U.S. patent application number 15/611008 was filed with the patent office on 2017-09-28 for antibodies that bind il-23.
The applicant listed for this patent is Eli Lilly and Company. Invention is credited to Catherine Brautigam Beidler, Stuart Willis Bright, Daniel Scott Girard, Kristine Kay Kikly.
Application Number | 20170275356 15/611008 |
Document ID | / |
Family ID | 51488096 |
Filed Date | 2017-09-28 |
United States Patent
Application |
20170275356 |
Kind Code |
A1 |
Beidler; Catherine Brautigam ;
et al. |
September 28, 2017 |
ANTIBODIES THAT BIND IL-23
Abstract
The present invention provides an antibody that binds to the p19
subunit of human IL-23 and is characterized as having high
affinity, selective, and neutralizing properties. The antibody is
useful in the treatment or prevention of an autoimmune or
inflammatory condition selected from the group consisting of
consisting of multiple sclerosis, rheumatoid arthritis, psoriasis,
inflammatory bowel diseases, ankylosing spondylitis,
graft-versus-host disease, lupus and metabolic syndrome. The
antibody is also useful in the treatment of cancer.
Inventors: |
Beidler; Catherine Brautigam;
(Poway, CA) ; Bright; Stuart Willis; (Carmel,
IN) ; Girard; Daniel Scott; (San Diego, CA) ;
Kikly; Kristine Kay; (Spiceland, IN) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Eli Lilly and Company |
Indianapolis |
IN |
US |
|
|
Family ID: |
51488096 |
Appl. No.: |
15/611008 |
Filed: |
June 1, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14702124 |
May 1, 2015 |
9688753 |
|
|
15611008 |
|
|
|
|
14195889 |
Mar 4, 2014 |
9023358 |
|
|
14702124 |
|
|
|
|
61774732 |
Mar 8, 2013 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 37/00 20180101;
A61P 35/00 20180101; C07K 2317/33 20130101; C07K 2317/76 20130101;
A61K 2039/505 20130101; A61P 17/06 20180101; A61P 1/04 20180101;
A61P 37/06 20180101; C07K 2317/92 20130101; C07K 2317/56 20130101;
A61P 29/00 20180101; C07K 2317/94 20130101; A61P 25/00 20180101;
C07K 2317/34 20130101; A61P 17/00 20180101; C07K 16/244 20130101;
A61P 3/00 20180101; A61P 19/02 20180101 |
International
Class: |
C07K 16/24 20060101
C07K016/24 |
Claims
1. An antibody that binds to the p19 subunit of human IL-23
comprising a light chain and a heavy chain, wherein the light chain
comprises a light chain variable region (LCVR) and the heavy chain
comprises a heavy chain variable region (HCVR), wherein the LCVR
comprises complementarity determining regions LCDR1, LCDR2, and
LCDR3, and the HCVR comprises complementarity determining regions
HCDR1, HCDR2, and HCDR3, wherein LCDR1 consists of amino acid
sequence SEQ ID NO:4, LCDR2 consists of amino acid sequence SEQ ID
NO:5, LCDR3 consists of amino acid sequence SEQ ID NO:6, HCDR1
consists of amino acid sequence SEQ ID NO:1, HCDR2 consists of
amino acid sequence SEQ ID NO:2, and HCDR3 consists of amino acid
sequence SEQ ID NO:3.
2. An antibody that binds to the p19 subunit of human IL-23
comprising a light chain and a heavy chain, wherein the light chain
comprises a light chain variable region (LCVR) and the heavy chain
comprises a heavy chain variable region (HCVR), wherein the LCVR
comprises amino acid sequence SEQ ID NO: 8 and the HCVR comprises
amino acid sequence SEQ ID NO: 7.
3. An antibody that binds to the p19 subunit of human IL-23
comprising a light chain and a heavy chain, wherein the light chain
comprises amino acid sequence SEQ ID NO: 10 and the heavy chain
comprises amino acid sequence SEQ ID NO: 9.
4. An antibody that binds to the p19 subunit of human IL-23
comprising two light chains and two heavy chains, wherein each
light chain comprises amino acid sequence SEQ ID NO: 10 and each
heavy chain comprises SEQ ID NO: 9.
5. A DNA molecule comprising a polynucleotide sequence encoding a
light chain polypeptide having the amino acid sequence SEQ ID NO:
10.
6. A DNA molecule comprising a polynucleotide sequence encoding a
heavy chain polypeptide having the amino acid sequence SEQ ID NO:
9.
7. A recombinant host cell comprising the DNA molecule of claim 5
and the DNA molecule of claim 6, which cell is capable of
expressing an antibody comprising a heavy chain and a light chain,
wherein the amino acid sequence of the heavy chain is SEQ ID NO: 9
and the amino acid sequence of the light chain is SEQ ID NO:
10.
8. A process for producing an antibody that binds to the p19
subunit of human IL-23 comprising a heavy chain and a light chain,
wherein the heavy chain comprises amino acid sequence SEQ ID NO: 9
and the light chain comprises the amino acid sequence of SEQ ID NO:
10, said process comprising the steps of: a) cultivating a
recombinant host cell of claim 7, under conditions such that said
antibody is expressed; and b) recovering from said host cell the
expressed antibody.
9. An antibody produced by the process of claim 8.
10. A pharmaceutical composition comprising an antibody of claim 4
and one or more pharmaceutically acceptable carriers, diluents or
excipients.
11. A pharmaceutical composition comprising an antibody of claim 9
and one or more pharmaceutically acceptable carriers, diluents or
excipients.
12. A method of treating or preventing an autoimmune or
inflammatory condition in a patient, comprising administering to a
patient in need thereof an effective amount of an antibody of claim
4, wherein the condition is selected from the group consisting of
multiple sclerosis, rheumatoid arthritis, psoriasis, inflammatory
bowel diseases, ankylosing spondylitis, graft-versus-host disease,
lupus and metabolic syndrome.
13. A method of treating or preventing an autoimmune or
inflammatory condition in a patient, comprising administering to a
patient in need thereof an effective amount of an antibody of claim
9, wherein the condition is selected from the group consisting of
multiple sclerosis, rheumatoid arthritis, psoriasis, inflammatory
bowel diseases, ankylosing spondylitis, graft-versus-host disease,
lupus and metabolic syndrome.
14. A method of treating or preventing cancer in a patient,
comprising administering to a patient in need thereof an effective
amount of an antibody of claim 4, wherein the cancer is melanoma,
colon, ovarian, head and neck, lung, breast, or stomach cancer.
15. A method of treating or preventing cancer in a patient,
comprising administering to a patient in need thereof an effective
amount of an antibody of claim 9, wherein the cancer is melanoma,
colon, ovarian, head and neck, lung, breast, or stomach cancer.
Description
[0001] The present invention relates to antibodies that bind human
interleukin-23 (IL-23) and uses thereof.
[0002] Interleukin-23 (IL-23) is a disulfide linked heterodimeric
cytokine composed of a p19 and p40 subunit. It is part of the
interleukin-12 (IL-12) family of cytokines. IL-12 is a
heterodimeric cytokine of 70 kDa consisting of covalently linked
p40 and p35 subunits. IL-12 plays a critical role in the
development of protective innate and adaptive immune responses and
in tumour surveillance. IL-12 has also been implicated in the
inflammatory response through its capacity to promote T helper type
1 (Th1) responses. However, the functional role of IL-12 in the
inflammatory response has been re-evaluated with the discovery of
the related cytokine, IL-23. IL-23 is composed of the same p40
subunit as IL-12 but is covalently paired with a p19 subunit. Many
of the reagents used to assess the role of IL-12 are directed
against the shared IL-12/IL-23 p40 subunit, meaning that the
activities previously ascribed to IL-12 may have been mediated via
IL-23. The development of IL-23 deficient mice enabled
investigators to distinguish between the activities of IL-12 and
IL-23 and identified IL-23 as an essential mediator of the
autoimmune/inflammatory response.
[0003] The functional IL-23 receptor is a heterodimer of the
IL-12R.beta.1 subunit, which is shared with the IL-12 receptor, and
an IL-23R subunit. The receptor for IL-23 is constitutively
associated with Janus kinase 2 (Jak2) and predominantly activates
STAT3, with less STAT4 activation than IL-12.
[0004] The IL-23 receptor is expressed on activated/memory T-cells
and natural killer (NK) cells. Monocytes, macrophages and dendritic
cells also express IL-23 receptor at low levels. IL-23 supports the
differentiation and maintenance of naive CD4+ T-cells into a novel
subset of cells called Th17 cells, which are distinct from the
classical Th1 and Th2 cells. Th17 cells produce interleukin-17A
(IL-17A) and interleukin-17F (IL-17F). Th17 cells produce a range
of other factors known to drive inflammatory responses, including
tumor necrosis factors known to drive inflammatory responses,
including tumor necrosis factor alpha (TNF-.alpha.), interleukin-6
(IL-6), granulocyte-macrophage colony-stimulating factor (GM-CSF),
CXCL1 and CCL20. NK cells and innate lymphoid cells such as
lymphoid tissue induce (LTi)-like cells express IL-23 receptor and
retinoic-acid-related orphan receptor (ROR) gamma and produce IL-17
in response to IL-23. IL-1.beta. and IL-23 also co-stimulate
gamma-delta T cells to induce IL-17 production without T cell
receptor engagement.
[0005] There is substantial evidence that IL-23 responsive cells
are associated with autoimmune inflammatory diseases and cancer. In
particular, an IL-23 specific inhibitor (i.e. an inhibitor that
inhibits IL-23 but not IL-12) would be particularly useful as
inhibiting IL-23 without affecting IL-12 is hypothesized to
maximize therapeutic benefit while minimizing the risk of
suppression of host defenses.
[0006] Antibodies that specifically bind to the p19 subunit of
IL-23 are potentially useful inhibitors, see, for example, WO
2007/024846 and WO 2007/027714. A problem with the antibodies
disclosed in WO 2007/024846, at least, is the potential for tissue
cross-reactivity, in particular, the potential to bind retinal
tissue, which is a safety concern. Furthermore, the antibodies
disclosed in WO 2007/024846, at least, have sub-optimal
physical-chemical properties, for example, extreme hydrophobicity
leading to aggregation, that present a significant barrier to
production of the antibodies on an industrial scale. Additionally,
no antibody targeting the p19 subunit of IL-23 has been approved
for therapeutic use.
[0007] Thus, there remains a need for IL-23 antibodies. In
particular, there remains a need for IL-23 antibodies that bind
with high affinity to the p19 subunit of IL-23, in particular,
human IL-23, and do not bind to the p40 subunit of the related
cytokine family member, IL-12. More particularly, there remains a
need for IL-23 antibodies that bind with high affinity to the p19
subunit of IL-23 and do not observably exhibit tissue
cross-reactivity, in particular, retinal tissue cross-reactivity.
There is also a need for IL-23 antibodies that possess
pharmaceutically acceptable physical-chemical properties that
facilitate development, manufacturing or formulation.
[0008] The present invention provides an antibody that binds to the
p19 subunit of human IL-23 comprising a light chain and a heavy
chain, wherein the light chain comprises a light chain variable
region (LCVR) and the heavy chain comprises a heavy chain variable
region (HCVR), wherein the LCVR comprises amino acid sequences
LCDR1, LCDR2, and LCDR3, and the HCVR comprises amino acid
sequences HCDR1, HCDR2, and HCDR3, wherein LCDR1 is SEQ ID NO:4,
LCDR2 is SEQ ID NO:5, LCDR3 is SEQ ID NO:6, HCDR1 is SEQ ID NO:1,
HCDR2 is SEQ ID NO:2, and HCDR3 is SEQ ID NO:3.
[0009] In an embodiment of the present invention, the antibody
comprises a light chain and a heavy chain, wherein the light chain
comprises a light chain variable region (LCVR) and the heavy chain
comprises a heavy chain variable region (HCVR), wherein the amino
acid sequence of the LCVR is SEQ ID NO: 8 and the amino acid
sequence of the HCVR is SEQ ID NO: 7.
[0010] In a further embodiment of the present invention, the
antibody comprises two light chain variable regions (LCVRs) and two
heavy chain variable regions (HCVRs), wherein the amino acid
sequence of each LCVR is SEQ ID NO: 8 and the amino acid sequence
of each HCVR is SEQ ID NO: 7.
[0011] In a still further embodiment of the present invention, the
antibody comprises a light chain and a heavy chain, wherein the
amino acid sequence of the light chain is SEQ ID NO: 10 and the
amino acid sequence of the heavy chain is SEQ ID NO: 9.
[0012] In a still further embodiment of the present invention, the
antibody comprises two light chains and two heavy chains, wherein
the amino acid sequence of each light chain is SEQ ID NO: 10 and
the amino acid sequence of each heavy chain is SEQ ID NO: 9.
[0013] The present invention provides an antibody that binds to the
p19 subunit of human IL-23 comprising a light chain and a heavy
chain wherein the light chain comprises a light chain variable
region (LCVR) and the heavy chain comprises a heavy chain variable
region (HCVR), wherein the LCVR comprises complementarity
determining regions LCDR1, LCDR2, and LCDR3, and the HCVR comprises
complementarity determining regions HCDR1, HCDR2, and HCDR3, and
wherein LCDR1 consists of amino acid sequence SEQ ID NO:4, LCDR2
consists of amino acid sequence SEQ ID NO:5, LCDR3 consists of
amino acid sequence SEQ ID NO:6, HCDR1 consists of amino acid
sequence SEQ ID NO:1, HCDR2 consists of amino acid sequence SEQ ID
NO:2, and HCDR3 consists of amino acid sequence SEQ ID NO:3.
[0014] The present invention also provides an antibody that binds
to the p19 subunit of human IL-23 comprising a light chain and a
heavy chain, wherein the light chain comprises a light chain
variable region (LCVR) and the heavy chain comprises a heavy chain
variable region (HCVR), wherein the LCVR chain comprises amino acid
sequence SEQ ID NO: 8 and the HCVR chain comprises amino acid
sequence SEQ ID NO: 7.
[0015] The present invention also provides an antibody that binds
to the p19 subunit of human IL-23 comprising a light chain and a
heavy chain, wherein the light chain comprises amino acid sequence
SEQ ID NO: 10 and the heavy chain comprises amino acid sequence SEQ
ID NO: 9.
[0016] The present invention also provides an antibody that binds
to the p19 subunit of human IL-23 comprising two light chains and
two heavy chains, wherein each light chain comprises amino acid
sequence SEQ ID NO: 10 and each heavy chain comprises amino acid
sequence SEQ ID NO: 9.
[0017] The amino acid sequences of the antibodies of the present
invention are provided below.
TABLE-US-00001 SEQ ID NOs Heavy Light Antibody Chain Chain HCVR
LCVR I 9 10 7 8 Antibody HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 I 1 2
3 4 5 6
[0018] The present invention also provides an antibody that binds
to the p19 subunit of human IL-23 at a conformational epitope
within amino acid positions 81-99 and 115-140 of SEQ ID NO: 15.
[0019] The present invention also provides an antibody that binds
to the p19 subunit of human IL-23 at a conformational epitope
within amino acid positions 81-99 and 115-140 of SEQ ID NO: 15,
wherein the antibody contacts at least amino acid residues 94P,
95S, 97L, 98P, 99D, 123W, 130S, 133P and 137W of SEQ ID NO: 15.
[0020] In a still further embodiment of the present invention, the
antibody is selective to the p19 subunit of human IL-23.
[0021] When bound to the p19 subunit of human IL-23, the antibody
of the present invention prevents binding of human IL-23 to the
IL-23 subunit of the IL-23 receptor. Accordingly, the antibody of
the present invention inhibits the activity of human IL-23 at the
human IL-23 subunit of the IL-23 receptor.
[0022] The antibody of the present invention does not prevent
binding of human IL-23 to the IL-12R.beta.1 subunit of the IL-23
receptor and, therefore, does not inhibit the activity of human
IL-23 at the IL-12R.beta.1 subunit of the IL-23 receptor.
[0023] The antibody does not detectably bind to the p40 subunit
shared by human IL-23 and human IL-12.
[0024] In a still further embodiment of the present invention, the
antibody the antibody has neutralizing activity to the p19 subunit
of human IL-23.
[0025] In a still further embodiment of the present invention, the
antibody of the present invention has an IC.sub.50 of less than or
equal to about 90 pM. Preferably, the antibody of the present
invention has an IC.sub.50 of less than or equal to about 74 pM.
The IC.sub.50 values are measured in an in vitro murine splenocyte
assay as described in the section entitled "In Vitro Neutralization
of Human or Cynomolgus Monkey IL-23 by Antibody I in Murine
Splenocytes" in Example 1.
[0026] In a still further embodiment of the present invention, the
antibody of the present invention is selective and has neutralizing
activity to the p19 subunit of human IL-23.
[0027] In a still further embodiment of the present invention, the
antibody of the present invention has a dissociation equilibrium
constant, K.sub.D, of about 10 pM to about 30 pM for human IL-23.
Preferably, the antibody of the present invention has a K.sub.D of
about 21 pM for human IL-23. The K.sub.D values are established by
binding kinetics at 37.degree. C. as described in the section
entitled "Affinity Binding Measurement by Surface Plasmon Resonance
(BIAcore for Antibody I" in Example 1. The antibody of the present
invention is further characterized with a k.sub.on rate to the p19
subunit of human IL-23 of from about 2.2.times.10.sup.6
M.sup.-1sec.sup.-1 to about 2.6.times.10.sup.6 M.sup.-1sec.sup.-1.
Preferably, the antibody of the present invention has a k.sub.on
rate to the p19 subunit of human IL-23 of about 2.43.times.10.sup.6
M.sup.-1sec.sup.-1. The antibody of the present invention is even
further characterized with a k.sub.off rate to the p19 subunit of
human IL-23 of from about 0.30.times.10.sup.-4 sec.sup.-1 to about
0.70.times.10.sup.-4 sec.sup.-1. Preferably, the antibody of the
present invention has a k.sub.off rate to the p19 subunit of human
IL-23 of about 0.52.times.10.sup.-4 sec.sup.-1.
[0028] The antibody of the present invention binds to the p19
subunit of human IL-23 with high affinity. For the purposes of the
present disclosure, the term "high affinity" refers to a K.sub.D of
at least about 21 pM. The K.sub.D values are established by binding
kinetics at 37.degree. C. as described in the section entitled
"Affinity Binding Measurement by Surface Plasmon Resonance (BIAcore
for Antibody I" in Example 1.
[0029] Unlike certain prior art antibodies that bind to human
IL-23, the antibody of the present invention does not observably
exhibit tissue cross-reactivity. In particular, the antibody of the
present invention does not observably bind to retinal tissue.
[0030] The antibody of the present invention possesses
pharmaceutically acceptable physical-chemical properties, including
pharmaceutically acceptable solubility in physiological and
laboratory conditions, and pharmaceutically acceptable chemical and
physical stability wherein the antibody remains in a monomeric form
and very little high molecular weight (HMW) aggregates are observed
under a range of conditions as described in the section entitled
"Physical-Chemical Properties of IL-23 Antibody" in Example 1.
[0031] The present invention further provides pharmaceutical
compositions comprising an antibody of the present invention and
one or more pharmaceutically acceptable carriers, diluents or
excipients. More particularly, the pharmaceutical compositions of
the present invention further comprise one or more additional
therapeutic agents.
[0032] The present invention also provides a method of treating or
preventing a condition in a patient, comprising administering to a
patient in need thereof an effective amount of an antibody of the
present invention, wherein the condition is an autoimmune or
inflammatory condition selected from the group consisting of
multiple sclerosis, rheumatoid arthritis, psoriasis, inflammatory
bowel diseases, ankylosing spondylitis, graft-versus-host disease,
lupus and metabolic syndrome.
[0033] The present invention also provides a method of treating or
preventing a condition in a patient, comprising administering to a
patient in need thereof an effective amount of an antibody of the
present invention, wherein the condition is cancer.
[0034] In an embodiment of the present invention, the cancer is
melanoma, colon, ovarian, head and neck, lung, breast, or stomach
cancer.
[0035] The present invention also provides the antibody of the
present invention for use in therapy.
[0036] More particularly, the present invention provides the
antibody of the present invention for use in the treatment or
prevention of an autoimmune or inflammatory condition selected from
the group consisting of multiple sclerosis, rheumatoid arthritis,
psoriasis, inflammatory bowel diseases, ankylosing spondylitis,
graft-versus-host disease, lupus and metabolic syndrome.
[0037] The present invention also provides the antibody of the
present invention for use in the treatment or prevention of
cancer.
[0038] In an embodiment of the present invention, the cancer is
melanoma, colon, ovarian, head and neck, lung, breast, or stomach
cancer. The present invention provides the use of an antibody of
the present invention in the manufacture of a medicament for the
treatment or prevention of a condition selected from the group
consisting of multiple sclerosis, rheumatoid arthritis, psoriasis,
inflammatory bowel diseases, ankylosing spondylitis,
graft-versus-host disease, lupus and metabolic syndrome.
[0039] The present invention also provides the use of an antibody
of the present invention in the manufacture of a medicament for the
treatment or prevention of cancer.
[0040] In an embodiment of the present invention, the cancer is
melanoma, colon, ovarian, head and neck, lung, breast, or stomach
cancer.
[0041] The present invention also relates to polynucleotides
encoding the above-described antibody of the present invention.
[0042] The present invention provides a DNA molecule comprising a
polynucleotide sequence encoding a light chain polypeptide having
the amino acid sequence SEQ ID NO: 10.
[0043] The present invention also provides a DNA molecule
comprising a polynucleotide sequence encoding a heavy chain
polypeptide having the amino acid sequence SEQ ID NO: 9.
[0044] In one embodiment, the present invention provides a
polynucleotide encoding an antibody of the present invention,
wherein the HCVR is encoded by SEQ ID NO: 11 and the LCVR is
encoded by SEQ ID NO: 12.
[0045] In a further embodiment, the present invention provides a
polynucleotide encoding an antibody of the present invention,
wherein the heavy chain is encoded by SEQ ID NO: 13 and the light
chain is encoded by SEQ ID NO: 14.
[0046] The polynucleotides of the present invention may be in the
form of RNA or in the form of DNA, which DNA includes cDNA, and
synthetic DNA. The DNA may be double-stranded or single-stranded.
The coding sequences that encode the antibody of the present
invention may vary as a result of the redundancy or degeneracy of
the genetic code.
[0047] The polynucleotides that encode for the antibody of the
present invention may include the following: only the coding
sequence for the antibody, the coding sequence for the antibody and
an additional coding sequence such as a leader or secretory
sequence or a pro-protein sequence; the coding sequence for the
antibody and non-coding sequence, such as introns or non-coding
sequence 5' and/or 3' of the coding sequence for the protein. Thus
the term "polynucleotide encoding an antibody" encompasses a
polynucleotide that may include not only coding sequence for the
protein but also a polynucleotide that includes additional coding
and/or non-coding sequence.
[0048] The polynucleotides of the present invention will be
expressed in a host cell after the sequences have been operably
linked to an expression control sequence. The expression vectors
are typically replicable in the host organisms either as episomes
or as an integral part of the host chromosomal DNA. Commonly,
expression vectors will contain selection markers, e.g.,
tetracycline, neomycin, and dihydrofolate reductase, to permit
detection of those cells transformed with the desired DNA
sequences.
[0049] The present invention provides a recombinant host cell
comprising the DNA molecule of comprising a polynucleotide sequence
encoding a light chain polypeptide having the amino acid sequence
SEQ ID NO: 10 and the DNA molecule comprising a polynucleotide
sequence encoding a heavy chain polypeptide having the amino acid
sequence SEQ ID NO: 9, which cell is capable of expressing an
antibody comprising a heavy chain and a light chain, wherein the
amino acid sequence of the heavy chain is SEQ ID NO: 9 and the
amino acid sequence of the light chain is SEQ ID NO: 10.
[0050] The antibody of the present invention may readily be
produced in mammalian cells such as CHO, NS0, HEK293 or COS cells;
in bacterial cells such as E. coli, Bacillus subtilis, or
Pseudomonas fluorescence; or in fungal or yeast cells. The host
cells are cultured using techniques well known in the art.
[0051] The vectors containing the polynucleotide sequences of
interest (e.g., the polynucleotides encoding the polypeptides of
the antibody and expression control sequences) can be transferred
into the host cell by well-known methods, which vary depending on
the type of cellular host. For example, calcium chloride
transformation is commonly utilized for prokaryotic cells, whereas
calcium phosphate treatment or electroporation may be used for
other cellular hosts.
[0052] Various methods of protein purification may be employed and
such methods are known in the art and described, for example, in
Deutscher, Methods in Enzymology 182: 83-89 (1990) and Scopes,
Protein Purification: Principles and Practice, 3rd Edition,
Springer, NY (1994).
[0053] The present invention provides a process for producing an
antibody that binds to the p19 subunit of human IL-23 comprising a
heavy chain and a light chain, wherein the heavy chain comprises
amino acid sequence SEQ ID NO: 9 and light chain comprise amino
acid sequences SEQ ID NO: 10, said process comprising the steps of:
[0054] a) cultivating a recombinant host cell of claim 7 under
conditions such that said antibody is expressed; and [0055] b)
recovering from said host cell the expressed antibody.
[0056] Further, the present invention provides a process for
producing an antibody that binds to the p19 subunit of human IL-23
having a heavy chain and a light chain, wherein the amino acid
sequence of the heavy chain is SEQ ID NO: 9 and the amino acid
sequence of the light chain is SEQ ID NO: 10, said process
comprising the steps of: [0057] a) cultivating a recombinant host
cell comprising a first polynucleotide sequence encoding the
polypeptide sequence given by SEQ ID NO: 9 and a second
polynucleotide sequence encoding the polypeptide sequence given by
SEQ ID NO: 10, under conditions such that said polypeptide
sequences are expressed; and [0058] b) recovering from said host
cell an antibody comprising a heavy chain and a light chain,
wherein the polypeptide sequence of said heavy chain is given by
SEQ ID NO: 9 and the polypeptide sequence of said light chain is
given by SEQ ID NO: 10.
[0059] In one embodiment of the above-described process, the first
polynucleotide sequence encoding the polypeptide sequence given by
SEQ ID NO: 9 and the second polynucleotide sequence encoding the
polypeptide sequence given by SEQ ID NO: 10 are part of the same
nucleic acid molecule.
[0060] In an embodiment, the present invention provides an antibody
produced by the afore-mentioned process.
[0061] In a further embodiment, the antibody produced by the
afore-mentioned process has two heavy chains and two light chains,
wherein the polypeptide sequence of each heavy chain is given by
SEQ ID NO: 9 and the polypeptide sequence of each light chain is
given by SEQ ID NO: 10.
[0062] The antibody of the present invention is an IgG type
antibody and has four amino acid chains (two "heavy" chains and two
"light" chains) that are cross-linked via intra- and inter-chain
disulfide bonds. When expressed in certain biological systems,
antibodies having native human Fe sequences are glycosylated in the
Fc region. Antibodies may be glycosylated at other positions as
well.
[0063] Each heavy chain is comprised of an N-terminal HCVR and a
heavy chain constant region ("HCCR"). Human heavy chains are
classified as gamma, mu, alpha, delta, or epsilon, and define the
isotype of an antibody as IgG, IgM, IgA, IgD, or IgE, respectively.
Human IgG antibodies can be further divided into subclasses, e.g.,
IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4.
[0064] Preferably, the antibody of the present invention contains
an Fc portion which is derived from human IgG.sub.4 Fc region
because of a reduced ability to engage Fc receptor-mediated
inflammatory mechanisms or to activate complement resulting in
reduced effector function.
[0065] More preferably, the antibody of the present invention
contains an IgG.sub.4-PAA Fc portion. The IgG.sub.4-PAA Fe portion
has a serine to proline mutation at position 223 (S223P; SEQ ID NO:
9), a phenylalanine to alanine mutation at position 229 (F229A; SEQ
ID NO: 9) and a leucine to alanine mutation at position 230 (L230A;
SEQ ID NO: 9). The S223P mutation is a hinge mutation that prevents
half-antibody formation (phenomenon of dynamic exchange of
half-molecules in IgG.sub.4 antibodies). The F229A and L230A
mutations further reduce effector function of the already low human
IgG.sub.4 isotype.
[0066] Each heavy chain type is also characterized by a particular
constant region with a sequence well known in the art. The heavy
chain constant region is comprised of three domains (CH1, CH2, and
CH3) for IgG.
[0067] Light chains are classified as kappa or lambda, which are
each characterized by a particular constant region as known in the
art. Each light chain is comprised of a LCVR and a light chain
constant region ("LCCR"). Preferably, the antibody of the present
invention comprises a kappa light chain.
[0068] The variable regions of each light/heavy chain pair form the
antibody binding site. The HCVR and LCVR regions can be further
subdivided into regions of hyper-variability, termed
complementarity determining regions ("CDRs"), interspersed with
regions that are more conserved, termed framework regions ("FR").
Each HCVR and LCVR is composed of three CDRs and four FRs, arranged
from amino-terminus to carboxy-terminus in the following order:
FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Herein, the three CDRs of the
heavy chain are referred to as "HCDR1, HCDR2, and HCDR3" and the
three CDRs of the light chain are referred to as "LCDR1, LCDR2 and
LCDR3". The CDRs contain most of the residues which form specific
interactions with the antigen. There are currently three systems of
CDR assignments for antibodies that are used for sequence
delineation. The Kabat CDR definition (Kabat et al., "Sequences of
Proteins of Immunological Interest," National Institutes of Health,
Bethesda, Md. (1991)) is based upon antibody sequence variability.
The Chothia CDR definition (Chothia et al., "Canonical structures
for the hypervariable regions of immunoglobulins", Journal of
Molecular Biology, 196, 901-917 (1987); Al-Lazikani et al.,
"Standard conformations for the canonical structures of
immunoglobulins", Journal of Molecular Biology, 273, 927-948
(1997)) is based on three-dimensional structures of antibodies and
topologies of the CDR loops. The Chothia CDR definitions are
identical to the Kabat CDR definitions with the exception of HCDR1
and HCDR2. The North CDR definition (North et al., "A New
Clustering of Antibody CDR Loop Conformations", Journal of
Molecular Biology, 406, 228-256 (2011)) is based on affinity
propagation clustering with a large number of crystal
structures.
[0069] For the purposes of the present invention, a consensus of
the three methods is used to define CDRs. In the case of the light
chain CDRs, the Kabat and Chothia CDR definitions are used. In the
case of HCDR1, a hybrid of the Kabat and Chothia CDR definitions is
used. The Kabat definition of HCDR1 starts eight residues after the
first cysteine of the heavy chain and is five residues in length,
whereas the Chothia definition of HCDR1 starts three residues after
this cysteine and is seven residues in length. The HCDR1 of the
antibody of the present invention is defined by the Chothia
starting position and the Kabat end position. In the case of HCDR2,
the Kabat CDR definition is used. In the case of HCDR3, a hybrid of
the North, Kabat and Chothia CDR definitions is used. The Kabat
definition of HCDR3 comprises residues 95-102 of the heavy chain
(SEQ ID NO: 13 for the antibody of the present invention) and
typically starts three residues after a cysteine. The Chothia
definition of HCDR3 is the same as the Kabat definition. The North
definition of HCDR3 comprises residues 93-102 of the heavy chain
(SEQ ID NO: 13 for the antibody of the present invention) and
typically starts immediately after the cysteine residue. The HCDR3
of the antibody of the present invention is defined by the North
starting position and the Kabat/Chothia/North end position.
[0070] Table 1 shows exemplary CDR assignments of the antibody of
the present invention.
TABLE-US-00002 TABLE 1 CDR Assignments CDR Start Definition End
Definition LCDR1 Kabat/Chothia/North Kabat/Chothia/North LCDR2
Kabat/Chothia Kabat/Chothia/North LCDR3 Kabat/Chothia/North
Kabat/Chothia/North HCDR1 Chothia Kabat/North HCDR2 Kabat/North
Kabat HCDR3 North Kabat/Chothia/North
[0071] An antibody of the present invention is an engineered
antibody that has been designed to have frameworks, hinge regions,
and constant regions of human origin that are identical with or
substantially identical (substantially human) with frameworks and
constant regions derived from human genomic sequences. Fully human
frameworks, hinge regions, and constant regions are those human
germline sequences as well as sequences with naturally-occurring
somatic mutations and those with engineered mutations. An antibody
of the present invention may comprise framework, hinge, or constant
regions derived from a fully human framework, hinge, or constant
region containing one or more amino acid substitutions, deletions,
or additions therein. Further, an antibody of the present invention
is preferably substantially non-immunogenic in humans.
[0072] A variety of different human framework sequences may be used
singly or in combination as a basis for an antibody of the present
invention. Preferably, the framework regions of an antibody of the
present invention are of human origin or substantially human (at
least 95%, 97% or 99% of human origin.) The sequences of framework
regions of human origin may be obtained from The Immumunoglobulin
Factsbook, by Marie-Paule Lafranc, Gerard Lefranc, Academic Press
2001, ISBN 012441351.
[0073] The framework sequence for an antibody of the present
invention serves as the "donor" variable framework region and can
be used to create additional antibodies with the same CDRs
specified herein using methodology known in the art. Furthermore,
the framework sequence for an antibody of the present invention can
be compared to other known human framework sequences to generate
additional antibodies. Thus, this information can be used to
"back-mutate" another selected homologous human framework region to
the donor amino acid residue at these positions. Further, any
"rare" amino acids can be detected in additional human frameworks
such that the consensus or donor amino acid residue can be used at
the relevant position.
[0074] Methods for producing and purifying antibodies are well
known in the art and can be found, for example, in Harlow and Lane
(1988) Antibodies. A Laboratory Manual, Cold Spring Harbor
Laboratory Press. Cold Spring Harbor, N.Y., Chapters 5-8 and 15.
For example, mice can be immunized with human IL-23, or fragments
thereof, and the resulting antibodies can then be recovered,
purified and the amino acid sequences determined using conventional
methods well known in the art. The antibody of the present
invention is engineered to contain one or more human framework
regions surrounding CDRs derived from a non-human antibody. Human
framework germline sequences can be obtained from ImMunoGeneTics
(IMGT) via their website http://imgt.cines.fr, or from The
Immunoglobulin Facts Book by Marie-Paule Lefranc and Gerard
Lefranc, Academic Press, 2001, ISBN 012441351. Particular, germline
light chain frameworks for use in the antibody of the present
invention include 02.
[0075] Particular germline heavy chain framework regions for use in
the antibody of the present invention include VH1-69.
[0076] The engineered antibodies of the present invention may be
prepared and purified using known methods. For example, cDNA
sequences encoding a heavy chain (for example, the amino acid
sequence given by SEQ ID NO: 9) and a light chain (for example, the
amino acid sequence given by SEQ ID NO: 10) may be cloned and
engineered into a GS (glutamine synthetase) expression vector. The
engineered immunoglobulin expression vector may then be stably
transfected in CHO cells. Mammalian expression of antibodies will
result in glycosylation, typically at highly conserved
N-glycosylation sites in the Fc region. Stable clones may be
verified for expression of an antibody specifically binding to
human IL-23. Positive clones may be expanded into serum-free
culture medium for antibody production in bioreactors. Media, into
which an antibody has been secreted, may be purified by
conventional techniques. For example, the medium may be
conveniently applied to a Protein A or G Sepharose FF column that
has been equilibrated with a compatible buffer, such as phosphate
buffered saline. The column is washed to remove nonspecific binding
components. The bound antibody is eluted, for example, by pH
gradient and antibody fractions are detected, such as by SDS-PAGE,
and then pooled. The antibody may be concentrated and/or sterile
filtered using common techniques. Soluble aggregate and multimers
may be effectively removed by common techniques, including size
exclusion, hydrophobic interaction, ion exchange, or hydroxyapatite
chromatography. The product may be immediately frozen, for example
at -70.degree. C., or may be lyophilized.
[0077] The antibodies of the present invention are monoclonal
antibodies. "Monoclonal antibody" or "mAb", as used herein, refers
to an antibody that is derived from a single copy or clone
including, for example, any eukaryotic, prokaryotic, or phage
clone, and not the method by which it is produced. Monoclonal
antibodies thereof can be produced, for example, by hybridoma
technologies, recombinant technologies, phage display technologies,
synthetic technologies, e.g., CDR-grafting, or combinations of such
or other technologies known in the art.
[0078] In another embodiment of the present invention, the
antibody, or the nucleic acid encoding the same, is provided in
isolated form.
[0079] The antibody of the present invention, or pharmaceutical
compositions comprising the same, may be administered by parenteral
routes (e.g., subcutaneous, intravenous, intraperitoneal,
intramuscular, or transdermal).
[0080] Pharmaceutical compositions of the present invention can be
prepared by methods well known in the art (e.g., Remington: The
Science and Practice a/Pharmacy, 19.sup.th edition (1995), (A.
Gennaro et al., Mack Publishing Co.) and comprise an antibody as
disclosed herein, and one or more pharmaceutically acceptable
carriers, diluents, or excipients. For example, an antibody of the
present invention can be formulated with agents such as sodium
citrate, citric acid, polysorbate 80, sodium chloride and sucrose
and the resulting composition may then be lyophilized and stored at
2.degree. C.-8.degree. C. The lyophilized composition may then be
reconstituted with sterile water for injection prior to
administration.
[0081] The term "bind (or "binds") to the p19 subunit of human
IL-23", as used herein, refers to a detectable interaction of the
antibody of the present invention with an epitope on the p19
subunit of human IL-23 given by the amino acid sequence of SEQ ID
NO: 15. The interaction between the antibody of the present
invention and the p19 subunit of human IL-23 is measured by binding
kinetics at 37.degree. C. as described in the section entitled
"Affinity Binding Measurement by Surface Plasmon Resonance
(BIAcore) for Antibody I" in Example 1.
[0082] The term "epitope" as used herein refers to amino acid
residues that lie close together on the protein (antigen) surface
and interact with an antibody. There are two broad classes of
epitopes: linear epitopes and conformational epitopes.
[0083] The term "linear epitope" as used herein refers to a
continuous primary amino acid sequence of a particular region of a
protein.
[0084] The term "conformational epitope" as used herein refers to
discontinuous sections of the antigen's amino acid sequence that
are contacted by the antibody of the invention. Conformational
epitopes are defined by the structure as well as the sequence of
the native protein; these epitopes may be continuous or
discontinuous. Components of the epitope can be situated on
disparate parts of the protein, which are brought close to each
other in the folded native protein structure. In the context of the
present invention, the antibody of the present invention binds to a
conformational epitope within amino acid positions 81-99 and
115-140 of SEQ ID NO: 15, wherein the antibody contacts at least
amino acids residues 94P, 95S, 97L, 98P, 99D, 123W, 130S, 133P and
137W of SEQ ID NO: 15. The conformational epitope is not, however,
limited to these amino acid residues and may comprise additional
amino acid residues within amino acid positions 81-99 and 115-140
of SEQ ID NO: 15.
[0085] The term "does not observably bind retinal tissue", as used
herein, refers to the absence of a detectable interaction of the
antibody of the present invention with human and cynomolgus monkey
retinal tissue. The interaction between the antibody of the present
invention and the human and cynomolgus monkey retinal tissue is
assessed in an immunohistochemistry assay as described in the
section entitled "Retinal Tissue Cross-Reactivity: In Vitro
Analysis by Immunohistochemistry" in Example 1. The term
"observably" as used in the present context refers to a visual
assessment of the human and cynomolgus monkey retinal tissue to
determine if the antibody of the present invention binds to said
human and cynomolgus monkey retinal tissue.
[0086] The term "selective" as used herein in reference to an
antibody of the present invention refers to an antibody that binds
the p19 subunit of human IL-23 but does not bind to the p40 subunit
shared by human IL-23 and human IL-12.
[0087] The term "neutralizing" refers to "neutralizing antibody",
as used herein, is intended to refer to inhibition of the
biological activity of human IL-23. Measuring one or more
indicators of IL-23 biological activity as determined using either
the mouse splenocyte bioassay (see section entitled "In Vitro
Neutralization of Human or Cynomolgus Monkey IL-23 by Antibody I in
Murine Splenocytes in Example 1) or the human IL-23 neutralization
assay (see section entitled "Neutralization of Human IL-23: Acute,
Local" in Example 1) can assess this inhibition of the biological
activity of human IL-23.
[0088] The term "K.sub.D", as used herein, is intended to refer to
the dissociation constant of a particular antibody-antigen
interaction. It is calculated by the formula:
K.sub.off/K.sub.on=K.sub.D
[0089] The term "k.sub.on", as used herein, is intended to refer to
the association or on rate constant, or specific reaction rate, of
the forward, or complex-forming, reaction, measured in units:
M.sup.-1sec.sup.-1.
[0090] The term "k.sub.off", as used herein, is intended to refer
to the dissociation or off rate constant, or specific reaction
rate, for dissociation of an antibody from the antibody/antigen
complex, measured in units: sec.sup.-1.
[0091] The term "IC.sub.50", as used herein, is intended to refer
to the effective concentration of antibody of the present invention
needed to neutralize 50% of the bioactivity of IL-23 on mouse
splenocytes in the bioassay described in the section entitled "In
Vitro Neutralization of Human or Cynomolgus Monkey IL-23 by
Antibody I in Murine Splenocytes in Example 1.
[0092] The term "polynucleotide", as used herein, is intended to
include DNA molecules and RNA molecules. A nucleic acid molecule
may be single-stranded or double-stranded.
[0093] The term "isolated", as used herein, refers to a protein,
peptide or nucleic acid which is free or substantially free from
other macromolecular species found in a cellular environment.
[0094] The term "substantially free", as used herein, means the
protein, peptide or nucleic acid of interest comprises more than
80% (on a molar basis) of the macromolecular species present,
preferably more than 90% and more preferably more than 95%.
[0095] A "patient" is a mammal, preferably a human.
[0096] The term "treating" (or "treat" or "treatment") refers to
slowing, interrupting, arresting, alleviating, stopping, reducing,
or reversing the progression or severity of an existing symptom,
disorder, condition, or disease
[0097] The term "effective amount", as used herein, refers to the
amount or dose of an antibody of the present invention which, upon
single or multiple dose administration to the patient, provides the
desired effect in the patient under treatment. An effective amount
can be readily determined by the attending diagnostician, as one
skilled in the art. by considering a number of factors such as the
species of mammal; its size, age, and general health; the specific
disease involved; the degree or severity of the disease; the
response of the individual patient; the particular antibody
administered; the mode of administration; the bioavailability
characteristics of the preparation administered; the dose regimen
selected; and the use of any concomitant medications.
EXAMPLE
[0098] The following Example further illustrates the invention. It
is understood, however, that the Example is set forth by way of
illustration and not limitation, and that various modifications may
be made by one of ordinary skill in the art.
Example 1
Production of Antibodies
[0099] Antibody I of this example comprises two heavy chains and
two light chains, each heavy chain having the amino acid sequence
given by SEQ ID NO: 9 and each light chain having the amino acid
sequence given by SEQ ID NO: 10. Antibody I can be made and
purified as follows. An appropriate host cell, such as HEK 293 or
CHO, is either transiently or stably transfected with an expression
system for secreting antibodies using an optimal predetermined
HC:LC vector ratio or a single vector system encoding both heavy
chain (SEQ ID NO: 9) and light chain (SEQ ID NO: 10). Clarified
media, into which the antibody has been secreted, is purified using
any of many commonly-used techniques. For example, the medium may
be conveniently applied to a Protein A or G column that has been
equilibrated with a compatible buffer, such as phosphate buffered
saline (pH 7.4). The column is washed to remove nonspecific binding
components. The bound antibody is eluted, for example, by pH
gradient (such as 0.1 M sodium phosphate buffer pH 6.8 to 0.1 M
sodium citrate buffer pH 2.5). Antibody fractions are neutralized
(for example by adding 1/10.sup.th volume of 1M TRIS at pH 8.0),
detected, such as by SDS-PAGE, and then are pooled. Further
purification is optional, depending on the intended use. The
antibody may be concentrated and/or sterile filtered using common
techniques. Soluble aggregate and multimers may be effectively
removed by common techniques, including size exclusion, hydrophobic
interaction, ion exchange, or hydroxyapatite chromatography. The
purity of the antibody after these chromatography steps is greater
than 99%. The product may be immediately frozen at -70.degree. C.
or may be lyophilized.
Affinity Binding Measurement by Surface Plasmon Resonance
(BIAcore)
[0100] Antibody affinity (K.sub.D) to human, cynomolgus monkey or
rabbit IL-23 is determined using a BIAcore Biosensor 2000 and
BIAevaluation software with a 1:1 binding with mass transfer model.
A capture protein (Protein A, Calbiochem) is coupled via free amine
groups to carboxyl groups on flow cells 1 and 2 of a CM4 biosensor
chip using a mixture of
N-ethyl-N-(dimethylaminopropyl)-carbodiimide (EDC) and
N-hydroxysuccinimide (NHS). Flow cells are monitored with a flow
rate of 80 .mu.L/minute using a buffer containing 0.01 M HEPES, pH
7.4, 150 mM NaCl, 0.005% surfactant P20. Antibody I is captured on
flow cell 2 to yield a total of 40 to 60 response units (RU).
Multiple cycles of increasing concentrations of IL-23 are then
injected over flow cells 1 and 2 (0.62 nM to 30 nM for human and
monkey IL-23 and 30 nM to 240 nM for rabbit IL-23) followed by a
regeneration step using glycine-HCl (pH 1.5) between each cycle.
Flow cell 1 is used as a control to monitor non-specific binding of
IL-23 and the data reflects flow cell 2 minus flow cell 1. Each
cycle includes an antibody capture step followed by injection of
IL-23 at one concentration with a 30 minute dissociation period,
then regeneration. Two cycles where buffer is injected in place of
IL-23, serve as a control for baseline subtraction and correct for
drift associated with the dissociation of Antibody I from the
protein A surface. Affinity is measured at 37 .degree. C. The assay
is performed 2 times with human, monkey or rabbit IL-23. Antibody I
is tested 2 times each with mouse IL-23 at 333 nM, rat IL-23 at 200
nM, human IL-12 at 333 nM, human IL-27 at 500 nM or human IL-35 at
833 nM.
[0101] The on-rate (k.sub.on) and off-rate (k.sub.off) for each
antigen are evaluated using a 1:1 binding with mass transfer model.
The affinity (K.sub.D) is calculated from the binding kinetics
according to the relationship: K.sub.D=k.sub.off/k.sub.on.
TABLE-US-00003 TABLE 2 Binding Parameters for Antibody I On Rate
(k.sub.on) Off Rate (k.sub.off) Affinity (K.sub.D.sup.a) (Avg .+-.
SD) (Avg .+-. SD) (Avg .+-. SD) Antigen (M.sup.-1s.sup.-1)
(10.sup.6) (s.sup.-1) (10.sup.-4) (PM) Human No detectable No
detectable No detectable IL-12 binding binding binding Human 2.43
.+-. 0.16 0.52 .+-. 0.21 21 .+-. 9.9 IL-23 Human No detectable No
detectable No detectable IL-27 binding binding binding Human No
detectable No detectable No detectable IL-35 binding binding
binding Monkey 1.28 .+-. 0.05 0.7 .+-. 0.11 55 .+-. 6.4 IL-23
Rabbit 0.09 .+-. 0.001 47.9 .+-. 0.4 53,000 .+-. 1131 IL-23 Mouse
No detectable No detectable No detectable IL-23 binding binding
binding Rat No detectable No detectable No detectable IL-23 binding
binding binding .sup.aCalculated as K.sub.D = k.sub.off/k.sub.on n
= 2 for each antigen. IL-12 was tested at a 400x concentration of
what is detectable for IL-23. IL-27 and IL-35 were tested at an
800x concentration of what is detectable for IL-23. Mouse and rat
IL-23 were tested at 500x and 300x concentrations of what is
detectable for human IL-23.
[0102] Antibody I produces a concentration-dependent binding
response with human, cynomolgus monkey, and rabbit IL-23 using this
method. Saturation of binding of IL-23 is attained at a
concentration of 30 nM (human and monkey) and 240 nM (rabbit) using
80-100 response units of Antibody I captured on the chip surface.
Under the conditions tested, the binding affinity (K.sub.D) of
human, monkey, or rabbit IL-23 to Antibody I is 21, 55 or 53,000 pM
respectively (Table 1). Mouse IL-23, rat IL-23, human IL-12, human
IL-27 or human IL-35 do not bind to Antibody I under these
conditions.
In Vitro Inhibition of IL-23 Binding to IL-23 Receptor
[0103] Recombinant human IL-23R/Fc is coupled via free amine groups
to carboxyl groups on flow cell 2 of a CM4 biosensor chip using a
mixture of N-ethyl-N-(dimethylaminopropyl)-carbodiimide (EDC) and
N-hydroxysuccinimide (NHS). Recombinant human IgG.sub.1 Fc (R&D
Systems, Inc.) is coupled using the same method to flow cell 1 of
the same chip. Mouse anti-6X HIS antibody (R&D Systems, Inc.)
is coupled using the same method to flow cell 4 of the same chip.
Mouse anti-6X HIS is used to pre-capture human IL-12R.beta.1/Fc
(R&D Systems, Inc.) which contains a HIS tag. Flow cells are
monitored with a flow rate of 30 .mu.L/minute using a buffer
containing 0.01 M HEPES, pH 7.4, 150 mM NaCl, 0.005% surfactant
P20. Recombinant human IL-23 is pre-incubated for 90 minutes with
or without the addition of a 16.times. molar excess of Antibody I.
Each combination is injected over flow cells 1, 2 and 4 in a total
volume of 150 .mu.L followed by a regeneration step using
glycine-HCl (pH 1.5) between each test. Flow cell 1 is used as a
control to monitor non-specific binding of IL-23 to the chip.
BIAevaluation software is used to prepare overlays of individual
binding sensorgrams.
[0104] Antibody I neutralizes human IL-23 using in vitro functional
assays. Furthermore, Antibody I prevents binding of IL-23 to
IL-23R/Fc. The data in Table 3 shows: [0105] (A) IL-23 binds to
IL-23R/Fc; [0106] (B) Antibody I/IL-23 complex does not bind to
IL-23R/Fc; [0107] (C) IL-23 binds to IL-12R.beta.1/Fc, and [0108]
(D) Antibody I/IL-23 complex binds to IL-12R.beta.1/Fc.
TABLE-US-00004 [0108] TABLE 3 Effect of Antibody I on IL-23 binding
to IL-23R Cytokine Antibody Binding to IL-23R Binding to
IL-12.beta.1 IL-23 None YES YES IL-23 I NO YES
[0109] Thus, Antibody I neutralizes IL-23 because it inhibits the
binding of IL-23 to the IL-23R subunit. Additionally, Antibody I
does not inhibit binding of IL-23 to the IL-12R.beta.1 subunit.
In Vitro Neutralization of Human or Cynomolgus Monkey IL-23 by
Antibody I in Murine Splenocytes
[0110] For evaluation of Antibody I, a concentration of human or
cynomolgus monkey IL-23 that gives approximately 50% of maximal
production of IL-17 is used (16 pM). A dose response ranging from
800,000 to 4.4 pM of Antibody I is evaluated. Antibody I or an
IgG.sub.4 control antibody is combined with human or cynomolgus
monkey IL-23 in a separate well for 90 minutes at 37.degree. C.
before addition to the cells (pre-incubation mix).
[0111] Splenocytes from C57BL/6 mice stimulated with IL-23 and IL-2
produce IL-17 (Aggarwal, S. et al., "Interleukin-23 Promotes a
Distinct CD4 T Cell Activation State Characterized by the
Production of Interleukin-17", Journal of Biological Chemistry, 278
(3): 1910-1914 2003). Mouse splenocytes are re-suspended at
5.times.10.sup.6 WBC/mL in assay media (RPMI1640 with L-glutamine
containing 10% FBS, 1% non-essential amino acids, 1 mM sodium
pyruvate, 100 U/mL penicillin, 100 .mu.g/ml streptomycin, 0.00035%
2-mercaptoethanol, 50 ng/mL human IL-2) and dispensed in volumes of
100 .mu.L per well into a 96-well culture plate. The pre-incubation
mix of Antibody I/IL-23 is dispensed as 100.quadrature. .mu.L at
per well and incubated at 37.degree. C. in 5% CO.sub.2. Forty-eight
hours later, culture supernatants are tested for mIL-17 using a
commercial ELISA kit from R&D Systems (DY421) according to the
instructions in the kit using duplicate wells at each dilution. An
IC.sub.50 is determined using a 4 parameter curve fit of the
data.
[0112] Mouse splenocytes produce IL-17 in response to human or
cynomolgus monkey IL-23. Antibody I neutralizes human or cynomolgus
monkey IL-23. The calculated IC.sub.50 is 82.+-.11 pM for human and
120.+-.14 pM for cynomolgus monkey IL-23, n=2 for each (Table 4).
These results demonstrate that Antibody I is able to neutralize
human or cynomolgus monkey IL-23 in vitro.
TABLE-US-00005 TABLE 4 IC.sub.50 in the in vitro human and
cynomolgus monkey IL-23 neutralization assay Species Assay #
Antibody IC.sub.50 (pM) Human 1 I 90 Human 2 I 74 Human Average
(SD) 82 (11) Cyno 3 I 110 Cyno 4 I 130 Cyno Average (SD) 120
(14)
Neutralization of Human IL-23: Acute, Local
[0113] Animals (C57BL/six females, eight weeks old from Jackson
Labs) are housed (minimum of 72 hrs after arrival) and fed normally
prior to the experiment and for the duration of the study. Hair is
removed from the back of mice with electric clippers, and 3 days
later mice (n=10 per group) received a subcutaneous injection of
Antibody I or an IgG.sub.4 isotype control antibody (0.54 mg per
mouse). The following 2 days, mice are injected intradermally with
human IL-23 in one location on one side of the back (1 .mu.g in 50
.mu.L diluted with sterile saline) using a 29-gauge needle. Sterile
saline is used as a vehicle control on the other side of the back.
Mice are sacrificed 24 hours after the last human IL-23 injection
and skin samples are removed from IL-23-injected side and from the
sterile saline-injected side, keeping at least 5 mm away from the
hair boundary. Skin samples are frozen directly in liquid nitrogen
for mRNA studies.
[0114] Total RNA is isolated from frozen skin tissue by
homogenization in Lysing Matrix A shaker tubes (Qbiogene
Inc./Bio101 Systems) followed by RNeasy Mini kit cleanup (Qiagen,
Inc.). RNA concentrations are determined from spectrophotometric
absorption at 260 nm. RNA is reverse-transcribed into cDNA using
High-Capacity cDNA Reverse Transcription Kit (PE Applied
Biosystems). All reactions are performed in triplicate on an ABI
Prism 7900HT (PE Applied Biosystems) to determine the relative
abundance of assayed mRNAs. Primer probe sets for mouse IL-17A
(Mm00439618_m1), mouse IL-17F (Mm00521423_m1) and mouse keratin-16
(Mm00492979_g1) are obtained from PE Applied Biosystems. Both 18S
and GAPD are measured as endogenous controls to normalize
variability in gene expression levels. Expression data is analyzed
using Delta (.DELTA.-.DELTA.) Ct method. Individual Ct values are
calculated as means of triplicate measurements. Experiments are
performed two times. Unpaired t-test is used where appropriate.
P<0.05 is considered to be statistically significant.
[0115] To explore whether systemic administration of Antibody I is
able to neutralize the local response to human IL-23, human IL-23
protein is injected intradermally into mice to investigate the
downstream consequences of cutaneous IL-23 exposure. Skin from
wild-type mice treated saline solution daily does not show
detectable levels of mouse IL-17A or mouse IL-17F.
[0116] However, injection of human IL-23 induces mRNA expression of
mouse IL-17A and mouse IL-17F (Table 5). Treatment with Antibody I
but not isotype control antibody abrogated the human IL-23-induced
IL-17A and IL-17F mRNA expression.
TABLE-US-00006 TABLE 5 In vivo neutralization of human IL-23
induced murine IL-17A and IL-17F mRNA expression. Ct Values PBS
IL-23 IL-17A IL-17F IL-17A IL-17F Isotype control .gtoreq.40
.gtoreq.40 35.4 31.6 Antibody I .gtoreq.40 .gtoreq.40 .gtoreq.40
.gtoreq.40
[0117] Furthermore, human IL-23 injection induces an epidermal
thickening associated with increased expression of keratin-16, a
proliferation-associated cytokeratin. The induction of keratin-16
is significantly inhibited by administration of Antibody I (fold
induction of murine keratin-16 is 5.21.+-.2.72 for isotype control
antibody versus 1.23.+-.0.72 for Antibody I; p=0.0003).
[0118] All together, these results show that Antibody I effectively
inhibits human IL-23-induced mouse IL-17A, IL-17F and keratin-16
mRNA production in an acute local in vivo assay.
Retinal Tissue Cross-Reactivity: In Vitro Analysis by
Immunohistochemistry
[0119] Sections of fresh-frozen human and cynomolgus monkey retinal
tissue (5-7 .mu.m thick) are cut on a cryostat. The sections are
fixed in acetone for approximately 10 minutes at room temperature,
allowed to dry overnight at room temperature and stored at
approximately -80.degree. C. until use. Acetone-fixed slides are
subsequently removed from the freezer and allowed to dry overnight
at room temperature. The following steps are performed at room
temperature. The slides are incubated in 1.times. Morphosave.TM.
for approximately 15 minutes to preserve morphology. The slides are
washed 10 minutes in 1.times.PBS and then incubated in 0.3%
H.sub.2O.sub.2 in 1.times.PBS at room temperature for approximately
20 minutes to quench endogenous peroxidase activity. After
incubation, the slides are washed two times for approximately 5
minutes in 1.times.PBS. Endogenous biotin is blocked by sequential
incubation (approximately 15 minutes each) in avidin and biotin
solutions. Following the incubation in biotin, the tissue sections
are blocked with a blocking antibody solution for 30 minutes.
Antibody I or control human IgG.sub.4 is applied to sections at the
optimal concentrations (2.5 or 5 .mu.g/mL) or five times the
optimal concentration (25 .mu.g/mL) and incubated for 1 hour at
room temperature. Slides are then rinsed and incubated with
biotinylated mouse anti-human IgG.sub.4 antibody (2.5 mg/mL) for 30
minutes. Bound primary/secondary antibody complexes are detected
with streptavidin-biotin-horseradish peroxidase conjugate and a
diaminobenzidine chromagen substrate.
[0120] CHO cells transfected with human IL-23 are used as a
positive control sample in all experiments. Parental CHO
(non-transfected) cells are used as a negative control sample and
did not stain. Binding is not observed in serial sections stained
with the isotype control antibody (human IgG4). Antibody I does not
observably bind retinal tissue.
Epitope Mapping for Antibody I: Alanine Scanning
[0121] Background to Epitope Mapping using Yeast Displayed
Antigen
[0122] Epitope mapping studies are performed to determine the
specific amino acids in the human IL-23 p19 subunit (SEQ ID NO: 15)
that are required for Antibody I binding. Epitope mapping of
Antibody I is completed by utilizing alanine scanning in
conjunction with a yeast display platform.
[0123] Exposed amino acid positions of the p19 subunit of human
IL-23 are identified by analysis in PyMOL. The exposed or partially
exposed positions of the p19 subunit of IL-23 are shown in Table 6.
Those positions that were determined not to be exposed are omitted
from this study, i.e. only amino acid positions of the p19 subunit
of human IL-23 that are exposed or partially exposed are mutated.
Accordingly, not all positions are investigated.
[0124] Although the epitope mapping is only performed on the p19
subunit of IL-23 (no epitope mapping performed on the p40 subunit
of IL-23 as Antibody I does not detectably bind to the p40
subunit), both the p19 subunit and p40 subunit of human IL-23 must
be co-expressed in the yeast display platform.
[0125] Single yeast displayed alanine mutants of the p19 subunit of
human IL-23 are constructed and antibody binding determined in
order to identify the epitope. By measuring the affinity of
antibody mutants compared to the wild-type yeast displayed antigen,
it is possible to determine the energetic contribution of the amino
acid side chain to antibody binding.
[0126] Mutant Library Construction
[0127] The p40 gene is cloned into the soluble-expression plasmid,
pYKY, which has a uracil selection marker. The p19 subunit gene is
cloned into the yeast display plasmid, pEMD3, which contains a
tryptophan selection marker and a VS tag at the N-terminus and to a
GPDL2 anchor protein at the C-terminus allowing display on the
surface of yeast under the tryptophan selectable marker. The
restriction sites used for cloning are XhoI and BamHI in the pYKY
plasmid and AvrII and XmaI in the pEMD3 plasmid, respectively.
[0128] Alanine mutations are introduced at every exposed position
and tested for double positive staining with V5 antibody and
Antibody I. Panels of p19 alanine mutants are constructed in pEMD3
plasmids using site directed mutagenesis (Kunkel Mutagenesis).
Briefly, uracil containing ssDNA of the pEMD3 vector is produced
after transformation into CJ236 (New England Biolabs). A single
colony of the transformation is grown overnight and the ssDNA
rescued following infection with M13K07 helper phage (New England
Biolabs) and ssDNA purified using a QIAprep spin M13 kit.
Oligonucleotides encoding alanine mutations are annealed at a 20:1
molar ratio to the uracil template by denaturing at 85.degree. C.
for 5 minutes, ramping to 55.degree. C. over 1 hour, holding at
55.degree. C. for 5 minutes, then chilling on ice. Second strand
synthesis is then completed with T4 polymerase, T4 ligase and dNTPs
(Invitrogen). The reaction is electroporated into Top10 E. coli
(Invitrogen) and single colonies picked, dsDNA prepared using the
QIAprep miniprep kit (Qiagen) and mutations confirmed by
sequencing. p19 mutants are then co-transformed into BJ5464 yeast
(ATCC) with the p40 pYKY plasmid and grown in complete minimal
media without tryptophan and uracil.
[0129] Selection of Mutated Antigen Library for Loss of Antigen
Binding
[0130] In order to identify the antibody epitope, the mutated
antigen library is selected for loss of antibody binding by flow
cytometry. Yeast cells are stained with two antibodies, one of
which is being mapped and one of which is not. Yeast-displayed
antigen mutants are selected for loss of binding to the first
antibody, but retention of binding to the second antibody.
Retention of binding of the second antibody ensures that mutants
are selected on the basis of mutations in the epitope, rather than
selection of unfolded or poorly displayed mutants.
[0131] For the present analysis, the first antibody (i.e. the
antibody whose epitope is being mapped) is Antibody I and the
second antibody is an anti-V5 antibody. Yeast are stained with
anti-V5 antibody (Invitrogen) and Antibody I to begin with and
subsequently with a secondary goat anti-mouse IgG.sub.2a
(Invitrogen, Alexa Fluor.RTM. 647) to detect anti-V5 antibody
(expression/display) and a goat anti-human kappa RPE (Southern
Biotech) to detect Antibody I. Yeast are analyzed by flow cytometry
on a Becton Dickinson LSRII, where 50,000 events are collected
based on gating cells by light scatter, V5/Alexa647 and Antibody
I/PE staining. Data analysis for binding of each of Antibody I and
anti-V5 antibody is performed using FACSDiva v6.1.2 software, which
calculates the percentage of double stained yeast cells.
[0132] Results
[0133] Due to displayed protein partition, at best 50% of yeast
will display IL-23 p19. Detection of double-positive yeast cells
demonstrate that the amino acid position under investigation is not
involved with Antibody I binding to IL-23. Detection of only V5
staining demonstrates that the protein is expressed and displayed
on the surface of the yeast and that the amino acid position under
investigation is important for Antibody I binding. It is determined
that those residues that demonstrated >50% reduction in double
positive staining compared to adjacent residues are important for
binding. These residues are highlighted in Table 7. Some positions
demonstrate the lack of both V5 and Antibody I binding, suggesting
that amino acid residue may be necessary for protein conformation.
Systematic investigation of each exposed or partially exposed amino
acid position in the IL-23 p19 subunit (SEQ ID NO: 15) demonstrates
that positions 94P, 95S, 97L, 98P, 99D, 123W, 130S, 133P, and 137W
are important for Antibody I binding to human IL-23 based on the
reduced amount of double positive staining for V5 and Antibody I
binding (Table 7).
[0134] Epitope mapping is also performed using hydrogen-deuterium
exchange. The results of this hydrogen-deuterium exchange epitope
mapping illustrate that the epitope of Antibody I is a
conformational epitope within residues 81-99 and 115-140 of human
IL-23 (SEQ ID NO: 15).
TABLE-US-00007 TABLE 6 Exposed or partially exposed amino acid
sequence of mature human IL-23 p19 subunit Position 1 2 3 4 5 6 7 8
9 10 Amino Acid R A V P G G S S P A Exposed/Partially x x x x x x x
x x exposed Position 11 12 13 14 15 16 17 18 19 20 Amino Acid W T Q
C Q Q L S Q K Exposed/Partially x x x x x x x exposed Position 21
22 23 24 25 26 27 28 29 30 Amino Acid L C T L A W S A H P
Exposed/Partially x x x x x exposed Position 31 32 33 34 35 36 37
38 39 40 Amino Acid L V G H M D L R E E Exposed/Partially x x x x x
x x x x x exposed Position 41 42 43 44 45 46 47 48 49 50 Amino Acid
G D E E T T N D V P Exposed/Partially x x x x x x x x x exposed
Position 51 52 53 54 55 56 57 58 59 60 Amino Acid H I Q C G D G C D
P Exposed/Partially x x x x x exposed Position 61 62 63 64 65 66 67
68 69 70 Amino Acid Q G L R D N S Q F C Exposed/Partially x x x x x
x x exposed Position 71 72 73 74 75 76 77 78 79 80 Amino Acid L Q R
I H Q G L I F Exposed/Partially x x x x x exposed Position 81 82 83
84 85 86 87 88 89 90 Amino Acid Y E K L L G S D I F
Exposed/Partially x x x x x x exposed Position 91 92 93 94 95 96 97
98 99 100 Amino Acid T G E P S L L P D S Exposed/Partially x x x x
x x x x x x exposed Position 101 102 103 104 105 106 107 108 109
110 Amino Acid P V G Q L H A S L L Exposed/Partially x x x x x x
exposed Position 111 112 113 114 115 116 117 118 119 120 Amino Acid
G L S Q L L Q P E G Exposed/Partially x x x x x x exposed Position
121 122 123 124 125 126 127 128 129 130 Amino Acid H H W E T Q Q I
P S Exposed/Partially x x x x x x x x x exposed Position 131 132
133 134 135 136 137 138 139 140 Amino Acid L S P S Q P W Q R L
Exposed/Partially x x x x x x x x x x exposed Position 141 142 143
144 145 146 147 148 149 150 Amino Acid L L R F K I L R S L
Exposed/Partially x x x x x x exposed Position 151 152 153 154 155
156 157 158 159 160 Amino Acid Q A F V A V A A R V
Exposed/Partially x x x x exposed Position 161 162 163 164 165 166
167 168 169 170 Amino Acid F A H G A A T L S P Exposed/Partially x
x x x x x x x x x exposed
Physical-Chemical Properties of IL-23 Antibody
[0135] Antibody I has pharmaceutically acceptable solubility,
chemical stability and physical stability.
[0136] A. Solubility
[0137] Sufficiently high solubility is desired to enable convenient
dosing. For example, a 1 mg/kg dose administered by a 1.0 mL
injection into a 100 kg patient will require solubility of 100
mg/mL. In addition, maintaining the antibody in a monomeric state
without high molecular weight (HMW) aggregation at high
concentration is also desirable.
[0138] Antibody I is formulated at approximately 1 mg/mL in a
physiological-like buffer (PBS, pH 7.4) and under two drug product
formulation conditions (10 mM citrate, pH 6, plus and minus 150 mM
NaCl). The antibody is centrifuged at 2000.times.G through an
Amicon Ultra 30 kDa molecular weight filter (Millipore, UFC803204)
to concentrate the antibody while maintaining the same buffer
conditions. Centrifugation is continued until solubility limit or
minimal holdup volume of the device is reached. Greater than 100
mg/mL solubility is achieved under all three conditions.
[0139] Size-exclusion chromatography (SEC) is used to assess
whether an increase in high molecular weight (HMW) polymer occurred
following concentration of the antibody formulations to greater
than 1.00 mg/mL. The starting antibody solution and concentrated
antibody solution are injected onto a TSK3000 SWXL column (TOSOH
Bioscience) using a mobile phase consisting of 12 mM phosphate, 500
mM NaCl, pH 7.4. No large increase in soluble polymer is observed
under any formulation condition tested (<0.6% HMW polymer by
SEC).
[0140] B. Chemical Stability
[0141] Antibody I is formulated at 1 mg/mL in 10 mM buffer (10 mM
citrate for pH 4, 5, 6, and 7; 10 mM TRIS for pH 8) and incubated
for 4 weeks at 4, 25, or 40.degree. C. Chemical stability is
monitored by SEC (see above method), cation exchange chromatography
[CEX; Dionex, using a gradient between Buffer A (20 mM sodium
phosphate, pH 5.8, 0.36% CHAPS) and Buffer B (20 mM sodium
phosphate, pH 5.8, 0.36% CHAPS, 200 mM sodium chloride)], CE-SDS
(Agilent Bioanalyzer with a protein 230 chip under reducing
conditions) and by LC-MS characterization of enzymatically digested
material.
[0142] Antibody I is stable against polymer formation (SEC) over pH
5-8 even after 4-weeks at 40.degree. C. At pH 4, significant
polymer is observed at 40.degree. C. but not at 25.degree. C. (4
wk). Expected peptide bond hydrolysis or clipping is evident at pH
4 (40.degree. C.) by CE-SDS. The degradation level at pH 4.0 is
typical of IgG.sub.4 antibodies. Above pH 4 (pH 5-8) levels are low
and do not consistently change with time and thus likely represent
background noise.
[0143] This hypothesis is consistent with the LC-MS analysis which
detects no clipping at pH 6 while measuring typical level of
antibody clipping at pH 4. Changes in charged variants are
monitored by CEX. The starting material consists of three
significant main peaks which minimize resolving power of this
assay. In general, the 25.degree. C. and 40.degree. C. stressed
samples are higher than the 4.degree. C. control, but levels did
not increase with incubation time (actually decreased in many
cases). The percent change at pH 6.0 (4 wk at 25.degree. C. minus
4.degree. C. control) is 2.5%. LC-MS analysis indicates the
majority of the modification is outside of the CDR region and is at
levels typical of other IgG4 antibodies. Three degradation sites
within the CDRs are identified changed less than 1% (pH 6; 4 wk at
25.degree. C. minus 4.degree. C. control). The lack of degradation
sites within the CDRs is also consistent with no significant change
in BIACore affinity or stoichiometry following four weeks at
40.degree. C. incubation at either pH 4, 6, or 8.
[0144] C. Physical Stability
[0145] i) Freeze Thaw Stability
[0146] Antibody I is formulated under the following conditions:
[0147] a) 1 mg/mL in 10 mM Citrate, pH 6.0; [0148] b) 1 mg/mL in 10
mM Citrate, pH 6.0, 0.02% Tween-80; [0149] c) 1 or 50 mg/mL in 10
mM Citrate, pH 6.0, 150 mM NaCl; and [0150] d) 1 or 50 mg/mL in 10
mM Citrate, pH 6.0, 150 mM NaCl, 0.02% Tween-80.
[0151] These formulations are placed in a PC/min controlled
freezing container (Nalgene, 5100-0001) and frozen in a -80.degree.
C. freezer for at least eight hours and then removed and thawed at
room temperature for at least eight hours. This freeze/thaw cycle
is repeated up to three times. Samples are removed after one and
three freeze thaw cycles and analyzed for HMW polymer by SEC (see
SEC method described in part A above) and insoluble particle
formation by HIAC particle counter (Pacific Scientific model 9703
with low volume attachment). No significant increase in HMW polymer
formation is observed following three freeze thaw cycles under any
conditions tested. For the 1 mg/ml formulations a significant
increase in HIAC particle counts is observed only in the
non-Tween-80 containing formulations. At 50 mg/ml particle counts
were typical of other well performing IgG4 antibodies with particle
counts (.gtoreq.10 micron) were approximately 1500 counts/mL
without Tween-80 and lowered to approximately 280 with
Tween-80.
[0152] ii) Static Hold at High Concentration
[0153] Antibody is formulation at 50 mg/mL under the following
conditions: [0154] a) 10 mM Citrate, pH 6.0, 150 mM NaCl; and
[0155] b) 10 mM Citrate, pH 6.0, 150 mM NaCl, 0.02% Tween-80
[0156] These formulations are held static for 4-weeks at 4 and
25.degree. C. The change in HIAC particle counts (Pacific
Scientific model 9703 with low volume attachment) is measured after
4-weeks at 25.degree. C.
[0157] HIAC particle counts (.gtoreq.10 micron) for Tween
containing formulations average 290 counts/mL (270 and 310) and
moderately higher, 804 counts/mL (728 and 880) for formulations
without Tween. These results are typical of other IgG4 antibodies
that exhibit good physical stability. These two formulations were
also stored in glass instead of standard plastic eppendorf tubes.
Particle counts for the samples stored in glass are 4 to 8 fold
lower (average 35 and 191 counts/mL respective for with and without
Tween).
TABLE-US-00008 SEQ ID Listing Heavy Chain CDRs SEQ ID NO: 1
GYKFTRYVMH SEQ ID NO: 2 YINPYNDGTNYNEKFKG SEQ ID NO: 3 ARNWDTGL
Light Chain CDRs SEQ ID NO: 4 KASDHILKFLT SEQ ID NO: 5 GATSLET SEQ
ID NO: 6 QMYWSTPFT Heavy Chain Variable Regions SEQ ID NO: 7
(Antibody I)
QVQLVQSGAEVKKPGSSVKVSCKASGYKFTRYVMHWVRQAPGQGLEWMGYINPYND
GTNYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNWDTGLWGQGTTVTVSS Light
Chain Variable Regions SEQ ID NO: 8 (Antibody I)
DIQMTQSPSSLSASVGDRVTITCKASDHILKFLTWYQQKPGKAPKLLIYGATSLETGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQMYWSTPFTFGGGTKVEIK Complete Heavy
Chain SEQ ID NO: 9 (Antibody I)
QVQLVQSGAEVKKPGSSVKVSCKASGYKFTRYVMHWVRQAPGQGLEWMGYINPYND
GTNYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNWDTGLWGQGTTVTVS
SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR
WQEGNVFSCSVMHEALHNHYTQKSLSLSLG Complete Light Chain SEQ ID NO: 10
(Antibody I)
DIQMTQSPSSLSASVGDRVTITCKASDHILKFLTWYQQKPGKAPKLLIYGATSLETGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQMYWSTPFTFGGGTKVEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Nucleotide Seuuences Heavy
Chain Variable Region SEQ ID NO: 11 (Antibody I)
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA
GGTCTCCTGCAAGGCTTCTGGATATAAATTCACTCGTTATGTTATGCACTGGGTGCG
ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATATATTAATCCTTACAATGATG
GTACTAACTACAATGAGAAGTTCAAAGGCAGAGTCACGATTACCGCGGACAAATCC
ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA
TTACTGTGCGAGAAACTGGGACACAGGCCTCTGGGGCCAAGGCACCACTGTCACAG TCTCCTCA
Nucleotide Sequences Light Chain Variable Regions SEQ ID NO: 12
(Antibody I)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCAAGGCAAGTGACCACATTCTCAAATTTTTAACTTGGTATCAGCAG
AAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGGTGCAACCAGTTTGGAAACTGG
GGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAG
CAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAAATGTATTGGAGTACTCC
GTTCACGTTCGGAGGGGGGACCAAGGTGGAAATAAAA Nucleotide Seouence Complete
Heavy Chain SEQ ID NO: 13 (Antibody I)
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA
GGTCTCCTGCAAGGCTTCTGGATATAAATTCACTCGTTATGTTATGCACTGGGTGCG
ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATATATTAATCCTTACAATGATG
GTACTAACTACAATGAGAAGTTCAAAGGCAGAGTCACGATTACCGCGGACAAATCC
ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA
TTACTGTGCGAGAAACTGGGACACAGGCCTCTGGGGCCAAGGCACCACTGTCACAG
TCTCCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCGCTAGCGCCCTGCTCCAGGA
GCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAA
CCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCC
GGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTC
CAGCAGCTTGGGCACGAAGACCTACACCTGCAACGTAGATCACAAGCCCAGCAACA
CCAAGGTGGACAAGAGAGTTGAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCA
GCACCTGAGGCCGCCGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGA
CACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCA
GGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAGGTGCATAATG
CCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTC
CTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTC
CAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGC
CCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAGAAC
CAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAG
TGGGAAAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGA
CTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCA
GGAGGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACAC
ACAGAAGAGCCTCTCCCTGTCTCTGGGT Nucleotide Sequence Complete Light
Chain SEQ ID NO: 14 (Antibody 1)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCAAGGCAAGTGACCACATTCTCAAATTTTTAACTTGGTATCAGCAG
AAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGGTGCAACCAGTTTGGAAACTGG
GGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAG
CAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAAATGTATTGGAGTACTCC
GTTCACGTTCGGAGGGGGGACCAAGGTGGAAATAAAACGAACTGTGGCTGCACCAT
CTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGT
GTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATA
ACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC
AGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACA
CAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGA
GCTTCAACAGGGGAGAGTGC Protein Sequences Mature Human IL-23 p19
subunit amino acid sequence SEQ ID NO: 15
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDG
CDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQP
EGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Sequence CWU 1
1
15110PRTArtificial Sequencesynthetic construct 1Gly Tyr Lys Phe Thr
Arg Tyr Val Met His 1 5 10 217PRTArtificial Sequencesynthetic
construct 2Tyr Ile Asn Pro Tyr Asn Asp Gly Thr Asn Tyr Asn Glu Lys
Phe Lys 1 5 10 15 Gly 38PRTArtificial Sequencesynthetic construct
3Ala Arg Asn Trp Asp Thr Gly Leu 1 5 411PRTArtificial
Sequencesynthetic construct 4Lys Ala Ser Asp His Ile Leu Lys Phe
Leu Thr 1 5 10 57PRTArtificial Sequencesynthetic construct 5Gly Ala
Thr Ser Leu Glu Thr 1 5 69PRTArtificial Sequencesynthetic construct
6Gln Met Tyr Trp Ser Thr Pro Phe Thr 1 5 7115PRTArtificial
Sequencesynthetic construct 7Gln Val Gln Leu Val Gln Ser Gly Ala
Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys Val Ser Cys Lys
Ala Ser Gly Tyr Lys Phe Thr Arg Tyr 20 25 30 Val Met His Trp Val
Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Tyr Ile
Asn Pro Tyr Asn Asp Gly Thr Asn Tyr Asn Glu Lys Phe 50 55 60 Lys
Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr 65 70
75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95 Ala Arg Asn Trp Asp Thr Gly Leu Trp Gly Gln Gly Thr
Thr Val Thr 100 105 110 Val Ser Ser 115 8107PRTArtificial
Sequencesynthetic construct 8Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys
Lys Ala Ser Asp His Ile Leu Lys Phe 20 25 30 Leu Thr Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Gly Ala
Thr Ser Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70
75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Met Tyr Trp Ser Thr Pro
Phe 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105
9441PRTArtificial Sequencesynthetic construct 9Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Lys Phe Thr Arg Tyr 20 25 30 Val
Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45 Gly Tyr Ile Asn Pro Tyr Asn Asp Gly Thr Asn Tyr Asn Glu Lys Phe
50 55 60 Lys Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr
Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Ala Arg Asn Trp Asp Thr Gly Leu Trp Gly
Gln Gly Thr Thr Val Thr 100 105 110 Val Ser Ser Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro 115 120 125 Cys Ser Arg Ser Thr Ser
Glu Ser Thr Ala Ala Leu Gly Cys Leu Val 130 135 140 Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala 145 150 155 160 Leu
Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly 165 170
175 Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly
180 185 190 Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn
Thr Lys 195 200 205 Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro Pro
Cys Pro Pro Cys 210 215 220 Pro Ala Pro Glu Ala Ala Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro 225 230 235 240 Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys 245 250 255 Val Val Val Asp Val
Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp 260 265 270 Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 275 280 285 Glu
Gln Phe Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 290 295
300 His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
305 310 315 320 Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly 325 330 335 Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser Gln Glu Glu 340 345 350 Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr 355 360 365 Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn 370 375 380 Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 385 390 395 400 Leu Tyr
Ser Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn 405 410 415
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr 420
425 430 Gln Lys Ser Leu Ser Leu Ser Leu Gly 435 440
10214PRTArtificial Sequencesynthetic construct 10Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Lys Ala Ser Asp His Ile Leu Lys Phe 20 25 30
Leu Thr Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr Gly Ala Thr Ser Leu Glu Thr Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Met Tyr
Trp Ser Thr Pro Phe 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln 145 150 155 160
Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165
170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val
Tyr 180 185 190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val
Thr Lys Ser 195 200 205 Phe Asn Arg Gly Glu Cys 210
11345DNAArtificial Sequencesynthetic construct 11caggtgcagc
tggtgcagtc tggggctgag gtgaagaagc ctgggtcctc ggtgaaggtc 60tcctgcaagg
cttctggata taaattcact cgttatgtta tgcactgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggatat attaatcctt acaatgatgg
tactaactac 180aatgagaagt tcaaaggcag agtcacgatt accgcggaca
aatccacgag cacagcctac 240atggagctga gcagcctgag atctgaggac
acggccgtgt attactgtgc gagaaactgg 300gacacaggcc tctggggcca
aggcaccact gtcacagtct cctca 34512321DNAArtificial Sequencesynthetic
construct 12gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
cagagtcacc 60atcacttgca aggcaagtga ccacattctc aaatttttaa cttggtatca
gcagaaacca 120gggaaagccc ctaagctcct gatctatggt gcaaccagtt
tggaaactgg ggtcccatca 180aggttcagtg gcagtggatc tgggacagat
ttcactctca ccatcagcag tctgcaacct 240gaagattttg caacttacta
ctgtcaaatg tattggagta ctccgttcac gttcggaggg 300gggaccaagg
tggaaataaa a 321131323DNAArtificial Sequencesynthetic construct
13caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctgggtcctc ggtgaaggtc
60tcctgcaagg cttctggata taaattcact cgttatgtta tgcactgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggatat attaatcctt acaatgatgg
tactaactac 180aatgagaagt tcaaaggcag agtcacgatt accgcggaca
aatccacgag cacagcctac 240atggagctga gcagcctgag atctgaggac
acggccgtgt attactgtgc gagaaactgg 300gacacaggcc tctggggcca
aggcaccact gtcacagtct cctcagcctc caccaagggc 360ccatcggtct
tcccgctagc gccctgctcc aggagcacct ccgagagcac agccgccctg
420ggctgcctgg tcaaggacta cttccccgaa ccggtgacgg tgtcgtggaa
ctcaggcgcc 480ctgaccagcg gcgtgcacac cttcccggct gtcctacagt
cctcaggact ctactccctc 540agcagcgtgg tgaccgtgcc ctccagcagc
ttgggcacga agacctacac ctgcaacgta 600gatcacaagc ccagcaacac
caaggtggac aagagagttg agtccaaata tggtccccca 660tgcccaccct
gcccagcacc tgaggccgcc gggggaccat cagtcttcct gttcccccca
720aaacccaagg acactctcat gatctcccgg acccctgagg tcacgtgcgt
ggtggtggac 780gtgagccagg aagaccccga ggtccagttc aactggtacg
tggatggcgt ggaggtgcat 840aatgccaaga caaagccgcg ggaggagcag
ttcaacagca cgtaccgtgt ggtcagcgtc 900ctcaccgtcc tgcaccagga
ctggctgaac ggcaaggagt acaagtgcaa ggtctccaac 960aaaggcctcc
cgtcctccat cgagaaaacc atctccaaag ccaaagggca gccccgagag
1020ccacaggtgt acaccctgcc cccatcccag gaggagatga ccaagaacca
ggtcagcctg 1080acctgcctgg tcaaaggctt ctaccccagc gacatcgccg
tggagtggga aagcaatggg 1140cagccggaga acaactacaa gaccacgcct
cccgtgctgg actccgacgg ctccttcttc 1200ctctacagca ggctaaccgt
ggacaagagc aggtggcagg aggggaatgt cttctcatgc 1260tccgtgatgc
atgaggctct gcacaaccac tacacacaga agagcctctc cctgtctctg 1320ggt
132314642DNAArtificial Sequencesynthetic construct 14gacatccaga
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgca
aggcaagtga ccacattctc aaatttttaa cttggtatca gcagaaacca
120gggaaagccc ctaagctcct gatctatggt gcaaccagtt tggaaactgg
ggtcccatca 180aggttcagtg gcagtggatc tgggacagat ttcactctca
ccatcagcag tctgcaacct 240gaagattttg caacttacta ctgtcaaatg
tattggagta ctccgttcac gttcggaggg 300gggaccaagg tggaaataaa
acgaactgtg gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc
agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat
420cccagagagg ccaaagtaca gtggaaggtg gataacgccc tccaatcggg
taactcccag 480gagagtgtca cagagcagga cagcaaggac agcacctaca
gcctcagcag caccctgacg 540ctgagcaaag cagactacga gaaacacaaa
gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc ccgtcacaaa
gagcttcaac aggggagagt gc 64215170PRTHomo sapiens 15Arg Ala Val Pro
Gly Gly Ser Ser Pro Ala Trp Thr Gln Cys Gln Gln 1 5 10 15 Leu Ser
Gln Lys Leu Cys Thr Leu Ala Trp Ser Ala His Pro Leu Val 20 25 30
Gly His Met Asp Leu Arg Glu Glu Gly Asp Glu Glu Thr Thr Asn Asp 35
40 45 Val Pro His Ile Gln Cys Gly Asp Gly Cys Asp Pro Gln Gly Leu
Arg 50 55 60 Asp Asn Ser Gln Phe Cys Leu Gln Arg Ile His Gln Gly
Leu Ile Phe 65 70 75 80 Tyr Glu Lys Leu Leu Gly Ser Asp Ile Phe Thr
Gly Glu Pro Ser Leu 85 90 95 Leu Pro Asp Ser Pro Val Gly Gln Leu
His Ala Ser Leu Leu Gly Leu 100 105 110 Ser Gln Leu Leu Gln Pro Glu
Gly His His Trp Glu Thr Gln Gln Ile 115 120 125 Pro Ser Leu Ser Pro
Ser Gln Pro Trp Gln Arg Leu Leu Leu Arg Phe 130 135 140 Lys Ile Leu
Arg Ser Leu Gln Ala Phe Val Ala Val Ala Ala Arg Val 145 150 155 160
Phe Ala His Gly Ala Ala Thr Leu Ser Pro 165 170
* * * * *
References