U.S. patent application number 15/592692 was filed with the patent office on 2017-09-21 for modulators of retinoid-related orphan receptor gamma.
The applicant listed for this patent is Orphagen Pharmaceuticals, Inc.. Invention is credited to Robert Babine, Xiaolin Li, Scott McNear Thacher, Bruno Tse.
Application Number | 20170267712 15/592692 |
Document ID | / |
Family ID | 47748964 |
Filed Date | 2017-09-21 |
United States Patent
Application |
20170267712 |
Kind Code |
A1 |
Thacher; Scott McNear ; et
al. |
September 21, 2017 |
MODULATORS OF RETINOID-RELATED ORPHAN RECEPTOR GAMMA
Abstract
Methods for modulating (inhibiting or stimulating)
retinoid-related orphan receptor .gamma. (ROR.gamma.) activity.
This modulation has numerous effects, including inhibition of
T.sub.H-17 cell function and/or T.sub.H-17 cell activity, and
inhibition of re-stimulation of T.sub.H-17 cells, which are
beneficial to treatment of inflammation and autoimmune disorders.
Stimulation of ROR.gamma. results in stimulation of T.sub.H-17 cell
function and/or activity which is beneficial for immune-enhancing
compositions (e.g., vaccines).
Inventors: |
Thacher; Scott McNear; (San
Diego, CA) ; Li; Xiaolin; (San Diego, CA) ;
Babine; Robert; (Carlsbad, CA) ; Tse; Bruno;
(San Francisco, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Orphagen Pharmaceuticals, Inc. |
San Diego |
CA |
US |
|
|
Family ID: |
47748964 |
Appl. No.: |
15/592692 |
Filed: |
May 11, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13766076 |
Feb 13, 2013 |
9657053 |
|
|
15592692 |
|
|
|
|
13114616 |
May 24, 2011 |
8389739 |
|
|
13766076 |
|
|
|
|
11867637 |
Oct 4, 2007 |
|
|
|
13114616 |
|
|
|
|
60849903 |
Oct 5, 2006 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07J 9/005 20130101;
C07C 311/21 20130101; C07D 493/10 20130101; C07J 9/00 20130101;
C07D 249/12 20130101; C07J 21/00 20130101; C07D 401/14 20130101;
A61K 31/58 20130101 |
International
Class: |
C07J 9/00 20060101
C07J009/00; A61K 31/58 20060101 A61K031/58; C07C 311/21 20060101
C07C311/21; C07D 249/12 20060101 C07D249/12; C07D 401/14 20060101
C07D401/14; C07D 493/10 20060101 C07D493/10; C07J 21/00 20060101
C07J021/00 |
Goverment Interests
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH
[0002] This invention was made with government support under Grant
Numbers 1 R43 A1060447-01, 1 R03 NS 050879-01, 1 R43 DK071461-01, 1
R43 MH075461-01, 1 R43 NS 059219-01, 1 R43 CA099875-01A1, and 1 R43
AR055427-01 from the National Institutes of Health. The government
has certain rights in the invention.
Claims
1. A method of inhibiting T.sub.H-17 cell differentiation, function
or activity in an individual afflicted with multiple sclerosis,
psoriasis, Crohn's disease, asthma, rheumatoid arthritis, uveitis
or psoriatic arthritis, comprising administering to said individual
an effective amount of a small organic molecule antagonist of
ROR.gamma., wherein said small organic molecule antagonist has a
molecular weight of less than about 600 daltons, wherein the
ability of said small organic molecule to act as a ROR.gamma.
antagonist is demonstrable by its ability to inhibit transcription
through the ROR.gamma. ligand binding domain and to regulate the
affinity of the ROR.gamma. ligand binding domain with a
coregulatory peptide at concentrations of 1 .mu.M or less.
2. The method of claim 1, wherein said T.sub.H-17 cell function or
activity is release of a cytokine.
3. The method of claim 2, wherein said cytokine is interleukin-17
or interleukin-22.
4. The method of claim 1, wherein the ROR.gamma. antagonist is
orally administered.
5. The method of claim 1 wherein the ROR.gamma. antagonist is
locally administered.
6. The method of claim 1 wherein said effective amount of a
ROR.gamma. antagonist is administered on a daily basis without
resulting in weight loss or hypertriglyceridemia.
7. The method of claim 1, wherein the coregulatory peptide binding
is measured by a method selected from the group consisting of
fluorescence resonance energy transfer (FRET), fluorescence
polarization, time-resolved FRET (TR-FRET) and Alpha Screen.
8. A method of treating multiple sclerosis, psoriasis, Crohn's
disease, asthma, rheumatoid arthritis, uveitis or psoriatic
arthritis, in an individual, comprising identifying an individual
in need of such treatment, and administering to said individual an
effective amount of a selective small organic molecule antagonist
of ROR.gamma., wherein said small organic molecule antagonist has a
molecular weight of less than about 600 daltons, wherein the
ability of small organic molecule to act as a ROR.gamma. antagonist
is demonstrable by its ability to inhibit transcription through the
ROR.gamma. ligand binding domain and to regulate the affinity of
the ROR.gamma. ligand binding domain with a coregulatory peptide at
concentrations of 1 .mu.M or less.
9. The method of claim 8, wherein the ROR.gamma. antagonist is
orally administered.
10. The method of claim 8, wherein said ROR.gamma. antagonist is
locally administered.
11. The method of claim 8, wherein said effective amount of
ROR.gamma. antagonist is administered on a daily basis without
resulting in weight loss or hypertriglyceridemia.
12. The method of claim 8, wherein the coregulatory peptide is
measured by a method selected from the group consisting of
fluorescence resonance energy transfer (FRET), fluorescence
polarization, time-resolved FRET (TR-FRET) and Alpha Screen.
Description
RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 13/766,076, filed Feb. 13, 2013, which is a continuation of
U.S. application Ser. No. 13/114,616, filed May 24, 2011, which is
a continuation of U.S. application Ser. No. 11/867,637, filed Oct.
4, 2007, which claims priority under 35 U.S.C. .sctn.119(e) to U.S.
Provisional Application No. 60/849,903, filed Oct. 5, 2006. The
contents of these applications are incorporated herein by reference
in their entireties.
REFERENCE TO SEQUENCE LISTING
[0003] The parent application (U.S. application Ser. No.
13/766,076) was filed along with a sequence listing in electronic
format. The sequence listing was provided in the parent case as a
file entitled ORPH.001C2.txt, created Feb. 13, 2013 which is 12 KB
in size. This sequence listing contains the same sequences as does
the present continuation application. The information in the
electronic format of the sequence listing is incorporated herein by
reference in its entirety.
FIELD OF THE INVENTION
[0004] The present invention relates to methods for modulating
(inhibiting or stimulating) retinoid-related orphan receptor
.gamma. (ROR.gamma.) activity. This modulation has numerous
effects, including inhibition of T.sub.H-17 cell function and/or
T.sub.H-17 cell activity, and inhibition of re-stimulation of
T.sub.H-17 cells, which are beneficial to treatment of inflammation
and autoimmune disorders. In contrast, stimulation of ROR.gamma.
results in stimulation of T.sub.H-17 cell function and/or activity
which is beneficial for immune-enhancing compositions (e.g.,
vaccines). More specifically, the present invention relates to
methods for inhibiting differentiation of T cells into T.sub.H-17
cells, or inhibiting the activity of T.sub.H-17 cells and other T
cells that express IL-17, by contacting a population of T cells
that may include T.sub.H-17 cells, with an antagonist of
ROR.gamma..
BACKGROUND OF THE INVENTION
[0005] Many forms of serious human disease result from an
autoimmune attack on the body. Many forms of autoimmune disease,
such as rheumatoid arthritis, multiple sclerosis, psoriasis, and
Crohn's disease, are particularly difficult to treat. An activated
CD4.sup.+ T cell that releases interleukin-17 (IL-17), a powerful
pro-inflammatory cytokine (Aggarwal, Ghilardi et al. 2003), and is
referred to as a T.sub.H-17 cell (Bettelli, Carrier et al. 2006;
Mangan, Harrington et al. 2006; Veldhoen, Hocking et al. 2006), may
be a significant pathogenic factor in autoimmune disease, based on
observations that patients have high levels of IL-17 expression in
target tissues. For example, the level of IL-17 mRNA was found to
be elevated in brain autopsy tissue from patients with MS compared
with controls, and the number of IL-17 positive mononuclear cells
was also increased in the cerebrospinal fluid of affected patients
(Matusevicius, Kivisakk et al. 1999; Lock, Hermans et al. 2002;
Vaknin-Dembinsky, Balashov et al. 2006). Rheumatoid arthritis (RA)
also appears to involve a T cell-mediated autoimmune reaction. The
level of IL-17 mRNA in synovial fluid of rheumatoid arthritis
patients is predictive of disease progression (Kirkham, Lassere et
al. 2006). Furthermore, T.sub.H-17 cells have been isolated from
intestinal biopsies of patients with Crohn's Disease (Annunziato,
Cosmi et al. 2007), and their frequencies are elevated in
comparison to T cells isolated from normal intestine or peripheral
blood. In disease tissue of psoriasis patients, levels of IL-22,
another proinflammatory cytokine produced by T.sub.H-17 cells, are
elevated (Zheng, Danilenko et al. 2007).
[0006] T.sub.H-17 cells, also referred to as IL-17.sup.+CD4.sup.+ T
or T.sub.117 cells, have only been recently characterized and are
distinct from the T.sub.H1 and T.sub.H2 lineages of CD4.sup.+
effector T cells. The relationship of T.sub.H-17 cells to the
T.sub.H1 and T.sub.H2 lineages is diagrammed in FIG. 1. T.sub.H1
and T.sub.H2-derived cytokines (such as IFN-.gamma. and IL-4) block
T.sub.H-17 formation (FIG. 1) and targeted deletion of some
transcription factors considered to be central for maintenance of
the T.sub.H1 and T.sub.H2 phenotype have no major effect on
T.sub.H-17 differentiation (Harrington, Hatton et al. 2005; Park,
Li et al. 2005). IL-23 expression in mouse is required for
induction of T cell-derived IL-17, and in culture IL-23 seems to
act as a survival factor for pre-existing T.sub.H-17 cells but does
not stimulate T.sub.H-17 formation from naive CD4.sup.+ T cells.
Instead, the combination of TGF.beta. and IL-6 is required to
stimulate the formation of T.sub.H-17 cells from naive mouse
CD4.sup.+ T cells, and there is genetic evidence in mouse for the
involvement of IL-6 and TGF.beta. in T.sub.H-17 formation in vivo
(Bettelli, Carrier et al. 2006; Mangan, Harrington et al. 2006;
Veldhoen, Hocking et al. 2006). The cytokine requirements for
T.sub.H-17 differentiation in human are somewhat different that in
mouse but the T.sub.H-17 phenotype is similar, including expression
of IL-17, IL-22, and ROR.gamma. (Annunziato, Cosmi et al. 2007;
Kebir, Kreymborg et al. 2007).
[0007] The older view that autoreactive CD4.sup.+ T.sub.H1 cells
are a prime cause for the development or progression of MS and
other forms of autoimmune disease has been challenged (Steinman
2007) by recent results from rodent models showing that mice with a
targeted deletion in the p35 subunit of IL-12, which is required
for the formation of T.sub.H1 cells, are still highly susceptible
to the induction of experimental autoimmune encephalomyelitis (EAE)
after immunization with myelin antigens (Becher, Durell et al.
2002; Gran, Zhang et al. 2002). In contrast, the knockout of either
p19, the unique subunit of the cytokine IL-23, or p40, a common
subunit of the two cytokines IL-12 and IL-23, create mice that are
resistant to the induction of EAE (Cua, Sherlock et al. 2003;
Langrish, Chen et al. 2005).
[0008] In addition to EAE, development of disease in a mouse model
of rheumatoid arthritis, collagen-induced arthritis (Courtenay,
Dallman et al. 1980), is also dependent on IL-23 function and is
correlated with an increased level of T.sub.H-17 cell activity,
such as release of IL-17 in affected tissues (Murphy, Langrish et
al. 2003; Sato, Suematsu et al. 2006). Inhibition of IL-17 may be a
viable alternative to inhibition of TNF.alpha. in treatment of RA
(Lubberts, Koenders et al. 2005). Further, IL-23 expression is
required for induction of IBD in mouse, and T.sub.H-17 cells appear
to be an important downstream mediator of IL-23 effect in this
model (Yen, Cheung et al. 2006). Disease progression in EAE models
is partially suppressed in IL-17.sup.-/- mice or after treatment
with anti-IL-17 antibodies (Iwakura and Ishigame 2006).
IL-17.sup.-/- mice also show reduced incidence and severity in a
collagen-induced arthritis (CIA) model for rheumatoid arthritis and
IL-17 antibodies have been shown to attenuate development of
intestinal inflammation in rodent models of IBD (Nakae, Nambu et
al. 2003; Yen, Cheung et al. 2006). Further, purified autoreactive
T.sub.H-17 cells strongly induce encephalomyelitis when transferred
to naive mice, leading to more dramatic disease manifestation
compared to disease induction by T.sub.H1 CD4.sup.+ T cells
(Langrish, Chen et al. 2005; Komiyama, Nakae et al. 2006). The
IL-27 receptor is prominently expressed in T.sub.H-17 cells and the
action of IL-27 as an inhibitor of murine EAE is correlated to
reduced T.sub.H-17 cell number in the animal (Batten, Li et al.
2006; Stumhofer, Laurence et al. 2006). Therefore, the activity of
murine T.sub.H-17 cells is well correlated to disease.
[0009] Inhibition of the human equivalent of the mouse T.sub.H-17
cell is a highly desirable target for new therapeutic agents to
treat autoimmune disease. Recent findings implicate T.sub.H-17
cells in the pathogenesis of Crohn's disease and more generally
inflammatory bowel disease (IBD). Antibody to the common subunit of
IL-23 and IL-12, p40, is safe and may be clinically effective in
treatment of Crohn's disease (Mannon, Fuss et al. 2004). A recent
Phase 2 clinical trial also shows that anti-p40 is highly effective
in the treatment of psoriasis (Krueger, Langley et al. 2007). The
identification of T.sub.H-17 cells has not only provided insight
into autoimmune pathogenesis, it has also revealed a major pathway
of adaptive immunity for extracellular microbes (Mangan, Harrington
et al. 2006; Annunziato, Cosmi et al. 2007). Stimulation of
T.sub.H-17 differentiation, function and cytokine release therefore
has the potential to enhance protective immunity by increasing T
cell reactivity to pathogenic organisms and other targets, such as
cancer-associated antigens.
Structure and Function of ROR.gamma.
[0010] ROR.gamma. (NR1F3), a ligand-regulated nuclear transcription
factor from the steroid/retinoid/thyroid family (Jetten,
Kurebayashi et al. 2001), has been shown to be essential for
CD4.sup.+ T.sub.H-17 development and/or function. ROR.gamma.
participates in and is required for the development of T.sub.H-17
cells. T.sub.H-17 cells are absent from genetically-engineered mice
that fail to express a specific splicing isoform of ROR.gamma.,
ROR.gamma.t (Ivanov, McKenzie et al. 2006; Littman and Eberl 2006).
Furthermore, an ROR.gamma.t-GFP transgene that expresses GFP from
the ROR.gamma.t promoter is expressed in CD4.sup.+IL-17.sup.+ T
cells from the lamina propria of the gut and other tissues. In cell
culture, transfection of ROR.gamma.t into naive murine CD4.sup.+ T
cells induces differentiation of these cells into IL-17 expressing
T cells even in the absence of the inducing cytokines IL-6 and
TGF.beta.. The data suggest that the transcriptional activity of
ROR.gamma.t is of major importance to T.sub.H-17 cell
differentiation and function (Ivanov, McKenzie et al. 2006).
ROR.gamma.t expression is induced in the presence of TGF.beta. and
IL-6 or by TGF.beta. and IL-21, an autocrine cytokine released from
developing T.sub.H-17 cells in response to IL-6 (Ivanov, McKenzie
et al. 2006; Korn, Bettelli et al. 2007; Nurieva, Yang et al. 2007;
Zhou, Ivanov et al. 2007).
[0011] The expression of ROR.gamma. follows a similar pattern in
human as in mouse T cells: ROR.gamma. is more highly expressed in
IL-17 or IL-17/IFN.gamma. expressing CD4.sup.+ T cells (Th-17) than
in CD4.sup.+ T cells that express IFN.gamma. alone (Th-1)
(Acosta-Rodriguez, Napolitani et al. 2007; Acosta-Rodriguez, Rivino
et al. 2007; Annunziato, Cosmi et al. 2007; Wilson, Boniface et al.
2007). Finally, it has been reported that other murine T cell types
express ROR.gamma.t, including .gamma..delta.TCR.sup.+ cells,
CD8.sup.+ T cells, and iNKT cells (Ivanov, McKenzie et al. 2006;
Ivanov and Littman 2007). Since these cells are also express IL-17,
it is possible that ROR.gamma.t is required for the differentiation
of the IL-17.sup.+ subpopulations of several other types of T
cells.
[0012] Finally, in the absence of ROR.gamma.t, mice are much less
susceptible to the induction of EAE (Ivanov, McKenzie et al. 2006).
These studies were carried out in immunodeficient mice.
ROR.gamma.t.sup.-/- mice lack lymph notes, and although they are
resistant to the development of EAE, a further study was carried
out by adoptive transfer of ROR.gamma.t wild type or
ROR.gamma.t.sup.-/- bone marrow to immunodeficient mice. While
transfer of normal bone marrow rendered the mice sensitive to the
induction of EAE by peptide immunization, the ROR.gamma.t.sup.-/-
transfectants were substantially resistant (Ivanov, McKenzie et al.
2006). These data suggest that ROR.gamma.t mediated regulation of T
cell differentiation is involved in the development of autoimmune
disease.
[0013] ROR.gamma. Structure.
[0014] ROR.gamma., like other members of the nuclear receptor
family, has a bipartite structure with two major functional
domains, a DNA binding domain (DBD) and a ligand binding domain
(LBD, see FIG. 2) (Medvedev, Yan et al. 1996). Ligand-regulated
transcription of the nuclear receptors is mediated through the LBD,
which has been crystallized for many receptors (Li, Lambert et al.
2003), including ROR.alpha. and ROR.beta., the receptors most
closely related to ROR.gamma.. The ROR.gamma. LBD is predicted to
have a binding pocket similar to ROR.alpha. and ROR.beta. (Stehlin,
Wurtz et al. 2001; Kallen, Schlaeppi et al. 2004). The retinoic
acid receptors (RAR.alpha., RAR.beta., and RAR.gamma.) are more
distantly related and appear not to have a functional overlap with
the RORs (Jetten, Kurebayashi et al. 2001).
[0015] The nuclear receptor LBD recruits transcriptional
coregulators (FIG. 2) in response to small molecule compounds (Li,
Lambert et al. 2003; Savkur and Burris 2004). These coregulatory
proteins act as sensors for the conformational state of the
ligand-bound complex and in turn regulate the recruitment of
transcriptional factors to chromatin adjacent to the receptor.
Short peptide domains of the coregulatory proteins required for
interaction with the nuclear receptor contain the conserved
sequence LXXLL (SEQ ID NO: 1), and synthetic peptide recruitment
assays based on this motif are widely used to monitor the binding
of agonists and antagonists to the nuclear receptor LBD (Lee,
Elwood et al. 2002; Savkur and Burris 2004), including for an assay
described herein for ROR.gamma..
[0016] Functional Studies of ROR.gamma..
[0017] Recognition of specific DNA motifs by the nuclear receptor
DBD determines specificity for gene transcription; however, little
is known about specific gene targets for ROR.gamma., and the major
findings on ROR.gamma. function have been derived from studies of
gene-targeted mice (Kurebayashi, Ueda et al. 2000; Sun, Unutmaz et
al. 2000; Eberl and Littman 2004; Eberl, Marmon et al. 2004).
ROR.gamma. has two splicing isoforms, ROR.gamma. and ROR.gamma.t
(He, Deftos et al. 1998). ROR.gamma.t differs from ROR.gamma. by a
truncation of 21 amino acids at the N-terminal and is the isoform
specifically expressed in thymus, lymph node precursors, and
T.sub.H-17 cells (Eberl and Littman 2004; Eberl, Marmon et al.
2004; Ivanov, McKenzie et al. 2006; Littman and Eberl 2006), the
major tissues affected in knockout studies of ROR.gamma.. The
significance of the N-terminal deletion of ROR.gamma. is not known,
but it is unlikely to affect ligand specificity or LBD function,
which is encoded at the receptor's C-terminal and is identical in
the two splicing isoforms.
[0018] In addition to its requirement for T.sub.H-17
differentiation, ROR.gamma. has other discrete functions in the
immune system. In its absence, the survival of the major subtype of
developing T lymphocytes, the CD4.sup.+CD8.sup.+ double positive
(DP) thymocytes, is reduced (Kurebayashi, Ueda et al. 2000; Sun,
Unutmaz et al. 2000), and the embryonic formation of lymph nodes
and Peyer's patches is blocked (Eberl, Marmon et al. 2004).
ROR.gamma.t is an early marker for the embryonic formation of
lymphoid tissue inducer or LTi cells. LTi cells are involved in
lymph node and Peyer's patch formation during embryogenesis (Eberl,
Marmon et al. 2004). After birth, an LTi-like cell participates in
formation of intermediate lymphoid follicles (ILFs) of the gut.
These lymphoid structures appear to participate in the gut immune
response (Eberl and Littman 2004). ROR.gamma. is also expressed in
liver, muscle, and fat (Jetten, Kurebayashi et al. 2001; Fu, Sun et
al. 2005). A recent study of ROR.gamma..sup.-/- mice also suggests
that the receptor has some regulatory effects on Phase 1 and Phase
2 detoxification enzymes (Kang, Angers et al. 2007).
[0019] Clinical Significance.
[0020] Three major points of action of ROR.gamma. in the immune
system have been identified in gene knockout studies; T cells,
including the T.sub.H-17 cell, lymph node formation, and survival
of DP thymocytes. Of these, regulation of IL-17.sup.+ T cell
function, including T.sub.H-17 differentiation, appears to be most
relevant to human therapeutics. Not only is the receptor absolutely
required for T.sub.H-17 differentiation, but the supply of
pathogenic T.sub.H-17 cells must be constantly replenished since
they are destroyed in target tissue (Gold, Linington et al. 2006).
Inhibition of new T.sub.H-17 formation will therefore have
important benefits. ROR.gamma. is expressed in human memory
T.sub.H-17 cells (Acosta-Rodriguez, Rivino et al. 2007; Annunziato,
Cosmi et al. 2007), and data presented herein shows that ROR.gamma.
antagonists block IL-17 expression in human peripheral blood
mononuclear cells (PBMCs). The primary source of IL-17 in PBMCs has
been reported to be memory T cells (Shin, Benbernou et al. 1999).
Finally, ROR.gamma. enhances, but is not absolutely required for,
the survival of the major developing T cell type of the thymus, the
DP thymocyte. In the knockout animal, there is no evidence of
immunodeficiency although splenic and peripheral frequencies of
some immune cell types are changed. However, there is a much higher
rate of apoptosis among thymocytes and thymocyte number is reduced
(Kurebayashi, Ueda et al. 2000; Zhang, Guo et al. 2003). The thymus
of an adult has already atrophied to a considerable degree and can
be reversibly suppressed by many forms of pharmacological
treatment, including exposure to steroids (Haynes, Markert et al.
2000). These data suggest that secondary effects of an ROR.gamma.
antagonist on thymic function in human may not be clinically
significant.
[0021] Prior to 1990, no drugs to treat MS were available. In the
last 15 years, several treatment options have emerged, primarily
various forms of INF.beta. (Avonex, Rebif, Betaseron), Glatiramer
acetate (Copaxone) and the chemotherapeutic drug mitoxantrone
(Novantrone) (Rolak 2003). INF.beta. and Glatiramer acetate both
appear to inhibit T cell activation and both drugs reduce the
number of attacks in relapsing-remitting MS but have little effect
in the progressive phase of the disease (Dhib-Jalbut 2002; Rolak
2003). The long-term benefits of these drugs are unclear.
Mitroxantrone appears to retard progression and delay disability in
secondary progressive MS. However, toxicity of this drug is very
limiting and Mitroxantrone is considered a short-term treatment
option. More recently, a humanized antibody to .alpha.4.beta.1
integrin (NATALIZUMAB, Tysabri) has been approved for the treatment
of MS and has been shown to slow disease progression and reduce
relapse rate in several clinical trials using different outcome
measures (Steinman 2005). Compared to existing treatments, the
efficacy of Tysabri is quite dramatic. However, several cases of
progressive multifocal leukoencephalopathy (PML), a lethal
resurgence of a latent viral infection linked to the
immunosuppressive action of the drug, led to withdrawal (Rudick,
Stuart et al.). Tysabri has now been reintroduced into the market
with much stricter patent monitoring. Tysabri likely blocks both
T.sub.H-17 and T.sub.H1 cells. A novel small molecule drug that is
specific for T.sub.H-17 cells and does not compromise the antiviral
activity of T.sub.H1 cells could be safer and more effective for
several reasons: (1) a small molecule drug, administered daily, can
be rapidly withdrawn if significant side effects occur; (2) a small
molecule drug is more readily manufactured and more easily
administered than a biologic, such as Tysabri; and (3) T.sub.H1
cells suppress T.sub.H-17 differentiation and thus specific
inhibition of T.sub.H-17 cells may be more effective.
[0022] A number of other small molecule drugs are marketed for
autoimmune diseases such as rheumatoid arthritis, IBD, and
psoriasis. Many of these, such as methotrexate or azathioprine,
carry significant toxicity because of anti-metabolite or
anti-mitotic effects. Dosing is usually limited. A small molecule
drug that has a more specific mechanism of action, such as
inhibition of T.sub.H-17 cells or other IL-17 expressing T cells,
are likely to be safer and, hence, more efficacious as dosages may
be elevated to have a substantial inhibitory effect on target
cells.
[0023] Pharmacologically useful ligands to members of the ROR
family of orphan nuclear receptors have not been identified in the
published literature. Cholesterol and cholesterol sulfate occupy
the ligand binding pocket within the receptor LBD of ROR.alpha. as
determined by x-ray crystallography (Kallen, Schlaeppi et al. 2002;
Kallen, Schlaeppi et al. 2004), but, due to the fact that these
molecules are plentiful in normal cells, it has not been possible
to use these molecules in order to characterize ROR.alpha. as a
pharmacological target (Moraitis and Giguere 2003). A series of
ROR.alpha. ligands was published in 1996 (Missbach, Jagher et al.
1996; Wiesenberg, Chiesi et al. 1998), but these findings have not
been independently replicated or evaluated by functional criteria
described below. One of the proposed ligands for ROR.beta.,
melatonin, has been challenged in the literature (Becker-Andre,
Wiesenberg et al. 1994; Greiner, Kirfel et al. 1996; Becker-Andre,
Wiesenberg et al. 1997). More recently, it was proposed that
all-trans retinoic acid and the synthetic retinoid ALRT 1550 are
functional ligands for ROR.beta. and that these two ligands also
regulate ROR.gamma. in a similar manner, in both cases inhibiting
the transcriptional activity of the receptors. All-trans retinoic
acid and ALRT 1550 were referred to as "functional" ligands because
they were presumed to both bind and regulate transcription through
ROR.beta.. The ligands are unlikely to be useful pharmacologically
because they are potent activators of the retinoid receptors,
RAR.alpha., RAR.beta., RAR.gamma. (Thacher, Vasudevan et al. 2000).
Therefore all of these ligands fail the test of functional
usefulness either on the criterion that their effects have not been
reproducible, or because they are ubiquitous, or because they lack
specificity. This application describes assay for ROR.gamma., and
ROR.gamma. ligands that have pharmacologically useful potency (in
the range of 50 nM to 1 .mu.M), that have good selectivity, as
demonstrated by assays for other members of the nuclear receptor
family. These ligands, both agonists and antagonists, have
drug-like properties as indicated by rational structure activity
relationships among analogues as well as other drug-like properties
such as bioavailability and activity in cellular and animal models.
Specific ROR.gamma. antagonists are predicted to be highly useful
in treatment of autoimmune disease by blocking T.sub.H-17 function.
Agonists of ROR.gamma. are predicted to enhance immunity and to
have application in stimulation of vaccination and in adjuvant
cancer therapy.
SUMMARY OF THE INVENTION
[0024] The present invention provides a method of inhibiting
T.sub.H-17 cell differentiation from naive T cells, or T.sub.H-17
cell function/activity, comprising contacting a population of T
cells that may include T.sub.H-17 cells with an effective amount of
an antagonist of retinoic acid related orphan receptor .gamma.
(ROR.gamma.). In one embodiment, T.sub.H-17 cell function/activity
is release of a cytokine. The cytokine may be interleukin-17 or
interleukin-22. In one embodiment, the ROR.gamma. antagonist is at
least 20-fold more potent as an ROR.gamma. antagonist than as an
LXR agonist. In another embodiment, the T.sub.H-17 cell
differentiation or cytokine release is associated with an
inflammatory or an autoimmune disorder. In another embodiment, the
inflammatory or autoimmune disorder is arthritis, diabetes,
multiple sclerosis, uveitis, rheumatoid arthritis, reactive
arthritis, sarcoidosis, psoriasis, psoriatic arthritis, asthma,
bronchitis, allergic rhinitis, chronic obstructive pulmonary
disease, atherosclerosis, H. pylori infections, ulcers resulting
from H. pylori infections, inflammatory bowel disease, Crohn's
Disease ulcerative colitis or sprue. Preferably, the ROR.gamma.
antagonist is a small molecule drug, and is preferably not a
polynucleotide. In one embodiment, the antagonist has the
structure:
##STR00001##
[0025] wherein R.sub.1=H, C.sub.1-C.sub.6 alkyl, F, Cl, Br, I, NO2;
R.sub.2=C.sub.1-C.sub.4 alkyl; and X=OH, or a pharmaceutically
acceptable salt, prodrug, derivative or metabolite thereof.
[0026] In one embodiment, the antagonist is OR-1050. In another
embodiment, the antagonist has the structure:
##STR00002##
[0027] wherein X=O or is absent (X=H,H), or a pharmaceutically
acceptable salt, prodrug, derivative or metabolite thereof.
[0028] In other embodiments, the antagonist is OR-885, OR-345,
OR-13571, OR-2161, OR-133171, or a pharmaceutically acceptable
salt, prodrug, derivative or metabolite thereof.
[0029] The present invention also provides a method of inhibiting
T.sub.H-17 cell differentiation from naive T cells, or T.sub.H-17
cell function/activity, in an individual in need thereof,
comprising administering an effective amount of an ROR.gamma.
antagonist to the individual. In one embodiment, the T.sub.H-17
cell function/activity is release of a cytokine. In one embodiment,
the cytokine is interleukin-17 or interleukin-22. In another
embodiment, the ROR.gamma. antagonist is at least 20-fold more
potent as ROR.gamma. antagonist than as LXR agonist. In one
embodiment, the ROR.gamma. antagonist is orally administered. In
another embodiment, the ROR.gamma. antagonist is administered on a
daily basis without resulting in weight loss or
hypertriglyceridemia. In another embodiment, the T.sub.H-17 cell
differentiation or cytokine release is associated with an
inflammatory or autoimmune disorder. In another embodiment, the
inflammatory or autoimmune disorder is arthritis, diabetes,
multiple sclerosis, uveitis, rheumatoid arthritis, reactive
arthritis, sarcoidosis, psoriasis, psoriatic arthritis, asthma,
bronchitis, allergic rhinitis, chronic obstructive pulmonary
disease, atherosclerosis, H. pylori infections, ulcers resulting
from H. pylori infections or inflammatory bowel disease, Crohn's
Disease, ulcerative colitis, or sprue. In one embodiment, the
antagonist has the structure:
##STR00003##
[0030] wherein R.sub.1=H, C.sub.1-C.sub.6 alkyl, F, Cl, Br, I,
NO.sub.2; R.sub.2=C.sub.1-C.sub.4 alkyl; and X=OH, or a
pharmaceutically acceptable salt, prodrug, derivative or metabolite
thereof.
[0031] In one embodiment, the antagonist is OR-1050. In another
embodiment, the antagonist has the structure:
##STR00004##
[0032] wherein X=O or is absent (X=H,H), or a pharmaceutically
acceptable salt, prodrug, derivative or metabolite thereof.
[0033] In another embodiment, the antagonist is OR-885, OR-345,
OR-13571, OR-2161, OR-133171 or a pharmaceutically acceptable salt,
prodrug, derivative or metabolite thereof.
[0034] The present invention also provides a method of treating an
inflammatory or autoimmune disease in an individual, comprising
identifying an individual in need of such treatment, and
administering an effective amount of an ROR.gamma. antagonist the
individual. In another embodiment, the ROR.gamma. antagonist is at
least 20-fold more potent as ROR.gamma. antagonist than as LXR
agonist. In one embodiment, the ROR.gamma. antagonist is orally
administered. In another embodiment, the ROR.gamma. antagonist is
administered on a daily basis without resulting in weight loss or
hypertriglyceridemia. In one embodiment, the inflammatory or
autoimmune disorder is arthritis, diabetes, multiple sclerosis,
uveitis, rheumatoid arthritis, reactive arthritis, sarcoidosis,
psoriasis, psoriatic arthritis, asthma, bronchitis, allergic
rhinitis, chronic obstructive pulmonary disease, atherosclerosis,
H. pylori infections, ulcers resulting from H. pylori infections or
inflammatory bowel disease. In one embodiment, the inflammatory
bowel disease is Crohn's disease, ulcerative colitis or sprue.
Preferably, the ROR.gamma. antagonist is a small molecule drug. It
is preferably not a polynucleotide, including DNA, antisense,
siRNA, and the like. In one embodiment, the antagonist has the
structure:
##STR00005##
[0035] wherein R1=H, C1-C6 Alkyl, F, Cl, Br, I, NO2; R2=C1-C4
Alkyl; and X=OH, or a pharmaceutically acceptable salt, prodrug,
derivative or metabolite thereof.
[0036] In one embodiment, the antagonist is OR-1050. In another
embodiment, the antagonist has the structure
##STR00006##
[0037] wherein X=O or is absent (X=H,H), or a pharmaceutically
acceptable salt, prodrug, derivative or metabolite thereof. In
other embodiments, the antagonist is OR-885, OR-345, OR-13571,
OR-2161, OR-133171 or a pharmaceutically acceptable salt, prodrug,
derivative or metabolite thereof.
[0038] The present invention also provides a method of screening
for agonists or antagonists to ROR.alpha., ROR.gamma. or ROR.beta.,
comprising contacting a compound with a labeled, expressed ROR LBD
and a labeled peptide that includes residues 710-720 (RTVLQLLLGNP;
SEQ ID NO: 2) of human RIP140; and measuring the proximity of the
two labels, wherein binding of labeled peptide identifies the
compound as an agonist and displacement of labeled peptide
identifies the compound as an antagonist. In one embodiment, the
proximity of the two labels is measured using radioactive or
fluorescent probes. In another embodiment, the ROR LBD is labeled
with glutathione-S-transferase (GST), and the peptide is labeled
with biotin. In another embodiment, wherein the peptide has the
sequence ERRTVLQLLLGNSNK (SEQ ID NO: 3), wherein biotin is linked
to the N-terminus of the peptide by an aminohexanoic acid
linker.
[0039] The present invention also provides a method of increasing
the number of T cells reactive to a specific antigen, comprising
administering an ROR.gamma. agonist in conjunction with, or
subsequent to, administration of the antigen.
[0040] The present invention also provides a method of increasing
the immunogenicity of an immunogenic composition in an individual
in need thereof, comprising administering an
immunogenicity-increasing amount of an ROR.gamma. agonist in
conjunction with, or subsequent to, the immunogenic composition. In
one embodiment, the immunogenic composition is a vaccine
composition. In another embodiment, the vaccine composition is an
attenuated live vaccine or a non-replicating and/or subunit
vaccine, wherein the vaccine induces memory T.sub.H-17 cells
specific for said vaccine. In one embodiment, the vaccine is a
tumor vaccine, viral vaccine, bacterial vaccine or parasitic
vaccine. In one embodiment, the viral vaccine is a DNA viral
vaccine, an RNA viral vaccine or a retroviral viral vaccine.
[0041] The present invention also provides a method of increasing
mucosal immunity to a preselected antigen, comprising administering
to a subject a mucosal immunity-increasing amount of an ROR.gamma.
agonist in conjunction with, or subsequent, to the antigen. In one
embodiment, the antigen is a bacterial antigen, viral antigen or
tumor antigen.
[0042] The present invention also provides a method of enhancing
induction, expression and/or release of a pro-inflammatory
cytokine, a pro-inflammatory cytokine receptor, a pro-inflammatory
chemokine or a pro-inflammatory chemokine receptor in cells capable
of expressing said cytokine, cytokine receptor, chemokine or
chemokine receptor, comprising administering an ROR.gamma. agonist
to the cells. In one embodiment, the ROR.gamma. agonist is a small
organic molecule, protein, peptide, nucleic acid, carbohydrate or
antibody. In another embodiment, the pro-inflammatory cytokine is
IL-17 or IL-22. In one embodiment, the cells are contacted in
vitro, ex vivo or in vivo.
[0043] The present invention also provides a method of inducing
T.sub.H-17 cell differentiation and/or transcription of IL-17
and/or IL-22 in a population of T cells that may include T.sub.H-17
cells, comprising contacting the cells with an effective amount of
an ROR.gamma. agonist. In one embodiment, the cells are contacted
in vitro, ex vivo or in vivo.
[0044] The present invention also provides a method of inducing
T.sub.H-17 cell differentiation in an individual in need thereof,
comprising administering an effective T.sub.H-17 cell
differentiation-inducing amount of an ROR.gamma. agonist to the
individual
[0045] The present invention also provides a method of inhibiting
T.sub.H-17 cell differentiation and/or release of IL-17 and/or
IL-22, comprising administering an effective amount of an
ROR.gamma. antagonist to a population of T cells that may include
T.sub.H-17 cells. In one embodiment, the antagonist is a small
organic molecule, protein, peptide, nucleic acid, carbohydrate or
antibody. In another embodiment, the T cell is a CD4+ T cell, a
CD8+ T-cell or a TCR.gamma..delta.+ T cell. In one embodiment, the
antagonist is administered in vitro, ex vivo or in vivo.
BRIEF DESCRIPTION OF THE DRAWINGS
[0046] FIG. 1. Naive T cell differentiation in mouse. T.sub.H-17
cell differentiation is independent of T.sub.H1 and T.sub.H2.
IFN.gamma. and IL-4, from T.sub.H1 and T.sub.H2, respectively,
antagonize T.sub.H-17 differentiation, while TGF.beta. and IL-6
stimulate T.sub.H-17 differentiation. ROR.gamma.t is required for
T.sub.H-17 cell formation, and its expression appears to take place
early in differentiation (Ivanov, McKenzie et al. 2006). IL-23
appears to have a stimulatory effect on the differentiated
T.sub.H-17 cell.
[0047] FIG. 2. Nuclear Receptor Structure. The activation
function-1 (AF-1) domain induces gene transcription independently
of ligand. The activation function-2 domain (AF-2) is a part of the
LBD and is required for the ligand-dependent transcriptional
effect.
[0048] FIG. 3. Dose response of ROR.gamma. antagonists in a Chinese
Hamster Ovary (CHO) cell assay of transcription. CHO cells were
transfected with an expression plasmid encoding a fusion of the
DNA-binding domain (DBD) of the yeast transcriptional factor Gal4
with the ligand-binding domain of mouse ROR.gamma.
(Gal4-mROR.gamma.). A luciferase reporter containing a 5.times.Gal4
response element at its promoter region was cotransfected with the
receptor chimera. T0901317 (Schultz, Tu et al. 2000) and OR-1050
are added in DMSO and each point is the median of triplicate
values, normalized to a DMSO-only control.
[0049] FIGS. 4A-B. Identification and characterization of
ROR.gamma. agonists. To lower the transcriptional basal activity of
ROR.gamma. in CHO cells and increase the dynamic range for
ROR.gamma. activation by agonists, one micromolar of the ROR.gamma.
antagonist T0901317 (Cayman Chemical, Ann Arbor Mich.) was added to
the cell-based assay described in FIG. 3. (FIG. 4A) OR-942
(hyodeoxycholic acid methyl ester) was identified as an agonist in
the transcriptional assay. When OR-942 was tested alone,
GAL4-ROR.gamma. transcriptional activity was only modestly elevated
in CHO cells. In the presence of the antagonist T0901317, however,
ROR.gamma. displays lowered basal activity and OR-942 activates
ROR.gamma. transcriptional activity by approximately 8-fold.
[0050] (FIG. 4B) The agonist activity of OR-942 was confirmed in a
biochemical assay based on coregulatory peptide recruitment. OR-942
induces an interaction between partially purified ROR.gamma. LBD,
expressed as a fusion protein with glutathione-S-transferase
(GST-ROR.gamma.), and a 15-mer peptide (ERRTVLQLLLGNPTK; SEQ ID NO:
4), or peptide K, derived from the human coregulator protein RIP140
(Lee, Elwood et al. 2002). The peptide is biotinylated at the
amino-terminal. The interaction of peptide K and GST-ROR.gamma. was
followed by fluorescence resonance energy transfer (FRET). The two
components of the assay were labeled with an anti-GST antibody
coupled to allophycocyanin (APC) and streptavidin-R-phycoerythrin
(SA-RPE). FRET units were calculated as the fractional increase
(.times.100) of the APC/RPE fluorescence ratio over the value
obtained in the presence of a mutated form of the K peptide (Kmut,
ERRTVLQLVVGNPTK; SEQ ID NO: 5), also biotinylated at the N-terminal
amino acid residue, that substitutes two of the leucine residues
required for coactivator peptide binding (Darimont, Wagner et al.
1998; Li, Lambert et al. 2003) with valine.
[0051] FIG. 5. The ROR.gamma. antagonist T0901317 has the
properties of a competitive antagonist to OR-942. A dose response
of the ROR.gamma. agonist OR-942 was carried out in the biochemical
assay with GST-ROR.gamma. and peptide K. The effect of the
antagonist T0901317 is to shift the estimated EC.sub.50 of OR-942
from 0.4 .mu.M to 4 .mu.M, consistent with competition for a single
binding site on ROR.gamma.. Each point is the median of triplicate
values.
[0052] FIG. 6. Simultaneous characterization of an ROR.gamma.
agonist and antagonist in the biochemical assay for ROR.gamma.. The
activities of OR-1050 and OR-12872 were compared in a coregulatory
peptide recruitment assay that uses peptide biotinylated K1 (from
RIP140 of rat) instead of peptide K (from RIP140 of human). The
sequence of peptide K1 is ERRTVLQLLLGNSNK (SEQ ID NO: 3). The
mutated form of the K1 peptide (K1mut, ERRTVLQLVVGNSNK; SEQ ID NO:
6) was used as a control. The biotin was separated from the K1 and
K1mut N-terminus by an aminohexanoic acid linker. The combination
of GST-ROR.gamma. and peptide K1 has a significant FRET value in
the absence of added ligand, and this enables characterization of
both agonist and antagonist in the same assay format. Values are
the average of duplicate measurements.
[0053] FIG. 7. Regulation of T.sub.H-17 cell differentiation by
ROR.gamma. ligands. Naive CD4.sup.+CD62L.sup.+ T cells were
incubated for five days in the presence of IL-6 and TGF.beta. and
0.01% DMSO. On day 5, a high level of intracellular cytokine
expression is induced by combination of treatment with a phorbol
ester, ionomycin, and brefeldin A, and T.sub.H-17 and T.sub.H1
cells identified by intracellular staining with antibodies to IL-17
and IFN-.gamma., respectively. The percentage of IL-17 positive
cells, or T.sub.H-17 cells, was calculated as a fraction of total
live cells. OR-1050 decreases the proportion of IL-17.sup.+ cells
while OR-12872 increases the fraction of IL-17.sup.+ cells. Each
treatment was performed in duplicate (mean.+-.SD, n=2)
[0054] FIGS. 8A-D. An ROR.gamma. agonist (OR-12872) reverses
antagonist (OR-1050) effects on regulation of T.sub.H-17 cell
differentiation. The methods follow FIG. 7. Each treatment was
performed in duplicate, and a representative scatterplot for each
treatment is shown. FIG. 8A: control; FIG. 8B: 3 .mu.m OR-1050;
FIG. 8C: 3 .mu.m OR-12872; FIG. 8D: 3 .mu.m OR-1050+3 .mu.m
OR-12872.
[0055] FIG. 9A-D. OR-885 inhibits T.sub.H-17 differentiation and
OR-12872 reverses its antagonistic effect. The methods follow FIGS.
7 and 8. Each treatment was performed in duplicate, and a
representative scatterplot for each treatment is shown. FIG. 9A:
control; FIG. 9B: 3 .mu.m OR-885; FIG. 8C: 1 .mu.m OR-112872; FIG.
8D: 3 .mu.m OR-885+1 .mu.m OR-12872.
[0056] FIG. 10. IL-17 release into culture medium was measured four
days after induction of T.sub.H-17 differentiation in CD4.sup.+
naive murine T cells, following the methods of FIG. 7. Each
antagonist (OR-885, OR-1050, OR-13571, and OR-2161) was incubated
in the cultures at 3 .mu.M, in the presence or absence of OR-12872,
also at 3 .mu.M. On day 4, culture supernatants were saved and
IL-17 measured by ELISA.
[0057] FIGS. 11A-C. ROR.gamma. antagonist inhibits severity, weight
loss, onset, Th-17 frequency and inflammation in EAE models. (FIGS.
11A-C) C57BL/6 mice were immunized with 150 .mu.g MOG.sub.35-55 at
day 0 to induce EAE and were dosed daily with corn oil (vehicle) or
OR-1050 (50 mg/kg, 2.times. per day) by oral gavage starting at day
-1. At Day 26, the spinal cord was removed for analysis of
inflammation (FIG. 11C).
[0058] FIGS. 11D-F SJL/J mice were immunized with 75 .mu.g
PLP.sub.139-151 (Day 0). Osmotic pumps delivering vehicle or
OR-1050 (.about.30 mg/kg) were inserted at Days 3 and 4. Day of
onset (FIG. 11E) compares the first day when EAE severity is 1 or
higher. The ratio of Th-17 cells (CD4.sup.+CD8.sup.-IL17.sup.+) to
total live cells was analyzed in a separate study (F FIG. 11F) at
day 9 after immunization with PLP where mice had been dosed daily
with OR-1050 (100 mg/kg in HRC-6) since day -1. Statistics (panels
A,B,D,F) were performed by Student's t-test. *, P<0.05; #,
P<0.01 (mean.+-.sem, n=7-10) or by the Mann-Whitney rank order
test (FIGS. 11C, E, median values shown).
[0059] FIG. 11G shows the effect of OR-1050 on splenic T.sub.H-17
cells in C57BL/6 mice (29% inhibition, p<0.05, n=8-10) with no
change in T.sub.H1 cells. C57BL/6 female mice were immunized with
150 .mu.g MOG.sub.33-55 on study day 0. Mice were treated with
either OR-1050 at 100 mg/kg or with vehicle (HRC-6) by oral gavage
for 9 days starting day 0. Splenocytes were collected at Day 9 and
stained for T.sub.H-17 (CD4.sup.+CD8.sup.-IL17.sup.+) and T.sub.H1
(CD4.sup.+CD8.sup.-IFN.gamma..sup.+) cells. Statistics were
performed by Student's t-test.
[0060] FIG. 12A. OR-1050 inhibits the onset of paralysis in a
murine model of EAE. This is a separate statistical analysis of
data presented in FIG. 11A. C57BL/6 mice were immunized with
MOG.sub.35-55, an immunogenic peptide derived from myelin
oligodendrocyte glycoprotein, to trigger symptoms of EAE. Mice were
treated with corn oil vehicle or OR-1050 (15 mg/kg or 50 mg/kg)
twice per day by gavage starting one day before injection of
MOG.sub.35-55 and continuing for 25 days after injection. The day
on which a visual, clinical score first reached 1 or greater was
recorded for each mouse, and observations were carried out until
day 26. By a rank order non-parametric test for multiple groups
(Kruskal-Wallis, with Dunn's Multiple Comparison Test for
significance), the onset of EAE (determined as a severity score of
1 or greater) in mice treated with 100 mg/kg OR-1050 per day is
significantly (p<0.05) delayed compared to the vehicle control.
A similar finding was obtained by analysis of day of onset
determined by severity score of 2 or greater.
[0061] FIG. 12B. Bioavailability of OR-1050. OR-1050 was dosed in
CD-1 mice at 5 mg/ml in HRC-6, a proprietary formulation that is
commercially available from Pharmatek (San Diego, Calif.). Blood
samples from triplicate animals were tested for levels of OR-1050
at multiple time points.
[0062] FIGS. 13A-F. IL-17 levels in lymph node cells from mice
immunized with myelin-derived peptides respond to cognate peptide
antigens, IL-23 and ROR.gamma. ligands. (FIG. 13A) SJL/J mice were
immunized by complete Freund's adjuvant (CFA) only or by
Proteolipid Protein residues 139-151 (PLP.sub.139-151) emulsified
in CFA. Lymph nodes were cultured for 3 days in with or without 40
.mu.g/ml PLP in the presence or absence of OR-885. Culture media
were analyzed by ELISA for IL-17. (FIGS. 13B-C) Lymph node cells
from PLP-immunized SJL/J mice were cultured as before with the
addition of 10 ng/ml IL-23 and 3 .mu.M compounds. At the end of 1
day or 3 days in culture, Th-17 (CD4.sup.+CD8.sup.-IL17.sup.+) cell
frequency was measured by FACS (FIG. 13B) and compared to IL-17
levels in culture media (FIG. 13C). (FIG. 13D-F) Lymph node cells
from MOG.sub.35-55 immunized C57BL/6 mice were cultured for 3 days
with 30 .mu.g/ml MOG and/or 10 ng/ml IL-23. ROR.gamma. ligands were
not added (FIG. 13D), or added at the beginning of the culture at a
single concentration (FIG. 13E, 1 .mu.M) or in multiple doses (FIG.
13F).
[0063] FIG. 14. Inhibition of IL-17 release in mouse lymph node
cultures by the ROR.gamma. antagonist OR-885 can be reversed by the
ROR.gamma. agonist OR-12872. The lymph node cells were culture in
the presence of 10 ng/mL IL-23 and 40 .mu.g/mL PLP for three days
under identical conditions to FIG. 13 and IL-17 in the culture
supernatant was measured by ELISA.
[0064] FIGS. 15A-B. IL-22 release in lymph node cultures is
regulated by ROR.gamma. ligands. Lymph node cells from
MOG-immunized C57BL/6 mice were cultured for 3 days with 30
.mu.g/ml MOG, 10 mg/ml IL-23 (FIG. 15A) and 3 .mu.M compounds (FIG.
15B). Culture media were analyzed by IL-22 ELISA.
[0065] FIGS. 16A-C. Human IL-17 release from activated human T
cells is inhibited by ROR.gamma. antagonist and is partially
reversible in the presence of OR-12872, an ROR.gamma. agonist. In
FIG. 16A, PBMCs were exposed to 1 .mu.g/ml Con A for 3 days and
treated simultaneously with 3 .mu.M OR-885 or DMSO carrier in the
presence or absence of 3 .mu.M OR-12872. In FIG. 16B, PBMCs were
treated for 3 days in the presence 1 .mu.g/mL Con A and 3 .mu.M of
the following compounds: OR-13571, OR-1050, or OR-12872 alone or in
combination. In FIG. 16C, T cell blasts were treated with OR-1050,
OR-13571, and OR-12872 in the presence of a phorbol ester for 18
hours to induce cytokine release.
[0066] FIGS. 17A-B. ROR.gamma. antagonist regulation of CIA in
DBA/1 mice. Mice were immunized with bovine type II collagen (CII)
at days 0 and 29. (FIG. 17A) Arthritic scores in hind limb (max
score=8) for vehicle-treated (n=15) or 100 mg/kg/day
OR-1050-treated (n=12) animals. (FIG. 17B) Disease intensity
(Mean.+-.SEM) is the area under the curve (AUC) for hind limb
clinical scores from day 24 to 48. AUC scores for the two groups
were compared by the Mann-Whitney rank order test (one-tailed) to
determine statistical significance.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
[0067] The present invention includes the discovery that small
molecule antagonists to retinoic acid related orphan receptor
.gamma. (ROR.gamma.) inhibit T.sub.H-17 cell differentiation from
naive mouse T cells in cell culture, and inhibit the release of
cytokines from mouse and human T.sub.H-17 cells. These small
molecule antagonists have unique and beneficial properties for
treatment of inflammatory and autoimmune diseases, since they
inhibit the release of several pro-inflammatory cytokines from
T.sub.H-17 cells, including IL-17 and IL-22. Conversely, a potent
ROR.gamma. agonist can enhance T.sub.H-17 cell formation and
reverse the antagonist effect. These small molecule inhibitors can
be used to treat a variety of inflammatory and autoimmune disorders
including, but not limited to, arthritis, diabetes, multiple
sclerosis, uveitis, rheumatoid arthritis, psoriasis, asthma,
bronchitis, allergic rhinitis, chronic obstructive pulmonary
disease, atherosclerosis, H. pylori infections, ulcers resulting
from H. pylori infections and inflammatory bowel disease (IBD). IBD
includes, but is not limited to, Crohn's disease, ulcerative
colitis and sprue.
[0068] ROR.gamma. agonists and antagonists are fairly specific to
T.sub.H-17 cells and do not appear to have a primary effect on
T.sub.H1 cells. Several strategies that inhibit development or
activity of T.sub.H-17 cells for the treatment of MS and other
autoimmune diseases can be envisioned, but these primarily involve
treatment with macromolecules such as antibodies that block IL-23
or IL-17 (Bowman, Chackerian et al. 2006) or cytokines that inhibit
T.sub.H-17 cell function (Batten, Li et al. 2006; Stumhofer,
Laurence et al. 2006). ROR.gamma. antagonists offer the first
approach to specifically block T.sub.H-17 development with small
molecule drugs. An ROR.gamma. antagonist offers superior properties
for human dosing and therapeutic use such as oral bioavailability.
The following definitions are provided:
[0069] A receptor antagonist is a molecule that inhibits the normal
physiological function of a receptor. Many drugs work by blocking
the action of endogenous receptor agonists such as hormones and
neurotransmitters. Antagonists that compete with an agonist for a
receptor are competitive antagonists. Those that antagonize by
other means are non-competitive antagonists.
[0070] A receptor agonist is a molecule that, in the nuclear
receptor context, increases the transcriptional activity of a
receptor or overcomes the activity of a competitive receptor
antagonist.
[0071] A small molecule drug is an orally or intravenously
bioavailable compound having a molecular weight less than about 600
daltons.
[0072] Related Nuclear Receptor.
[0073] The human and mouse families of nuclear receptors comprise
48 members (Laudet 1999), and these have been arranged in both
families (e.g., family 1, including both ROR.gamma. and LXR.alpha.)
and subfamilies (e.g., NR1F) that include ROR.alpha., ROR.beta.,
and ROR.gamma.. For the purposes of this discussion, related
nuclear receptors are those that belong to a single receptor
subfamily, such as NR1F, and unrelated nuclear receptors may belong
to the same family but to different subfamilies.
[0074] A confirmed hit at ROR.gamma. is a small molecule compound
that regulates transcription through ROR.gamma. and also regulates
the affinity of the ROR.gamma. LBD with an appropriate coregulatory
peptide in a validated assay for the receptor.
[0075] Potency. A measure of compound concentration required to
activate or inhibit a pharmacological endpoint. Potency is often
estimated as EC.sub.50 (effective concentration producing a 50%
effect) or by similar measures known to those skilled in the art of
pharmacology.
[0076] Rank order of potency is a method of comparing small
molecule ligand pharmacology data from two separate assays.
Compounds are ranked by EC.sub.50 or other measure of potency in
each of the two assays. The purpose of this ranking is to provide a
method of comparing the results of two different assays for which
absolute compound potencies may differ.
[0077] A transcriptional assay for a nuclear receptor measures
regulation of gene expression of a target gene that contains a
response element for that receptor in its promoter region. Promoter
regions can be engineered to contain appropriate response elements
and these in turn can be coupled to a variety of reporter genes.
Such assays are widely used to characterize nuclear receptor
function and utilize target genes, such as chloramphenicol acetyl
transferase (CAT), luciferase (LUC), and beta-lactamase (BLA). The
activity of these enzymes is readily assayed in cell extracts or
whole cells. Nuclear receptor assays also take advantage of the
fact that the ligand-binding domain (LBD) of the receptor can
function independently of its DNA-binding domain (DBD). Chimeric
receptors that contain a common DBD, for example the DBD of the
yeast transcriptional factor GAL4 (Webster, Green et al. 1988), are
fused to the LBDs of individual nuclear receptors. Multiple nuclear
receptor LBDs, fused to the same DBD, may be screened against a
common target gene that contains the response element for that DBD
(Schultz, Tu et al. 2000). Chimeric receptors are co-transfected
individually with the common target gene. Ligands effects are
determined after incubation for a sufficient period of time
according to changes in level of expression of the target gene.
[0078] A biochemical assay for a nuclear receptor is carried out in
the presence of partially purified receptor LBD and, directly or
indirectly, measures binding of ligand. Two methods are commonly
used: (i) competitive displacement of known, labeled ligand and
(ii) recruitment of coregulatory peptide. Coregulatory peptide
recruitment takes advantage of the fact that the receptor LBD will
usually bind short peptides derived from conserved sequences within
the so-called coregulatory proteins in a manner that depends on the
presence or absence of ligand (Bramlett, Yao et al. 2000; Lee,
Elwood et al. 2002; Wu, Chin et al. 2002). Coregulatory proteins in
turn are required for transcriptional regulation in response to
ligand binding to the receptor (McKenna and O'Malley 2002). Both
receptor LBD and peptide are tagged with molecular markers, and the
degree of association of these markers determined in the presence
or absence of ligand.
[0079] ROR.gamma.. The gene that encodes ROR.gamma. (RORc)
undergoes alternative splicing to give rise to two splicing
isoforms, ROR.gamma. and ROR.gamma.t. The expression of ROR.gamma.
is widespread, and mRNA for ROR.gamma. appears in liver, muscle,
fat and many other tissues (Jetten, Kurebayashi et al. 2001). The
ROR.gamma.t splicing isoform is predicted to generate a protein
that is truncated by 21 amino acids at the N-terminus of ROR.gamma.
(He, Deftos et al. 1998). ROR.gamma.t is expressed predominantly in
thymocytes, lymph node precursors known as LTi cells, in T.sub.H-17
cells, and in other T cells, including a subpopulation of
CD8.sup.+, .gamma..gamma.TCR.sup.+, and NKT cells (Ivanov, McKenzie
et al. 2006; Ivanov and Littman. 2007). The ROR.gamma.t isoform
contains an LBD that is identical to ROR.gamma.. For the purpose of
this application, the two receptors may be referred to collectively
as ROR.gamma..
[0080] ROR.gamma. Function. Nuclear receptors are thought to act
primarily as nuclear transcription factors, by regulating gene
expression. Some nuclear receptors have been shown to have acute,
non-genomic effects that cannot be explained by gene transcription.
Examples include the thyroid and estrogen receptors (Hiroi, Kim et
al. 2006). Although a transcriptional assay is useful for
identification of ROR.gamma. ligands, the ligand response of
ROR.gamma. may include direct activation of other cell-signaling
pathways, such as those mediated by kinases, phosphatases, or
levels of intracellular messengers.
[0081] FITC--Flourescein isothiocyanate
[0082] APC--allophycocyanin
[0083] PE--phycoerythrin
[0084] LBD--ligand-binding domain
[0085] DBD--DNA-binding domain
[0086] FRET--Fluorescence resonance energy transfer
[0087] The T.sub.H-17 cell is recently-described subset of
CD4.sup.+ T helper cells that expresses IL-17 and IL-17F, as well
as other cytokines, including pro-inflammatory cytokines such as
IL-22 (Liang, Tan et al. 2006). The T.sub.H-17 cell also expresses
the autocrine cytokine, IL-21. Other T cells may also express
ROR.gamma.t and IL-17. The most prevalent type of IL-17.sup.+ T
cell in the gut is the TCR.alpha..beta..sup.+CD4.sup.+ T.sub.H-17
cell (Ivanov, McKenzie et al. 2006), while the .gamma..delta. T
cell is the primary source of IL-17 in response to pulmonary
infection (Lockhart, Green et al. 2006). In addition, CD8.sup.+ T
cells, .gamma..delta. T cells and NKT cells also express
ROR.gamma.. Thus, T.sub.H-17 cells are a subset of IL-17.sup.+ T
cells. A significant fraction of the IL-17+ T cells appear to be
ROR.gamma.t.sup.+ (Ivanov and Littman 2007).
[0088] Pharmaceutical composition refers to a mixture of ROR.gamma.
antagonist or inhibitor, or a pharmaceutically acceptable salt,
prodrug, derivative or metabolite thereof, with other chemical
components, such as diluents or carriers. The pharmaceutical
composition facilitates administration of the compound to an
organism. Multiple techniques of administering a compound exist in
the art including, but not limited to, oral, injection, aerosol,
parenteral, and topical administration. Pharmaceutical compositions
can also be obtained by reacting compounds with inorganic or
organic acids such as hydrochloric acid, hydrobromic acid, sulfuric
acid, nitric acid, phosphoric acid, methanesulfonic acid,
ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the
like.
[0089] Carrier defines a chemical compound that facilitates the
incorporation of a compound into cells or tissues. For example
dimethyl sulfoxide (DMSO) is a commonly utilized carrier as it
facilitates the uptake of many organic compounds into the cells or
tissues of an organism.
[0090] Diluent defines chemical compounds diluted in water that
will dissolve or suspend the compound of interest and preferably
also stabilize the biologically active form of the compound. Salts
dissolved in buffered solutions are utilized as diluents in the
art. One commonly used buffered solution is phosphate buffered
saline because it mimics the salt conditions of human blood. Since
buffer salts can control the pH of a solution at low
concentrations, a buffered diluent rarely modifies the biological
activity of a compound.
[0091] Physiologically acceptable defines a carrier or diluent that
is suitable for in vivo administration.
[0092] Pharmaceutically acceptable salt refers to a salt form of an
original compound formed by association of a counterion with that
compound, wherein the counterion is generally nontoxic.
Pharmaceutical salts can be obtained, for example, by reacting a
compound of the invention with inorganic acids such as hydrochloric
acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric
acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic
acid, salicylic acid and the like. Pharmaceutical salts can also be
obtained by reacting a compound of the invention with a base to
form a salt such as an ammonium salt, an alkali metal salt, such as
a sodium or a potassium salt, an alkaline earth metal salt, such as
a calcium or a magnesium salt, a salt of organic bases such as
dicyclohexylamine, N-methyl-D-glutamine,
tris(hydroxymethyl)methylamine, and salts with amino acids such as
arginine, lysine, and the like.
[0093] Metabolite refers to a compound to which a ROR.gamma.
antagonist or agonist is converted within the cells of a mammal.
The pharmaceutical compositions of the present invention may
include a metabolite of a ROR.gamma. antagonist instead of the
ROR.gamma. antagonist. The scope of the methods of the present
invention includes those instances where the ROR.gamma. antagonist
is administered to the patient, yet the metabolite is the bioactive
entity.
[0094] Prodrug refers to an agent that is converted into the parent
drug in vivo. Prodrugs are often useful because, in some
situations, they may be easier to administer than the parent drug.
They may, for instance, be bioavailable by oral administration
whereas the parent is not. The prodrug may also have improved
solubility in pharmaceutical compositions over the parent drug. An
example, without limitation, of a prodrug would be a compound of
the present invention which is administered as an ester (the
"prodrug") to facilitate transmittal across a cell membrane where
water solubility is detrimental to mobility but which then is
metabolically hydrolyzed to the carboxylic acid, the active entity,
once inside the cell where water-solubility is beneficial. A
further example of a prodrug might be a short peptide
(polyaminoacid) bonded to an acid group where the peptide is
metabolized to reveal the active moiety.
[0095] In a further aspect, the present invention relates to a
method of treating a patient with a pharmaceutical composition as
described herein.
[0096] The term "treating" or "treatment" does not necessarily mean
total cure. Any alleviation of any undesired signs or symptoms of
the disease to any extent or the slowing down of the progress of
the disease can be considered treatment. Furthermore, treatment may
include acts that may worsen the patient's overall feeling of well
being or appearance. Treatment may also include lengthening the
life of the patient, even if the symptoms are not alleviated, the
disease conditions are not ameliorated, or the patient's overall
feeling of well being is not improved.
ROR.gamma. Antagonists
[0097] The present invention provides compounds that selectively
inhibit the transcriptional activity of the orphan nuclear receptor
ROR.gamma.. These ROR.gamma. antagonists may be small organic
molecules, proteins, peptides, nucleic acids, carbohydrates or
antibodies. These compounds permit the properties of ROR.gamma. as
a pharmacological target to be investigated in isolated cells and
in animals. Further, the invention provides for novel methods of
treating autoimmune disease and related conditions by inhibiting
the function and/or activity of TH-17 cells, or by inhibiting the
differentiation of TH-17 cells, or by inhibiting IL-17 and IL-22
release in a population of T cells that may include TH-17 cells
(e.g., CD4+ T cells) and other ROR.gamma.t+IL-17+ T cells such as
CD8+ T cells, NKT, or TCR.gamma..delta.+ T cells, through
suppression of the activity of ROR.gamma.. In examples shown
herein, specific compounds that inhibit or activate transcription
through the ROR.gamma. LBD, respectively ROR.gamma. antagonists or
agonists, are described, and structurally distinct antagonists of
ROR.gamma. transcription specifically inhibit the differentiation
of CD4.sup.+ T.sub.H-17 cells from naive CD4.sup.+ T cells.
Furthermore, the structurally distinct antagonists also inhibit the
release of IL-17 from murine T.sub.H-17 cells during
differentiation or from memory IL-17.sup.+ T cells in lymph node
cultures. In addition, the structurally diverse ROR.gamma.
antagonists inhibit IL-17 release from human peripheral blood
mononuclear cells (PBMCs).
[0098] The examples demonstrate that pharmacologically useful small
molecules for cellular studies can be identified by receptor
assays. To be useful, the molecules should be active in an assay of
receptor-mediated transcription. Second, in addition to activity in
a transcriptional assay, such molecules should be active in a
second receptor assay that uses a mechanistically distinct readout,
such as coactivator or coregulatory protein or peptide recruitment
to receptor LBD as a function of ligand concentration (Heery,
Kalkhoven et al. 1997; Lee, Elwood et al. 2002). The proximity of
the ROR.gamma. LBD and the coregulatory peptide or macromolecule is
measured by one of several well-established biophysical methods.
Some of these methods, well known to practitioners of the art of
studying protein-peptide interactions, include fluorescence
resonance energy transfer (FRET), fluorescence polarization,
time-resolved FRET (TR-FRET) with europium conjugates as donor, and
Alpha Screen, in which laser-induced oxygen emission from a donor
bead stimulates a fluorophore in an acceptor bead in close
proximity (Iannone, Consler et al. 2001; Lee, Elwood et al. 2002;
Xu, Stanley et al. 2002; Moore, Galicia et al. 2004; Li, Choi et
al. 2005).
[0099] The biochemical assay excludes molecules that
non-specifically regulate an ROR.gamma. reporter gene in culture.
To allow definitive findings in cell experiments, a compound will
ideally have an EC.sub.50<1 .mu.M and measurable cytotoxicity
only at higher concentrations. Finally, such molecules should be
selective for ROR.gamma.. If this is not the case, a secondary
control should be available, for example, an agonist that
demonstrates the reversibility of antagonist effect. Without these
controls, there is the opportunity to confuse an effect of a
non-specific candidate ROR.gamma. ligand on T.sub.H-17 cells with
an authentic activity of the small molecule mediated by interaction
with the LBD of ROR.gamma.. The transcriptional and biochemical
assays described herein can be used to determine the ability of any
small molecule to act as an ROR.gamma. receptor antagonist or
agonist.
[0100] The invention provides examples in which the validity of
certain hits were further confirmed by demonstrating that a series
of related compounds to the hit share a similar rank order of
potency in both the transcriptional and biochemical assays over a
wide range.
[0101] In view of the fact that ROR.gamma.t is required for
CD4.sup.+ T.sub.H-17 cell formation in mice (Littman and Eberl
2006), we tested whether ROR.gamma. ligands specifically inhibit
T.sub.H-17 differentiation from naive CD4.sup.+ T cells in culture
(Mangan, Harrington et al. 2006; Veldhoen, Hocking et al. 2006).
T.sub.H-17 inhibition by small molecule modulation through
ROR.gamma. was verified by several criteria. First, three separate
structurally distinct ROR.gamma. antagonists (OR-1050, OR-885, and
OR-13571, EC.sub.50<1 .mu.M in the transcriptional assay) had
comparable activity in T.sub.H-17 inhibition; second, antagonist
effect could be reversed by a potent and specific agonist
(OR-12872) to ROR.gamma.; and third, the ROR.gamma. ligand effect
was specific for cell culture differentiation of T.sub.H-17 but not
T.sub.H-1 cells.
[0102] Further, the invention provides for molecules with a
reasonable margin of safety. We demonstrated that one of the
ROR.gamma. ligands, OR-1050, can be dosed in mice such that it
should cause a pharmacological effect through ROR.gamma.. We
therefore examined the effect of the compound on function of the
thymus, since the major pool of developing T lymphocytes, the
double positive CD4.sup.+CD8.sup.+ (DP) T cells, expresses
ROR.gamma.t. Germline deletion of ROR.gamma. or ROR.gamma.t leads
to an increased rate of DP thymocyte apoptosis and a reduction in
DP thymocyte number to about 30% of control (Kurebayashi, Ueda et
al. 2000; Sun, Unutmaz et al. 2000; Eberl and Littman 2004).
Therefore, a model study with OR-1050 was used to investigate
possible effects on thymic function. The ROR.gamma. antagonist
OR-1050 also activates the nuclear receptors LXR.alpha. and
LXR.beta., and therefore the bioavailability of OR-1050 could be
demonstrated by induction of triglyceride accumulation in liver
since this is a well-defined endpoint for LXR ligands (Schultz, Tu
et al. 2000; Beyer, Schmidt et al. 2004). The EC.sub.50 for OR-1050
at LXR.alpha. (1.5 .mu.M) is higher than for ROR.gamma. (0.3 .mu.M)
in transcriptional assays, suggesting that ROR.gamma. would also be
antagonized in the drug-treated animals. In a six day study, liver
triglycerides were markedly elevated by daily exposure to 100 mg/kg
OR-1050, but the compound had no effect on the frequency or total
number of the major cell types of the thymus. This invention
therefore provides for compounds that will have limited effects on
the function of the thymus.
[0103] Further, OR-1050 slows the onset of EAE in C57BL/6 female
mice injected with a myelin-derived peptide. The data are
consistent with the prediction that an ROR.gamma. antagonist free
of LXR activity will be effective in this model. In addition,
OR-1050 is demonstrated to have modest bioavailability. The
invention provides a method for selecting compounds that have
negligible or reduced LXR potency while maintaining or improving
ROR.gamma. potency. T0901317 does not elevate liver triglyceride
levels in mice where the LXR.alpha. and LXR.beta. receptors have
been deleted (Schultz, Tu et al. 2000). More specific ROR.gamma.
antagonists are predicted to have beneficial effects in animal
models of CIA, EAE, and IBD while limiting the undesirable
consequences of LXR activation, such as liver triglyceride
accumulation and elevated serum LDL (Schultz, Tu et al. 2000;
Beyer, Schmidt et al. 2004; Groot, Pearce et al. 2005), or other
undesirable consequences, either for safety or efficacy, of
activation, inhibition, or interaction with other known
pharmacological targets.
[0104] In addition, the invention provides for compounds that
suppress IL-17 expression in activated human T cells. Elevated
IL-17 levels in disease tissue are strongly suggested to signal
pathogenic involvement of T.sub.H-17 and other IL-17 positive
cells.
[0105] The advantages of direct targeting of T.sub.H-17 cells with
a small molecule drug could be very significant compared to the
biologics that are very likely under development (Bowman,
Chackerian et al. 2006). In one embodiment, a drug from the
ROR.gamma. antagonist class has good oral bioavailability. In
another embodiment, the drug has a half-life of four hours or more,
enabling once or twice-daily administration. Nuclear receptor
ligands have commonly given rise to orally bioavailable drugs;
OR-1050 is an example of an orally-bioavailable ROR.gamma.
antagonist characterized in these studies. The advantage of an
orally bioavailable drug is: (i) direct oral administration is
feasible; (ii) unlike injectable biologics, which may have an
extremely long half life, a small molecule drug with reasonable
half-life can be withdrawn if necessary to limit side effects and
(iii) small molecule drugs are readily manufactured. Such compounds
may also be selected for clinical development by potency in animal
models of EAE, CIA and IBD and by parallel in vivo studies of
compound safety.
ROR.gamma. Agonists
[0106] ROR.gamma. agonists may be small organic molecules,
proteins, peptides, nucleic acids, carbohydrates or antibodies.
Particularly preferred are small organic molecules. The present
invention also includes methods of increasing the number of T cells
reactive to a specific antigen by administering an ROR.gamma.
agonist in conjunction with, or subsequent to, administration of
the antigen; and for enhancing the differentiation of T.sub.H-17
cells by contacting a population of T cells that may include
T.sub.H-17 cells with an ROR.gamma. agonist. In one embodiment,
agonists of ROR.gamma. are used to enhance or modulate an immune
response. In another embodiment, an ROR.gamma. agonist is used to
enhance the effectiveness of vaccine compositions. Vaccination
remains the primary mechanism of inhibiting the spread of
infectious agents. For newly discovered organisms, vaccination is
the most highly favored option since drug therapy may require
decades to provide clinical options. Although most healthy
individuals respond to the foreign antigen presented by
vaccination, there is a critical need to stimulate the immune
response in the elderly, who are much less responsive to
vaccination in the first place due to aging of their immune system.
Furthermore, subunit vaccines, although easy to prepare since they
are based on exogenously expressed proteins from the pathogen, are
often not highly immunogenic. Thus, concomitant stimulation of the
immune response will improve vaccine take. The vaccine compositions
may be attenuated live vaccines, or non-replicating and/or subunit
vaccines. In one embodiment, these vaccines induce memory
T.sub.H-17 cells specific for the vaccine. Types of vaccines
include, but are not limited to, tumor vaccines, viral vaccines
(DNA, RNA or retroviral), bacterial vaccines and parasitic
vaccines.
[0107] ROR.gamma. agonists can also be used to increase mucosal
immunity to a preselected antigen by administering a mucosal
immunity-enhancing amount of an ROR.gamma. agonist in conjunction
with, or subsequent to, the antigen. The antigen can be bacterial,
viral or a tumor antigen.
[0108] An ROR.gamma. agonist can be used to increase the
immunogenicity of an immunogenic composition (e.g., vaccine
composition) by administering the ROR.gamma. agonist in conjunction
with, or subsequent to, the immunogenic composition. ROR.gamma.
agonists can also be used to enhance induction, expression and/or
release of a pro-inflammatory cytokine (e.g., IL-6, IL-17, IL-22,
IL-3, TNF-.alpha.), a pro-inflammatory cytokine receptor, a
pro-inflammatory chemokine (e.g., CC chemokines, CXC chemokines, C
chemokines, CX.sub.3C chemokines) or a pro-inflammatory chemokine
receptor in cells capable of expressing the cytokine, cytokine
receptor, chemokine or chemokine receptor, by administering the
ROR.gamma. agonist to the cells. The administration may be in
vitro, ex vivo or in vivo.
[0109] The ROR.gamma. agonists described herein also induce
T.sub.H-17 cell differentiation and/or transcription of IL-17
and/or IL-22 in a population of T cells that may include T.sub.H-17
cells. The ROR.gamma. agonists may be administered in vitro, ex
vivo or in vivo.
[0110] The pharmaceutical compositions described herein can be
administered to a human patient per se, or in pharmaceutical
compositions where they are mixed with other active ingredients, as
in combination therapy, or suitable carriers or excipient(s).
Techniques for formulation and administration of the compounds of
the instant application may be found in "Remington's Pharmaceutical
Sciences," Mack Publishing Co., Easton, Pa., 18th edition, 1990.
The pharmaceutical compositions may also be administered to other
mammals, including dogs, cats, sheep, pigs, horses, cows, and the
like. Thus, the veterinary use of these pharmaceutical compositions
is also within the scope of the present invention.
[0111] Suitable routes of administration may, for example, include
oral, rectal, topical, transmucosal, or intestinal administration;
parenteral delivery, including intramuscular, subcutaneous,
intravenous, intramedullary injections, as well as intrathecal,
direct intraventricular, intraperitoneal, intranasal, or
intraocular injections.
[0112] Alternately, one may administer the compound in a local
rather than systemic manner, for example, via injection of the
compound directly in the renal or cardiac area, often in a depot or
sustained release formulation. Furthermore, one may administer the
drug in a targeted drug delivery system, for example, in a liposome
coated with a tissue-specific antibody. The liposomes will be
targeted to and taken up selectively by the organ.
[0113] The pharmaceutical compositions of the present invention may
be manufactured in a manner that is itself known, e.g., by means of
conventional mixing, dissolving, granulating, dragee-making,
levigating, emulsifying, encapsulating, entrapping or tabletting
processes.
[0114] Pharmaceutical compositions for use in accordance with the
present invention thus may be formulated in conventional manner
using one or more physiologically acceptable carriers comprising
excipients and auxiliaries which facilitate processing of the
active compounds into preparations which can be used
pharmaceutically. Proper formulation is dependent upon the route of
administration chosen. Any of the well-known techniques, carriers,
and excipients may be used as suitable and as understood in the
art; e.g., in Remington's Pharmaceutical Sciences, above.
[0115] For injection, the ROR.gamma. agonists/antagonists of the
invention may be formulated in aqueous solutions, preferably in
physiologically compatible buffers such as Hanks's solution,
Ringer's solution, or physiological saline buffer. For transmucosal
administration, penetrants appropriate to the barrier to be
permeated are used in the formulation. Such penetrants are
generally known in the art.
[0116] For oral administration, the compounds can be formulated
readily by combining the active compounds with pharmaceutically
acceptable carriers well known in the art. Such carriers enable the
compounds of the invention to be formulated as tablets, pills,
dragees, capsules, liquids, gels, syrups, slurries, suspensions and
the like, for oral ingestion by a patient to be treated.
Pharmaceutical preparations for oral use can be obtained by mixing
one or more solid excipient with pharmaceutical combination of the
invention, optionally grinding the resulting mixture, and
processing the mixture of granules, after adding suitable
auxiliaries, if desired, to obtain tablets or dragee cores.
Suitable excipients are, in particular, fillers such as sugars,
including lactose, sucrose, mannitol, or sorbitol; cellulose
preparations such as, for example, maize starch, wheat starch, rice
starch, potato starch, gelatin, gum tragacanth, methyl cellulose,
hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose,
and/or polyvinylpyrrolidone (PVP). If desired, disintegrating
agents may be added, such as the cross-linked polyvinyl
pyrrolidone, agar, or alginic acid or a salt thereof such as sodium
alginate.
[0117] For topical administration, the compounds may be formulated
for administration to the epidermis as ointments, gels, creams,
pastes, salves, gels, creams or lotions, or as a transdermal patch.
Ointments and creams may, for example, be formulated with an
aqueous or oily base with the addition of suitable thickening
and/or gelling agents. Lotions may be formulated with an aqueous or
oily base and will in general also containing one or more
emulsifying agents, stabilizing agents, dispersing agents,
suspending agents, thickening agents, or coloring agents.
[0118] Dragee cores are provided with suitable coatings. For this
purpose, concentrated sugar solutions may be used, which may
optionally contain gum arabic, talc, polyvinyl pyrrolidone,
carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer
solutions, and suitable organic solvents or solvent mixtures.
Dyestuffs or pigments may be added to the tablets or dragee
coatings for identification or to characterize different
combinations of active compound doses.
[0119] Pharmaceutical preparations which can be used orally,
including sublingually, which include push-fit capsules made of
gelatin, as well as soft, sealed capsules made of gelatin and a
plasticizer, such as glycerol or sorbitol. The push-fit capsules
can contain the active ingredients in admixture with filler such as
lactose, binders such as starches, and/or lubricants such as talc
or magnesium stearate and, optionally, stabilizers. In soft
capsules, the active compounds may be dissolved or suspended in
suitable liquids, such as fatty oils, liquid paraffin, or liquid
polyethylene glycols. In addition, stabilizers may be added. All
formulations for oral administration should be in dosages suitable
for such administration.
[0120] For buccal administration, the compositions may take the
form of tablets or lozenges formulated in conventional manner.
[0121] For administration by inhalation, the compounds for use
according to the present invention are conveniently delivered in
the form of an aerosol spray presentation from pressurized packs or
a nebulizer, with the use of a suitable propellant, e.g.,
dichlorodifluoromethane, trichlorofluoromethane,
dichlorotetrafluoroethane, carbon dioxide, or other suitable gas.
In the case of a pressurized aerosol the dosage unit may be
determined by providing a valve to deliver a metered amount.
Capsules and cartridges of, e.g., gelatin for use in an inhaler or
insufflator may be formulated containing a powder mix of the
compound and a suitable powder base such as lactose or starch.
[0122] The compounds may be formulated for parenteral
administration by injection, e.g., by bolus injection or continuous
infusion. Formulations for injection may be presented in unit
dosage form, e.g., in ampules or in multi-dose containers, with an
added preservative. The compositions may take such forms as
suspensions, solutions or emulsions in oily or aqueous vehicles,
and may contain formulatory agents such as suspending, stabilizing
and/or dispersing agents.
[0123] Pharmaceutical formulations for parenteral administration
include aqueous solutions of the active compounds in water-soluble
form. Additionally, suspensions of the active compounds may be
prepared as appropriate oily injection suspensions. Suitable
lipophilic solvents or vehicles include fatty oils such as sesame
oil, or synthetic fatty acid esters, such as ethyl oleate or
triglycerides, or liposomes. Aqueous injection suspensions may
contain substances which increase the viscosity of the suspension,
such as sodium carboxymethyl cellulose, sorbitol, or dextran.
Optionally, the suspension may also contain suitable stabilizers or
agents which increase the solubility of the compounds to allow for
the preparation of highly concentrated solutions.
[0124] Alternatively, the active ingredient may be in powder form
for constitution with a suitable vehicle, e.g., sterile
pyrogen-free water, before use.
[0125] The compounds may also be formulated in rectal compositions
such as suppositories or retention enemas, e.g., containing
conventional suppository bases such as cocoa butter or other
glycerides.
[0126] In addition to the formulations described previously, the
compounds may also be formulated as a depot preparation. Such long
acting formulations may be administered by implantation (for
example subcutaneously or intramuscularly) or by intramuscular
injection. Thus, for example, the compounds may be formulated with
suitable polymeric or hydrophobic materials (for example as an
emulsion in an acceptable oil) or ion exchange resins, or as
sparingly soluble derivatives, for example, as a sparingly soluble
salt.
[0127] A pharmaceutical carrier for the hydrophobic compounds of
the invention is a cosolvent system comprising benzyl alcohol, a
nonpolar surfactant, a water-miscible organic polymer, and an
aqueous phase. A common cosolvent system used is the VPD co-solvent
system, which is a solution of 3% w/v benzyl alcohol, 8% w/v of the
nonpolar surfactant Polysorbate 80.TM., and 65% w/v polyethylene
glycol 300, made up to volume in absolute ethanol. Naturally, the
proportions of a co-solvent system may be varied considerably
without destroying its solubility and toxicity characteristics.
Furthermore, the identity of the co-solvent components may be
varied: for example, other low-toxicity nonpolar surfactants may be
used instead of POLYSORBATE 80.TM.; the fraction size of
polyethylene glycol may be varied; other biocompatible polymers may
replace polyethylene glycol, e.g., polyvinyl pyrrolidone; and other
sugars or polysaccharides may substitute for dextrose.
[0128] Alternatively, other delivery systems for hydrophobic
pharmaceutical compounds may be employed. Liposomes and emulsions
are well known examples of delivery vehicles or carriers for
hydrophobic drugs. Certain organic solvents such as
dimethylsulfoxide also may be employed, although usually at the
cost of greater toxicity. Additionally, the compounds may be
delivered using a sustained-release system, such as semipermeable
matrices of solid hydrophobic polymers containing the therapeutic
agent. Various sustained-release materials have been established
and are well known by those skilled in the art. Sustained-release
capsules may, depending on their chemical nature, release the
compounds for a few weeks up to over 100 days. Depending on the
chemical nature and the biological stability of the therapeutic
reagent, additional strategies for protein stabilization may be
employed.
[0129] Many of the compounds used in the pharmaceutical
combinations of the invention may be provided as salts with
pharmaceutically compatible counterions. Pharmaceutically
compatible salts may be formed with many acids, including but not
limited to hydrochloric, sulfuric, acetic, lactic, tartaric, malic,
succinic, etc. Salts tend to be more soluble in aqueous or other
protonic solvents than are the corresponding free acid or base
forms.
[0130] Pharmaceutical compositions suitable for use in the present
invention include compositions where the active ingredients are
contained in an amount effective to achieve its intended purpose.
More specifically, a therapeutically effective amount means an
amount of compound effective to prevent, alleviate or ameliorate
symptoms of disease or prolong the survival of the subject being
treated. Determination of a therapeutically effective amount is
well within the capability of those skilled in the art, especially
in light of the detailed disclosure provided herein.
[0131] The exact formulation, route of administration and dosage
for the pharmaceutical compositions of the present invention can be
chosen by the individual physician in view of the patient's
condition. (See e.g., Fingl et al. 1975, in "The Pharmacological
Basis of Therapeutics", Ch. 1 p. 1). Typically, the dose range of
the composition administered to the patient can be from about 0.5
to 1000 mg/kg of the patient's body weight. The dosage may be a
single one or a series of two or more given in the course of one or
more days, as is needed by the patient. Note that for almost all of
the specific compounds mentioned in the present disclosure, human
dosages for treatment of at least some condition have been
established. Thus, in most instances, the present invention will
use those same dosages, or dosages that are between about 0.1% and
500%, more preferably between about 25% and 250% of the established
human dosage. Where no human dosage is established, as will be the
case for newly-discovered pharmaceutical compounds, a suitable
human dosage can be inferred from ED.sub.50 or ID.sub.50 values, or
other appropriate values derived from in vitro or in vivo studies,
as qualified by toxicity studies and efficacy studies in
animals.
[0132] Although the exact dosage will be determined on a
drug-by-drug basis, in most cases, some generalizations regarding
the dosage can be made. The daily dosage regimen for an adult human
patient may be, for example, an oral dose of between 0.1 mg and
6000 mg of each ingredient, preferably between 1 mg and 5000 mg,
e.g. 25 to 5000 mg or an intravenous, subcutaneous, or
intramuscular dose of each ingredient between 0.01 mg and 100 mg,
preferably between 0.1 mg and 60 mg, e.g. 1 to 40 mg of each
ingredient of the pharmaceutical compositions of the present
invention or a pharmaceutically acceptable salt thereof calculated
as the free base, the composition being administered 1 to 4 times
per day. Alternatively the compositions of the invention may be
administered by continuous intravenous infusion, preferably at a
dose of each ingredient up to 400 mg per day. Thus, the total daily
dosage by oral administration of each ingredient will typically be
in the range 1 to 2500 mg and the total daily dosage by parenteral
administration will typically be in the range 0.1 to 400 mg.
Suitably the compounds will be administered for a period of
continuous therapy, for example for a week or more, or for months
or years.
[0133] In one embodiment, the dose of the pharmaceutical
composition comprising a ROR.gamma. agonist or antagonist or a
pharmaceutically acceptable salt, prodrug, derivative or metabolite
thereof, is from about 10 to about 50 mg per day.
[0134] In another embodiment, the ROR.gamma. antagonist is
administered daily without resulting in weight loss or
hypertriglyceridemia.
[0135] Dosage amount and interval may be adjusted individually to
provide plasma levels of the active moiety which are sufficient to
maintain the modulating effects, or minimal effective concentration
(MEC). The MEC will vary for each compound but can be estimated
from in vitro data. Dosages necessary to achieve the MEC will
depend on individual characteristics and route of administration.
However, HPLC assays or bioassays can be used to determine plasma
concentrations.
[0136] Dosage intervals can also be determined using MEC value.
Compositions should be administered using a regimen that maintains
plasma levels above the MEC for 10-90% of the time, preferably
between 30-90% and most preferably between 50-90%.
[0137] In cases of local administration or selective uptake, the
effective local concentration of the drug may not be related to
plasma concentration.
[0138] The amount of composition administered will, of course, be
dependent on the subject being treated, on the subject's weight,
the severity of the affliction, the manner of administration and
the judgment of the prescribing physician.
[0139] The compositions may, if desired, be presented in a pack or
dispenser device which may contain one or more unit dosage forms
containing the active ingredient. The pack may for example comprise
metal or plastic foil, such as a blister pack. The pack or
dispenser device may be accompanied by instructions for
administration. The pack or dispenser may also be accompanied with
a notice associated with the container in form prescribed by a
governmental agency regulating the manufacture, use, or sale of
pharmaceuticals, which notice is reflective of approval by the
agency of the form of the drug for human or veterinary
administration. Such notice, for example, may be the labeling
approved by the U.S. Food and Drug Administration for prescription
drugs, or the approved product insert. Compositions comprising a
compound of the invention formulated in a compatible pharmaceutical
carrier may also be prepared, placed in an appropriate container,
and labeled for treatment of an indicated condition.
[0140] The compositions described herein may also be used in the
preparation of a medicament for treatment of any of the disorders
described above.
Example 1
[0141] This example describes ligands to ROR.gamma. and confirms
their receptor regulation properties in two mechanistically
distinct receptor assays. Transcriptional assays for mouse and
human ROR.gamma. (mROR.gamma. and hROR.gamma.) were implemented in
cultured cells. A biochemical assay, using exogenously expressed
mROR.gamma. LBD, was established to measure ligand-mediated
regulation of coregulatory peptide recruitment in vitro. The
transcriptional assay measures the product of a reporter gene, such
as an enzyme, whose expression is in turn regulated by the
ROR.gamma. LBD. The biochemical assay responds to a
ligand-dependent conformational change in the receptor LBD that
changes receptor affinity for coregulatory peptide. The ligands to
ROR.gamma. described here were predominantly identified in the
transcriptional assay and confirmed in the biochemical assay.
[0142] This example also describes several additional tests that
were commonly performed to confirm the authenticity of a hit to
ROR.gamma.. These tests also verified the validity of the
transcriptional and biochemical assays used. In all cases, the
activity of a compound was also tested in transcriptional assays
for the orphan nuclear receptors ROR.alpha., ROR.beta., and SF-1 to
demonstrate specificity and to rule out a non-specific effect on
the assay system as an explanation for the apparent activity. In
some cases, close analogs of a confirmed hit were obtained by
synthesis or purchase from a commercial source. The series of
compounds related to the confirmed hit was then tested in the
biochemical and transcriptional assays. The rank order of the
potency of the compounds was then compared. If closely similar for
the two assays, the findings demonstrated that minor chemical
modifications had equivalent effects on compound interaction with
the ROR.gamma. LBD in each assay. The data imply in turn that the
compounds are binding to the same binding pocket. Even though
absolute EC.sub.50 values may differ in a rank order comparison,
the observation that relative values are similar provides strong
confirmation of the conclusion that the identified compounds act
directly through ROR.gamma. and not by a secondary mechanism that
is assay but not receptor-specific. This results presented in this
example demonstrate that the transcriptional and biochemical assays
provide an internally consistent method of characterizing
ROR.gamma. ligand potency and that more potent compounds can be
identified using this assay technology by a program of additional
screening or directed medicinal chemistry synthesis.
Methods
[0143] Transcriptional Assay.
[0144] Gal4-mROR.gamma. was generated by inserting the LBD of mouse
ROR.gamma. (Ile-251-Lys-516) into the EcoRI-HindIII site of
pFA-CMV. The vector pFA-CMV (Stratagene, La Jolla, Calif.) contains
the yeast Gal4 DNA binding domain (amino acids 1-148) upstream of
the multiple cloning site where the EcoRI and HindIII restriction
enzyme sites are found. The fragment of mROR.gamma. was a PCR
product using the template of pM-mROR.gamma. (Medvedev, Yan et al.
1996). The complete Gal4-mROR.gamma. nucleotide sequence is shown
below:
TABLE-US-00001 (Gal4 DBD) (SEQ ID NO: 7)
ATGAAGCTACTGTCTTCTATCGAACAAGCATGCGATATTTGCCGACTTAA
AAAGCTCAAGTGCTCCAAAGAAAAACCGAAGTGCGCCAAGTGTCTGAAGA
ACAACTGGGAGTGTCGCTACTCTCCCAAAACCAAAAGGTCTCCGCTGACT
AGGGCACATCTGACAGAAGTGGAATCAAGGCTAGAAAGACTGGAACAGCT
ATTTCTACTGATTTTTCCTCGAGAAGACCTTGACATGATTTTGAAAATGG
ATTCTTTACAGGATATAAAAGCATTGTTAACAGGATTATTTGTACAAGAT
AATGTGAATAAAGATGCCGTCACAGATAGATTGGCTTCAGTGGAGACTGA
TATGCCTCTAACATTGAGACAGCATAGAATAAGTGCGACATCATCATCGG
AAGAGAGTAGTAACAAAGGTCAAAGACAGTTGACTGTATCGCCG (linker) (SEQ ID NO:
8) GGATCCGCCCGGGCTGGAATTCGC (mROR.gamma. LBD) (SEQ ID NO: 9)
ATTCCCAGTTTCTGCAGTGCCCCAGAGGTACCATATGCCTCTCTGACAGA
CATAGAGTACCTGGTACAGAATGTCTGCAAGTCCTTCCGAGAGACATGCC
AGCTGCGACTGGAGGACCTTCTACGGCAGCGCACCAACCTCTTTTCACGG
GAGGAGGTGACCAGCTACCAGAGGAAGTCAATGTGGGAGATGTGGGAGCG
CTGTGCCCACCACCTCACTGAGGCCATTCAGTATGTGGTGGAGTTTGCCA
AGCGGCTTTCAGGCTTCATGGAGCTCTGCCAGAATGACCAGATCATACTA
CTGACAGCAGGAGCAATGGAAGTCGTCCTAGTCAGAATGTGCAGGGCCTA
CAATGCCAACAACCACACAGTCTTTTTTGAAGGCAAATACGGTGGTGTGG
AGCTGTTTCGAGCCTTGGGCTGCAGCGAGCTCATCAGCTCCATATTTGAC
TTTTCCCACTTCCTCAGCGCCCTGTGTTTTTCTGAGGATGAGATTGCCCT
CTACACGGCCCTGGTTCTCATCAATGCCAACCGTCCTGGGCTCCAAGAGA
AGAGGAGAGTGGAACATCTGCAATACAATTTGGAACTGGCTTTCCATCAT
CATCTCTGCAAGACTCATCGACAAGGCCTCCTAGCCAAGCTGCCACCCAA
AGGAAAACTCCGGAGCCTGTGCAGCCAACATGTGGAAAAGCTGCAGATCT
TCCAGCACCTCCACCCCATCGTGGTCCAAGCCGCCTTCCCNCCACTCTAT
AAGGAACTCTTCAGCACTGATGTTGAATCCCCTGAGGGGCTGTCAAAGTG A
The complete Gal4-mROR.gamma. protein sequence is shown below:
TABLE-US-00002 (Gal4 DBD) (SEQ ID NO: 10)
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLT
RAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQD
NVNKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVSP (linker) (SEQ ID
NO: 11) GSARAGIR (mROR.gamma. LBD) (SEQ ID NO: 12)
IPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIIL
LTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFD
FSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHH
HLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFXPLY
KELFSTDVESPEGLSK
Gal4-hROR.gamma. was generated by inserting the ligand-binding
domain of human ROR.gamma. LBD (Ser-253-Lys-518) into pFA-CMV by
BamHI-KpnI sites. The vector pFA-CMV (Stratagene, La Jolla, Calif.)
contains the yeast Gal4 DNA binding domain (amino acids 1-148) at
N-terminal of the multiple cloning sites. The fragment of
hROR.gamma. LBD was a PCR product using the template of a
commercial clone from Invitrogen (Clone ID: 5186655; Vector:
pCMV-SPORT6). The complete Gal4-hROR.gamma. nucleotide sequence is
shown below:
TABLE-US-00003 (Gal4 DBD) (SEQ ID NO: 7)
ATGAAGCTACTGTCTTCTATCGAACAAGCATGCGATATTTGCCGACTTAA
AAAGCTCAAGTGCTCCAAAGAAAAACCGAAGTGCGCCAAGTGTCTGAAGA
ACAACTGGGAGTGTCGCTACTCTCCCAAAACCAAAAGGTCTCCGCTGACT
AGGGCACATCTGACAGAAGTGGAATCAAGGCTAGAAAGACTGGAACAGCT
ATTTCTACTGATTTTTCCTCGAGAAGACCTTGACATGATTTTGAAAATGG
ATTCTTTACAGGATATAAAAGCATTGTTAACAGGATTATTTGTACAAGAT
AATGTGAATAAAGATGCCGTCACAGATAGATTGGCTTCAGTGGAGACTGA
TATGCCTCTAACATTGAGACAGCATAGAATAAGTGCGACATCATCATCGG
AAGAGAGTAGTAACAAAGGTCAAAGACAGTTGACTGTATCGCCG (linker) (SEQ ID NO:
13) GGATCC (hROR.gamma. LBD) (SEQ ID NO: 14)
AGCCCCAGTTTCCGCAGCACACCGGAGGCACCCTATGCCTCCCTGACAGA
GATAGAGCACCTGGTGCAGAGCGTCTGCAAGTCCTACAGGGAGACATGCC
AGCTGCGGCTGGAGGACCTGCTGCGGCAGCGCTCCAACATCTTCTCCCGG
GAGGAAGTGACTGGCTACCAGAGGAAGTCCATGTGGGAGATGTGGGAACG
GTGTGCCCACCACCTCACCGAGGCCATTCAGTACGTGGTGGAGTTCGCCA
AGAGGCTCTCAGGCTTTATGGAGCTCTGCCAGAATGACCAGATTGTGCTT
CTCAAAGCAGGAGCAATGGAAGTGGTGCTGGTTAGGATGTGCCGGGCCTA
CAATGCTGACAACCGCACGGTCTTTTTTGAAGGCAAATACGGTGGCATGG
AGCTGTTCCGAGCCTTGGGCTGCAGCGAGCTCATCAGCTCCATCTTTGAC
TTCTCCCACTCCCTAAGTGCCTTGCACTTTTCCGAGGATGAGATTGCCCT
CTACACAGCCCTTGTTCTCATCAATGCCCATCGGCCAGGGCTCCAAGAGA
AAAGGAAAGTAGAACAGCTGCAGTACAATCTGGAGCTGGCCTTTCATCAT
CATCTCTGCAAGACTCATCGCCAAAGCATCCTGGCAAAGCTGCCACCCAA
GGGGAAGCTTCGGAGCCTGTGTAGCCAGCATGTGGAAAGGCTGCAGATCT
TCCAGCACCTCCACCCCATCGTGGTCCAAGCCGCTTTCCCTCCACTCTAC
AAGGAGCTCTTCAGCACTGAAACCGAGTCACCTGTGGGGCTGTCCAAGTG A
The complete Gal4-hROR.gamma. protein sequence is shown below:
TABLE-US-00004 (Gal4 DBD) (SEQ ID NO: 10)
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLT
RAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQD
NVNKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVSP (linker) (SEQ ID
NO: 15) GS (hROR.gamma. LBD) (SEQ ID NO: 16)
SPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSR
EEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVL
LKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFD
FSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH
HLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLY
KELFSTETESPVGLSK
[0145] Four other orphan nuclear receptors were similarly cloned as
Gal4-LBD hybrids in pFA-CMV by PCR as follows for initial screening
studies: human SF-1 (NR5A1, aa 198-462) at BamHI and XbaI
restriction enzymes sites; mROR.alpha. (NR1F1, aa 266-523) at
XmaI-HindIII restriction enzymes sites; human ROR.beta. (NR1F2, aa
201-459) at EcoRI and KpnI restriction enzyme sites; and mouse
LRH-1 (NR5A2, aa 311-561) at EcoRI and HindIII restriction enzyme
sites.
[0146] A firefly luciferase reporter gene for Gal4 DBD hybrid
receptors, such as Gal4-ROR.gamma., contains five copies of the
Gal4 17-mer response element in its promoter and the coding
sequence for firefly luciferase (pG5-luc, Promega). CHO (Chinese
Hamster Ovary) cells were cultured in Ham's F12 medium supplemented
with 10% fetal calf serum (Gemini Biologicals), 10 .mu.g/ml
penicillin and streptomycin, and were maintained in a humidified
37.degree. C. incubator (Thermo Electron, Steri-Cycle) with 5%
CO.sub.2. 24 hours before transfection, cells were plated in T175
flasks (5.times.10.sup.6 cells/flask) or T75 flasks
(1.7.times.10.sup.6 cells/flask). Transient transfection of CHO
cells was performed using TransIT-CHO reagents (Mirus, Madison,
Wis.) with a mixing ratio of 2:6:1 between plasmid DNA (in .mu.g),
TransIT-CHO (in .mu.1) and CHO-mojo (in .mu.1). As an example, 9
.mu.g pG5-luc, 8.75 .mu.g pcDNA3 and 0.25 .mu.g receptor plasmid
were transfected into each T175 flask.
[0147] Four hours after transfection, cells were dislodged with
trypsin and seeded into a 384-well plate at 8,000 cells/well using
a Titertek Multidrop 384. Edge effects within the 384-well plate
were minimized by leaving plates at room temperature for 30 min so
that cells plated evenly within each well (Lundholt, Scudder et al.
2003). Plates are maintained at 37.degree. C. in a humidified
atmosphere with 7% CO.sub.2 overnight. Four (4) hours after cell
seeding, compounds dissolved in DMSO at 10 mM were added to cells
at final concentrations of 20 micromolar (.mu.M) to 20 nanomolar
(nM) in 0.2% DMSO in triplicate plates. Approximately 40 hours
later, cytotoxicity in the assay well was characterized by addition
of the dye resazurin (O'Brien, Wilson et al. 2000) to a final
concentration of 3 .mu.M. After incubation for 2 hours at 37
degrees centigrade, the conversion of resazurin to resorufin was
measured by fluorescence (excitation at 570 nm and emission at 615
nm). Living cells catalyze dye conversion while cells that lack
metabolic activity do not. Percent viability was determined as 2
hour fluorescence, minus background at t=0 hours, normalized to
DMSO controls. For detection of luciferase activity, media was
removed from plates after the measurement of resazurin conversion,
and SteadyLite luciferase reagent (Perkin-Elmer) was added (30
.mu.l/well). Luminescence is detected with a Victor 2-V plate
reader (Perkin-Elmer) and normalized to luciferase activity of DMSO
control wells alone.
[0148] Compounds Described.
[0149] The following test compounds were obtained commercially:
T0901317 (Cayman Chemicals); rockogenin or OR-885 (Steraloids,
Newport, R.I.); 5.alpha., 20.alpha., 22.alpha.,
25D-Spirostan-3.beta., 12.beta.-diol-11-one or OR-345 (Steraloids);
hyodeoxycholic acid methyl ester or OR-942 and hyodeoxyclolic acid
or OR-412 (Steraloids); 11-oxo ursolic acid acetate or OR-13571
(Microsource, Gaylordsville, Conn.) and AG-205/33159060 (Specs,
Delft, The Netherlands) or OR-2161; OR-133008 (Specs
AG-690/40752395); OR-133097 (Specs AG-690/40698971); OR-133099
(Specs AG-690/40699006); OR-133167 (Specs AG-690/40752726); and
OR-133171 (Specs AG-690/40752859).
[0150] Compounds Synthesized.
[0151] The following describes synthesis of a representative
antagonist (e.g., OR-1050) and a representative agonist (e.g.,
OR-12872) to ROR.gamma.. All starting materials were commercially
available. Related antagonists and agonists, where not purchased
commercially, were synthesized by analogous methods.
[0152] Abbreviations: Ac.sub.2O--acetic anhydride;
NEt.sub.3--triethylamine; THF--tetrahydrofuran;
DMAP--4-Dimethylaminopyridine;
EDCl--1-(3-dimethylaminopropyl)-3-ethyl-carbodiimide hydrochloride;
TBSCl--tert-butyl-chloro-dimethyl-silane; DMF--dimethylformamide;
TBAF--Tetra-n-butylammonium fluoride.
Synthetic Scheme for OR-1050 where R=Para-Nitrophenyl:
##STR00007##
2-(4-Ethylamino-phenyl)-1,1,1,3,3,3-hexalluoro-propan-2-ol
[0153] To a solution of 3.0 gm of
2-(4-Amino-phenyl)-1,1,1,3,3,3-hexafluoro-propan-2-ol (Matrix
Scientific, Columbia, S.C.) in 30 ml of methylene chloride was
added 2.4 ml of triethyl amine, 1.2 ml of acetic anhydride, and 100
mg of dimethylaminopyridine. The mixture was allowed to stir at
room temperature for 16 hrs. An additional 2.4 ml of triethyl amine
and 1.2 ml of acetic anhydride was added and the mixture was
stirred for an additional 6 hrs. The solution was evaporated and
purified by column chromatography (1:1 Ethyl Acetate:Hexane) to
give 3.1 gm of material that was used in the next step. To this
material dissolved in 30 ml of tetrahydrofuran cooled to 0 degrees
C. was added 1.6 gm of lithium aluminum hydride. This solution was
stirred for 16 hrs and quenched with 1 N sodium hydroxide. This was
then extracted with ethyl acetate and dried over anhydrous sodium
sulfate. Chromatography gave 2.188 gm of the named product. 1H NMR
was consistent with the structure.
N-Ethyl-4-nitro-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)-p-
henyl]-benzenesulfonamide (OR-1050)
[0154] To a solution of 104 mg
2-(4-Ethylamino-phenyl)-1,1,1,3,3,3-hexafluoro-propan-2-ol in 3 ml
of pyridine was added 104 mg 4-Nitro-benzenesulfonyl chloride and
10 mg of dimethylaminopyridine. The mixture was stirred for 16 hrs
and then concentrated in vacuo. After chromatography (1:3 Ethyl
Acetate:Hexane), 129 mg of the named product was obtained. 1H NMR
was consistent with the structure.
Synthetic Scheme for OR-12872
##STR00008## ##STR00009##
[0155]
4R-[3R,6R-Bis-(tert-butyl-dimethyl-silanyloxy)-10R,13R-dimethyl-5R--
8S-9S-14S-hexadecahydro-cyclopenta[a]phenanthren-17R-yl]-pentanoic
acid methyl ester (2)
[0156] To a solution of 8.974 gm of hyodeoxycholic acid methyl
ester
(4R-(3R,6R-Dihydroxy-10R,13R-dimethyl-5R-8S-9S-14S-hexadecahydro-cyclopen-
ta[a]phenanthren-17R-yl)-pentanoic acid methyl ester) (1)
(Steraloids, Newport, R.I.) in 60 ml of dimethyl formamide was
added 12 ml of triethylamine, 8.3 gm of
tert-Butyl-chloro-dimethyl-silane and 270 mg of
dimethyl-aminopyridine. The mixture was stirred at room temperature
for 16 hrs and concentrated in vacuo. After chromatography (1:9
Ethyl Acetate:Hexane), 13.748 gm of the named product (2) was
obtained. 1H NMR was consistent with the structure.
4R-[3R,6R-Bis-(tert-butyl-dimethyl-silanyloxy)-10R,13R-dimethyl-5R-8S-9S-1-
4S hexadecahydro-cyclopenta[a]phenanthren-17R-yl]-pentanoic acid
(3)
[0157] To a solution of
4-[3,6-Bis-(tert-butyl-dimethyl-silanyloxy)-10,13-dimethyl-hexadecahydro--
cyclopenta[a]phenanthren-17-yl]-pentanoic acid methyl ester (9.41
gm) in 15 ml of tetrahydrofuran, 10 ml of methanol and 10 ml of
water was added 620 mg of sodium hydroxide. The mixture was then
stirred at room temperature for 16 hrs and concentrated in vacuo.
After acidification the residue was extracted with ethyl acetate,
dried over anhydrous sodium sulfate, filtered and concentrated in
vacuo. Chromatography (1:3 Ethyl Acetate:Hexane) gave 8.6 gm of the
title compound (3). 1H NMR was consistent with the structure.
5R-[3R,6R-Bis-(tert-butyl-dimethyl-silanyloxy)-10R,13R-dimethyl-5R-8S-9S-1-
4S-hexadecahydro-cyclopenta[a]phenanthren-17R-yl]-hexan-2-one
(4)
[0158] To a solution of
4-[3,6-Bis-(tert-butyl-dimethyl-silanyloxy)-10,13-dimethyl-hexadecahydro--
cyclopenta[a]phenanthren-17-yl]-pentanoic acid (3.419 gm) in 30 ml
of tetrahydrofuran at 0 degrees C. was added 7.6 ml of a 1.6 M
solution of methyl lithium. The mixture was stirred at 0 degrees C.
for 30 min and quenched with 20 ml water followed by 20 ml of 1N
hydrochloric acid. The mixture was extracted with ethyl acetate,
dried over anhydrous sodium sulfate and concentrated in vacuo.
Chromatography (1:9 Ethyl Acetate:Hexane) gave 0.985 gm of the
title compound (4). 1H NMR was consistent with the structure.
5R-[3R,6R-Bis-(tert-butyl-dimethyl-silanyloxy)-10R,13R-dimethyl-5R-8S-9S-1-
4S-hexadecahydro-cyclopenta[a]phenanthren-17R-yl]-hexan-2-ol
(5)
[0159] To a solution of 516 mg of
5-[3,6-Bis-(tert-butyl-dimethyl-silanyloxy)-10,13-dimethyl-hexadecahydro--
cyclopenta[a]phenanthren-17-yl]-hexan-2-one in 10 ml of ethanol was
added 250 mg of sodium borohydride. The mixture was stirred for 1
hr and concentrated in vacuo, 20 ml of water was added followed by
30 ml of ethyl acetate and 10 ml of 1N hydrochloric acid. The
mixture was extracted with ethyl acetate, dried over anhydrous
sodium sulfate and concentrated in vacuo. Chromatography (1:9 Ethyl
Acetate:Hexane) gave 512 mg of the title compound (5). 1H NMR was
consistent with the structure.
17R-(4-Methoxy-1R-methyl-pentyl)-10R,13R-dimethyl-5R-8S-9S-14S-hexadecahyd-
ro-cyclopenta[a]phenanthrene-3R,6R-diol (OR-12872)
[0160] To a solution of 262 mg of (5) in 6 ml of dimethyl formamide
was added 110 ml of methyl iodide followed by 29 mg of a 60% oil
dispersion of sodium hydride. The mixture was stirred for 16 hr and
concentrated in vacuo. The mixture was extracted with ethyl
acetate, dried over anhydrous sodium sulfate and concentrated in
vacuo. Chromatography (1:9 Ethyl Acetate:Hexane) gave 257 mg of an
intermediate that was dissolved in 10 ml of tetrahydrofuran and 2.4
ml of a 1M tetrahydrofuran solution of tetra-butylammonium
fluoride. The mixture was then stirred at room temperature for 16
hrs and then at 60 C for 2 hrs. After concentration in vacuo and
chromatography (1:9 Ethyl Acetate:Hexane), 154 mg of the title
compound (OR-12872) was produced. 1H NMR was consistent with the
structure.
[0161] Compound Nomenclature.
[0162] Compounds have the following IUPAC names: OR-1048,
4-Bromo-N-ethyl-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)--
phenyl]-benzenesulfonamide; OR-1052,
N-Ethyl-4-methyl-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)-
-phenyl]-benzenesulfonamide; OR-1050,
N-Ethyl-4-nitro-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)--
phenyl]-benzenesulfonamide; OR-1047,
4-Butyl-N-ethyl-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)--
phenyl]-benzenesulfonamide; OR-1031,
N-Ethyl-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)-phenyl]--
benzenesulfonamide; T0901317,
N-(2,2,2-Trifluoro-ethyl)-N-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluorometh-
yl-ethyl)-phenyl]-benzenesulfonamide; OR-1030,
N-Ethyl-N-[4-(2,2,2-trifluoro-1-methoxy-1-trifluoromethyl-ethyl)-phenyl]--
benzenesulfonamide; OR-1046,
{Benzenesulfonyl-[4-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)-p-
henyl]-amino}-acetic acid.
[0163] OR-12872,
17-(4-Methoxy-1-methyl-pentyl)-10,13-dimethyl-hexadecahydro-cyclopenta[a]-
phenanthrene-3,6-diol; OR-12866,
17-(4-Methoxy-1,4-dimethyl-pentyl)-10,13-dimethyl-hexadecahydro-cyclopent-
a[a]phenanthrene-3,6-diol; OR-942,
4-(3,6-Dihydroxy-10,13-dimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-
-yl)-pentanoic acid methyl ester; OR-12863,
17-(4-Hydroxy-1-methyl-butyl)-10,13-dimethyl-hexadecahydro-cyclopenta[a]p-
henanthrene-3,6-diol; OR-12870,
5-(3,6-Dihydroxy-10,13-dimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-
-yl)-hexan-2-one; OR-12868, 4-(3,6-Di
hydroxy-10,13-dimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pent-
anoic acid dimethylamide; OR-12864,
17-(4-Methoxy-1-methyl-butyl)-10,13-dimethyl-hexadecahydro-cyclopenta[a]p-
henanthrene-3,6-diol; OR-12865,
17-(4-Hydroxy-1,4-dimethyl-pentyl)-10,13-dimethyl-hexadecahydro-cyclopent-
a[a]phenanthrene-3,6-diol; OR-12871,
17-(4-Hydroxy-1-methyl-pentyl)-10,13-dimethyl-hexadecahydro-cyclopenta[a]-
phenanthrene-3,6-diol; OR-412,
4-(3,6-Dihydroxy-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pentanoic
acid; OR-12867,
4-(3,6-Dihydroxy-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pentanoic
acid methylamide; OR-12869,
4-(3,6-Dihydroxy-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-1-piperidi-
n-1-yl-pentan-1-one;
[0164] OR-13571 (11-oxo-ursolic acid acetate),
10-Acetoxy-1,2,6a,6b,9,9,12a-heptamethyl-13-oxo-1,3,4,5,6,6a,6b,7,8,8a,9,-
10,11,12,12a,12b,13,14b-octadecahydro-2H-picene-4a-carboxylic
acid.
[0165] The following descriptions are available for two of the
natural compounds tested: OR-885 (CAS registry number, 16653-52-4,
Rockogenin, 5.alpha., 20.alpha., 22.alpha., 25D-SPIROSTAN-3.beta.,
12.beta.-DIOL, Steraloids catalogue number S0300-000) and OR-345
(5.alpha., 20.alpha., 22.alpha., 25D-SPIROSTAN-3.beta.,
12.beta.-DIOL-11-ONE, Steraloids catalogue number S0400-000).
[0166] OR-2161 is
N-(4,6-Di-piperidin-1-yl-[1,3,5]triazin-2-yl)-N'-(2-methoxy-3-nitro-benzy-
lidene)-hydrazine (Specs catalog number AG-205/33159060); OR-133008
is
2-{[(4-Chloro-phenylamino)-methyl]-4-ethyl-4H-[1,2,4]triazol-3-ylsulfanyl-
}-N-naphthalen-1-yl-acetamide (Specs AG-690/40752395); OR-133097 is
2-{5-[(3-Chloro-phenylamino)-methyl]-4-ethyl-4H-[1,2,4]triazol-3-ylsulfan-
yl}-N-naphthalen-1-yl-acetamide (Specs AG-690/40698971); OR-133099
is
2-{4-Ethyl-5-[(3-trifluoromethyl-phenylamino)-methyl]-4H-[1,2,4]triazol-3-
-ylsulfanyl}-N-naphthalen-1-yl-acetamide (Specs AG-690/40699006);
OR-133167 is
2-{5-[(3-Chloro-phenylamino)-methyl]-4-methyl-4H-[1,2,4]triazol-3-ylsulfa-
nyl}-N-naphthalen-1-yl-acetamide (Specs AG-690/40752726); OR-133171
is
2-{5-[(3-Chloro-4-methyl-phenylamino)-methyl]-4-ethyl-4H-[1,2,4]triazol-3-
-ylsulfanyl}-N-naphthalen-1-yl-acetamide (Specs
AG-690/40752859).
[0167] Biochemical Assay.
[0168] GST-ROR.gamma. was generated by subcloning the
ROR.gamma.-LBD into pET-41a, a vector which expresses GST fusion
proteins in bacteria. A biochemical assay developed with
GST-ROR.gamma. purified from bacteria had a poor response to
ligand. The receptor was expressed in a baculovirus expression
vector (Luckow and Summers 1989) in insect Sf9 cells. Expression in
Sf9 cells, as an alternative to bacterial expression, was also
successfully used to generate ROR.alpha. LBD in a form suitable for
protein crystallization (Kallen, Schlaeppi et al. 2002).
[0169] The cloning steps for GST-ROR.gamma. were as follows. The
mROR.gamma. LBD was excised from Gal4-mROR.gamma. (see above for
cloning steps) at BamHI and HindIII sites of Sequence 1 and cloned
into the corresponding sites of pET-41a(+) (EMD Biosciences, San
Diego, Calif.). A GST-mROR.gamma. fragment was then excised from
pET-41a(+) at XbaI and XhoI sites and cloned into a pcDNA3.1vector
(Invitrogen, Carlsbad, Calif.) restricted at NheI and XhoI sites.
Plasmid GST-mROR.gamma.-pcDNA3.1 was used as a PCR template to
generate a GST-mROR.gamma. fragment that was later cloned into
pENTR/D-TOPO vector (Invitrogen, Carlsbad, Calif.) by standard
cloning techniques recommended by the manufacturer of the vector.
The nucleotide sequence of GST-mROR.gamma. is shown below:
TABLE-US-00005 (GST) (SEQ ID NO: 17)
ATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCAC
TCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATG
AGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTG
GAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACA
GTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTG
GTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTG
GATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAAC
TCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCG
AAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCAT
CCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCC
AATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTG
AAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCA
TGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCC AAAATCGGAT
(linker) (SEQ ID NO: 18)
GGTTCAACTAGTGGTTCTGGTCATCACCATCACCATCACTCCGCGGGTCT
GGTGCCACGCGGTAGTACTGCAATTGGTATGAAAGAAACCGCTGCTGCTA
AATTCGAACGCCAGCACCTGGACAGCCCAGATCTGGGTACCGGTGGTGGC
TCCGGTGATGACGACGACAAGAGTCCCATGGGATATCGGGGATCCGCCCG GGCTGGAATTCGC
(mROR.gamma. LBD) (SEQ ID NO: 9)
ATTCCCAGTTTCTGCAGTGCCCCAGAGGTACCATATGCCTCTCTGACAGA
CATAGAGTACCTGGTACAGAATGTCTGCAAGTCCTTCCGAGAGACATGCC
AGCTGCGACTGGAGGACCTTCTACGGCAGCGCACCAACCTCTTTTCACGG
GAGGAGGTGACCAGCTACCAGAGGAAGTCAATGTGGGAGATGTGGGAGCG
CTGTGCCCACCACCTCACTGAGGCCATTCAGTATGTGGTGGAGTTTGCCA
AGCGGCTTTCAGGCTTCATGGAGCTCTGCCAGAATGACCAGATCATACTA
CTGACAGCAGGAGCAATGGAAGTCGTCCTAGTCAGAATGTGCAGGGCCTA
CAATGCCAACAACCACACAGTCTTTTTTGAAGGCAAATACGGTGGTGTGG
AGCTGTTTCGAGCCTTGGGCTGCAGCGAGCTCATCAGCTCCATATTTGAC
TTTTCCCACTTCCTCAGCGCCCTGTGTTTTTCTGAGGATGAGATTGCCCT
CTACACGGCCCTGGTTCTCATCAATGCCAACCGTCCTGGGCTCCAAGAGA
AGAGGAGAGTGGAACATCTGCAATACAATTTGGAACTGGCTTTCCATCAT
CATCTCTGCAAGACTCATCGACAAGGCCTCCTAGCCAAGCTGCCACCCAA
AGGAAAACTCCGGAGCCTGTGCAGCCAACATGTGGAAAAGCTGCAGATCT
TCCAGCACCTCCACCCCATCGTGGTCCAAGCCGCCTTCCCNCCACTCTAT
AAGGAACTCTTCAGCACTGATGTTGAATCCCCTGAGGGGCTGTCAAAGTG A
The protein sequence of GST-mROR.gamma. is shown below:
TABLE-US-00006 (Gal4 DBD) (SEQ ID NO: 10)
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLT
RAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQD
NVNKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVSP (linker) (SEQ ID
NO: 11) GSARAGIR (mROR.gamma. LBD) (SEQ ID NO: 12)
IPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIIL
LTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFD
FSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHH
HLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFXPLY
KELFSTDVESPEGLSK
[0170] For baculoviral expression of ROR.gamma., the cDNA fragment
of GST-ROR.gamma.-LBD, was subcloned from pET-41a into the
pENTR/D-TOPO vector using a commercially-available kit
(BaculoDirect, Invitrogen). Briefly, GST-ROR.gamma. carried by
pENTR/D-TOPO was transfected into mono-layer Sf9 cells
(8.times.10.sup.5/well in 6-well plates) by Cellfectin
(Invitrogen). Sf9 cells were incubated at 27.degree. C. in a
non-humidified incubator for 72 hours. Cell media was collected as
P1 viral stock and used to further infect Sf9 cells to generate P2
and P3 virus. Significant signs of infection were observed during
generation of P3 virus. A plaque assay was performed to determine
the titer of P3 virus and to isolate single plaques. P4 virus was
generated from a single plaque and propagated on a larger
scale.
[0171] Adherent SF9 cells were infected with baculovirus carrying
GST-ROR.gamma. and were cultured for 72 hours. Sf9 cell were then
subject to a brief sonication in a lysis buffer (20 mM phosphate,
pH 6.8, 50 mM KCl, 50 mM NaCl, 0.5 mM EDTA, 50% glycerol, 0.001%
NP-40 and 1 mM DTT) and centrifuged at 3000 rpm for 15 minutes.
GST-ROR.gamma. protein represents an estimated 20-30% of total
soluble protein in the cytosolic supernatant as determined by
SDS-PAGE and immunoblot with anti-GST antibody (Sigma). Some
protein remained in an insoluble fraction after centrifugation. We
found that addition of ROR.gamma. ligands (preferably 5 .mu.M
T0901317) in the culture media increased the fraction of
GST-ROR.gamma. in the cytosolic fraction. Cleared cell lysate was
stored at -70.degree. C. and is directly utilized in the
coregulatory peptide recruitment assay.
[0172] To carry out the biochemical assay, receptor, peptides, and
fluorescently-labeled probes to GST and biotin were incubated under
these conditions: purified biotinylated peptide K (0.2 .mu.M), 80
nM anti-GST coupled to allophycocyanin (APC), 25 nM
streptavidin-R-phycoerythrin (SA-RPE), that specifically binds the
biotinylated peptide, 20 mM sodium phosphate, pH 6.8, 50 mM KCl, 50
mM NaCl, 0.5 mM EDTA, 5% glycerol, 0.001% NP-40, and 1 mM DTT were
incubated with the Sf9 cell lysate diluted in the range of 1:10 to
1:50, following methods from the literature (Coward, Lee et al.
2001; Drake, Zhang et al. 2002; Lee, Elwood et al. 2002), and
incubated at room temperature for 2 hours. The labeled probes
anti-GST-APC and SA-RPE were purchased from Prozyme (San Leandro,
Calif.). Compounds were added directly from a DMSO solution to a
final concentration of 1-2% DMSO. Fluorescence was measured on a
Wallac Victor 2 V plate reader equipped with a 670/40 nm filter
(Omega Optical, Brattleboro, Vt.) for APC emission (Channel A) and
a 600/25 bandpass filter for monitoring the RPE emission (Channel
B). The FRET signal is calculated as: (the difference between the
ratio of Channel B/Channel A in the presence of an active peptide
(such as peptide K) and the Channel A/Channel B ratio in the
presence of the corresponding inactive peptide (peptide
Kmut)).times.100 or in the complete absence of peptide.
Results
[0173] Members of the ROR.alpha., ROR.beta., and ROR.gamma. family
of orphan nuclear receptors are generally recognized as having a
high basal activity in cell culture systems (Jetten, Kurebayashi et
al. 2001). The transcriptional activity of Gal4-mROR.gamma. in CHO
cells and in the choriocarcinoma cell line JEG-3 was >20-fold
higher than a mutated form of Gal4-mROR.gamma. (E502Q or E/Q). The
E/Q mutation inactivates a highly conserved residue of the helix 12
region of the LBD that is required for recruitment of
transcriptional coactivators in most well-characterized nuclear
receptors (Li, Lambert et al. 2003), and is predicted to abrogate
transcription from the ROR.gamma. LBD. An assay for detecting
ROR.gamma. ligands was developed in CHO cells, and about 100,000
individual small molecule compounds from various commercial sources
tested in this assay in several formats (e.g., in 96 or 384-well
plates, or following 24-hour or 40-hour incubation with test
compounds). Two classes of ROR.gamma. antagonists are shown below.
Structure 1 represents a genus of non-steroidal antagonists in
which R1=H, C1-C6 Alkyl, F, Cl, Br, I, NO2; R2=C1-C4 Alkyl; and
X=OH. Structure 3 represents a genus of steroidal antagonists in
which X=O or is absent (X=H,H). Any antagonist encompassed by these
generic structures is within the scope of the present invention.
The ability of any such compound, or any other compound, to act as
an ROR.gamma. antagonist may be easily determined using the assays
described herein. Structure 2 represents a genus of steroidal
agonists in which X=C(E)(F)(G); wherein E and F are independently
selected from H, lower alkyl or E and F taken together form a
carbonyl group; G is selected from OH, 0-lower alkyl or N(lower
alkyl).sub.2. Any agonist encompassed by these generic structures
is within the scope of the present invention. The ability of any
such compound, or any other compound, to act as an ROR.gamma.
agonist may be easily determined using the assays described
herein.
[0174] FIG. 3 shows that two compounds, T0901317 and OR-1050 (Table
1), both inhibit the high basal transcriptional activity of
ROR.gamma.. In separate studies, we determined that the two
compounds had no effects on the transcription of ROR.alpha.,
ROR.beta. or SF-1 as GAL4 hybrids in the same format as the
GAL4-ROR.gamma. assay. Further, T0901317<1004 was not cytotoxic
to CHO cells while OR-1050 was not cytotoxic at 50 .mu.M. All
antagonists and agonists identified in this example were similarly
specific for ROR.gamma. in the transcriptional assay and were
non-cytotoxic to CHO cells at 20 .mu.M or, if not, were
non-cytotoxic at a concentration 10-fold greater than the EC.sub.50
in the transcriptional assay.
[0175] Because the basal transactivation activity of GST-ROR.gamma.
is high, other compounds that bind ROR.gamma. and have only a
modest effect on transcription when tested alone in cell culture
may be overlooked. Some of these compounds could be classified as
ROR.gamma. agonists. These may activate, rather than repress,
ROR.gamma.-mediated processes in cells or animals. Accordingly, a
screening assay for ROR.gamma. agonists was carried out in which
one of the ROR.gamma. antagonists identified, T0901317, was added
to suppress the basal transcriptional activity of GAL4-ROR.gamma..
FIG. 4A demonstrates a method for the identification of ROR.gamma.
agonists. Compounds that only modestly elevated transcription in
the absence of T0901317 (for example, the steroidal antagonist
OR-942, see Table 2), but induced a much greater elevation in the
presence of 1-3 .mu.M T0901317, determined as the ratio between
wells containing OR-942 and those lacking OR-942, were further
investigated in dose response assays (FIG. 4A).
[0176] To further confirm the properties of ROR.gamma. agonists and
antagonists, a biochemical assay for ROR.gamma. was developed. This
assay can be used to screen for agonists or antagonists of
ROR.alpha., ROR.gamma. or ROR.beta.. This assay is based on
contacting a compound with a labeled, expressed ROR LBD and a
peptide that includes residues 710-720 (RTVLQLLLGNP; SEQ ID NO: 2)
of human RIP140, and measuring the proximity of the two labels,
wherein binding of the labeled peptide identifies the compound as
an antagonist and displacement of the labeled peptide identifies
the compound as an agonist.
[0177] In FIG. 4B, the addition of OR-942 causes the recruitment of
peptide K (ERRTVLQLLLGNPTK; SEQ ID NO: 4), a 15-mer identical to
amino acid residues 708-722 of transcriptional coregulatory protein
human RIP140 (Iannone, Consler et al. 2001), to the ROR.gamma. LBD
and increases the FRET signal. In the presence of OR-942, T0901317
depresses the FRET signal. Further, T0901317 causes a rightward
shift in the dose-response curve for OR-942 (FIG. 5) as would be
expected if both compounds compete for the same binding site.
[0178] A modified coregulatory peptide was identified for the
biochemical assay, peptide K1 (ERRTVLQLLLGNSNK; SEQ ID NO: 3). In
addition to its modified sequence, the peptide K1 reagent is
attached to biotin by a six carbon linker that may facilitate
better accessibility of biotin with streptavidin in the
peptide/receptor complex. K1 interacts with GST-mROR.gamma. in the
absence of agonist, and therefore we also used the biochemical
assay in this format in some of these experiments. In K1, the
N-terminal biotin is linked to the first amino acid via
6-aminohexanoic acid (AHC), which is introduced by using
Fmoc-6-aminohexanoic acid (CAS NO: 88574-06-5) during peptide
synthesis. In peptide K, the N-terminal biotin is directly linked
to the first amino acid without any linker.
[0179] As shown in FIG. 6, this assay could be used to characterize
both an agonist (OR-12872) and an antagonist (OR-1050)
independently under the same assay conditions. The methods
illustrated in FIG. 5 and FIG. 6 may also be modified to allow high
throughput screening of ROR.gamma. agonists and antagonists with
the coregulatory peptide recruitment assay.
[0180] A number of analogs of T0901317 and OR-1050 were synthesized
and compared in the transcriptional and biochemical assays for
ROR.gamma. (Table 1). These findings showed that the rank order of
potency of the series of related molecules was similar in the two
assays. Further, several analogs of OR-942 were also synthesized,
including OR-12872, an agonist with potency less than 100 nM in the
biochemical assay (Table 2). The rank order of potency of these
compounds was also similar in the transcriptional and biochemical
assays. In one embodiment, the ROR.gamma. antagonist is not
T0901317.
TABLE-US-00007 TABLE 1 The biochemical assay was carried out in the
presence of mROR.gamma. and peptide K1. ##STR00010## (Structure 1)
Non-steroidal analogues of Assay EC.sub.50 T0901317 (see Structure
1) in micromolar at mROR.gamma. X R1 R2 Transcriptional Biochemical
OR-1048 OH Br Me 0.12 0.42 OR-1052 OH Me Me 0.21 0.89 OR-1050 OH
NO2 Me 0.26 0.9 T0901317 OH H CF3 0.54 1.2 OR-1031 OH H Me 1.4 3.5
OR-1047 OH nBu Me 3.6 5.8 OR-1030 OMe H H >20 >100 OR-1046 OH
H CO2H >20 >100
TABLE-US-00008 TABLE 2 Derivatives of hyodeoxycholic acid methyl
ester (OR-942) were evaluated in the transcriptional assay for
ROR.gamma. and in the biochemical assay using biotinylated peptide
K as the coregulatory peptide. In the transcriptional assay,
antagonist OR-376 (1.5 .mu.M) was added to reduce the basal
transcriptional activity or ROR.gamma. thus to increase the dynamic
range of the agonist effect. EC.sub.50 values were estimated by
fitting the data to a sigmoidal curve (GraphPad, Prism, San Diego,
CA). In the biochemical assay, the compounds induce association
between the ROR.gamma. LBD and peptide K. The EC.sub.50 of the
biochemical assay was determined by the concentration of compound
required to elevate the baseline by 50% of estimated maximum FRET
signal for the individual compound after fitting data to a
sigmoidal dose response curve. ##STR00011## (Structure 2) Analogs
of OR-942 (see Structure 2) EC.sub.50 in micromolar at mROR.gamma.
X Transcriptional Biochemical OR-12872 CH(Me)OMe 0.44 0.052
OR-12866 C(Me)2OMe 0.56 0.14 OR-942 CO2Me 1.5 0.12 OR-12863 CH2OH
4.1 0.67 OR-12870 C(.dbd.O)Me 4.1 ND OR-12868 C(.dbd.O)NMe2 5.2
0.56 OR-12864 CH2OMe 6 0.23 OR-12865 C(Me)2OH 8.3 0.21 OR-12871
CH(Me)OH 8.3 0.25 OR-412 CO2H >20 >100 OR-12867 C(.dbd.O)NHMe
>20 ND OR-12869 C(.dbd.O)N(c-C5H10) >20 ND
[0181] In addition, several other ROR.gamma. antagonists were
identified, including the related terpenes OR-345 and OR-885
(rockogenin) in Table 3. The natural compound OR-13571 (11-oxo
ursolic acid acetate), is illustrated in Tables 4A and 4B. Further,
the structurally-distinct synthetic compound OR-2161 was also
examined in ROR.gamma. assays.
TABLE-US-00009 TABLE 3 The biochemical assay was carried out in the
presence of peptide K and 1 .mu.M OR-942 to elevate the assay
baseline. The EC.sub.50 of the biochemical assay was determined by
the concentration of compound required to inhibit the OR-942
baseline by 50% after fitting data to a sigmoidal dose response
curve. ##STR00012## (Structure 3) In which X = O or is absent (X =
H,H) Steroidal Antagonists Assay EC.sub.50 in micromolar X
transcriptional biochemical OR-885 H,H 0.2 2.5 OR-345 O 5 12.7
TABLE-US-00010 TABLE 4A ROR.gamma. antagonists. Biochemical assays
were carried out in the presence of peptide K1. No agonist was
present. OR-13571 is 11-oxo ursolic acid acetate. Values are
medians of two or more assays. EC.sub.50 EC.sub.50 Compound Trans-
Bio- ID Structure criptional chemical OR-13571 ##STR00013## 0.27
1.2 OR-2161 ##STR00014## 0.33 4.5 OR-133008 ##STR00015## 1.46 1.61
OR-133097 ##STR00016## 1.44 1.34 OR-133099 ##STR00017## 1.04 1.33
OR-133167 ##STR00018## 3.3 3.4 OR-133171 ##STR00019## 0.49 0.44
TABLE-US-00011 TABLE 4B OR-52 and analogues of OR-52. Biochemical
assays were carried out in the presence of peptide K1. No agonist
was present. ##STR00020## Structure 4 Compounds (see Structure 4)
Assay EC.sub.50 in micromolar X R1 R2 R3 Transcriptional
Biochemical OR-52 CH2CH2 CF3 H H 5.8 3.5 OR-32286 CH2 CF3 H H
>20 >100 OR-32268 CH2CH2 CH3 H H 13.5 8.9 OR-32281 CH2CH2 Cl
Cl H 3.7 5.8 OR-32288 CH2CH2 CH3 H CH3 >20 52.2
[0182] Further, many of the compounds listed above were evaluated
in a transcriptional assay for hROR.gamma.. As shown in Table 4C,
the EC.sub.50 values were comparable for most compounds tested,
except for OR-885, which was significantly less potent at
hROR.gamma., and the analogs of OR-133008, which also were more
potent at mROR.gamma. than at hROR.gamma..
TABLE-US-00012 TABLE 4C Potency of ROR.gamma. antagonists in a
transcriptional assay of human ROR.gamma.. Compound EC.sub.50
(.mu.M) OR-885 5.1 T0901317 1.1 OR-1050 0.4 OR-2161 1.0 OR-13571
0.2 OR-133008 6.8 OR-133097 5.0 OR-133099 2.4 OR-133167 9.4
OR-133171 1.7
[0183] These findings demonstrate that a range of ligands to
ROR.gamma. may be identified by receptor screening. The example
also illustrates that a series of agonists and a series of
antagonists, each covering a wide range of potencies, will have
consistent rank order of potencies in two mechanistically separate
assays for the same target (e.g. mROR.gamma.). Collectively, these
findings strongly imply binding of these ligands to the ROR.gamma.
LBD. The most potent compounds, both agonists and antagonists, are
also useful for characterization of ROR.gamma.-mediated effects in
target cells
Example 2
[0184] It is not unusual for a single compound to interact with
receptors from different subfamilies within the nuclear receptor
superfamily (Laudet 1999). Nuclear receptor crossreactivity is
sufficiently common that it must be accounted for in a program of
ligand design and characterization. An example of such a
crossreactive ligand is TTNPB, which binds the retinoic acid
receptors (RAR.alpha., RAR.beta., and RAR.gamma.) from the NR1B
subfamily and the farnesoid X-receptor FXR (Zavacki, Lehmann et al.
1997) in subfamily NR1H. Other examples are the estrogen receptor
(NR3A) ligands diethylstilbestrol (DES), tamoxifen (TAM), and
4-hydroxytamoxifen (4-OHT) which bind the estrogen-related receptor
ERR.gamma. (NR3B3) (Coward, Lee et al. 2001). Therefore,
transcriptional assays were developed to characterize ROR.gamma.
ligands at several of the other major nuclear receptors.
Methods
[0185] Table 5 lists details of construction of Gal4 hybrids with
the following nuclear receptor LBDs. The positive control compounds
for transcriptional assays (Table 6) are dexamethasone,
dihydrotestosterone, 1,25 (OH).sub.2 Vitamin D.sub.3, progesterone,
chenodeoxycholic acid (CDCA), TTNPB
((E)-4-[2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-prope-
nyl]benzoic acid), 9-cis retinoic acid, 17.beta.-estradiol, and
bezafibrate (from Sigma, St. Louis, Mo.) and T0901317,
rosiglitazone and WY14643 from Cayman Chemicals. The
transcriptional assays were carried out as in Example 1.
TABLE-US-00013 TABLE 5 The following nuclear receptor LBDs were
cloned in pFA-CMV for expression as Gal4 hybrids. Receptors are
described by common names found in the literature, by a Unified
Receptor Nomenclature system (Laudet 1999), and by species of
origin (h = human or m = mouse) and a trivial name or abbreviation.
The range of amino acids included in the LBD is shown along with
the cloning site in pFA-CMV. The amino acid range corresponds, in
most cases, to the most common splicing isoform of the receptor.
The final amino acid corresponds in each case to the C-terminal
residue. Receptors were subcloned into pFA-CMV by PCR using primers
containing the restriction enzyme sites shown. The methods are well
known to those skilled in the art and constructs similar to these
have been widely reported in the scientific literature. Common
Unified Species & Amino Name of Receptor trivial Acid cloning
sites in Receptor Nomenclature name range pFACMV glucocorticoid
NR3C1 mGR 524-793 BamHI, KpnI receptor androgen NR3C4 hAR 646-919
BamHI, XbaI receptor Vitamin D NR1I1 hVDR 90-427 BamHI, HindIII
receptor Liver X NR1H3 mLXR.alpha. 172-455 BamHI, XbaI receptor
alpha progesterone NR3C3 hPR 687-933 XbaI, KpnI receptor PPAR-gamma
NR1C3 hPPAR.gamma. 175-477 XbaI, KpnI farnesoid X NR1H4 hFXR
192-473 BamHI, XbaI receptor retinoic acid NR1B1 hRAR.alpha.
156-462 BamHI, HindIII receptor alpha retinoid X NR2B1 hRXR.alpha.
203-462 EcoRI, HindIII receptor alpha PPAR-alpha NR1C1 hPPAR.alpha.
166-468 BamHI, HindIII PPAR-delta NR1C2 hPPAR.alpha. 138-441 BamHI,
HindIII Estrogen NR3A1 hER.alpha. 249-595 BamHI, KpnI receptor-
alpha
TABLE-US-00014 TABLE 6 Crossreactive receptor assays for ROR.gamma.
ligands. Standard ROR.gamma. Ligands Standard Ligands OR- OR- OR-
OR- Ligand Efficacy Potency T0901317 OR-1050 OR-885 13571 12872
2161 133008 mGR Dexamethasone 35X ++++ - - - - - - - hAR dihydro-
8X ++++ - - - - - - - testosterone hVDR 1,25 Vitamin 68X ++++ - - -
- - - - D3 mLXR.alpha. T0901317 120X ++ ++ + - - - - - hPR
Progesterone 6X ++++ - - - - - - - hPPAR.gamma. Rosiglitazone 50X
+++ - - - - - - - hFXR CDCA 5X ++ + - - - - - - hRAR.alpha. TTNPB
18X ++++ - - - - - - - hER.alpha. 17.beta.-estradiol 40X ++++ - - -
- - - - hRXR.alpha. 9-cis-retinoic 180X +++ - - - - - - - acid
hPPAR.alpha. WY14643 6X * - - - - - - - hPPAR.delta. Bezafibrate
10X * - - - - - - - Potency indicates EC50 values in .mu.M: ++++
(EC50 < 0.01), +++ (0.01-0.1), ++ (0.1-1), + (1-10) and -
(>10). * EC.sub.50 values of standard ligands for PPAR.alpha.
and PPAR.delta. are >>20 .mu.M. Efficacy = activity of
standard ligand at 20 .mu.M. The ROR.gamma. ligands show no
significant activity at 20 .mu.M in assays for PPAR.alpha. and
PPAR.delta..
Results
[0186] Among the ROR.gamma. ligands identified in studies described
in Example 1, one of the compounds, T0901317, was previously shown
to activate LXR.alpha. and LXR.beta. (Schultz, Tu et al. 2000). A
transcriptional assay for LXR.alpha., using a Gal4-LXR.alpha.
hybrid, was implemented in order to compare ROR.gamma. ligand
potencies. In addition to LXR.alpha., transcriptional assays for a
number of other major nuclear receptors were developed. In Table 6,
several of the ROR.gamma. ligands described in Example 1 were
characterized against these receptors. Confirming published data on
T0901317 (Schultz, Tu et al. 2000; Houck, Borchert et al. 2004), we
found that T0901317 activates LXR and FXR (Table 6). At the same
time, a number of other ROR.gamma. antagonists, such as OR-12872,
OR-885, OR-13571, OR-133008, and OR-2161 were shown to be selective
for ROR.gamma. within this receptor family.
TABLE-US-00015 TABLE 7 Comparative pharmacology of ROR.gamma.
antagonists at ROR.gamma. and LXR.alpha.. Compound structures are
presented in Table 1, and ROR.gamma. pharmacology is taken from
Table 1. Activity in the LXR.alpha. transcriptional assay is the
estimated maximum elevation of luciferase activity, based on a
sigmoidal dose response curve, with respect to T0901317. Assay
EC.sub.50 in Transcriptional ROR.gamma. micromolar at mROR.gamma.
Assay of LXR.alpha. antagonists Transcriptional Biochemical
activity EC.sub.50 OR-1048 0.12 0.42 >80% 0.57 OR-1052 0.21 0.89
>80% 0.81 OR-1050 0.26 0.9 >80% 1.5 T0901317 0.54 1.2 100%
0.14 OR-1031 1.4 3.5 >80% 1.4 OR-1047 3.6 5.8 <5% >20
OR-1030 >20 >100 <5% >100 OR-1046 >20 >100 <5%
>100
[0187] In Table 7, several analogs of T0901317 were compared in
transcriptional assays for ROR.gamma. and LXR.alpha.. The binding
pockets of LXR.alpha. and LXR.beta. are very similar in structure
and have closely similar affinities to a range of ligands
(Svensson, Ostberg et al. 2003). Hence, the LXR.alpha. assay is
assumed to be representative of both receptors. A number of
derivatives of T0901317 were synthesized. As can be seen in Table
7, compounds with a wide range of specificity were identified,
including several that are more specific for ROR.gamma. than
LXR.alpha., including OR-1048, OR-1050, OR-1052 and OR-1047.
[0188] The importance of this example is two-fold. First, selective
ROR.gamma. ligands can be identified that lack obvious
cross-reactivity with other nuclear receptors. Secondly, the SAR of
compounds in the T0901317 series differ between ROR.gamma. and
LXR.alpha., suggesting that ligands can be designed from this
series that retain ROR.gamma. potency and have better separation
between the two targets.
[0189] In one embodiment, the ROR.gamma. antagonist is at least
20-fold more potent as an ROR.gamma. antagonist than as an LXR
agonist. In other embodiments, the ROR.gamma. antagonist is at
least about 30-fold, 40-fold, 50-fold, 75-fold, 100-fold, 150-fold,
200-fold, 250-fold, 300-fold, 400-fold, 500-fold, 600-fold,
700-fold, 800-fold, 900-fold, or 1,000-fold more potent as an
ROR.gamma. antagonist than as an LXR agonist.
[0190] Ligands to LXR have anti-inflammatory effects that may make
them active in animal models of autoimmune disease (Zelcer and
Tontonoz 2006). Recently, T0901317 was shown to inhibit the
development of murine EAE (Hindinger, Hinton et al. 2006). It is
not known what proportion of the therapeutic effect of T0901317 in
the mouse model of EAE is due to ROR.gamma. antagonism as opposed
to LXR activation. However, strong genetic and pharmacological data
demonstrate that activation of LXR causes hypertriglyceridema and
triglyceride accumulation in liver. Specifically, in mice lacking
the LXR.alpha. and LXR.beta. receptors, T0901317 has no effect on
liver triglyceridemia (Schultz, Tu et al. 2000). Other LXR ligands
have been tested in cynomolgus monkey and hamster (Groot, Pearce et
al. 2005), and these ligands were shown to elevate serum
triglycerides and serum LDL. The importance of this example is that
it provides methodology to eliminate various forms of LXR-mediated
hyperlipidemic activity from the T0901317 and OR-1050 series of
compounds while retaining the ability to inhibit T.sub.H-17
differentiation.
Example 3
[0191] The differentiation of purified naive murine CD4.sup.+
splenic T cells into T.sub.H-17 cells in cell culture is simulated
by a combination of the cytokines TGF.beta. and IL-6 or inhibited
by the cytokine IFN-.gamma. (Mangan, Harrington et al. 2006;
Veldhoen, Hocking et al. 2006). This is not the only
differentiation pathway available to naive CD4.sup.+ T cells (FIG.
1). For example, IL-12 stimulates the differentiation of T.sub.H1
cells in the same system. The effects of continuous treatment with
ROR.gamma. agonists and antagonists on T.sub.H1 and T.sub.H-17
differentiation were investigated. This example demonstrates that
small molecule ligands to ROR.gamma. regulate T.sub.H-17 T cell
differentiation. In these experiments, a T.sub.H-17 cell was
identified by cell surface staining for CD4 and intracellular
staining with a labeled antibody to IL-17. In particular, we
observe that antagonists to ROR.gamma. inhibit T.sub.H-17 cell
differentiation but have no consistent effect on the
differentiation of murine T.sub.H1 cells (that are
CD4.sup.+IFN.gamma..sup.+ but do not express IL-17). The inhibitory
effect on T.sub.H-17 cells has been observed with four different
antagonists that are each structurally distinct (that is, they are
not analogs of one another). Further, supporting the conclusion
that inhibition of ROR.gamma. activity in naive CD4.sup.+ T cells
by an ROR.gamma. antagonist will inhibit T.sub.H-17
differentiation, we show that an agonist to ROR.gamma. reverses
antagonist inhibition of T.sub.H-17 cell differentiation and
independently enhances T.sub.H-17 cell formation. These results
indicate that the ROR.gamma. ligands described in the example act
specifically through the ROR.gamma. LBD in the differentiating
T.sub.H-17 cell.
Methods
[0192] Antibodies and Cytokines.
[0193] The following reagents were selected for characterization of
mouse lymphocytes. FITC anti-IFN.gamma. (XMG1.2), PE anti-CD62L
(MEL-14), APC anti-CD4 (RM4-5), FITC anti-CD4 (RM4-5), PE anti-CD8
(53-6.7), APC anti-CD25 (PC61), biotinylated anti-CD25 (PC61.5),
Cy5.5 anti-CD44 PE-(IM7) were from eBioscience (San Diego, Calif.).
PE anti-IL-17 (TC11-18H10.1) was from BD Biosciences (San Diego,
Calif.). TGF-.beta. and IL-6 were from Sigma. IL-12 was from
PeproTech (Rocky Hill, N.J.).
[0194] Purification of Naive (CD4.sup.+CD62L.sup.+CD25) CD4
Cells.
[0195] Spleens of 5-7 week old outbred ICR (CD-1, Harlan Labs) mice
were gently minced with two 18-gauge needles in PBS buffer
supplemented with 2.5 mM MgCl.sub.2, 0.5 mM CaCl.sub.2 and 25 ug/ml
DNAse I. A single cell suspension of splenocytes was triturated
with a 5-ml pipet and passed through a 40 .mu.m nylon mesh filter.
Splenocytes were spun down at 300.times.g for five minutes and
resuspended in buffer containing PBS, 2% heat-inactivated FCS and 2
mM EDTA. Naive T cells were purified from splenocytes using a
CD4.sup.+CD62L.sup.+ magnetic bead T cell Isolation Kit from
Miltenyi Biotec (Auburn, Calif.) in two steps. First, CD4' cells
were removed by negative selection with biotinylated antibodies to
CD8a, CD45R, CD11b, CD49b, and Ter119 (supplied by the
manufacturer) and to CD25 (biotinylated PC61), added at the time of
isolation. The flow through, predominantly CD4.sup.+ cells, was
directly labeled with anti-CD62L microbeads and enriched on a
magnetic column to about 93% purity, as determined by staining for
CD4, CD62L, and CD25.
[0196] Stimulation and Culture of T.sub.H-17 Cells.
[0197] Purified CD4.sup.+CD62L.sup.+ T cells were plated in 24-well
plates with 2-4.times.10.sup.5 cells in 700 ul volume of RPMI 1640
media containing 10% heat-inactivated FCS, 100 IU penicillin, 100
.mu.g/ml streptomycin, 1.times. non-essential amino acids, 1 mM
pyruvate, 2 mM glutamine, and 50 .mu.M .beta.-mercaptoethanol
(Veldhoen, Hocking et al. 2006). T cells were stimulated with
exogenous cytokines and anti-CD3/anti-CD28 conjugated Dynabeads
(Dynal Biotech, Oslo) at a 1:1 ratio of beads to cells. Exogenous
cytokines used were: 4 ng/ml TGF-.beta., 20 ng/ml of IL-6, or 10
ng/ml IL-12. ROR.gamma. agonist and antagonist ligands, dissolved
in DMSO, were added directly to cell cultures, to a final
concentration of 0.01%. Cytokines and ROR.gamma. ligands were added
immediately after cell plating.
[0198] Cell Staining and Flow Cytometry.
[0199] To determine intracellular cytokine production, exogenous
cytokines were removed by centrifugation and cultures treated with
500 ng/ml phorbol 12,13 dibutyrate (PdBu), 500 ng/ml ionomycin, and
1 .mu.g/ml brefeldin A for 4-6 hours to stimulate cytokine
production while preventing secretion as described (Veldhoen,
Hocking et al. 2006) and washed again. Cells were then fixed,
permeabilized and stained for intracellular cytokines using
commercial reagents (eBioscience, San Diego). Cells were also
stained for the cell surface markers CD4 and CD8. Flow cytometry
analysis was performed on a FACSCalibur (Becton Dickinson) and the
data were analyzed using FlowJo Software (Tree Star, Inc).
[0200] ELISA for IL-17.
[0201] ELISA kits for mouse IL-17 and human IL-17 were from
eBioscience (San Diego, Calif.). ELISA assays were performed
following the manufacturer's protocol. Certain samples were diluted
20-fold to avoid maximization of enzymatic signals. For mouse IL-22
ELISA, antibodies and standards were from Antigenix America
(Huntington Station, N.Y.) and accessory components were from
eBioscience. The IL-22 assay protocol was similar to that of the
IL-17 assays.
Results
[0202] Mouse T.sub.H-17 cells can be induced to differentiate from
naive CD4.sup.+ T cells in the presence of TGF.beta. and IL-6
(Veldhoen, Hocking et al. 2006). At the same time, T.sub.H1
differentiation is suppressed. Critical steps in this protocol are:
(i) purification of naive CD4.sup.+ cells to remove potentially
inhibitory activated T cells, such as T.sub.H1 cells, or T
regulatory (Treg) cells, (ii) activation of T cells by crosslinking
CD3 and CD28, and (iii) incubation with TGF.beta. and IL-6 to
induce T.sub.H-17 differentiation. Protocols for T.sub.H-17
differentiation have been reported by several laboratories
(Bettelli, Carrier et al. 2006; Mangan, Harrington et al. 2006;
Veldhoen, Hocking et al. 2006). The percentage of differentiated
cells is determined by intracellular staining for IL-17 and
IFN-.gamma., markers of T.sub.H-17 and T.sub.H1 cells respectively
(Park, Li et al. 2005). A T.sub.H-17 differentiation assay provides
a cell-based model to demonstrate ROR.gamma. antagonist function.
We predicted that OR-1050, OR-885, OR-13571, and OR-2161 should
inhibit T.sub.H-17 differentiation and/or IL-17 release and that
this inhibitory effect could be reversed by the potent ROR.gamma.
agonist OR-12872.
[0203] Naive CD4.sup.+ T cells were isolated from splenocytes of
5-8 wk old CD-1 mice and CD4.sup.+CD62L.sup.+ cells with
approximately 93% purity selected with magnetic beads. We estimated
that the population of Tregs (Itoh, Takahashi et al. 1999) in the
purified cells, as estimated by the percentage of
CD25.sup.+CD44.sup.+ cells, was about 1-1.5% as compared to 5% in
total splenocytes. IL-12 treatment of the naive T cells stimulates
T.sub.H1 differentiation as shown by the high percentage of
IFN.gamma. positive cells, while the combination of TGF.beta.1 and
IL-6 induced the formation of 4% IL-17-producing cells (Table 8).
As reported, the T.sub.H1 (IFN.gamma..sup.+) and T.sub.H-17
(IL-17.sup.+) phenotypes were mutually exclusive (see also FIG. 8).
Further, both IL-6 and TGF.beta. were required to fully induce the
T.sub.H-17 phenotype as reported in the scientific literature
(Bettelli, Carrier et al. 2006; Mangan, Harrington et al. 2006;
Veldhoen, Hocking et al. 2006). Finally, we observed that the
IL-17.sup.+ cells were >97% CD4.sup.+.
TABLE-US-00016 TABLE 8 IL-17- or IFN.gamma.-producing cells are
differentiated from naive CD4 cells in the presence of exogenous
cytokines. Cells are stained for IL-17 or IFN-.gamma. and
quantitated by FACS analysis. Data are shown as mean .+-. SD of the
percentage of IL-17 or IFN.gamma.-producing cells in total cell
populations after 5 days in culture. Less than 0.02% of total cells
appear to express both cytokines. IL-17 (%) IFN.gamma. (%) No
cytokine 0.21 .+-. 0.00 2.50 .+-. 0.40 IL-12 (10 ng/ml) 0.09 .+-.
0.01 39.6 .+-. 2.44 TGF.beta.1 (4 ng/ml) 0.21 .+-. 0.02 0.32 .+-.
0.05 IL-6 (20 ng/ml) 1.20 .+-. 0.04 3.42 .+-. 0.08 TGF.beta.1 +
IL-6 4.53 .+-. 0.18 2.14 .+-. 0.18
[0204] For pharmacology studies, we added either agonist or
antagonist to ROR.gamma. at the initiation of naive CD4.sup.+ T
cell cultures described above. We found that OR-1050 significantly
inhibited T.sub.H-17 cell differentiation in a dose-dependent
manner while the potent agonist OR-12872 was stimulatory (see FIG.
7).
[0205] As expected from receptor pharmacology studies, OR-12872 was
able to reverse the effect of OR-1050, consistent with the
conclusion that both compounds act through the same target, i.e.,
ROR.gamma. (FIG. 8). In this experiment, the agonist OR-12872 alone
elevated T.sub.H-17 frequency by 60%, but in the presence of
OR-1050 the agonist caused a 400% percent increase from the lower
baseline produced by OR-1050, precisely the behavior expected if
agonist and antagonist bind the same target. The figure represents
individual observations, and the average of duplicate observations
is presented in Table 9. Neither 3 .mu.M OR-1050 nor 3 .mu.M
OR-12872 had an effect on the frequency of T.sub.H1 cell
differentiation in the presence of IL-12. The findings show that
OR-1050 is unlikely to block T.sub.H-17 cell formation through a
non-specific cytotoxic effect for two reasons: it does not inhibit
T.sub.H1 differentiation and the blockage of T.sub.H-17
differentiation is reversible by an ROR.gamma. agonist.
TABLE-US-00017 TABLE 9 Naive CD4+ T cells were induced to
differentiate with 4 ng/ml TGF.beta. and 20 ng/ml IL-6 (T.sub.H-17
protocol) or 10 ng/ml IL-12 (Th-1 protocol). After addition of
compound, the final DMSO concentration in the culture wells was
0.01%. Cytokine positive cells were determined as in the methods
for this example. Duplicate cell cultures were counted and
averaged. Cell Frequency (%) T.sub.H-17 Protocol Th-1 Protocol
Compound IL-17.sup.+ IFN-.gamma..sup.+ IFN-.gamma..sup.+ DMSO 2.32%
1.60% 36.3% 3 .mu.M OR-1050 0.44% 1.42% 37.4% 3 .mu.M OR-12872
3.91% 1.37% 41.4% OR-1050 + OR-12872 1.79% 1.47% 36.6%
[0206] To provide additional confirmation that T.sub.H-17 cell
differentiation can be pharmacologically-regulated through
inhibition of ROR.gamma. function, we tested the effects of the
antagonist OR-885 and its reversal by OR-12872. FIG. 9 demonstrates
that OR-885 blocks the differentiation of T.sub.H-17 cells and that
this effect is reversed by OR-12872. The results of this experiment
are summarized in Table 10. It appears that there may be a small
secondary effect of ligand on Th-1 cell levels. Overall, however,
the ROR.gamma. ligands did not have a consistent effect on Th-1
cell frequency in these studies.
TABLE-US-00018 TABLE 10 Naive CD4+ T cells were induced to
differentiate with 4 ng/ml TGF.beta. and 20 ng/ml IL-6 (T.sub.H-17
protocol) or 10 ng/ml IL-12 (Th-1 protocol). After addition of
compound, the final DMSO concentration in the culture wells was
0.01%. Cytokine positive cells were determined as in the methods
for this example. Duplicate cell cultures were counted. Cell
Frequency (%) T.sub.H-17 Protocol Th-1 Protocol Compound
IL-17.sup.+ IFN-.gamma..sup.+ IFN-.gamma..sup.+ DMSO vehicle 2.46%
0.71% 29.7% 3 .mu.M OR-885 0.52% 1.45% 34.2% 1 .mu.M OR-12872 3.96%
0.65% 30.8% OR-885 + OR-12872 1.33% 1.11% 36.2%
[0207] Finally, OR-13571 exerted a similar effect on T.sub.H-17
differentiation as OR-885 and OR-1050. The effect of 3 .mu.M
OR-1050 was compared to that of 3 .mu.M OR-13571 in Table 11.
TABLE-US-00019 TABLE 11 Studies were performed as in Table 9. Cell
Frequency (%) Th-17 Differentiation Compound IL-17.sup.+
IFN-.gamma..sup.+ DMSO vehicle 3.81% 1.03% 3 .mu.M OR-1050 1.47%
1.09% 3 .mu.M OR-13571 1.42% 0.93%
The data show that OR-13571 also inhibits T.sub.H-17
differentiation at a concentration of 3 .mu.M. In summary, this
example provides very strong pharmacological evidence that
regulation of ROR.gamma. activity by small molecule ligands can
control cell fate. Antagonists with 3 distinct structures were
shown to have a similar effect on T.sub.H-17 differentiation and
two of these were reversed by a specific ROR.gamma. agonist,
OR-12872. It is probable that the ROR.gamma. ligands will regulate
T.sub.H-17 function in other settings described in the literature,
including by measurement of IL-17 release into surrounding medium
and by culture of cells from lymph nodes of animals treated with
antigen that provokes autoimmune disease (Murphy, Langrish et al.
2003; Langrish, Chen et al. 2005; Mangan, Harrington et al. 2006).
This hypothesis is addressed in Example 6.
[0208] We also investigated whether the concomitant release of
IL-17 that is expected to take place with T.sub.H-17
differentiation is pharmacologically regulated by ROR.gamma.
ligands. ROR.gamma. antagonists at 3 .mu.M were added as naive
CD4.sup.+ T cells were induced to differentiate into T.sub.H-17
cells, in the presence or absence of OR-12872. In this study, all
four ROR.gamma. antagonists tested block IL-17 release (FIG. 10).
Significantly, the presence of OR-12872, the ROR.gamma. agonist,
reverses the effect of each of the antagonists, indicating that the
compounds are acting in an ROR.gamma.-specific manner. We
hypothesize that the very marked reduction in IL-17 levels involved
simultaneous inhibition of T.sub.H-17 differentiation, as shown
above, and suppression of IL-17 release.
Example 4
[0209] This example provides data suggesting that pharmacological
repression of ROR.gamma. will not necessarily inhibit thymic
function in vivo. The induction of liver triglycerides by OR-1050
in C57BL/6 mice following oral dosing was investigated. In
addition, the effect of compound treatment in the same animals on
the number and distribution of the major thymocyte populations was
analyzed. The objective was to show evidence of bioavailability
through elevation of liver triglycerides (through LXR), and at the
same time to characterize the effect of OR-1050-mediated antagonism
of ROR.gamma. on thymic function.
Methods
[0210] Following six days of twice-a-day dosing with corn oil
vehicle or 50 mg/kg OR-1050 in corn oil, mice were sacrificed and
the thymus and liver removed and weighed. A small piece of the
liver (.about.200 mg) was weighed and extracted to determine
triglyceride content. Glycerol was liberated from liver
triglycerides by hydrolysis in base. The liver fragment was
incubated overnight at 55.degree. C. in 0.35 mls of ethanolic KOH
(2 parts EtOH: 1 part 30% KOH) in a closed tube. A solution of 50%
ethanol in water was added to bring the volume of each tube to 1.0
ml. The solution was cleared of debris by centrifugation, and the
resulting supernatant increased to 1.2 ml with further addition of
50% ethanol. Aqueous 1 M MgCl.sub.2 (215 .mu.l) was added to 200
.mu.l of the supernatant, and the mixture was cleared by
centrifugation again after standing 10 min on ice. Glycerol levels
were measured with the Sigma Free Glycerol Reagent (Sigma-Aldrich,
St. Louis, Mo.) according to the manufacturer's instructions. The
triglyceride concentration (in milligrams per gram of liver wet
weight) was determined by assuming average molecular weight of 1000
daltons for each molecule of triglyceride.
[0211] In addition, the total number and the fraction of the major
thymocyte subpopulations including CD4.sup.+CD8.sup.+ (DP),
CD4.sup.+CD8.sup.- (SP4.sup.+) and CD4.sup.-CD8.sup.+ (SP8.sup.+)
were measured by cell surface staining followed by FACS analysis.
The thymus was dissected, weighed, and gently pressed against a
wire screen (200 mesh USA standard test sieve, Newark Wire Cloth
Company) with plunger of a 5 ml plastic syringe. The volume of
cells was adjusted to 8 mls. Debris from the thymus was allowed to
settle, and a 200 .mu.l aliquot of cells was incubated with
fluorescent antibodies to CD4 and CD8 for 15 minutes at room
temperature. The cells were fixed in 4% formalin in PBS and stored
at 4.degree. C. for 48 hours. Before analytical flow cytometry was
carried out (FACS Calibur, Becton Dickinson), Caltag counting beads
(from Invitrogen) were added to allow absolute quantitation of cell
number. Thymus subpopulations were determined after gating for live
cells. As a positive control for thymic involution, two animals
were also treated once with 10 mg/kg dexamethasone two days before
sacrifice. Dexamethasone reproducibly induces rapid apoptosis of DP
thymocytes and reduction of thymic mass (Chmielewski, Drupt et al.
2000; Zubkova, Mostowski et al. 2005).
Results
[0212] Table 12 shows that liver triglyceride content (in mg of
triglyceride/gram liver) is markedly elevated by OR-1050 as
reported for other LXR agonists (Schultz, Tu et al. 2000; Beyer,
Schmidt et al. 2004). In contrast, the number and fraction of major
thymocyte subpopulations was not significantly affected. As
expected, dexamethasone caused a virtually total depletion of DP
thymocytes.
[0213] As shown above, OR-1050 is approximately 5-fold more potent
in repression of ROR.gamma. transcription than it is in induction
of LXR transcription. Thus it is likely that ROR.gamma. activity in
mice treated as above was significantly repressed. This example
demonstrates that pharmacological dosing of an ROR.gamma.
antagonist does not necessarily cause thymic atrophy or loss of
thymocytes following an intermediate period of dosing.
TABLE-US-00020 TABLE 12 Effects of OR-1050 on liver triglycerides
and thymocyte distribution. C57BL/6 mice were treated by vehicle
only (corn oil) or OR-1050 (100 mg/kg) for 7 days, or by
dexamethasone (Dex, 12.5 mg/kg) once 2 days before necropsy. Corn
oil and OR-1050 (50 mg/kg) were dosed twice per day by gavage.
Liver triglycerides are reported as mg triglyceride/gram liver wet
weight. One animal from the OR-1050 group had a very low frequency
of DP thymocytes (<1% of control) and was excluded from this
analysis. Frequency Liver Thymus Total cells per spleen of DP (%
Group triglycerides weight (.times.10.sup.-6) of total size (mg/g)
(.mu.g) DP SP4 SP8 cells) Vehicle 6 34.7 .+-. 5.7 71.3 .+-. 12.0
58.7 .+-. 24.7 6.3 .+-. 1.7 2.0 .+-. 0.4 52.6 .+-. 8.4 Dex 2 35.3
.+-. 8.2 49.7 .+-. 1.2 1.0 .+-. 0.4 3.9 .+-. 0.1 1.2 .+-. 0.1 4.2
.+-. 2.9 OR-1050 5 119.5 .+-. 18.8 76.1 .+-. 5.8 61.5 .+-. 10.0 8.1
.+-. 1.6 2.5 .+-. 0.5 56.7 .+-. 3.1
Example 5
[0214] This example provides a demonstration that an ROR.gamma.
antagonist may inhibit the development of EAE in a mouse model.
Methods
[0215] 8-10 week old, female C57BL/6 mice or SJL/J mice were
purchased from Harlan laboratories (Harlan, Indianapolis, Ind.) and
housed in a specific pathogen free (SPF) animal facility for one
week before the start of the studies. Mice were immunized with
peptide antigens intradermally at the dorsal flanks on day 0.
Peptide antigens are either 150 MOG.sub.35-55
(MEVGWYRSPFSRVVHLYRNGK (SEQ ID NO: 19), AnaSpec, San Jose, Calif.)
per C57BL/6 mouse or 75 .mu.g PLP.sub.139-151 (HSLGKWLGHPDKF (SEQ
ID NO: 20), Bio-Synthesis, Lewisville, Tex.) per SJL/J mouse.
Peptides were dissolved in PBS and emulsified with an equal volume
of Complete Freund's Adjuvant (CFA) containing 4 mg/ml of H37RA M.
tuberculosis (Chondrex, Redmond, Wash.). To ensure induction of
reliable EAE, 200 ng of pertussis toxin (List Biologicals,
Campbell, Calif.) was given by via intravenous injection (i.v.) at
day 0 and 2 (Cua, Sherlock et al. 2003; Zhang, Gran et al. 2003).
Animals were treated with drug beginning one day before peptide
injection. Animals were randomized into groups for treatment by
weight, so that the average weight of each group was similar. The
groups were not segregated by cage. Instead, members of all groups
were represented in every cage in order to minimize environmental
effects on the outcome of the study. In the C57BL/6 study, OR-1050
was suspended in corn oil by sonication at 6 mg/mL or 20 mg/mL and
animals were dosed twice daily by gavage with 2.5 mls/kg body
weight of corn oil for each dose. In one SJL/J study (FIGS. 11 D
& E), OR-1050 was dissolved in dimethylformamide at 200 mg/ml,
further diluted into three parts of HRC-6, loaded into an osmotic
pump (Alzet 2002) and implanted in the interscapular region under
anesthesia 2-3 days after peptide immunization. The estimated daily
does was 30 mg/kg in this study. In another SJL/J study (see FIG.
11F), mice were treated once daily by gavage with 100 mg/kg OR-1050
solubilized in the synthetic vehicle HRC-6.
[0216] Clinical symptoms are scored by a visual inspection of
behavior, along the following scale (Papenfuss, Rogers et al.
2004): 1) Limp tail or waddling gait; 2) waddling gait with tail
limpness; 3) partial hind limb paralysis; 4) complete hind limb
paralysis; 5) moribund state, leading to death by EAE. At severity
level 4 or 5 the animals were sacrificed to prevent further
suffering. Animals were weighed daily during the treatment period
as a secondary measure of the disease course. As a comparative
measure for drug treatment, the median day of onset was compared
between groups. Statistical analysis was by the Kruskal-Wallis
test, a non-parametric test for comparison of multiple groups. On
study day 27, remaining animals were euthanized, and brain and
spinal cord fixed, embedded in paraffin, and H&E sections
analyzed for inflammatory infiltration. For the studies of
inflammation, several sections of spinal cord (7 to 8) were
characterized by an experienced veterinary pathologist in a blinded
fashion. Inflammation in each section was evaluated visually using
a semi-quantitative scale based on the overall severity of the
sample (e.g., Severity: 0, not present; 1, slight; 2, mild, 3,
moderate; 4, severe).
Results
[0217] C57BL/6 mice were treated with OR-1050 by oral gavage twice
a day for a total dose of 30 mg/kg or 100 mg/kg for 25 days. Mice
were injected with a peptide that induces autoimmune disease in
this mouse strain one day after the start of dosing. The progress
of the disease in the vehicle and high dose groups is illustrated
in FIG. 11A and FIG. 11B, where exposure to OR-1050 both inhibits
progress of the disease and weight loss doe to the onset of
symptoms. FIG. 11C shows that inflammatory infiltration in the
spinal cord was reduced by treatment with OR-1050 in these animals.
The onset of disease in the three groups as a function of number of
days since peptide immunization is presented in FIG. 12. The median
day of onset of symptoms (clinical score 1 or greater) was day 18
for the corn oil vehicle control, day 16 for the 30 mg/kg group,
and day 26 for the 100 mg/kg treated group (FIG. 12A). The median
day of onset for untreated animals was day 15 (not shown). The
difference in day of onset between the vehicle and the 100 mg/kg
treated animals was statistically significant (p<0.05). This
example shows that an ROR.gamma. antagonist is able to delay the
onset of EAE. The surviving animals at day 27 showed a difference
in the severity of inflammation in spinal cord between vehicle and
high dose treated animals. The statistical significance was based
on a rank order test (p<0.07, Mann-Whitney).
[0218] In a second EAE mouse study, SJL/J mice were immunized with
PLP139-151 and OR-1050 was dosed by osmotic pump to achieve more
stable compound delivery starting at day 4. OR-1050 also reduced
paralytic severity (FIG. 11D) and onset (FIG. 11E). In each of
these studies, there was a significant difference in severity or
weight on several days, as indicated in the graphs (FIG. 8A,
B&D). Using a more rigorous statistical analysis, we calculated
the area under the severity curve for each of the mice in FIG. 11D,
and compared the mean values.+-.sem for vehicle (14.5.+-.1.6) and
treated (5.3.+-.2.7) groups. The differences were significant
(p<0.01) based on the Mann-Whitney rank order test (GraphPad
Prism, San Diego). Furthermore, as shown in FIG. 11E, the day of
onset was significantly delayed in the treated SJL/J mice.
[0219] Since OR-1050 inhibits T.sub.H-17 cells in ex vivo culture,
we also investigated whether T.sub.H-17 cell frequency was affected
in OR-1050-treated animals. SJL/J female mice (n=9/group) were
treated with 100 mg/kg OR-1050 in HRC-6 beginning two days before
immunization with PLP (as described above) and continuing until 8
days after immunization. Animals were sacrificed on day 9, and
T.sub.H-17 cells analyzed from pooled axillary, brachial, and
inguinal lymph nodes from each animal. We found a 35% reduction in
T.sub.H-17 frequency in lymph nodes of SJL/J mice (FIG. 11F) as a
fraction of the total CD4.sup.+ cell population. The change in
T.sub.H-17 frequency with OR-1050 treatment was statistically
significant.
[0220] In a second study on C57BL/6 mice (FIG. 11G), we observed a
similar effect on splenic T.sub.H-17 cells in C57BL/6 mice (29%
inhibition, p<0.05, n=8-10) with no change in T.sub.H1 cells.
C57BL/6 female mice were immunized with 150 .mu.g MOG.sub.33-55 on
study day 0. Mice were treated with either OR-1050 at 100 mg/kg or
with vehicle (HRC-6) by oral gavage for 9 days starting day 0.
Splenocytes were collected at Day 9 and stained for T.sub.H-17
(CD4.sup.+CD8.sup.-IL17.sup.+) and T.sub.H1
(CD4.sup.+CD8.sup.-IFN.gamma..sup.+) cells. Statistics were
performed by Student's t-test. Collectively, the data suggest that
OR-1050 inhibits the expansion of T.sub.H-17 cells in response to
peptide antigen.
[0221] In a separate study related to these findings, we
demonstrated that OR-1050 is orally bioavailable (FIG. 12B).
Pharmacokinetics of OR-1050 in CD-1 mice was analyzed at
independent bioanalytical laboratory. Male CD-1 mice were treated
via oral gavage with OR-1050 at 5 mg/kg in HRC-6. Blood was
collected via retro-orbital puncture in tubes containing sodium
heparin anticoagulant at 0, 5, 15, and 30 min, and at 1, 2, 4, 6, 8
and 24 hr after oral administration. The concentration of OR-1050
in plasma was determined using an HPLC/MS/MS method. The peak
concentration of OR-1050 (.about.100 ng/ml) suggests that a higher
dosage (50 mg/kg) will give blood levels, 1 .mu.g/ml or .about.2
.mu.M, that is higher than the EC.sub.50 for OR-1050 in
transcriptional assays in in vivo pharmacological studies.
Example 6
[0222] That ROR.gamma. antagonists inhibit the differentiation of
T.sub.H-17 is consistent with the phenotype of the
ROR.gamma..sup.-/- mouse, which lacks T.sub.H-17 cells and where
naive CD4.sup.+ T cells resist differentiate to T.sub.H-17 in the
presence of IL-6 and TGF.beta. (Ivanov, McKenzie et al. 2006). The
question of whether the reactivation of memory T.sub.H-17 cells can
be blocked by ROR.gamma. ligands is not addressed by the
ROR.gamma..sup.-/- mouse phenotype, since memory T.sub.H-17 cells
are unable to differentiate from naive CD4.sup.+ T cells. To
address the issue, we cultured lymph node cells from mice
previously immunized with the myelin-derived peptides
PLP.sub.139-151, MOG.sub.35-55, or complete Freund's adjuvant (CFA)
alone. Memory T cells are known to proliferate in response to
cognate peptide in these cultures, and our controls showed that
stimulation of T.sub.H-17 proliferation and IL-17 release were
dependent on prior immunization with peptide, consistent with a
memory T cell response (FIG. 13A). Thus, LN cultures from
CFA-immunized mice were insensitive to PLP in 3 day culture,
whereas LN cultures from mice immunized with PLP (emulsified in
CFA) showed a .about.10-fold increase in IL-17 release and a
concomitant two-fold elevation in the frequency of T.sub.H-17 cells
in response to peptide (not shown). These data show that IL-17
induction is closely linked to the peptide-dependent increase in
T.sub.H-17 cells and therefore provides a convenient method of
characterizing compound effects on Th-17 cells. Furthermore, OR-885
inhibited the PLP-stimulated release of IL-17. The correlation
between Th-17 cell number and IL-17 release in the presence of
agonist and antagonist was further confirmed (FIGS. 13B and 13C),
and the antagonist OR-885 was shown to block both the induction of
T.sub.H-17 cells (as a percentage of total live cells) and IL-17
release.
[0223] Overall, cultured lymph node cells that are stimulated with
IL-23 and peptide antigens provide a model system to examine IL-17
production ex vivo (FIG. 13D). We analyzed a variety of ROR.gamma.
ligands for their ability to regulate IL-17 (FIG. 13E). Four
different classes of ROR.gamma. antagonists tested all inhibit
IL-17 release, while the agonist is able to activate IL-17. A
dose-response assay suggested that the antagonist OR-885 inhibits
IL-17 production with an EC.sub.50 value of approximately 0.2 .mu.M
(FIG. 13F). Each point is the average of duplicate measurements of
IL-17 release in a single well. This potency is consistent with
that measured in the CHO cell transcription assay. To further
confirm that the activity of compounds was ROR.gamma.-dependent in
this system, we showed that the agonist OR-12872 reverses the
suppressive effects of OR-885 on IL-17 release in lymph node
cultures (FIG. 14).
[0224] The proinflammatory cytokine IL-22 is also expressed in
Th-17 cells. We characterized IL-22 release from lymph node cell
cultures and found that like IL-17, IL-22 release is induced by
both peptide antigen and IL-23, and that the effect of both was
more than additive. In addition, IL-22 seems to have 30-50 fold
higher levels than IL-17. IL-22 production is also inhibited by the
ROR.gamma. antagonists OR-885 and OR-1050 and enhanced by the
agonist OR-12872 at a concentration of 3 .mu.M each in LN cultures,
similar to findings with the IL-17 assays. This is illustrated in
FIG. 15.
[0225] Regulation of Human IL-17 Release in Cultured PBMCs.
[0226] We also investigated whether human IL-17 is subject to
regulation by ROR.gamma. ligands. It has proven difficult to
differentiate Th-17 cells from naive human T cells under the same
conditions as mouse (Zheng, Danilenko et al. 2007), although there
are now several very recent reports that this can be done
(Acosta-Rodriguez, Napolitani et al. 2007; Annunziato, Cosmi et al.
2007; Wilson, Boniface et al. 2007). Since mitogenic stimuli such
as ConA or PMA will stimulate IL-17 expression in memory T cells in
human PBMC (Yao, Painter et al. 1995; Shin, Benbernou et al. 1999),
we used this protocol for an initial investigation of IL-17
regulation by ROR.gamma. ligands. Frozen human peripheral blood
mononuclear cells (PBMCs from Stem Cell Technologies, Vancouver)
were thawed and cultured for 3 days with 1 .mu.g/ml Con A and 3
.mu.M compounds in lymphocyte culture medium (RPMI 1640 media
containing 10% heat-inactivated FCS, 100 IU penicillin, 100
.mu.g/ml streptomycin, 1.times. non-essential amino acids, 1 mM
pyruvate, 2 mM glutamine, and 50 .mu.M .beta.-mercaptoethanol).
Culture media were analyzed by hIL-17 ELISA (mean.+-.sem, n=4;
ANOVA with Bonferroni post test). In FIG. 16A, the effects of 3
.mu.M OR-885 and 3 .mu.M OR-12872 on IL-17 release from PBMCs were
compared. The effect of OR-885 was partially reversible by
OR-12872. FIG. 16B shows that stimulated IL-17 release into culture
medium by ConA is inhibited by OR-13571 and OR-1050. The
possibility that inhibition mediated by these two compounds is due
to cytotoxicity was addressed by co-treatment with the ROR.gamma.
agonist OR-12872. OR-12872 alone does not significantly alter IL-17
release but it does partly reverse the effects of OR-1050 and
OR-13571, suggesting that both compounds act specifically through
ROR.gamma..
[0227] In a separate study, T-cell blasts were generated from human
PBMC according to methods previously described (Hoeve, Savage et
al. 2006). Frozen T-cell blasts were thawed and cultured for 18
hours in a 24-well plate with 1.times.10.sup.6 cells per well in
700 .mu.L of lymphocyte culture medium. Phorbol 12,13-dibutyrate
(500 ng/ml), ionomycin (500 ng/ml) and compounds (3 .mu.M) were
added at the beginning of the culture. Culture media were collected
and analyzed for hIL-17 level by ELISA. The results of treatment
with OR-1050 and OR-13571 are shown in FIG. 16C.
Example 7
[0228] Methods.
[0229] 8 to 10-week old male DBA/1 (DBA/1OlaHsd, Harlan
Laboratories) mice are housed in a specific pathogen free (SPF)
animal facility. Arthritis is induced by two injections of collagen
subcutaneously in the base of the tail. The initial injection (on
day 0) uses bovine type II collagen (2 mg/ml from Chondrex,
Redmond, Wash.) emulsified in equal volume of CFA containing 4
mg/ml of M. tuberculosis (Chondrex). The CII booster injection on
Day 29 is emulsified in incomplete Freund's adjuvant (IFA). Each
animal receives 0.1 ml of emulsion by subcutaneous/intradermal
injection in the tail 2 to 3 cm from the body of the mouse. The
booster injection site is in the vicinity of but different from the
initial injection site and closer to the body of the animal.
OR-1050 was formulated in HRC-6 as above. On weekdays, the animals
received two doses (a.m. and p.m.) of HRC-6 or 50 mg/kg OR-1050
p.o. (2.5 mls/kg). On weekends, a single dose of 100 mg/kg was
administered (5 mls/kg).
[0230] The mice were observed daily for clinical symptoms of CIA
based on the following qualitative scale. Each paw was examined
individually and scored. Grade 0, normal; grade 1, mild but
definite redness and swelling of the ankle or wrist, or apparent
redness and swelling limited to individual digits, regardless of
the number of affected digits; grade 2, moderate redness and
swelling of ankle or wrist; grade 3, severe redness and swelling of
the entire paw including digits; grade 4, maximally inflamed limb
with involvement of multiple joints. To estimate cumulative disease
severity for each animal, an area under the curve score was
calculated for each animal by totaling the sum of the daily hind
paw measurements betweens days 24 and 48. Because of the difficult
of adequately distinguishing multiple gradations of change in the
front paws, scoring of the hind paw only was used in FIG. 17.
[0231] Results. We investigated the effect of the ROR.gamma.
antagonist OR-1050 on the course of collagen-induced arthritis in
mouse, where T.sub.H-17 cells are clearly involved (Courtenay,
Dallman et al. 1980; Sato, Suematsu et al. 2006). Animals were
treated with OR-1050 (p.o.) starting three days before immunization
with collagen type II. The disease phenotype is first clearly
visible about one week after the second injection of CII (at day
29), and the disease course is partly suppressed in the
OR-1050-treated animals when compared to vehicle controls (FIG.
17A). Based on the difference in overall disease severity
determined in the hind limbs of the animals (FIG. 17B), the
response shows a trend (p<0.09) towards a statistically
significant effect.
Example 8
[0232] The present invention provides for the discovery of novel
small molecule antagonists to ROR.gamma. that are useful in the
treatment of autoimmune disease and other conditions involving the
inhibition of T.sub.H-17 cell activity. The steps required to
identify a clinical candidate can be outlined briefly. (1) Novel
compounds derived from diverse screening libraries, or by directed
chemical synthesis from known hits, are tested for activity in
transcriptional and biochemical assays for ROR.gamma.. (2) Hits
from this primary screening are then characterized for specificity
against a panel of other nuclear receptors as described above. (3)
Candidate lead compounds for more extensive animal studies are
selected from these hits on the basis of potency and selectivity. A
candidate lead is expected to inhibit murine T.sub.H-17 cell
formation in culture. The candidate lead molecules are tested for
other desirable properties such as bioavailability and metabolic
stability that enable therapeutic use of the compound in animal
models of disease. (4) One or more lead ROR.gamma. antagonists are
tested in animal models of EAE, CIA and IBD which are known to
respond to other agents that inhibit T.sub.H-17 function. If active
in one or more of these models, the compounds are tested for
general immunotoxicity, effects on thymic function and overall
immune response, and on general aspects of toxicity such as liver
triglyceride content and serum lipids known to be affected by
ligands to several nuclear receptors. (5) Such leads are further
examined for properties that would prevent use in humans. These
include potential for drug-drug interactions and general toxicity
in rodents and at least one other higher species. If problems in
the areas of drug-drug interactions or toxicity are identified,
compounds may be further modified by synthetic methods, rescreened,
and reevaluated to reduce these side effects. Other features that
may be optimized at this stage are bioavailability, chemical
stability, and ease of manufacture. (6) One or more candidate
clinical compounds are selected for safety studies leading to
Investigative New Drug status granted by the FDA. This step enables
human clinical trials that will provide evidence for safety and
therapeutic utility. The execution of steps two and beyond is well
understood by practitioners of the art of drug discovery. The
validation of ROR.gamma. antagonist effects in T.sub.H-17 cells
provides the scientific rationale for undertaking drug
development.
[0233] As another example, the invention envisages modification of
hit or lead molecules to generate lead candidates. Examples of hits
useful for further medicinal synthetic work are OR-1050 or
OR-133171 described above. Analogs of these affect potency at
ROR.gamma. in a logical manner. Significantly, a representative
member of the OR-133171 series was shown to have no measurable
transcriptional activity at LXR.alpha.. More potent compounds may
be modified by parallel synthetic modification of the core
scaffolds of these two compounds in pharmacological assays. These
assays may identify compounds that increase potency. Other assays
for metabolic stability and bioavailability may be introduced in
order to identify a useful lead compound. The invention also
provides for the discovery of alternative compound series to those
indicated above, in case these fail to provide molecules with
characteristics suitable for commercial development, by screening
additional small molecule drug-like compound libraries.
[0234] A drug from the ROR.gamma. antagonist class will ideally
have good oral bioavailability and a half-life of four hours or
more, enabling once or twice-daily administration. Nuclear receptor
ligands have commonly given rise to orally bioavailable drugs;
OR-1050 is an example of an orally-bioavailable ROR.gamma.
antagonist characterized in these studies. The advantages of an
orally bioavailable drug are: (i) direct oral administration is
feasible; (ii) unlike injectable biologics, which may have an
extremely long half life, a small molecule drug with reasonable
half-life can be withdrawn if necessary to limit side effects and
(iii) small molecule drugs are readily manufactured. Such compounds
may also be selected for clinical development by potency in animal
models of EAE, CIA and IBD and by parallel in vivo studies of
compound safety. Examples of useful models for investigation of
ROR.gamma. antagonist effects on EAE, in addition to the C57BL/6
mouse immunized with the MOG.sub.35-55 peptide, are female SJL/J
mice induced with the myelin proteolipid peptide (PLP.sub.139-151)
(Papenfuss, Rogers et al. 2004) and the Lewis rat (Bolton, O'Neill
et al. 1997). EAE may also be induced by adoptive transfer of
cultured, antigen-specific T.sub.H-17 cells from previously
immunized mice (Langrish, Chen et al. 2005). CIA is induced by
injection of type 2 collagen (Courtenay, Dallman et al. 1980) and
this model is recognized to be IL-23 and T.sub.H-17 cell dependent
(Murphy, Langrish et al. 2003; Lubberts, Koenders et al. 2004).
Mouse models of IBD are now recognized to have a significant
involvement of T.sub.H-17 cells (Yen, Cheung et al. 2006; Zhang,
Zheng et al. 2006; Elson, Cong et al. 2007). Certain genetic models
such as the IL-10.sup.-/- mouse (Yen, Cheung et al. 2006) have
physiological relevance for understanding disease and have been
shown to require IL-23 for disease induction, but the disease
course itself is prolonged and highly variable in these animals,
rendering them unfavorable for pharmacological studies of
reasonable duration. On the other hand, transfer of T cell
populations with a reduced component of T regulatory cells to
immunodeficient mice will cause disease within about 10 weeks
(Powrie and Uhlig 2004), a time frame suitable for pharmacological
testing. Disease causation in the T cell transfer model is also
dependent on IL-23 (Yen, Cheung et al. 2006). Older mouse IBD
models that induce damage to the intestinal lining, such as by
treatment with dextran sodium sulfate (DSS) in drinking water
(Spahn, Herbst et al. 2002), are acceptable disease models and may
also include a significant contribution by T.sub.H-17 cells.
[0235] While the invention has been described with reference to
specific examples, this description is not meant to limit the kind
of small molecule drug that may be used as part of practicing this
invention.
LITERATURE CITED
[0236] Acosta-Rodriguez, E. V., G. Napolitani, et al. (2007).
"Interleukins 1beta and 6 but not transforming growth factor-beta
are essential for the differentiation of interleukin 17-producing
human T helper cells." Nat Immunol. [0237] Acosta-Rodriguez, E. V.,
L. Rivino, et al. (2007). "Surface phenotype and antigenic
specificity of human interleukin 17-producing T helper memory
cells." Nat Immunol 8: 639 [0238] Aggarwal, S., N. Ghilardi, et al.
(2003). "Interleukin-23 promotes a distinct CD4 T cell activation
state characterized by the production of Interleukin-17." J. Biol.
Chem. 278(3): 1910-1914. [0239] Annunziato, F., L. Cosmi, et al.
(2007). "Phenotypic and functional features of human Th17 cells." J
Exp Med 204(8): 1849-61. [0240] Batten, M., J. Li, et al. (2006).
"Interleukin 27 limits autoimmune encephalomyelitis by suppressing
the development of interleukin 17-producing T cells." Nat Immunol
7(9): 929-936. [0241] Becher, B., B. G. Durell, et al. (2002).
"Experimental autoimmune encephalitis and inflammation in the
absence of interleukin-12." J Clin Invest 110(4): 493-7. [0242]
Becker-Andre, M., I. Wiesenberg, et al. (1994). "Pineal gland
hormone melatonin binds and activates an orphan of the nuclear
receptor superfamily." J Biol Chem 269(46): 28531-4. [0243]
Becker-Andre, M., I. Wiesenberg, et al. (1997). "Additions and
Corrections to Pineal gland hormone melatonin binds and activates
an orphan of the nuclear receptor superfamily." J. Biol. Chem.
272(26): 16707. [0244] Bettelli, E., Y. Carrier, et al. (2006).
"Reciprocal developmental pathways for the generation of pathogenic
effector TH17 and regulatory T cells." Nature 441(7090): 235-8.
[0245] Beyer, T. P., R. J. Schmidt, et al. (2004).
"Coadministration of a liver X receptor agonist and a peroxisome
proliferator activator receptor-alpha agonist in Mice: effects of
nuclear receptor interplay on high-density lipoprotein and
triglyceride metabolism in vivo." J Pharmacol Exp Ther 309(3):
861-8. [0246] Bolton, C., J. K. O'Neill, et al. (1997). "Regulation
of chronic relapsing experimental allergic encephalomyelitis by
endogenous and exogenous glucocorticoids." Int Arch Allergy Immunol
114(1): 74-80. [0247] Bowman, E. P., A. A. Chackerian, et al.
(2006). "Rationale and safety of anti-interleukin-23 and
anti-interleukin-17A therapy." Curr. Opin. Infect. Dis. 19:
245-252. [0248] Bramlett, K. S., S. Yao, et al. (2000).
"Correlation of farnesoid X receptor coactivator recruitment and
cholesterol 7alpha-hydroxylase gene repression by bile acids." Mol
Genet Metab 71(4): 609-15. [0249] Chintalacharuvu, S. R., G. E.
Sandusky, et al. (2007). "Liver X receptor is a therapeutic target
in collagen-induced arthritis." Arthritis Rheum 56(4): 1365-7.
[0250] Chmielewski, V., F. Drupt, et al. (2000).
"Dexamethasone-induced apoptosis of mouse thymocytes: prevention by
native 7alpha-hydroxysteroids." Immunol Cell Biol 78(3): 238-46.
[0251] Courtenay, J. S., M. J. Dallman, et al. (1980).
"Immunisation against heterologous type II collagen induces
arthritis in mice." Nature 283(5748): 666-8. [0252] Coward, P., D.
Lee, et al. (2001). "4-Hydroxytamoxifen binds to and deactivates
the estrogen-related receptor gamma." Proc Natl Acad Sci USA
98(15): 8880-8884. [0253] Cua, D. J., J. Sherlock, et al. (2003).
"Interleukin-23 rather than interleukin-12 is the critical cytokine
for autoimmune inflammation of the brain." Nature 421(6924): 744-8.
[0254] Darimont, B. D., R. L. Wagner, et al. (1998). "Structure and
specificity of nuclear receptor-coactivator interactions." Genes
& Dev. 12: 3343-3356. [0255] Dhib-Jalbut, S. (2002).
"Mechanisms of action of interferons and glatiramer acetate in
multiple sclerosis." Neurology 58(8 Suppl 4): S3-9. [0256] Drake,
K. A., J. H. Zhang, et al. (2002). "Development of a homogeneous,
fluorescence resonance energy transfer-based in vitro recruitment
assay for peroxisome proliferator-activated receptor delta via
selection of active LXXLL coactivator peptides." Anal Biochem
304(1): 63-9. [0257] Eberl, G. and D. R. Littman (2004). "Thymic
origin of intestinal alphabeta T Cells revealed by fate mapping of
RORgammat+ cells." Science 305(5681): 248-51. [0258] Eberl, G., S.
Marmon, et al. (2004). "An essential function for the nuclear
receptor RORgamma(t) in the generation of fetal lymphoid tissue
inducer cells." Nat Immunol 5(1): 64-73. [0259] Elson, C. O., Y.
Cong, et al. (2007). "Monoclonal anti-interleukin 23 reverses
active colitis in a T cell-mediated model in mice."
Gastroenterology 132(7): 2359-70. [0260] Fu, M., T. Sun, et al.
(2005). "A Nuclear Receptor Atlas: 3T3-L1 Adipogenesis." Mol
Endocrinol: me.2004-0539. [0261] Gold, R., C. Linington, et al.
(2006). "Understanding pathogenesis and therapy of multiple
sclerosis via animal models: 70 years of merits and culprits in
experimental autoimmune encephalomyelitis research." Brain 129(8):
1953-1971. [0262] Gran, B., G. X. Zhang, et al. (2002).
"IL-12p35-deficient mice are susceptible to experimental autoimmune
encephalomyelitis: evidence for redundancy in the IL-12 system in
the induction of central nervous system autoimmune demyelination."
J Immunol 169(12): 7104-10. [0263] Greiner, E. F., J. Kirfel, et
al. (1996). "Functional analysis of retinoid Z receptor beta, a
brain-specific nuclear orphan receptor." Proc Natl Acad Sci USA
93(19): 10105-10. [0264] Groot, P. H. E., N. J. Pearce, et al.
(2005). "Synthetic LXR agonists increase LDL in CETP species." J.
Lipid Res. 46(10): 2182-2191. [0265] Harrington, L. E., R. D.
Hatton, et al. (2005). "Interleukin 17-producing CD4+ effector T
cells develop via a lineage distinct from the T helper type 1 and 2
lineages." Nat Immunol 6(11): 1123-32. [0266] Haynes, B. F., M. L.
Markert, et al. (2000). "The role of the thymus in immune
reconstitution in aging, bone marrow transplantation, and HIV-1
infection." Annu Rev Immunol 18: 529-60. [0267] He, Y. W., M. L.
Deftos, et al. (1998). "RORgamma t, a novel isoform of an orphan
receptor, negatively regulates Fas ligand expression and IL-2
production in T cells." Immunity 9(6): 797-806. [0268] Heery, D.
G., E. Kalkhoven, et al. (1997). "A signature motif in
transcriptional co-activators mediates binding to nuclear
receptors." Nature 387: 733-736. [0269] Hindinger, C., D. R.
Hinton, et al. (2006). "Liver X receptor activation decreases the
severity of experimental autoimmune encephalomyelitis." J Neurosci
Res 84(6): 1225-1234. [0270] Hiroi, Y., H.-H. Kim, et al. (2006).
"Rapid nongenomic actions of thyroid hormone." PNAS: 0601600103.
[0271] Hoeve, M. A., N. D. Savage, et al. (2006). "Divergent
effects of IL-12 and IL-23 on the production of IL-17 by human T
cells." Eur J Immunol 36(3): 661-670. [0272] Houck, K. A., K. M.
Borchert, et al. (2004). "T0901317 is a dual LXR/FXR agonist." Mol
Genet Metab 83(1-2): 184-7. [0273] Iannone, M. A., T. G. Consler,
et al. (2001). "Multiplexed molecular interactions of nuclear
receptors using fluorescent microspheres." Cytometry 44(4): 326-37.
[0274] Itoh, M., T. Takahashi, et al. (1999). "Thymus and
autoimmunity: production of CD25+CD4+ naturally anergic and
suppressive T cells as a key function of the thymus in maintaining
immunologic self-tolerance." J Immunol 162(9): 5317-26. [0275]
Ivanov, I. I. and D. R. Littman (2007). "Characterization of
naturally occurring Th17 cells." 13th International Congress of
Immunology, Rio di Janeiro, Brazil, Aug. 21-25, 2007: P0273. [0276]
Ivanov, I. I. and D. R. Littman (2007). Characterization of
naturally occurring Th17 cells. 13th International Congress of
Immunology, Rio de Janiero, Brazil. [0277] Ivanov, I. I., B. S.
McKenzie, et al. (2006). "The orphan nuclear receptor ROR.gamma.t
directs the differentiation program of proinflammatory IL-17.sup.+
T helper cells." Cell 126: 1121-1133. [0278] Iwakura, Y. and H.
Ishigame (2006). "The IL-23/IL-17 axis in inflammation." J Clin
Invest 116(5): 1218-22. [0279] Jetten, A. M., S. Kurebayashi, et
al. (2001). "The ROR nuclear orphan receptor subfamily: critical
regulators of multiple biological processes." Prog Nucleic Acid Res
Mol Biol 69: 205-47. [0280] Kallen, J., J. M. Schlaeppi, et al.
(2004). "Crystal structure of the human RORalpha ligand binding
domain in complex with cholesterol sulfate at 2.2 A." J Biol Chem
279(14): 14033-8. [0281] Kallen, J. A., J. M. Schlaeppi, et al.
(2002). "X-Ray structure of the hROR.alpha. LBD at 1.63 A.
Structural and functional data that cholesterol or a cholesterol
derivative is the natural ligand of ROR.alpha.." Structure (Camb)
10(12): 1697-707. [0282] Kang, H. S., M. Angers, et al. (2007).
"Gene expression profiling reveals a regulatory role for ROR{alpha}
and ROR{gamma} in Phase I and Phase II Metabolism." Physiol
Genomics. [0283] Kebir, H., K. Kreymborg, et al. (2007). "Human
T(H)17 lymphocytes promote blood-brain barrier disruption and
central nervous system inflammation." Nat Med. [0284] Kirkham, B.
W., M. N. Lassere, et al. (2006). "Synovial membrane cytokine
expression is predictive of joint damage progression in rheumatoid
arthritis: a two-year prospective study (the DAMAGE study cohort)."
Arthritis Rheum 54(4): 1122-31. [0285] Komiyama, Y., S. Nakae, et
al. (2006). "IL-17 Plays an Important Role in the Development of
Experimental Autoimmune Encephalomyelitis." J Immunol 177(1):
566-73. [0286] Korn, T., E. Bettelli, et al. (2007). "IL-21
initiates an alternative pathway to induce proinflammatory T(H)17
cells." Nature. [0287] Krueger, G. G., R. G. Langley, et al.
(2007). "A human interleukin-12/23 monoclonal antibody for the
treatment of psoriasis." N Engl J Med 356(6): 580-92. [0288]
Kurebayashi, S., E. Ueda, et al. (2000). "Retinoid-related orphan
receptor .gamma. (ROR.gamma.) is essential for lymphoid
organogenesis and controls apoptosis during thymopoiesis." Proc
Natl Acad Sci USA 97: 10132-10137. [0289] Langrish, C. L., Y. Chen,
et al. (2005). "IL-23 drives a pathogenic T cell population that
induces autoimmune inflammation." J Exp Med 201(2): 233-40. [0290]
Laudet, V. (1999). "A unified nomenclature system for the nuclear
receptor superfamily." Cell 97: 161-163. [0291] Lee, G., F. Elwood,
et al. (2002). "T0070907, a selective ligand for peroxisome
proliferator-activated receptor gamma, functions as an antagonist
of biochemical and cellular activities." J Biol Chem 277(22):
19649-57. [0292] Li, Y., M. Choi, et al. (2005). "Structural and
biochemical basis for selective repression of the orphan nuclear
receptor liver receptor homolog 1 by small heterodimer partner."
Proc Natl Acad Sci USA 102(27): 9505-10. [0293] Li, Y., M. H.
Lambert, et al. (2003). "Activation of nuclear receptors: a
perspective from structural genomics." Structure (Camb) 11(7):
741-6. [0294] Liang, S. C., X.-Y. Tan, et al. (2006). "Interleukin
(IL)-22 and IL-17 are coexpressed by Th17 cells and cooperatively
enhance expression of antimicrobial peptides." J. Exp. Med.
203(10): 2271-2279. [0295] Littman, D. and G. Eberl (2006).
Compositions and Methods for Modulation of ROR.gamma.t. World
Intellectual Property Organization. [0296] Lock, C., G. Hermans, et
al. (2002). "Gene-microarray analysis of multiple sclerosis lesions
yields new targets validated in autoimmune encephalomyelitis." Nat
Med 8(5): 500-8. [0297] Lockhart, E., A. M. Green, et al. (2006).
"IL-17 production Is dominated by {gamma} {delta} T cells rather
than CD4 T cells during Mycobacterium tuberculosis infection." J
Immunol 177(7): 4662-9. [0298] Lubberts, E., M. Koenders, et al.
(2005). "The role of T cell interleukin-17 in conducting
destructive arthritis: lessons from animal models." Arthritis Res
Ther 7(1): 29-37. [0299] Lubberts, E., M. I. Koenders, et al.
(2004). "Treatment with a neutralizing anti-murine interleukin-17
antibody after the onset of collagen-induced arthritis reduces
joint inflammation, cartilage destruction, and bone erosion."
Arthritis Rheum 50(2): 650-9. [0300] Luckow, V. A. and M. D.
Summers (1989). "High level expression of nonfused foreign genes
with Autographa californica nuclear polyhedrosis virus expression
vectors." Virology 170(1): 31-9. [0301] Lundholt, B. K., K. M.
Scudder, et al. (2003). "A simple technique for reducing edge
effect in cell-based assays." J Biomol Screen 8(5): 566-70. [0302]
Mangan, P. R., L. E. Harrington, et al. (2006). "Transforming
growth factor-beta induces development of the T(H)17 lineage."
Nature 441(7090): 231-4. [0303] Mannon, P. J., I. J. Fuss, et al.
(2004). "Anti-interleukin-12 antibody for active Crohn's disease."
N Engl J Med 351(20): 2069-79. [0304] Matusevicius, D., P.
Kivisakk, et al. (1999). "Interleukin-17 mRNA expression in blood
and CSF mononuclear cells is augmented in multiple sclerosis." Mult
Scler 5(2): 101-4. [0305] McKenna, N. J. and B. W. O'Malley (2002).
"Combinatorial control of gene expression by nuclear receptors and
coregulators." Cell 108(4): 465-74. [0306] Medvedev, A., Z. H. Yan,
et al. (1996). "Cloning of a cDNA encoding the murine orphan
receptor RZR/ROR gamma and characterization of its response
element." Gene 181(1-2): 199-206. [0307] Missbach, M., B. Jagher,
et al. (1996). "Thiazolidine diones, specific ligands of the
nuclear receptor retinoid Z receptor/retinoid acid receptor-related
orphan receptor alpha with potent antiarthritic activity." J Biol
Chem 271(23): 13515-22. [0308] Moore, J. M., S. J. Galicia, et al.
(2004). "Quantitative proteomics of the thyroid hormone receptor
coregulator interactions." J Biol Chem 279(26): 27584-90. [0309]
Moraitis, A. N. and V. Giguere (2003). "The corepressor hairless
protects ROR.alpha. orphan nuclear receptor from
proteasome-mediated degradation." J Biol Chem 278(52): 52511-8.
[0310] Murphy, C. A., C. L. Langrish, et al. (2003). "Divergent
pro- and anti-inflammatory roles for IL-23 and IL-12 in joint
autoimmune inflammation." J. Exp. Med. 198(12): 1951-1957. [0311]
Nakae, S., A. Nambu, et al. (2003). "Suppression of immune
induction of collagen-induced arthritis in IL-17-deficient mice." J
Immunol 171(11): 6173-7. [0312] Nurieva, R., X. O. Yang, et al.
(2007). "Essential autocrine regulation by IL-21 in the generation
of inflammatory T cells." Nature. [0313] O'Brien, J., I. Wilson, et
al. (2000). "Investigation of the Alamar Blue (resazurin)
fluorescent dye for the assessment of mammalian cell cytotoxicity."
Eur J Biochem 267(17): 5421-6. [0314] Papenfuss, T. L., C. J.
Rogers, et al. (2004). "Sex differences in experimental autoimmune
encephalomyelitis in multiple murine strains." J Neuroimmunol
150(1-2): 59-69. [0315] Park, H., Z. Li, et al. (2005). "A distinct
lineage of CD4 T cells regulates tissue inflammation by producing
interleukin 17." Nat Immunol 6(11): 1133-41. [0316] Powrie, F. and
H. Uhlig (2004). "Animal models of intestinal inflammation: clues
to the pathogenesis of inflammatory bowel disease." Novartis Found
Symp 263: 164-74; discussion 174-8, 211-8. [0317] Rolak, L. A.
(2003). "Multiple sclerosis: it's not the disease you thought it
was." Clin Med Res 1(1): 57-60. [0318] Rudick, R. A., W. H. Stuart,
et al. (2006).
"Natalizumab plus interferon beta-la for relapsing multiple
sclerosis." N Engl J Med 354(9): 911-23. [0319] Sato, K., A.
Suematsu, et al. (2006). "Th17 functions as an osteoclastogenic
helper T cell subset that links T cell activation and bone
destruction." J. Exp. Med. 203(12): 2673-2682. [0320] Savkur, R. S.
and T. P. Burris (2004). "The coactivator LXXLL nuclear receptor
recognition motif." J Pept Res 63(3): 207-12. [0321] Schultz, J.
R., H. Tu, et al. (2000). "Role of LXRs in control of lipogenesis."
Genes Dev 14(22): 2831-8. [0322] Shin, H. C., N. Benbernou, et al.
(1999). "Expression of IL-17 in human memory CD45RO+ T lymphocytes
and its regulation by protein kinase A pathway." Cytokine 11(4):
257-66. [0323] Spahn, T. W., H. Herbst, et al. (2002). "Induction
of colitis in mice deficient of Peyer's patches and mesenteric
lymph nodes is associated with increased disease severity and
formation of colonic lymphoid patches." Am J Pathol 161(6):
2273-82. [0324] Stehlin, C., J. M. Wurtz, et al. (2001). "X-ray
structure of the orphan nuclear receptor RORbeta ligand-binding
domain in the active conformation." EMBO J. 20(21): 5822-5831.
[0325] Steinman, L. (2005). "Blocking adhesion molecules as therapy
for multiple sclerosis: natalizumab." Nat Rev Drug Discov 4(6):
510-8. [0326] Steinman, L. (2007). "A brief history of T(H)17, the
first major revision in the T(H)1/T(H)2 hypothesis of T
cell-mediated tissue damage." Nat Med 13(2): 139-45. [0327]
Stumhofer, J. S., A. Laurence, et al. (2006). "Interleukin 27
negatively regulates the development of interleukin 17-producing T
helper cells during chronic inflammation of the central nervous
system." Nat Immunol 7(9): 937-945. [0328] Sun, Z., D. Unutmaz, et
al. (2000). "Requirement for ROR.gamma. in thymocyte survival and
lymphoid organ development." Science 288: 2369-2373. [0329]
Svensson, S., T. Ostberg, et al. (2003). "Crystal structure of the
heterodimeric complex of LXR{alpha} and RXR{beta} ligand-binding
domains in a fully agonistic conformation." EMBO J. 22(18):
4625-4633. [0330] Thacher, S. M., J. Vasudevan, et al. (2000).
"Therapeutic applications for ligands of retinoid receptors."
Current Pharmaceutical Design 6: 25-58. [0331] Vaknin-Dembinsky,
A., K. Balashov, et al. (2006). "IL-23 Is Increased in Dendritic
Cells in Multiple Sclerosis and Down-Regulation of IL-23 by
Antisense Oligos Increases Dendritic Cell IL-10 Production." J
Immunol 176(12): 7768-7774. [0332] Veldhoen, M., R. J. Hocking, et
al. (2006). "TGFbeta in the context of an inflammatory cytokine
milieu supports de novo differentiation of IL-17-producing T
cells." Immunity 24(2): 179-89. [0333] Webster, N. J., S. Green, et
al. (1988). "The hormone-binding domains of the estrogen and
glucocorticoid receptors contain an inducible transcription
activation function." Cell 54(2): 199-207. [0334] Wiesenberg, I.,
M. Chiesi, et al. (1998). "Specific activation of the nuclear
receptors PPARgamma and RORA by the antidiabetic thiazolidinedione
BRL 49653 and the antiarthritic thiazolidinedione derivative CGP
52608." Mol Pharmacol 53(6): 1131-8. [0335] Wilson, N. J., K.
Boniface, et al. (2007). "Development, cytokine profile and
function of human interleukin 17-producing helper T cells." Nat
Immunol. [0336] Wu, Y., W. W. Chin, et al. (2002). "Ligand and
coactivator identity determines the requirement of the charge clamp
for coactivation of the peroxisome proliferator-activated receptor
gamma." J. Biol. Chem. 278(10): 8637-8644. [0337] Xu, H. E., T. B.
Stanley, et al. (2002). "Structural basis for antagonist-mediated
recruitment of nuclear co-repressors by PPARalpha." Nature
415(6873): 813-7. [0338] Yao, Z., S. L. Painter, et al. (1995).
"Human IL-17: a novel cytokine derived from T cells." J Immunol
155(12): 5483-6. [0339] Yen, D., J. Cheung, et al. (2006). "IL-23
is essential for T cell-mediated colitis and promotes inflammation
via IL-17 and IL-6." J Clin Invest 116(5): 1310-6. [0340] Zavacki,
A. M., J. M. Lehmann, et al. (1997). "Activation of the orphan
receptor RIP14 by retinoids." Proc Natl Acad Sci USA 94(15):
7909-14. [0341] Zelcer, N. and P. Tontonoz (2006). "Liver X
receptors as integrators of metabolic and inflammatory signaling."
J. Clin. Invest. 116(3): 607-614. [0342] Zhang, G. X., B. Gran, et
al. (2003). "Induction of experimental autoimmune encephalomyelitis
in IL-12 receptor-beta 2-deficient mice: IL-12 responsiveness is
not required in the pathogenesis of inflammatory demyelination in
the central nervous system." J Immunol 170(4): 2153-60. [0343]
Zhang, N., J. Guo, et al. (2003). "Lymphocyte accumulation in the
spleen of retinoic acid receptor-related orphan receptor
gamma-deficient mice." J Immunol 171(4): 1667-75. [0344] Zhang, Z.,
M. Zheng, et al. (2006). "Critical role of IL-17 receptor signaling
in acute TNBS-induced colitis." Inflamm Bowel Dis 12(5): 382-388.
[0345] Zheng, Y., D. M. Danilenko, et al. (2007). "Interleukin-22,
a TH17 cytokine, mediates IL-23-induced dermal inflammation and
acanthosis." Nature 445(7128): 648-51. [0346] Zhou, L., Ivanov, I
I, et al. (2007). "IL-6 programs T(H)-17 cell differentiation by
promoting sequential engagement of the IL-21 and IL-23 pathways."
Nat Immunol. [0347] Zubkova, I., H. Mostowski, et al. (2005).
"Up-regulation of IL-7, stromal-derived factor-1{alpha},
thymus-expressed chemokine, and secondary lymphoid tissue chemokine
gene expression in the stromal cells in response to thymocyte
depletion: implication for thymus reconstitution." J Immunol
175(4): 2321-30.
Sequence CWU 1
1
2015PRTArtificial SequenceVARIANT(2)...(2)Xaa = any amino
acidVARIANT(3)...(3)Xaa = any amino acidConserved peptide motif
1Leu Xaa Xaa Leu Leu1 5 211PRTHomo sapiens 2Arg Thr Val Leu Gln Leu
Leu Leu Gly Asn Pro1 5 10 315PRTRattus norvegicus 3Glu Arg Arg Thr
Val Leu Gln Leu Leu Leu Gly Asn Ser Asn Lys1 5 10 15 415PRTHomo
sapiens 4Glu Arg Arg Thr Val Leu Gln Leu Leu Leu Gly Asn Pro Thr
Lys1 5 10 15 515PRTHomo sapiens 5Glu Arg Arg Thr Val Leu Gln Leu
Val Val Gly Asn Pro Thr Lys1 5 10 15 615PRTRattus norvegicus 6Glu
Arg Arg Thr Val Leu Gln Leu Val Val Gly Asn Ser Asn Lys1 5 10 15
7444DNASaccharomyces cerevisiae 7atgaagctac tgtcttctat cgaacaagca
tgcgatattt gccgacttaa aaagctcaag 60tgctccaaag aaaaaccgaa gtgcgccaag
tgtctgaaga acaactggga gtgtcgctac 120tctcccaaaa ccaaaaggtc
tccgctgact agggcacatc tgacagaagt ggaatcaagg 180ctagaaagac
tggaacagct atttctactg atttttcctc gagaagacct tgacatgatt
240ttgaaaatgg attctttaca ggatataaaa gcattgttaa caggattatt
tgtacaagat 300aatgtgaata aagatgccgt cacagataga ttggcttcag
tggagactga tatgcctcta 360acattgagac agcatagaat aagtgcgaca
tcatcatcgg aagagagtag taacaaaggt 420caaagacagt tgactgtatc gccg
444824DNAArtificial SequenceNucleic acid linker 8ggatccgccc
gggctggaat tcgc 249801DNAMus musculusmisc_feature741n = a, c, t, or
g 9attcccagtt tctgcagtgc cccagaggta ccatatgcct ctctgacaga
catagagtac 60ctggtacaga atgtctgcaa gtccttccga gagacatgcc agctgcgact
ggaggacctt 120ctacggcagc gcaccaacct cttttcacgg gaggaggtga
ccagctacca gaggaagtca 180atgtgggaga tgtgggagcg ctgtgcccac
cacctcactg aggccattca gtatgtggtg 240gagtttgcca agcggctttc
aggcttcatg gagctctgcc agaatgacca gatcatacta 300ctgacagcag
gagcaatgga agtcgtccta gtcagaatgt gcagggccta caatgccaac
360aaccacacag tcttttttga aggcaaatac ggtggtgtgg agctgtttcg
agccttgggc 420tgcagcgagc tcatcagctc catatttgac ttttcccact
tcctcagcgc cctgtgtttt 480tctgaggatg agattgccct ctacacggcc
ctggttctca tcaatgccaa ccgtcctggg 540ctccaagaga agaggagagt
ggaacatctg caatacaatt tggaactggc tttccatcat 600catctctgca
agactcatcg acaaggcctc ctagccaagc tgccacccaa aggaaaactc
660cggagcctgt gcagccaaca tgtggaaaag ctgcagatct tccagcacct
ccaccccatc 720gtggtccaag ccgccttccc nccactctat aaggaactct
tcagcactga tgttgaatcc 780cctgaggggc tgtcaaagtg a
80110148PRTSaccharomyces cerevisiae 10Met Lys Leu Leu Ser Ser Ile
Glu Gln Ala Cys Asp Ile Cys Arg Leu1 5 10 15 Lys Lys Leu Lys Cys
Ser Lys Glu Lys Pro Lys Cys Ala Lys Cys Leu 20 25 30 Lys Asn Asn
Trp Glu Cys Arg Tyr Ser Pro Lys Thr Lys Arg Ser Pro 35 40 45 Leu
Thr Arg Ala His Leu Thr Glu Val Glu Ser Arg Leu Glu Arg Leu 50 55
60 Glu Gln Leu Phe Leu Leu Ile Phe Pro Arg Glu Asp Leu Asp Met
Ile65 70 75 80 Leu Lys Met Asp Ser Leu Gln Asp Ile Lys Ala Leu Leu
Thr Gly Leu 85 90 95 Phe Val Gln Asp Asn Val Asn Lys Asp Ala Val
Thr Asp Arg Leu Ala 100 105 110 Ser Val Glu Thr Asp Met Pro Leu Thr
Leu Arg Gln His Arg Ile Ser 115 120 125 Ala Thr Ser Ser Ser Glu Glu
Ser Ser Asn Lys Gly Gln Arg Gln Leu 130 135 140 Thr Val Ser Pro145
118PRTArtificial SequencePeptide linker 11Gly Ser Ala Arg Ala Gly
Ile Arg1 5 12266PRTMus musculusVARIANT247Xaa = any amino acid 12Ile
Pro Ser Phe Cys Ser Ala Pro Glu Val Pro Tyr Ala Ser Leu Thr1 5 10
15 Asp Ile Glu Tyr Leu Val Gln Asn Val Cys Lys Ser Phe Arg Glu Thr
20 25 30 Cys Gln Leu Arg Leu Glu Asp Leu Leu Arg Gln Arg Thr Asn
Leu Phe 35 40 45 Ser Arg Glu Glu Val Thr Ser Tyr Gln Arg Lys Ser
Met Trp Glu Met 50 55 60 Trp Glu Arg Cys Ala His His Leu Thr Glu
Ala Ile Gln Tyr Val Val65 70 75 80 Glu Phe Ala Lys Arg Leu Ser Gly
Phe Met Glu Leu Cys Gln Asn Asp 85 90 95 Gln Ile Ile Leu Leu Thr
Ala Gly Ala Met Glu Val Val Leu Val Arg 100 105 110 Met Cys Arg Ala
Tyr Asn Ala Asn Asn His Thr Val Phe Phe Glu Gly 115 120 125 Lys Tyr
Gly Gly Val Glu Leu Phe Arg Ala Leu Gly Cys Ser Glu Leu 130 135 140
Ile Ser Ser Ile Phe Asp Phe Ser His Phe Leu Ser Ala Leu Cys Phe145
150 155 160 Ser Glu Asp Glu Ile Ala Leu Tyr Thr Ala Leu Val Leu Ile
Asn Ala 165 170 175 Asn Arg Pro Gly Leu Gln Glu Lys Arg Arg Val Glu
His Leu Gln Tyr 180 185 190 Asn Leu Glu Leu Ala Phe His His His Leu
Cys Lys Thr His Arg Gln 195 200 205 Gly Leu Leu Ala Lys Leu Pro Pro
Lys Gly Lys Leu Arg Ser Leu Cys 210 215 220 Ser Gln His Val Glu Lys
Leu Gln Ile Phe Gln His Leu His Pro Ile225 230 235 240 Val Val Gln
Ala Ala Phe Xaa Pro Leu Tyr Lys Glu Leu Phe Ser Thr 245 250 255 Asp
Val Glu Ser Pro Glu Gly Leu Ser Lys 260 265 136DNAArtificial
SequenceNucleic acid linker 13ggatcc 614801DNAHomo sapiens
14agccccagtt tccgcagcac accggaggca ccctatgcct ccctgacaga gatagagcac
60ctggtgcaga gcgtctgcaa gtcctacagg gagacatgcc agctgcggct ggaggacctg
120ctgcggcagc gctccaacat cttctcccgg gaggaagtga ctggctacca
gaggaagtcc 180atgtgggaga tgtgggaacg gtgtgcccac cacctcaccg
aggccattca gtacgtggtg 240gagttcgcca agaggctctc aggctttatg
gagctctgcc agaatgacca gattgtgctt 300ctcaaagcag gagcaatgga
agtggtgctg gttaggatgt gccgggccta caatgctgac 360aaccgcacgg
tcttttttga aggcaaatac ggtggcatgg agctgttccg agccttgggc
420tgcagcgagc tcatcagctc catctttgac ttctcccact ccctaagtgc
cttgcacttt 480tccgaggatg agattgccct ctacacagcc cttgttctca
tcaatgccca tcggccaggg 540ctccaagaga aaaggaaagt agaacagctg
cagtacaatc tggagctggc ctttcatcat 600catctctgca agactcatcg
ccaaagcatc ctggcaaagc tgccacccaa ggggaagctt 660cggagcctgt
gtagccagca tgtggaaagg ctgcagatct tccagcacct ccaccccatc
720gtggtccaag ccgctttccc tccactctac aaggagctct tcagcactga
aaccgagtca 780cctgtggggc tgtccaagtg a 801152PRTArtificial
SequencePeptide linker 15Gly Ser1 16266PRTHomo sapiens 16Ser Pro
Ser Phe Arg Ser Thr Pro Glu Ala Pro Tyr Ala Ser Leu Thr1 5 10 15
Glu Ile Glu His Leu Val Gln Ser Val Cys Lys Ser Tyr Arg Glu Thr 20
25 30 Cys Gln Leu Arg Leu Glu Asp Leu Leu Arg Gln Arg Ser Asn Ile
Phe 35 40 45 Ser Arg Glu Glu Val Thr Gly Tyr Gln Arg Lys Ser Met
Trp Glu Met 50 55 60 Trp Glu Arg Cys Ala His His Leu Thr Glu Ala
Ile Gln Tyr Val Val65 70 75 80 Glu Phe Ala Lys Arg Leu Ser Gly Phe
Met Glu Leu Cys Gln Asn Asp 85 90 95 Gln Ile Val Leu Leu Lys Ala
Gly Ala Met Glu Val Val Leu Val Arg 100 105 110 Met Cys Arg Ala Tyr
Asn Ala Asp Asn Arg Thr Val Phe Phe Glu Gly 115 120 125 Lys Tyr Gly
Gly Met Glu Leu Phe Arg Ala Leu Gly Cys Ser Glu Leu 130 135 140 Ile
Ser Ser Ile Phe Asp Phe Ser His Ser Leu Ser Ala Leu His Phe145 150
155 160 Ser Glu Asp Glu Ile Ala Leu Tyr Thr Ala Leu Val Leu Ile Asn
Ala 165 170 175 His Arg Pro Gly Leu Gln Glu Lys Arg Lys Val Glu Gln
Leu Gln Tyr 180 185 190 Asn Leu Glu Leu Ala Phe His His His Leu Cys
Lys Thr His Arg Gln 195 200 205 Ser Ile Leu Ala Lys Leu Pro Pro Lys
Gly Lys Leu Arg Ser Leu Cys 210 215 220 Ser Gln His Val Glu Arg Leu
Gln Ile Phe Gln His Leu His Pro Ile225 230 235 240 Val Val Gln Ala
Ala Phe Pro Pro Leu Tyr Lys Glu Leu Phe Ser Thr 245 250 255 Glu Thr
Glu Ser Pro Val Gly Leu Ser Lys 260 265 17660DNASacchraomyces
cerevisiae 17atgtccccta tactaggtta ttggaaaatt aagggccttg tgcaacccac
tcgacttctt 60ttggaatatc ttgaagaaaa atatgaagag catttgtatg agcgcgatga
aggtgataaa 120tggcgaaaca aaaagtttga attgggtttg gagtttccca
atcttcctta ttatattgat 180ggtgatgtta aattaacaca gtctatggcc
atcatacgtt atatagctga caagcacaac 240atgttgggtg gttgtccaaa
agagcgtgca gagatttcaa tgcttgaagg agcggttttg 300gatattagat
acggtgtttc gagaattgca tatagtaaag actttgaaac tctcaaagtt
360gattttctta gcaagctacc tgaaatgctg aaaatgttcg aagatcgttt
atgtcataaa 420acatatttaa atggtgatca tgtaacccat cctgacttca
tgttgtatga cgctcttgat 480gttgttttat acatggaccc aatgtgcctg
gatgcgttcc caaaattagt ttgttttaaa 540aaacgtattg aagctatccc
acaaattgat aagtacttga aatccagcaa gtatatagca 600tggcctttgc
agggctggca agccacgttt ggtggtggcg accatcctcc aaaatcggat
66018212DNAArtificial SequenceNucleic acid linker 18ggttcaacta
gtggttctgg tcatcaccat caccatcact ccgcgggtct ggtgccacgc 60ggtagtactg
caattggtat gaaagaaacc gctgctgcta aattcgaacg ccagcacctg
120gacagcccag atctgggtac cggtggtggc tccggtgatg acgacgacaa
gagtcccatg 180ggatatcggg gatccgcccg ggctggaatt cg
2121921PRTArtificial SequenceSynthetic peptide 19Met Glu Val Gly
Trp Tyr Arg Ser Pro Phe Ser Arg Val Val His Leu1 5 10 15 Tyr Arg
Asn Gly Lys 20 2013PRTArtificial SequenceSynthetic peptide 20His
Ser Leu Gly Lys Trp Leu Gly His Pro Asp Lys Phe1 5 10
* * * * *