 1 and 2). Panel 3 shows
its low staining with Hoechst 33342, stem cell side population
cells have the capability to exclude Hoechst 33342 by a multi-drug
like transporter (FIG. 37).
[0329] To determine whether WEE1/pY37-H2B signaling is essential to
maintain stemness of the GBM population, mRNA will be prepared from
MK-1775 (0.6 .mu.M) or DMSO treated neurospheres. This study will
analyze expression markers characteristic of the stem cell
phenotype and pluripotency, such as Sox4, Sox18, nanog homeobox
(NANOG), POU class 5 homeobox 1 (POU5F1) or OCT4, and SRY-box 2
(SOX2) by qRT-PCR. Morever, this study will analyze whether MK-1775
either alone or in combination with temozolomide, an alkylating
agent (specific aim 3) abolishes neurosphere formation and
propagation. These data will reveal whether WEE1/pY37-H2B signaling
is needed for maintaining GBM neurosphere formation potential.
Determine Whether WEE1/pY37-H2B Epigenetic Signaling Prevents
Formation 5-mC and 5-hmC by Suppressing DNMT3B and IDH2
Expression
[0330] To test the hypothesis whether increased WEE1/pY37-H2B
signaling suppresses IDH2 and DNMT3B expression and thus formation
5-mC and 5-hmC, respectively, this study will assess global 5-mC
and 5-hmC levels in GBM and normal brain samples using the EpiMark
5-hmC and 5-mC analysis Kit (New England Biolabs). This robust and
highly reproducible PCR-based assay utilizes the differential
methylation sensitivity of the isoschizomers MspI and HpaII to
quantitate the presence of 5-hmC and 5-mC. In brief, 5-hmC present
in genomic DNA isolated from .about.40 GBM tumor and 10 normal
brain samples will be glucosylated (unmodified or 5-mC containing
DNA will not be affected) followed by digestion. MspI and HpaII
recognize the same sequence (CCGG) but are sensitive to different
methylation status. HpaI will cleave unmodified site while MspI
will recognize and cleave 5-mC and 5-hmC, but not 5-ghmC. PCR will
be performed using primers corresponding to known locations e.g.
pericentric heterochromatin and the CpG sites that contain 5-hmC.
If the CpG site contains 5-hmC, amplification will occur after
glucosylation and digestion, but not in the samples lacking 5-hmC.
It is expected that real time PCR will reveal that GBM samples have
significantly lower 5-mC and 5-hmC levels as compared to normal
samples. In addition, 4 GBM patient-derived cell lines treated with
0.6 .mu.M of WEE1 inhibitor MK-1775 or DMSO will also be used to
determine 5-mC and 5-hmC levels. Consequently, this study expects
to see an increase in 5-hmC levels in Wee1 inhibitor treated
samples.
Validation of Lowering 5-mC and 5-hmC Levels in GBM by
Immunohistochemical Staining of TMA
[0331] To examine the role of WEE1/pY37-H2B signaling in regulating
5-mC and 5-hmC levels and correlate it to GBM disease progression,
this study will perform immunohistochemical (IHC) staining of brain
cancer TMA as described in specific aim 1. IHC grade antibodies for
5-mC and 5-hmC are commercially available from LifeSpan
BioSciences. A significant decrease in expression of 5-mC and 5-hmC
is expected when GBM tumors are compared to normal samples. This
study will perform ANOVA and Tukey-Kramer analysis to examine all
differences. This study will also determine whether overexpression
of WEE1 and pY37-H2B is significantly correlated with
downregulation of 5-mC and 5-hmC in situ by calculating Spearman
rank correlation coefficient (p=0.5 or above will be considered
significant).
ChIP-PCR Analysis to Determine Increased Recruitment of Histone
Transcriptional Suppressor HIRA at pY37-H2B Marked Sites in GBM
[0332] This study discovered for the first time that a rapid
cascade of events is initiated when WEE1 is recruited to the
chromatin by the transcriptional co-activator NPAT upstream of
Hist1 cluster. The pY37-H2B epigenetic marks acts as a docking site
for the recruitment of histone repressor, HIRA, to down regulate
expression of multiple histone genes of Hist1 cluster. In this
specific aim this study will explore whether pY37-H2B epigenetic
mark uses a similar mechanism to down regulate expression of IDH2,
DNMT3B and other candidate genes. ChIP with HIRA antibody or IgG
antibodies as control will be performed in primary GBM derived cell
lines that are treated with WEE1 inhibitor MK-1775 (DMSO as
control) followed by real time PCR of DNA using primers
corresponding to IDH2, DNMT3B and other 6 candidate genes. The
results from these studies will have a significant impact on the
understanding of how candidate chromatin modifying genes such as
IDH2 and DNMT3B are compromised in tumors. This acquires particular
significance in those tumors that do not display loss of function
mutations in these genes.
Determine the Ability of WEE1 Inhibitor MK-1775 to Mitigate the
Growth of Xenograft Tumors by Activating Expression of Chromatin
Modifiers
[0333] This study will use two different brain cancer cell lines,
U51 and U251N for xenograft studies. The inventors have generated
stable U87 and U251N cells that express luciferase and eGFP (FIG.
38). In brief, U51 and U251N cell lines will be injected into the
caudate nucleus of the right cerebral hemisphere of the brains of
NOD/SCID mice. In addition to U51 and U251N cell lines, this study
will also perform this experiment using two GBM patient derived
cell lines (BTICs), including BTIC5, shown in FIG. 37. With four
different cell types (n=20 mice), total 80 mice will be used. For
each mouse, 1.times.10.sup.5 cells/0.002 ml will be injected and
tumor growth will be characterized by weekly imaging using the IVIS
200 in vivo fluorescence imaging system. Of 20, 10 mice will be
administered with MK-1775 after a period of latency to tumor
formation (i.e. 14 days post-injection). A dose of 10 mg/kg/day of
MK-1775 will be injected intraperitoneally (IP) every day for 10
days and suppression of tumor growth will be confirmed by
non-invasive bio-imaging. The other half of the mice will be
injected IP with 10% DMSO solution. The significance of this system
is that the tumor cells can be identified ante mortem in mice.
Further, responses to treatments can also be monitored in vivo ante
mortem. After a period tumor growth, previously determined to be
approximately 35 days, mice will be euthanatized. At this time,
tumors will be resected and evaluated post mortem in the lab. It is
expected that WEE1 kinase inhibition by MK-1775 will result in at
least partial regression of xenograft tumor growth. To confirm the
role of chromatin modifiers in tumor growth, total RNA will be
isolated from resected xenograft tumors and qRT-PCR for histone
mRNAs (for assessing decreased WEE1 activity) and candidate genes
will be performed. It is expected that MK-1775 mediated inhibition
of WEE1/pY37-H2B signaling will lead to increased level of DNA and
histone modifiers genes, suppressing tumor growth.
[0334] Statistical analysis for xenograft studies: Ten animals are
planned for each of the groups. Using a two-sided two-sample
T-test, with 10 animals in each group, this study will achieve 100%
power to detect the difference between groups with a stringent
alpha level set at 0.01 (when adjusting for multiplicity).
Interrogate Mechanisms by which pY37-H2B Promotes DNA Repair and
Resistance to DNA Alkylating Agents
[0335] During S phase WEE1 appears to track not only completion of
DNA replication and genetic integrity by pTyr15-phosphorylation of
Cdc2 but also completion of histone synthesis by marking chromatin
with H2B pTyr37-phosphorylation, before cells enter mitosis. Thus
WEE1 behaves as a sensor of chromatin integrity and agents that can
compromise this function can lead to mitotic infidelity, chromosome
loss, and apoptosis. Not surprisingly, WEE1 inhibitor, MK-1775, is
able to sensitize cancers and cancer cell lines cells to certain
DNA damaging agents such as gemcitabine, 5-fluorouracil that
activate intra-S phase checkpoint. This appears not to be solely
limited to WEE1's role in regulating G2/M entry, but to additional
functions in S phase. Moreover, cells treated with agents that can
inhibit both DNA synthesis (hydroxyurea) and inhibit WEE1, were
found to contain a marked increase in disorganized mitotic spindles
and abnormal mitoses.
H2B Y40-Phosphorylation Function is Conserved in S. cerevisiae
[0336] Budding yeast, Saccharomyces cerevisiae, is a genetically
tractable model organism to study the functional roles of variety
of post-translational modifications in histones and histone
transcriptional activation. It was observed that H2B Tyr37 site is
evolutionarily conserved and is equivalent to Y40 in S. cerevisiae.
To examine H2B Tyr40-phosphorylation regulates histone
transcription, mRNAs were isolated from the WT and H2B-Y40A mutant
yeast followed by qRT-PCR. The WT cells exhibited peak histone mRNA
synthesis at 30 min post .alpha.-factor release followed by rapid
decrease, however, H2B-Y40A mutant yeast exhibited significant
increase in histone mRNA levels over the WT at 30 min post
.alpha.-factor release (FIGS. 39a and 39b). Similarly, loss of SWE1
(WEE1 homolog is called SWE1 in S. cerevisiae) resulted in
significant increase in all histone levels (FIGS. 39c and 39d).
Taken together, these data indicate that the kinase, the substrate
and the post-translational modification is evolutionarily
conserved.
Yeast H2BY40A Mutants Display Marked Sensitivity to DNA Alkylating
Agents
[0337] To test whether excess of histones interfere with the
ability of cells to repair DNA damage, S. cerevisiae wildtype (Wt)
and H2BY40A mutants were exposed to DNA alkylating agent
Methylmethane sulphonate (MMS). MMS inhibits DNA replication by
methylating adenine or guanine in the DNA to cause base mispairing
and stalling of replication forks, until the mutated/alkylated
bases are excised out and replaced with the normal bases by the DNA
alkyl transferases or the nucleotide repair machinery. In contrast
to the wild type cells, H2BY40A mutants exhibited acute sensitivity
to MMS similar to the checkpoint kinase mutant rad53 (FIG. 40).
Rad53 is a functional homologue of human Chk1 and Chk2 in budding
yeast. It not only senses DNA replication stress during S phase but
also acts as a surveillance machinery to detect excess histones
that are not packaged into chromatin and targets them for
degradation.
[0338] The acute sensitivity of the yeast H2BY40A mutants to MMS
suggests that H2B Tyr40-phosphorylation is critical to overcome DNA
damage and sensitivity may be due to three non-mutually exclusive
mechanisms; (1) By not recruiting factors facilitating
base-excision repair or nucleotide excision repair; (2) by
interfering with DNA repair by increasing nucleosomal density, and
(3) by a failure to arrest cells in S phase with damaged DNA. This
finding is particularly significant in GBM, as alkylating
neoplastic agents such as temozolomide are routinely used to treat
patients. Temozolomide methylates guanine at O.sup.6 position in
the DNA, interferes with replication of the DNA strand to arrest
cells in S phase, and if the damaged is not repaired it leads to
apoptosis. Interestingly, cancer cells upregulate expression of
enzymes such as O.sup.6 methyl guanine methyl transferase (MGMT),
which confers resistance to DNA alkylating agents by removing the
methyl groups efficiently. Moreover, expression of high levels of
MGMT is inversely correlated with angiogenicity and invasiveness of
GBM. Based on these data, it is contemplated that WEE1 mediated H2B
Tyr37-phosphorylation acts as `beacon` for recruitment of DNA
repair machinery e.g. AGT, ERCC1 and XPF (FIG. 41) or it may relay
the damage signal to the Chk1 S phase checkpoint kinase to arrest
cells. In the absence of H2B Tyr37-phosphorylation, recruitment of
AGT, ERCC1 and XPF and repair of alkylating DNA is impaired,
eventually leading to apoptosis. These data indicate that
combinatorial treatment with Temozolomide and MK-1775 could be a
novel and highly relevant strategy for treatment of GBM patients.
To test this hypothesis this study will pursue the following
experiments.
Examine Whether Loss of Y37 Phosphorylation Sensitizes GBM Cells to
DNA Alkylating Agents
[0339] GBM cell lines U373 (MGMT negative), U138 (moderate
expression of MGMT), LN18 and T98G (high expression of MGMT)
obtained from ATCC (American Type Culture Collection), will be
treated with different doses of the WEE1 inhibitor MK-1775 and
Temozolomide. Cell viability will be assayed by WST-1 proliferation
assay and cell cycle arrest will be assessed by flow cytometry as
described in Applicants' publications. As shown in the schematic
pY37-H2B is expected to have a protective effect due to its ability
to recruit the repair or checkpoint machinery to the
temozolomide-induced alkylated bases. In Wee1 inhibitor treated
cells, in the absence of phosphorylation, the repair or checkpoint
pathways are not active and have catastrophic consequences. It is
believed that significant toxicity will be observed in GBM cells
treated with MK-1775 and alkylating agents. This finding will be
crucial to initiate a clinical trial on combining WEE1 inhibitors
with DNA alkyating agents to treat GBM patients.
Investigate Whether pY37-H2B Recruits DNA Repair Enzymes or Relays
Signals to Checkpoint Kinases in Cells Treated with Alkylating
Agents
[0340] To further investigate interaction of DNA repair proteins
with pY37-H2B epigenetic mark, Phospho-peptide pull down assays
will be performed as described in Applicants' paper. Primary
GBM-derived cell line treated with a MK-1775, Temozolomide,
MK-1775+Temozolomide or DMSO as control. Extracts will be incubated
with biotinylated pY37-H2B or control peptides that are immobilized
on streptavidin beads. Interaction of pY37-H2B with DNA repair
proteins will be assessed by immunoblotting with specific
antibodies (anti-ERCC, anti-XPF and anti-MGMT or anti-ACT
antibodies or anti-Chk1 antibodies). Immunoprecipitation of MGMT or
excision repair proteins will be an important proof of the
mechanism by which pY37-H2B might epigenetically regulates DNA
repair and promote resistance to alkylating agents. Alternatively,
this study will perform mass-spectrometry analysis of the pY37-H2B
phospho-peptide pull down in cells treated with DNA alkylating
agents to identify proteins interacting with this modification.
Non-phospho peptides will be used as control.
Determine Whether Excess Histones Increase Nucleosomal Density in
GBM Cell Lines
[0341] The increased MMS sensitivity of the yeast H2BY40A mutants
could be due to increased heterochromatinization as a result of
excess histone gene expression due to loss of WEE1 mediated
regulation. To test this hypothesis this study will first determine
nucleosomal density in GBM cell lines untreated and treated with
WEE1 inhibitor. Briefly, nuclei will be isolated and the intact
nuclei will be digested with micrococcal nuclease, followed by
nucleosomal DNA purification using EZ Nucleosomal DNA Prep Kit
(Zymoresearch). Non-nucleosomal DNA is specifically degraded using
micrococcal nuclease, while nucleosomes bound DNA will be
protected, and exhibit a periodic ladder like pattern of .about.150
bp or higher. The nucleosomal DNA will be further analyzed by
agarose gel electrophoresis. Presence of high molecular weight or
non-digested DNA in the WEE1 inhibitor treated will confirm
Applicants' hypothesis that increased histones leads to increased
nucleosomal density and heterochromatinzation phenotype. The
results from these studies will suggest that excess histones
interfere with access of DNA repair machinery to damaged bases in
the DNA, leading to cell death. The results obtained from study
with the GBM cell lines will be validated using the yeast H2BY40A
mutant and wildtype as control. This kit works well for isolation
of mammalian and yeast nucleosome-associated DNA.
Evaluate Sensitivity of GBM Orthotopic Tumors to Combination of
MK1775 and Temozolomide
[0342] To assess whether combinatorial targeting with DNA
alkylating agent temozolomide and MK-1775 can efficiently overcome
GBM tumor growth, U51 and U251N cell lines, will be injected into
the brains of NOD/SCID mice as described in Specific Aim 2 (n=30
mice, total 60 mice). 10 mice will be administered with
temozolomide, or with MK-1775 and temozolomide or with DMSO, 14
days post-injection. Both, MK-1775 and temozolomide will be
injected at a dose of 10 mg/kg/day intraperitoneally for 10 days
and suppression of tumor growth will be confirmed by non-invasive
imaging the mice. It is expected that combinatorial treatment of
MK-1775 and Temozolomide will not only cause base alkylation, but
also cause failure of the DNA damage repair machinery to be
efficiently recruited due to the loss of WEE1/pY37-H2B signaling
activity. Inability of repair of the alkylated DNA would result in
cell cycle arrest, leading to cell death. Overall, it is expected
that combination of these two inhibitors will markedly suppress GBM
tumor growth.
Example 8: Histone H2B Phosphorylation at Tyrosine 37 by WEE1
Kinase and its Role in Glioblastoma Multiforme (GBM), Melanoma and
Prostate Cancer
[0343] The precise orchestration of epigenetic signaling networks
ensures timely gene expression profiles that are critical to
safeguard against catastrophic cellular events. Components of these
epigenetic signaling pathways include writers, readers and erasers,
each of which plays a critical role in regulated gene expression.
Importantly, deregulation of epigenetic mechanisms is linked to
cancer, hereditary and metabolic diseases (Probst, A. V. et al.
(2009) Nat. Rev. Mol. Cell. Biol., 10(3):192-206; Schwartzentruber,
J. et al. (2012) Nature, 482(7384):226-231; Wu, G. et al. (2012)
Nature Genetics, 44(3):251-253; Sturm, D. et al. (2012) Cancer
Cell, 22(4):425-437; Brower, V. (2011) Nature, 471(7339):512-513;
Burgess, R. J. et al. (2013) Nat. Struct. Mol. Biol., 20(1):14-22).
Applicants recently discovered the existence of a novel epigenetic
signaling network wherein WEE1 kinase directly phosphorylates the
histone H2B (pY37-H2B) to cause repression of global histone
synthesis, precisely in the late S phase of the cell cycle
(Mahajan, K. et al. (2012) Nat. Struct. Mol. Biol., 19(9):930-937).
Mechanistically, it was observed that pY37-H2B epigenetic marks
recruit the HIRA transcriptional repressor, exclude the
transcriptional co-activator, NPAT, to temporally suppress mRNA
synthesis, providing a key evidence of how cells use this
epigenetic signaling pathway to precisely coordinate duplication of
DNA and histones during each cell cycle (Mahajan, K. et al. (2012)
Nat. Struct. Mol. Biol., 19(9):930-937; Mahajan, K. et al. (2013)
Trends in Genetics:TIG, 29(7):394-402). Consonantly, it was
observed that a WEE1-specific small molecule inhibitor, MK-1775
(now AZT-1775) not only inhibited WEE1 epigenetic activity but also
robustly reversed histone transcriptional suppression, in both
yeast and mammalian cells, indicating that WEE1/pY37-H2B epigenetic
signaling has an universal applicability (Mahajan, K. et al. (2012)
Nat. Struct. Mol. Biol., 19(9):930-937; Mahajan, K. et al. (2013)
Trends in Genetics:TIG, 29(7):394-402). Based on these data and
without being bound by theory, Applicants suggest that
WEE1/pY37-H2B epigenetic signaling plays a critical role in
chromatin replication by silencing histone transcription that can
be reversed by WEE1 inhibitor, MK-1775. Applicants also established
the novel epigenetic reader function of HIRA and its role in
suppression of global histone output. Further, it was demonstrate
that the reversal of pY37-H2B epigenetic marks by MK-1775 could
overcome `loss of heterochromatinization` caused by abridged
histone synthesis in WEE1 overexpressing cancer cells.
[0344] Serendipitously, Applicants discovered that the pY37-H2B
marks are instantaneously erased after IR-induced DNA damage and
are restored after about 2 hours when majority of the DSBs are
repaired. The removal of these marks was found to be dependent on
the activity of Ataxia telangiectasia mutated (ATM) kinase, a
master regulator of the DNA damage signaling pathway. Thus, these
data indicate that another regulatory layer is involved in the
deposition of pY37-H2B epigenetic marks. Applicants investigated
how these marks are erased in a timely manner by EYA and CDC14
tyrosine phosphatases.
[0345] Interestingly, in light of Applicants' recent discovery, the
evolutionarily conserved WEE1 epigenetic function acquires a new
dimension--WEE1 is aberrantly expressed in highly aggressive tumors
such as glioblastoma multiforme (GBMs), malignant melanomas and
triple-negative & luminal breast cancers (Mir, S. E. et al.
(2010) Cancer Cell, 18(3):244-257; Wuchty, S. et al. (2011) PloS
One, 6(2):e14681; Magnussen, G. I. et al. (2012) PloS One,
7(6):e38254; Aarts, M. et al. (2012) Cancer Discov., 2(6):524-539;
Iorns, E. et al. (2009) PloS One, 4(4):e5120). To decipher its
puzzling role in malignancy, Applicants mined the ChIP-sequencing
data which revealed that in addition to HIST1, pY37-H2B marks are
also deposited at a tumor suppressor gene--the isocitrate
dehydrogenase 2 (10H2). This gene encodes a key enzyme in the
pathway catalyzing the conversion of methyl group at the 5'
position of cytosine (5-mC) to 5-hydroxymethylcytosine (5-hmC) (Xu,
W. et al. (2011) Cancer Cell, 19(1):17-30)--a metabolite
significantly reduced in malignant cancers (Xu, W. et al. (2011)
Cancer Cell, 19(1):17-30; Haffner, M. C. et al. (2011) Oncotarget,
2(8):627-37; Jin, S. G. et al. (2011) Cancer Res.,
71(24):7360-7365; Orr, B. A. et al. (2012) PLoS One, 7(7):e41036;
Lian, C. G. et al. (2012) Cell, 150(6):1135-1146). While IDH2 mRNA
expression is down regulated in brain and skin cancers, the
mechanistic basis of its transcriptional suppression was not known.
Therefore, Applicants profiled 27 primary GBM biopsies and 6 normal
brain samples and observed that a subset of the GBMs (about 26%)
exhibited elevated WEE1 mRNA levels coupled with a striking
downregulation of IDH2 mRNA transcription.
[0346] Therefore, Applicants demonstrated that by overexpressing
WEE1, cancer cells suppress IDH2 gene expression--revealing a novel
epigenetic pathway wherein histone Tyr-phosphorylation regulates
DNA methylation, promoting GBM and melanoma malignancy. Overall,
pY37-H2B modification was studied at two important genetic loci
(HIST1 and IDH2) and assessed its role in histone transcription and
gene regulation.
A Novel Function of WEE1 as a Regulator of Global Histone
Output
[0347] The precise execution of epigenetic signaling events, which
includes both addition and removal of epigenetic marks in a
temporally regulated manner, is paramount to preserving the
chromatin landscape and consequently governs the fate of the cell.
Inappropriate inhibition or activation of epigenetic signaling
events profoundly alters the epigenome and is linked to cancer and
developmental diseases. At the heart of the epigenome are the
histones. In higher eukaryotes histone synthesis is a complex
affair- to keep up with the massive demand of wrapping newly
duplicated DNA into chromatin, cells have evolved multiple copies
of histone genes, each encoding a fraction of the total histone
protein (Marzluff, W. F. et al. (2012) Genomics, 80(5):487-498).
Strikingly, at the end of S-phase, histone transcription plummets
to allow cells to maintain proper histone-DNA stoichiometry prior
to mitotic entry (Osley, M. A. (1991) Annu Rev Biochem, 60:827-861;
Hereford, L. M. et al. (1981) Cell, 24(2):367-375; Hereford, L. et
al. (1982) Cell, 30(1):305-310). The process by which higher
eukaryotic cells achieve this precipitous drop in histone
transcript levels has remained elusive. Unexpectedly, Applicants
identified a previously unknown epigenetic activity of the WEE1
tyrosine kinase--it directly modulates the histone gene
transcription by phosphorylating the core histone H2B at Y37 and
recruiting a transcriptional repressor to these loci. Mammalian
cells deficient in WEE1 function abrogated H2B Y37-phosphorylation
with a concurrent increase in histone transcription. Importantly,
S. cerevisiae mutants, swe1, lacking the homolog of human WEE1, or
the H2BY40A mutants, too were defective in H2B Y40-phosphorylation
(equivalent to H2BY37 in mammals) and did not terminate histone
transcription at the end of S phase, suggesting that the epigenetic
transcriptional suppressive activity mediated by WEE1 is
evolutionarily conserved and is critical to maintain chromatin
homeostasis (Mahajan, K. et al. (2012) Nat. Struct. Mol. Biol.,
19(9):930-937; Mahajan, K. et al. (2013) Trends in Genetics:TIG,
29(7):394-402). While it has been well established that averting
overproduction of histones is necessary for chromatin homeostasis,
how is it accomplished is far from clear. Applicants have made the
first attempt to obtain comprehensive understanding of the
regulatory roles of the various players that congregate at the
pY37-H2B epigenetic mark to regulate global chromatin
transaction.
HIRA, a Novel pY37-H2B Epigenetic Reader Involved in Global Histone
Transcription Suppression
[0348] Epigenetic readers are chromatin architectural proteins that
recognize specific marks on histones (or nucleotides) and can
either induce chromatin compaction or prevent the binding of
proteins involved in transcription. Applicants discovered a role
for HIRA, as a novel pY37-H2B epigenetic reader; it suppressed
transcription of multiple histone genes of the HIST1 cluster
(Mahajan, K. et al. (2012) Nat. Struct. Mol. Biol., 19(9):930-937;
Mahajan, K. et al. (2013) Trends in Genetics:TIG, 29(7):394-402).
HIRA (HIR histone cell cycle regulation defective homolog A) has
been identified as a component of the chromatin remodeling complex
of HIRA/Asf1/UBN1, which by its association with HP1 spreads across
silenced domains to enforce transcriptional silencing (Yamane, K.
et al. (2011) Molecular Cell, 41(1):56-66; Canzio, D. et al. (2013)
Nature, 496(7445):377-381; Canzio, D. et al. (2011) Molecular Cell,
41(1):67-81). HIRA also acts as a histone chaperone by depositing
the variant histone H3.3 in a replication-independent manner into
the nucleosome (Rai, T. S., et al. (2011) Mol. Cell. Biol.,
31(19):4107-4118). Interestingly, Applicants observed that pY37-H2B
epigenetic mark acts as a beacon for the recruitment of HIRA
(mammals) and HIR (yeast), leading to the suppression of global
histone gene transcription in different eukaryotic systems
(Mahajan, K. et al. (2012) Nat. Struct. Mol. Biol., 19(9):930-937).
These data support the idea that the mechanism of transcriptional
suppression by pY37-H2B/HIRA complex is evolutionarily conserved.
Although this recent work has uncovered a novel epigenetic reader
function of HIRA, how HIRA recognizes the pY37-H2B epigenetic marks
to enforce transcriptional shutdown is not known. Applicants have
undertaken detailed characterization of HIRA/pY37-H2B interaction,
especially focusing on assessing the C-terminal region of HIRA as a
potential epigenetic reader domain. Further, Applicants examined
the effect on transcription of the HIST1 locus and IDH2 upon
inhibition of pY37-H2B and HIRA reader domain interaction.
A Timely Removal of pY37-H2B Marks on Chromatin: CDC14 and EYA
Family of Tyrosine Phosphatases as pY37-H2B Erasers
[0349] Cell cycle analysis indicated that cells rapidly exit S
phase once histone transcription is terminated and the pY37-H2B
marks are quickly erased (Mahajan, K. et al. (2012) Nat. Struct.
Mol. Biol., 19(9):930-937; Mahajan, K. et al. (2013) Trends in
Genetics:TIG, 29(7):394-402). The temporal and transient nature of
H2B Y37-phosphorylation suggests that cells may actively recruit a
phosphatase to dephosphorylate pY37-H2B before the cells enter G2/M
phase. Identification of a novel pY37-H2B-specific phosphatase
would be highly desirable to interrogate its role in preserving the
chromatin landscape. Because a pY37-H2B-specific phosphatase has
not yet been identified, we performed substrate specificity
assessment of all the tyrosine phosphatase family members which led
us to determine that the members of the CDC14 tyrosine phosphatase
family could be a potential pY37-H2B-specific phosphatase. This
family consists of four members (CDC14A, B, KAP and PTP9Q22) which
are evolutionarily conserved tyrosine phosphatases (Hartwell, L. H.
et al. (1974) Science, 183(4120):46-51; Gray, C. H. et al. (2003)
The EMBO Journal, 22(14):3524-3535). Of these the CDC14A, was
recently found to interact with Swe1, a WEE1 homolog in S.
cerevisiae (Breitkreutz, A. et al. (2010) Science,
328(5981):1043-1046). Taken together, these data suggest to an
additional role for WEE1 as a dynamic recruiter of the cognate
phosphatase, CDC14A, to accomplish de-phosphorylation of the
pY37-H2B epigenetic marks.
[0350] Applicants' pursuit of understanding the transient nature of
pY37-H2B marks unveiled another surprise--the pY37-H2B epigenetic
marks were rapidly erased following DNA double-strand breaks (DSBs)
in ATM dependent manner. ATM is known to recruit the eyes absent
(EYA) family of tyrosine phosphatases to dephosphorylate the
variant histone H2AX (Cook, P. J. et al. (2009) Nature,
458(7238):591-596). These data suggest that EYA could be a second
potential epigenetic eraser of the pY37-H2B epigenetic marks, but
specifically in response to damage induced by genotoxic agents such
as IR. Thus, at least two distinct phosphatases may catalyze the
removal of the pY37-H2B marks depending on the status of chromatin;
(i) CDC14, which erases these epigenetic marks at the end of DNA
replication in late S-phase of cell cycle, and, (ii) EYA, which
erases pY37-H2B epigenetic marks specifically in response to DSBs.
We have assessed the activity of both of these tyrosine
phosphatases in greater detail, as potential pY37-H2B epigenetic
erasers.
Epigenetic Mechanisms Underlying IDH2 Transcriptional Down
Regulation in GBMs
[0351] Glioblastomas or GBMs are not only the most common brain
cancers, but also present with the dismal prognosis (Wen, P. Y. et
al. (2008) N. Engl. J. Med., 359(5):492-507). A median survival is
about 15 months and only 3-5% of GBM patients survive longer than
36 months. These account for .about.13,000 deaths per year in U.S.
alone (Wen, P. Y. et al. (2008) N. Engl. J. Med., 359(5):492-507).
The molecular basis of GBM pathogenesis is unknown, which has made
research into understanding the biology and the identification of
therapeutic targets an area of intense research interest.
[0352] Isocitrate dehydrogenases, IDH1 and IDH2, catalyze the
oxidative decarboxylation of isocitrate to .alpha.-ketoglutarate
(.alpha.-KG), a crucial regulator of cell metabolism (Xu, W. et al.
(2011) Cancer Cell, 19(1):17-30; Reitman, Z. J. et al. (2010) J.
Natl. Cancer Inst., 102(13):932-941). About 60 dioxygenases
expressed in mammalian cells utilize .alpha.-KG as an essential
cofactor in the oxidation reaction, including the recently
discovered TET family of 5-methylcytosine (5mC) hydroxylases that
convert 5-mC to 5-hmC Oyer, L. M. et al. (2009) Cell Cycle,
8(11):1698-1710; Loenarz, C. et al. (2008) Nat. Chem. Biol.,
4(3):152-156; Tsukada, Y. et al. (2006) Nature, 439(7078):811-816;
Tahiliani, M. et al. (2009) Science, 324(5929):930-935). Although
the levels of 5-hmC are tissue independent, the highest levels have
been reported in brain (Kriaucionis, S. et al. (2009) Science,
324(5929):929-930). In recent years, the loss of 5-hmC has been
identified to be a recurrent epigenetic hallmark in GBMs and
melanomas (Orr, B. A. et al. (2012) PLoS One, 7(7):e41036, Lian, C.
G. et al. (2012) Cell, 150(6):1135-1146; Krell, D. et al. (2011)
PloS One, 6(5):e19868). While down regulation of IDH2 has emerged
to be a key event in the loss of 5-hmC in cancer cells, how IDH2
downregulation is specifically achieved is not clear.
[0353] A clue to IDH2 down regulation in GBMs emerged from
Applicants' ChIP-Sequencing experiments. It revealed that WEE1
deposits pY37-H2B marks not only upstream of the HIST1 cluster but
also within the IDH2 gene. It indicated, for the first time, that
the epigenetic activity of WEE1 is not only crucial in regulating
global histone synthesis, but may also have a role in regulating
`other` epigenetic modifications, such as DNA methylation. Without
being bound by theory, it was reasoned that cancer cells could
benefit enormously if they were to hijack WEE1/pY37-H2B epigenetic
signaling to modify chromatin by altering methylation status. To
address this supposition, the mRNA levels of WEE1 and IDH2 were
examined in GBM tumors and observed that about 26% of GBM patients
exhibit elevated WEE1 mRNA expression and significant down
regulation of IDH2 transcription (FIG. 47). Conversely, inhibition
of WEE1 by MK-1775 increased IDH2 transcript levels and restored
5-hmC levels (FIGS. 45 and 46). This is an important finding, as
reversal of 5-hmC levels by WEE1 inhibitor (or any other inhibitor)
has not been previously demonstrated.
MK-1775 (AZT-1775), a Novel Epigenetic Inhibitor
[0354] WEE1 tyrosine kinase plays a key role as a regulator of the
G2/M checkpoint that precedes entry into mitosis. Hence after DNA
damage, WEE1 inhibitor can be deployed to block phosphorylation of
CDK1, thereby promoting inappropriate cell cycle progression,
causing mitotic catastrophe. Based on this premise, MK-1775
combined with gemcitabine, cisplatin or carboplatin has entered
phase I & II clinical trials (NCI Clinical Trial). However,
this data uncovered an additional function of WEE1 kinase, an
epigenetic modulator, overexpression of which in cancer cells could
suppress global histone output as well as silence tumor suppressor,
IDH2. Although, almost 13 clinical trials are active or approved
for MK-1775, none take into account the WEE1 epigenetic function
for selecting the patients for their potential response. In this
study Applicants performed preclinical evaluation of MK-1775 as a
novel epigenetic therapeutic agent. Specifically, this study has
demonstrated that a quarter of GBM patients may exhibit robust
activation of WEE1 epigenetic signaling nexus and suppression of
both histone and IDH2 mRNA levels can be a companion diagnostic for
screening of patients that are likely to respond to MK-1775, a
desperate need for these patients.
Metastatic Melanomas Display Significant Decrease in IDH2 mRNA
Expression
[0355] Not only is WEE1 overexpressed in melanomas, MK-1775, a
potent WEE1-specific inhibitor selectively induces apoptosis in
WEE1 expressing cancer cell lines (Hirai, H., et al. (2009) Mol.
Cancer Ther., 8(11):2992-3000, Sarcar, B. et al. (2011) Mol. Cancer
Ther., 10(12):2405-2414; De Witt Hamer, P. C. et al. (2011) Clin.
Cancer Res., 17(13):4200-4207), suggesting that some of the
melanomas may be addicted to the WEE1 signaling pathway for
survival. Based on the prior finding that WEE1 epigenetically
regulates the expression of chromatin modifying gene IDH2,
Applicants envisaged that alterations in WEE1 regulatory control
could significantly disrupt the epigenetic landscape of melanomas,
to promote malignancy. To interrogate this hypothesis further,
Applicants obtained 15 primary melanomas and 3 normal skin samples
(total 18 samples) under SRC/IRB approved protocol, MCC#15375, IRB
Study #106509 (PI: Sarnaik, Co-I: Mahajan). All the tumors were
microdissected and pathologist validated each of the microdissected
tissue samples prior to its usage. As a first step, total RNA was
prepared followed by qRT-PCR using IDH2 and actin specific primers.
Although, there was some inter individual variability, a
significant decrease in IDH2 mRNA levels was apparent in melanomas
as compared to normal skin samples.
[0356] Statistical Analysis: Relative expression of IDH2 mRNAs was
determined based on its ratio with actin. The log-transformation
was taken so that the data were normally distributed. The
differences in relative IDH2 mRNA levels between melanoma and
normal human skin were statistically significant (p=0.048). The
p-values are two-sided and computed by the two-sample t-test. To
identify patients that exhibit significant downregulation of IDH2,
the threshold for each variable was selected to maximize the
sensitivity (ratio of positives to melanoma) when the specificity
(ratio of negatives to normal samples) is set to 1. These indicated
that the melanoma patients whose IDH2/Actin ratios are <1.67,
are likely to have active/elevated WEE1/pY37-H2B signaling. There
were 10 such patients (patient #2, 4, 5, 8-14) that fit in this
category, indicating that about 70% (10 of 14) of the melanoma
patients exhibit elevated WEE1/pY37-H2B signaling (90% CI:
0.128-0.432). In contrast, none of the normal skin samples
exhibited <1.67 ratios for IDH2/Actin.
Deposition of pY37-H2B Epigenetic Mark by WEE1 Suppresses IDH2 and
Histone Transcription.
[0357] To investigate whether WEE1/pY37-H2B signaling plays a
direct role in regulating IDH2 gene transcription, three WEE1
expressing cancer cell lines, U87 (GBM), LNCaP (prostate) and
WM1366 (melanoma) were treated (1 uM, 24 hours), or untreated, with
WEE1-specific small molecule inhibitor MK-1775. Total RNA was
isolated followed by qRT-PCR with IDH2 and actin specific primers.
As control, U118 cell line was used which has low levels of WEE1
(unpublished data). A significant increase in transcript levels of
the IDH2 gene was observed in WEE1 expressing U87, LNCaP &
WM1366 cells upon treatment with MK-1775 (FIG. 42A-42C), in
contrast, IDH2 mRNA was not increased in U118 cell line (FIG.
42D).
[0358] To examine if MK-1775 mediated IDH2 downregulation is not
due to its `off site effect`, LNCaP cells were transfected with
WEE1 or control siRNA, which indicates that WEE1 loss by siRNA too
resulted in increased IDH2 levels (FIG. 42E).
[0359] Applicants also validated WEE1's ability to suppress histone
transcription in LNCaP cells (FIG. 42F). Taken collectively, these
data indicate that epigenetic writing by WEE1 has a repressive
effect on transcription of the IDH2 and histones and it can be
reversed by MK-1775.
Reversal of the Loss of the Epigenetic Mark 5-hmC by WEE1
Inhibitor
[0360] To determine whether WEE1 mediated IDH2 transcriptional
suppression impacts 5-hmC levels in cells, a melanoma derived cell
line SBC12 was treated with the WEE1 inhibitor, MK-1775. Genomic
DNA was isolated, blotted by slot blot, followed by immunoblotting
with 5-hmC and 5-mC antibodies. A GBM-derived T98G cells was used
as positive control as it is known to possess low 5-hmC levels
(Lian, C. G. et al. (2012) Cell, 150(6):1135-1146). Both of these
cell lines exhibited significant upregulation in 5-hmC levels upon
WEE1 inhibitor treatment (FIG. 43). HEK293 cells were used as
control as they do not exhibit endogenous WEE1 overexpression
(unpublished data). As expected, non cancerous HEK293 cell,
exhibited high levels of 5-hmC levels which remained unchanged by
WEE1 inhibition. 5-hmC containing plasmid DNA (Zymo research) was
used as positive control. Immunoblotting with 5-mC antibodies
revealed concomitant decrease (FIG. 43), which is consistent with
the report of Kriaucionis and Heintz who demonstrated that an
increase in the amount of 5-hmC is proportional to the decrease in
5-mC (Kriaucionis, S. et al. (2009) Science,
324(5929):929-930).
WEE1 Marks the IDH2 Locus by H2B Tyr37-Phosphorylation
[0361] ChIP-sequencing also revealed the presence of H2B
Y37-phosphorylation in the IDH2 coding region
(87,259,086-87,259,752) which was confirmed by directed ChIP-PCR in
synchronized MEFs (FIG. 44A). Treatment of cells with the WEE1
specific inhibitor, MK-1775, abolished the deposition of pY37-H2B
epigenetic marks. As a control, Applicants used primers
corresponding to the `Gene desert` on chromosome 6, where pY37-H2B
marks were not detected (control site, FIG. 44B). Based on the
location, Applicants identified the corresponding pY37-H2B-binding
site in human cells (15,241-15,400 nucleotide position). To
validate the presence of pY37-H2B marks within the human IDH2 gene
locus, sheared chromatin from HEK293 cells transfected with WEE1
kinase (or vector as a control) were immunoprecipitated using the
pY37-H2B antibody followed by qPCR using primers corresponding to
pY37-H2B-binding site in the IDH2 gene. WEE1 overexpression
resulted in significant increase in pY37-H2B deposition in the IDH2
gene (FIG. 44C).
[0362] To validate the role of WEE1 in IDH2 marking, chromatin from
GBM derived cell line U87 was immunoprecipitated using the pY37-H2B
antibody followed by qPCR. It revealed that pY37-H2B marks within
IDH2 were completely erased following treatment with the WEE1
inhibitor, MK-1775 (FIG. 44D). Similar data was obtained with
another human GBM derived cell lines T98G (FIG. 44E).
[0363] To identify patients that exhibit significant elevation in
WEE1/IDH2 signature and thus are potentially responders to
WEE1-specific inhibitors such as MK-1775, the threshold for each
variable was selected to maximize the sensitivity (ratio of
positives to GBMs) when the specificity (ratio of negatives to
normal samples) is set to 1. GBM patients whose WEE1/Actin and
IDH2/Actin ratios are >0.774 and <1.27, respectively, are
likely to have highly active/elevated WEE1/IDH2 signaling. There
were 7 such patients (patient #1, 4, 9, 15, 17 18 and 21) that fit
in this category, indicating that about 26% (7 out of 27) of the
GBM patients exhibit elevated WEE1/IDH2 signaling (90% CI:
0.128-0.432). In contrast, none of the normal brain samples
exhibited >0.774 and <1.27 ratios for WEE1/Actin and
IDH2/Actin. These results show that elevated WEE1 expression may be
an important contributor in the loss of 5-hmC, reported in GBMs,
via suppressing IDH2 expression.
TABLE-US-00010 TABLE 6 Descriptive Statistics- IDH2 and WEE1
expression profiles Variable Sample N Mean SD Med. Min. Max
IDH2/Actin GBMs 27 2.4 2.39 1.61 0.37 9.3 Normals 6 5.77 4.73 4.99
1.4 13.99 WEE1/Actin GBMs 27 1.3 1.1 0.79 0.17 3.96 Normals 6 0.28
0.27 0.17 0.06 0.76 Legend: Med. = median; Min. = minimum; Max =
maximum.
The Epigenetic Erasers of pY37-H2B Marks
[0364] The quest to decode the transient nature of pY37-H2B
epigenetic marks revealed that they are rapidly dephosphorylated
upon the introduction of double strand breaks (DSBs) by ionizing
radiation or IR (FIG. 47A). Recently, de-phosphorylation H2AX at
pY142 by EYA tyrosine phosphatase has been reported to facilitate
survival after DNA DSB repair (Cook, P. J. et al. (2009) Nature,
458(7238):591-596). Strikingly, in contrast to the H2AX
Y142-phosphorylation, the H2B Y37-phosphorylation is restored
within 2 hours, a time which coincides with repair in most cell
lines (FIG. 46A, lane 5).
[0365] To determine whether pY37-H2B de-phosphorylation is
regulated by ATM recruited to the sites of DSBs by the MRN complex,
Applicants treated the cells with the ATM inhibitor Ku55393.
Addition of the ATM inhibitor prevented IR-induced
de-phosphorylation of pY37-H2B (FIG. 46B, lane 4). Collectively,
these data opened a possibility that the ATM kinase, one of the
first responders to DSB sites, is likely to recruit a pY37-H2B
phosphatase following DNA damage. Interestingly, EYA1 and 3
tyrosine phosphatase have been shown to be specifically recruited
by ATM in response to IR (Cook, P. J. et al. (2009) Nature,
458(7238):591-596). EYA in turn interacted with H2AX executing a
damage-signal-dependent dephosphorylation of Tyr142, that is
constitutively phosphorylated in the absence of DNA damage (Cook,
P. J. et al. (2009) Nature, 458(7238):591-596).
[0366] Based on these evidences, and without being bound by theory,
Applicants reasoned that ATM could recruit the EYA phosphatase to
erase the pY37-H2B marks. Overall, these data indicates that EYA is
a potential epigenetic eraser of the pY37-H2B epigenetic marks in
response to damage induced by genotoxic agents such as IR.
[0367] In addition, this data indicated that a second tyrosine
phosphatase, CDC14, may be operational to erase pY37-H2B marks,
specifically in late S-phase of cell cycle. This data indicates
that WEE1-interacting CDC14 phosphatase erase pY37-H2B epigenetic
marks prior to entry in G2/M phase.
[0368] Summary:
[0369] While signaling mechanisms and cytosolic effectors of most
tyrosine kinases have been well-studied, the chromatin tyrosine
phosphorylation field is still in its infancy. Applicants
identified a previously undocumented histone phosphorylation event,
pY37-H2B. But, how this epigenetic mark exerts its regulatory
function was not understood. Applicants has delineated for the
first time the precise mechanistic details of pY37-H2B recognition
by a novel epigenetic reader, HIRA.
[0370] Every cell duplicates its chromatin precisely to prevent
mitotic catastrophe, however, the players orchestrating chromatin
replication with cell cycle progression are not well understood.
Applicants uncovered the mechanistic details of pY37-H2B deposition
at the end of S phase to co-ordinate termination of chromatin
synthesis before mitosis.
[0371] This data indicates that just as the pY37-H2B deposition is
precisely regulated, its removal too is strictly controlled.
[0372] Applicants discovered that the WEE1/pY37-H2B signaling
epigenetically suppresses IDH2 transcription, preventing the
formation of 5-hmC. Strikingly, WEE1 inhibition by MK-1775 or
AZT-1775 leads to increased 5-hmC levels. To the best of
Applicants' knowledge, this is the first report of a reversal of
`loss of 5-hmC` in cancer cells by WEE1 inhibitor.
[0373] Applicants have uncovered a novel epigenetic signaling axis,
WEE1/pY37-H2B/IDH2/5-hmC that is operational in a subset of GBM
patients (.about.26% of GBM patients). Significantly, it also
revealed a telltale signature for WEE1 inhibitor sensitivity.
However, screening of GBM patients for the activation of WEE1
epigenetic signaling to facilitate personalized treatment with WEE1
inhibitor is an unmet clinical need. The results from this study
could lead to the development of first of its kind `companion
diagnostic test` for WEE1 inhibitor, MK-1775 (AstraZeneca), for GBM
patients. Significantly, this test can also be used for melanoma
patients, which exhibit significant upregulation of WEE1
activity.
[0374] While signaling mechanisms and cytosolic effectors of most
tyrosine kinases have been well-studied, the chromatin tyrosine
phosphorylation field is still in its infancy. Applicants have
identified a previously undocumented histone phosphorylation event,
pY37-H2B orchestrated by WEE1 tyrosine kinase (Mahajan, K. et al.
(2012) Nat. Struct. Mol. Biol., 19(9):930-937; Mahajan, K. et al.
(2013) Trends Genet., 29(7):394-402). Recent reports demonstrate
recurrent aberrant expression of WEE1 in highly aggressive tumors
such as melanomas and GBMs (Mir, S. E. et al. (2010) Cancer Cell,
18(3):244-257; Wuchty, S. et al. (2011) PloS One, 6(2):e14681;
Magnussen, G. I. et al. (2012) PloS One, 7(6):e38254; Aarts, M. et
al. (2012) Cancer Discov., 2(6):524-539; Iorns, E. et al. (2009)
PloS One, 4(4):e5120), highlighting its underappreciated role in
cancer pathogenesis. Applicants have examined the ability of WEE1
to alter the epigenetic landscape. However, the molecular mechanism
by which the nuclear WEE1/pY37-H2B epigenetic signaling alters the
cancer epigenome to favor proliferation remains unexplored. This
data established operational status of the WEE1/pY37-H2B/IDH2
signaling nexus in melanoma, GBMs and prostate cancer.
[0375] The contents of the articles, patents, and patent
applications, and all other documents and electronically available
information mentioned or cited herein, are hereby incorporated by
reference in their entirety to the same extent as if each
individual publication was specifically and individually indicated
to be incorporated by reference.
[0376] Applicants reserve the right to physically incorporate into
this application any and all materials and information from any
such articles, patents, patent applications, or other physical and
electronic documents.
[0377] The disclosures illustratively described herein may suitably
be practiced in the absence of any element or elements, limitation
or limitations, not specifically disclosed herein. Thus, for
example, the terms "comprising", "including," containing", etc.
shall be read expansively and without limitation. Additionally, the
terms and expressions employed herein have been used as terms of
description and not of limitation, and there is no intention in the
use of such terms and expressions of excluding any equivalents of
the features shown and described or portions thereof, but it is
recognized that various modifications are possible within the scope
of the claims. Thus, it should be understood that although the
present disclosure has been specifically disclosed by preferred
embodiments and optional features, modification and variation of
the disclosures embodied therein herein disclosed may be resorted
to by those skilled in the art, and that such modifications and
variations are considered to be within the scope of this
disclosure.
[0378] The disclosure has been described broadly and generically
herein. Each of the narrower species and subgeneric groupings
falling within the generic disclosure also form part of the
disclosure. This includes the generic description of the disclosure
with a proviso or negative limitation removing any subject matter
from the genus, regardless of whether or not the excised material
is specifically recited herein. Other embodiments are within the
following claims. In addition, where features or aspects of the
disclosure are described in terms of Markush groups, those skilled
in the art will recognize that the disclosure is also thereby
described in terms of any individual member or subgroup of members
of the Markush group.
Sequence CWU 1
1
8119PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(3)..(3)Phospho-Tyr 1Glu Ser Tyr
Ser Val Tyr Val Tyr Lys 1 5 216PRTHomo sapiens 2Lys Arg Ser Arg Lys
Glu Ser Tyr Ser Val Tyr Val Tyr Lys Val Leu 1 5 10 15 316PRTBos
taurus 3Lys Arg Ser Arg Lys Glu Ser Tyr Ser Ile Tyr Val Tyr Lys Val
Leu 1 5 10 15 416PRTXenopus laevis 4Arg Lys Ser Arg Lys Glu Ser Tyr
Ala Ile Tyr Val Tyr Lys Val Leu 1 5 10 15 516PRTDanio rerio 5Lys
Arg Thr Arg Lys Glu Ser Tyr Ala Ile Tyr Val Tyr Lys Val Leu 1 5 10
15 616PRTAedes aegypti 6Lys Gln Arg Arg Lys Glu Ser Tyr Ala Ile Tyr
Ile Tyr Lys Val Leu 1 5 10 15 716PRTDrosophila melanogaster 7Lys
Arg Lys Arg Lys Glu Ser Tyr Ala Ile Tyr Ile Tyr Lys Val Leu 1 5 10
15 816PRTBombyx mori 8Lys His Lys Arg Lys Glu Ser Tyr Ala Ile Tyr
Ile Tyr Lys Val Leu 1 5 10 15 916PRTCaenorhabditis elegans 9Lys His
Ala Arg Lys Glu Ser Tyr Ser Val Tyr Ile Tyr Arg Val Leu 1 5 10 15
1016PRTSaccharomyces cerevisiae 10Ser Lys Val Arg Lys Glu Thr Tyr
Ser Ser Tyr Ile Tyr Lys Val Leu 1 5 10 15 1118PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"source/note="N-term
acetylated"MOD_RES(8)..(8)Phospho-TyrMOD_RES(17)..(17)Ahxsource/note="C-t-
erm amidated" 11Lys Arg Ser Arg Lys Glu Ser Tyr Ser Val Tyr Val Tyr
Lys Val Leu 1 5 10 15 Xaa Cys 1218PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"source/note="N-term
acetylated"MOD_RES(17)..(17)Ahxsource/note="C-term amidated" 12Lys
Arg Ser Arg Lys Glu Ser Tyr Ser Val Tyr Val Tyr Lys Val Leu 1 5 10
15 Xaa Cys 1330DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 13atcccctcta ttaatcacat
ggaacctgat 301430DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 14cactggcaaa agagcttctt
gtacataaag 301530DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 15caaagccagg acttgaccct
atgggacaca 301630DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 16tagtgttaga aagagttgag
catcctatcc 301730DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 17ctgggtgact ttctttaaaa
gagcactctt 301830DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 18gcaacgtaaa aacagaattc
taggccttta 301923DNAArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic primer" 19cattgctgac aggatgcaga agg
232022DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 20tgctggaagg tggacagtga gg
222122DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 21gcgacaacaa gaagacgcgc at
222221DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 22ctggatgttg ggcaggacgc c
212322DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 23aagaaggacg gcaagaagcg ca
222422DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 24cgctcgaaga tgtcgttcac ga
222521DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 25ctgatccgca agctgccgtt c
212622DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 26gttggtgtcc tcaaacagac cc
222722DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 27gaaggatggc aagaagcgca ag
222822DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 28cgctcgaaga tgtcgttcac ga
222922DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 29aacatccagg gcatcaccaa gc
223022DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 30gttctccagg aacaccttca gc
223122DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 31aagaaggacg gcaagaagcg ca
223222DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 32cgctcgaaga tgtcgttcac ga
223324DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 33gaaaagatct ggcatcatac cttc
243420DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 34aaaacggctt ggatggaaac
203525DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 35ggtaagaaga gaagcaaggc tagaa
253622DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 36gacttcttgt tatacgcagc ca
223720DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 37tgtcttggaa tatttggccg
203820DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 38tggatgtttg gcaaaacacc
203925DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 39gtcgatggta agaagagatc taagg
254023DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 40gtggatttct tgttataagc ggc
234123DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 41gctgtcttag aatatttggc tgc
234221DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 42ggcaacaagt tttggtgaat g
214325DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 43gctttgagag aaatcagaag attcc
254422DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 44gcagccaagt tggtatcttc aa
224525DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 45ctgttgcctt gagagaaatt agaag
254624DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 46gcagccagat tagtgtcttc aaac
244724DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 47taaaggtcta ggaaaaggtg gtgc
244824DNAArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic primer" 48taacagagtc cctgatgacg gatt
244925PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide" 49Asp Gly Lys Lys Arg Lys Arg Ser Arg
Lys Glu Ser Tyr Ser Val Tyr 1 5 10 15 Val Tyr Lys Val Leu Lys Gln
Val His 20 25 5025PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide"MOD_RES(13)..(13)Phospho-Tyr
50Asp Gly Lys Lys Arg Lys Arg Ser Arg Lys Glu Ser Tyr Ser Val Tyr 1
5 10 15 Val Tyr Lys Val Leu Lys Gln Val His 20 25 5111PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 51Lys Glu Ser Tyr Ser Val Tyr Val Tyr Lys Val 1 5 10
5212PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide" 52Arg Lys Glu Ser Tyr Ser Val Tyr Val
Tyr Lys Val 1 5 10 5312PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 53Arg Lys Glu Ser Tyr Ser Val Tyr Val Tyr Lys Val 1 5 10
5411PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(4)..(4)Phospho-Tyr 54Lys Glu Ser
Tyr Ser Val Tyr Val Tyr Lys Val 1 5 10 5532PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
polypeptide"misc_feature(16)..(16)May be phosphorylated 55Phe Gln
Ser Ser Ala Val Met Ala Leu Gln Glu Ala Cys Glu Ala Tyr 1 5 10 15
Leu Val Gly Leu Phe Glu Asp Thr Asn Leu Cys Ala Ile His Ala Lys 20
25 30 5610PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide"misc_feature(6)..(6)May be
phosphorylated 56Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg 1 5 10
5716PRTHomo sapiens 57Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr
Arg Gly Val Leu Lys 1 5 10 15 5816PRTSaccharomyces cerevisiae 58Lys
Arg Ile Ser Gly Leu Ile Tyr Glu Glu Val Arg Ala Val Leu Lys 1 5 10
15 5912PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide" 59Ser Arg Lys Glu Ser Tyr Ser Val Tyr
Val Tyr Lys 1 5 10 6012PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(6)..(6)Phospho-Tyr 60Ser Arg Lys Glu Ser Tyr Ser
Val Tyr Val Tyr Lys 1 5 10 6112PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 61Ser Arg Lys Glu Ser Phe Ser Val Tyr Val Tyr Lys 1 5 10
6216PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide" 62Lys Arg Ser Arg Lys Glu Ser Tyr Ser
Val Tyr Val Tyr Lys Val Leu 1 5 10 15 6316PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(8)..(8)Phospho-Tyr 63Lys Arg Ser Arg Lys Glu Ser
Tyr Ser Val Tyr Val Tyr Lys Val Leu 1 5 10 15 6417PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 64Thr Val Thr Ala Met Asp Val Val Tyr Ala Leu Lys Arg Gln
Gly Arg 1 5 10 15 Thr 6517PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(9)..(9)Phospho-Tyr 65Thr Val Thr Ala Met Asp Val
Val Tyr Ala Leu Lys Arg Gln Gly Arg 1 5 10 15 Thr 6615PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 66Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val
Leu 1 5 10 15 6715PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide"MOD_RES(8)..(8)Phospho-Tyr
67Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val Leu 1 5
10 15 6816PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 68Ala Leu Gln Glu Ala Cys
Glu Ala Tyr Leu Val Gly Leu Phe Glu Asp 1 5 10 15 6916PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(9)..(9)Phospho-Tyr 69Ala Leu Gln Glu Ala Cys Glu
Ala Tyr Leu Val Gly Leu Phe Glu Asp 1 5 10 15 7016PRTMus musculus
70Lys Arg Ser Arg Lys Glu Ser Tyr Ser Ile Tyr Val Tyr Lys Val Leu 1
5 10 15 7116PRTRattus norvegicus 71Lys Arg Ser Arg Lys Glu Ser Tyr
Ser Val Tyr Val Tyr Lys Val Leu 1 5 10 15 7216PRTBos taurus 72Lys
Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val Leu Lys 1 5 10
15 7316PRTMus musculus 73Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu
Thr Arg Gly Val Leu Lys 1 5 10 15 7416PRTRattus norvegicus 74Lys
Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val Leu Lys 1 5 10
15 7516PRTXenopus laevis 75Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu
Thr Arg Gly Val Leu Lys 1 5 10 15 7616PRTDanio rerio 76Lys Arg Ile
Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val Leu Lys 1 5 10 15
7716PRTAedes aegypti 77Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr
Arg Gly Val Leu Lys 1 5 10 15 7816PRTDrosophila melanogaster 78Lys
Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val Leu Lys 1 5 10
15 7916PRTBombyx mori 79Lys Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr
Arg Gly Val Leu Lys 1 5 10 15 8016PRTCaenorhabditis elegans 80Lys
Arg Ile Ser Gly Leu Ile Tyr Glu Glu Thr Arg Gly Val Leu Lys 1 5 10
15 8115PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"misc_feature(11)..(11)May be
phosphorylated 81Arg Lys Thr Val Thr Ala Met Asp Val Val Tyr Ala
Leu Lys Arg 1 5 10 15
* * * * *