U.S. patent application number 15/443717 was filed with the patent office on 2017-08-24 for diagnostic method for disorders using copeptin.
This patent application is currently assigned to B.R.A.H.M.S GMBH. The applicant listed for this patent is B.R.A.H.M.S GMBH. Invention is credited to Andreas BERGMANN, Joachim STRUCK.
Application Number | 20170242037 15/443717 |
Document ID | / |
Family ID | 34926232 |
Filed Date | 2017-08-24 |
United States Patent
Application |
20170242037 |
Kind Code |
A1 |
BERGMANN; Andreas ; et
al. |
August 24, 2017 |
DIAGNOSTIC METHOD FOR DISORDERS USING COPEPTIN
Abstract
Disclosed herein is the use of copeptin as a diagnostic marker
for the determination of the release of vasopressin, especially in
connection with disorders associated with non-physiological
alterations of vasopressin release from the neurohypophysis,
especially for detection and early detection, diagnosing and
monitoring of the course of cardiovascular diseases, renal and
pulmonary diseases as well as shock, including septic shock, sepsis
and diseases/disorders of the central nervous system and
neurodegenerative diseases.
Inventors: |
BERGMANN; Andreas; (Berlin,
DE) ; STRUCK; Joachim; (Berlin, DE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
B.R.A.H.M.S GMBH |
Hennigsdorf |
|
DE |
|
|
Assignee: |
B.R.A.H.M.S GMBH
Hennigsdorf
DE
|
Family ID: |
34926232 |
Appl. No.: |
15/443717 |
Filed: |
February 27, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12860311 |
Aug 20, 2010 |
|
|
|
15443717 |
|
|
|
|
11573595 |
Feb 12, 2007 |
7807397 |
|
|
PCT/EP2005/009001 |
Aug 19, 2005 |
|
|
|
12860311 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
G01N 33/74 20130101;
G01N 2333/5757 20130101; G01N 33/6893 20130101; G01N 2333/575
20130101; Y10S 930/15 20130101 |
International
Class: |
G01N 33/68 20060101
G01N033/68; G01N 33/74 20060101 G01N033/74 |
Foreign Application Data
Date |
Code |
Application Number |
Aug 19, 2004 |
EP |
04 019 732.9 |
Claims
1. A diagnostic in vitro method for the diagnosis and monitoring of
disorders associated with or caused by non-physiological
alterations of vasopressin release from the neurohypophysis by
determining in a sample of a body fluid of the patient the amount
of copeptin and/or a pathophysiologically occurring precursor,
splice variant, fragment or posttranslationally modified form of
copeptin displaying copeptin immunoreactivity, and associating the
determined amount of copeptin or copeptin immunoreactivity with the
presence and/or course and/or severity and/or prognosis of such
disorder.
2. The method of claim 1, wherein said disorder associated with or
caused by non-physiological alterations of vasopressin release from
the neurohypophysis is selected from the group consisting of
chronic or congestive heart failure, cardiac arrest, cardiac shock,
cardiac infarction, acute myocardial infarction, arterial
hypertension, cardiac surgery; cirrhosis; pulmonary disorders;
kidney (renal) diseases as polycystic kidney disease; Diabetes
insipidus; forms of hyponatremia, forms of syndrome of
inappropriate antidiuretic hormone secretion; hemorrhage,
edema-forming states, inflammatory diseases, trauma, burns,
infectious complications thereof and sepsis, severe sepsis and
septic shock; and diseases/disorders of the central nervous system
(CNS).
3. The method of claim 1, wherein the copeptin immunoreactivity is
an immunoreactivity which can be determined by using a sandwich
immunoassay using a first specific binder recognizing an amino acid
sequence present in SEQ ID NO:1, and a second specific binder
recognizing an amino acid sequence present in SEQ ID NO:2.
4. The method of claim 3, wherein said specific binders are
polyclonal and/or monoclonal antibodies.
5. The method of claim 3, wherein said immunoassay is a
heterogenous immunoassay using a first immobilized specific binder
and a second solubilized specific binder which carries a detectable
label or which can be selectively labeled by reaction with a
labeled marker molecule.
6. The method of claim 3, wherein said immunoassay is a homogeneous
immunoassay.
7. The method of claims 1, wherein the biological fluid is selected
from serum, plasma, blood or (cerebrospinal fluid; CSF).
8. The method of claim 2, wherein said disorder is selected from
the group consisting of sepsis, cardiac infarction, chronic heart
failure and increased arterial blood pressure.
9-12. (canceled)
Description
[0001] The present invention relates to the use of copeptin and/or
its precursors or fragments and/or its splice variants, fragments
comprising copeptin and/or combinations and/or derivatives thereof
in medical diagnosis as humoral bio-marker for disorders associated
with or caused by non-physiological alterations of vasopressin
release from the neurohypophysis, as there are, for example,
cardiac diseases, renal disaeases, inflammatory diseases and sepsis
and diseases/disorders of the central nervous system and
neurodegenerative diseases and others as mentioned below.
[0002] In the following text all biomolecules and fragments,
variants and combinations thereof as mentioned above, which share
the common feature that they display copeptin immunoreactivity, are
referred to as "copeptin" in the present application. The term
"copeptin", therefore, inter alia also comprises for example
VP-prohormone, if present in a sample as such.
[0003] Copeptin according to the present invention is used as
biomarker, especially humoral biomarker, which can be used to
diagnose disorders associated with or caused by non-physiological
alterations, espcially increases, of vasopressin release from the
neurohypophysis as there are cardiovascular diseases like chronic
or congestive heart failure, cardiac arrest, cardiac shock, cardiac
infarction, acute myocardial infarction, arterial hypertension,
cardiac surgery, cirrhosis, pulmonary disorders, kidney (renal)
diseases as polycystic kidney disease, Diabetes insipidus, forms of
hyponatremia, forms of syndrome of inappropriate antidiuretic
hormone secretion, hemorrhage, edema-forming states, inflammatory
diseases, trauma, burns, infectious complications thereof and
sepsis, severe sepsis and septic shock, as well as
diseases/disorders of the central nervous system (CNS) and
neurodegenerative diseases.
[0004] If, in the present application, a use as biomarker is
mentioned, this means the determination of said biomarker in in
vitro samples of biological fluids (i.e. ex vivo) as blood, serum
or plasma and liquor cerebrospinalis (cerebrospinal fluid; CSF).
For any skilled person this clearly implies that only such
physiologically occurring "copeptin" molecules are to be determined
which in fact can be present in such samples. There may be present
in a sample of a body fluid several distinct species of essentially
identical immunoreactivity, which differ e.g. in length and/or by
the presence and/or type and/or degree of their posttranslational
modification, e.g. glycosylation and/or phosphorylation. In view of
the inherent possibility that any given assay may recognize more
than just one sort of molecule, according to a preferred embodiment
the determination of copeptin is to be understood as determination
of copeptin immunoreactivity, especially preferred as
immunoreactivity as measured with an assay as described below.
[0005] As far as the use of the present invention also extends to
the preparation of assay components and reagents useful in
connection with the determination of copeptin as biomarker, or as
active ingredient in pharmaceuticals, any suitable copeptin
peptides or derivatives, including fusion products and
modifications having e.g. a reduced homology with the naturally
occurring copeptin, or having a modified stability, can be used,
without any restriction to naturally occurring copeptin
products.
[0006] The term copeptin of the present invention consequently
comprises also amino acid sequences showing e.g. only 75% homology,
preferred at least 80% homology, more preferred at least 90%
homology to copeptin.
[0007] Terms as "diagnosis" or "diagnostic" are used in this
specification as general terms, which, if not defined otherwise,
are intended to comprise not only diagnosis in the sense of
identifying a specific disease, but also screening of asymptomatic
or high risk populations at risk of certain diseases or suspected
to have certain diseases, especially for early detection,
monitoring of untreated or treated patients and monitoring the
course of a therapy and for prognosis/--early prognosis and
survival prognosis.
[0008] The invention further relates to antibodies raised against
copeptin or against partial peptides of copeptin, especially for
use in a method as mentioned above, as well as kits and assays
involving such components.
[0009] Vasodilatory states of shock are life threatening
situations. The peripheral blood pressure decreases drastically and
often does not normalise after administration of catecholamines.
The most frequent form of shock is septic shock, which is also the
most severe form of sepsis. Furthermore vasodilatory shock can
manifest itself after severe heart surgery, hemorrhagic and cardiac
shock or after poisoning by medicaments or toxins [1, 2].
[0010] A series of peptides being predominantly effective via the
autocrine/paracrine route are involved in the regulation of blood
pressure. The following molecules are known to have vasodilatory
function: e.g. adrenomedullin, calcitonin gene-related peptide
(CGRP) and atrial natriuretic peptide (ANP). Vasoconstrictive
effects show for example the following molecules: endothelin,
angiotensin II and vasopressin (also known as arginine-vasopressin,
antidiuretic hormone (ADH)).
[0011] Vasopressin is a cleavage product of a larger precursor
molecule ("VP pro-hormone"; its polypeptide sequence is shown in
FIG. 3; or as SEQ ID NO:4) that is mainly formed in the neurons of
the hypothalamus [20]. After synthesis the VP pro-hormone is
glycosylated in the Golgi apparatus, packed into secretory vesicles
and split by pro-hormone convertase SP3 into the three peptides
vasopressin, neurophysin and copeptin. After axonal migration to
the nerve endings of the hypophysis the peptides are secreted from
the vesicles upon certain stimuli (e.g. high osmolarity, decrease
of blood volume or different hormones).
[0012] The most prominent physiological effect of vasopressin is
the retention of body water (antidiuresis). The effect of
vasopressin to physiologically increase blood pressure is in
healthy individuals less prominent than in septic shock. Further
physiological functions of vasopressin are the regulation of the
pituitary adrenal axis (ACTH, Cortisol), stimulation of the
activity of the gastro-intestinal tract and the aggregation of
blood platelets [1; numbers in brakkets refer to the attached list
of literature references].
[0013] In the pathogenesis of shock vasopressin plays a central
role: in experimental shock-models it was shown that plasma
concentrations of vasopressin are increased by three orders of
magnitude above the normal concentration within 15 minutes after
stimulation [4]. After rapid release of vasopressin stored in the
hypophysis the vasopressin concentrations are decreasing
drastically during further course of shock syndrome as was observed
in patients with septic shock [5-7]. This observation was the base
for the concept of a vasopressin substitution therapy for the
treatment of septic shock that was successfully tested [8-10].
These results indicate that an endogenous decrease of vasopressin
is contributing to the state of septic shock [5].
[0014] Vasopressin has also been discussed as a marker for the
prognosis of probability of survival of patients with cardiac
arrest [11] and consequently it was used for the treatment of such
patients [12].
[0015] A pathophysiological overexpression of vasopressin or VP
pro-hormone has been shown for several types of cancer like
prostate, testicular cancer, ovarian and pancreatic cancer,
pituitary adenomas and gangliomas, olfactory neuroblastomas, breast
and colon tumours, nasopharyngeal carcinoma, head and neck cancer,
phaeochromocytoma and tumours of gastrointestinal origin,
squamous-cell carcinomas, adenocarcinomas and large cell carcinomas
[13, 24, 25, 26]. Vasopressin produced or released in cancers is to
be considered as pathophysiologically formed, i.e. formed by
unnormal physiological routes (altered pathological tissues) which
are distinct from the normal physiological vasopressin
production.
[0016] In diseases as mentioned above vasopressin is released from
an organ (neurohypophysis) which is its normal origin, although in
non-physiological levels.
[0017] Copeptin--also known as C-terminal glycoprotein--comprises
39 amino acids, its sugar moiety and has a molecular weight of
about 2000 Da [15-17]. The glycosylation is at position.sub.. 131
of the precursor VP-prohormone (cf. SEQ ID NO:4). The biological
function of copeptin remains unclear.
[0018] The direct determination of vasopressin as humoral
diagnostic marker in body fluids as e.g. serum or plasma itself is
not suitable for routine diagnostics. More than 90% of vasopressin
are bound to blood platelets and are thus not available for the
measurements [21]. Thus free vasopressin found in the plasma does
not reflect the true amount of vasopressin released into the blood
stream. The binding of vasopressin to the blood platelets leads to
different results, depending on the amount of platelets included in
the measurement, which is variable depending on the centrifugation
used to obtain the plasma [22]. A further hindrance is the fact
that a higher amount of vasopressin is observed, if the blood
sample is left at room temperature before centrifugation. These
effects and the short half-life of vasopressin in vivo (24 minutes,
[14]) and in plasma samples ex vivo even when stored at -20 [23] so
far has hindered the use of vasopressin in routine diagnostics. Due
to the short half-life, it is not possible in routine diagnostics
to take samples, obtain the plasma, transport the sample into the
laboratory and do the diagnostics in the laboratory including the
required tests before vasopressin reaches a critical level of
detection.
[0019] Furthermore due to the low in vivo stability of vasopressin
and the variable results due to the binding to and release from
blood platelets, the use as a biomarker is extremely limited even
under optimized samples logistics, as the influence of the
degradation occurs rapidly.
[0020] The object of the invention was to overcome the effects of
the disadvantageous half-life of vasopressin and the variable
results in measurements and to develop a method, use and a kit for
the detection and determination of the molecules associated with
the release of vasopressin, more specially copeptin, for the
diagnosis of cardiovascular diseases and sepsis.
[0021] This object could be achieved on the basis of the surprising
finding that certain fragments of VP prohormone--the precursor of
vasopressin--copeptin in particular, can be used as a tool for the
determination of the physiological release of vasopressin, in
particular in body fluids, in the diagnosis and monitoring of
cardiovascualr diseases and sepsis.
[0022] This generation of the fragments, copeptin in particular,
correlates with the release of vasopressin, since all are derived
from the same precursor.
[0023] Furthermore the stability of the precursor proteins,
fragments and/or combinations thereof ex vivo were found to be
surprisingly high and render the fragments, copeptin in particular,
fully suitable for routine purposes.
[0024] This linkage between the fragments like copeptin and other
fragments of the precursor peptides made them suitable as
diagnostic tools for all diseases, where vasopressin plays a role.
Copeptin in particular can therefore be used in mediacal
diagnostics for diagnosing and monitoring a variety of diseases,
especially cardiovascular diseases and systemic inflammations,
especially sepsis.
[0025] Furthermore the present invention in one embodiment relates
to the use of copeptin for diagnosis of the diseases, course
control and prognosis for the above mentioned diseases where
vasopressin plays a role.
[0026] Clinical data may additionally be taken into consideration
to support the determination of the disease.
[0027] It is possible to use amino acid sequences showing at least
75% homology, preferred 80% homology more preferred at least 90%
homology to copeptin according to the present invention.
[0028] In a preferred embodiment of the present invention according
to the following examples two regions (PATV17; PLAY17) of the human
vasopressin-neurophysin 2-copeptin-precursor amino acid sequence
were chosen as immunological binding sites to be recognized by
specific antibodies:
TABLE-US-00001 positions 132-147: (PATV17-SEQ ID NO: 1)
CATQLDGPAGALLLRLV positions 149-164: (PLAY17-SEQ ID NO: 2)
CLAGAPEPFEPAQPDAY,
[0029] For calibration purposes and for the preparation of standard
solutions, a peptid comprising both binding sites mentioned above
was used (PAY33):
TABLE-US-00002 positions 132-164: (PAY33-SEQ ID NO: 3)
ATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY.
[0030] The immunological binding sites PATV17 and PLAY17 to be
recognized by specific antibodies were selected such that they do
not include the putative glycosylation site of copeptin at position
131. Therefore, the presence or absence of a posttranslational
modification (glycosylation) of the determined copeptin should not
have any significant impact on the recognition of copeptin in an
assay using such antibodies. The term "copeptin", therefore,
includes the "naked" copeptin peptide as well as
posttranslationally modified forms of said peptide.
[0031] When each of the pepides mentioned above were synthesized as
described below, an amino terminal cystein residue was added to
each copeptin amino acid sequence, and the peptides were chemically
synthesized as soluble proteins according to methods known by the
person skilled in the art. They were purified and quality
controlled by mass spectroscopy and reversed phase HPLC and
lyophilised into aliquots (Jerini AG, Berlin, Germany).
[0032] The synthesized peptides according to the present invention
were used to produce antigens and injected into animals to raise
antibodies against copeptin according to the present invention.
Different methods can be used to achieve this object known by the
person skilled in the art.
[0033] In a preferred embodiment the peptides PATV17 and PLAY17
were conjugated to a carrier protein keyhole limpet hemocyanin
(KLH) via MBS (m-maleimidobenzoyl-N-hydroxysuccinimide ester)
according to the methods of Pierce, Rockford, Ill., USA. Antibodies
were produced to the above mentioned peptides in sheep. In a
preferred embodiment of the present invention, polyclonal
antibodies were raised against the above mentioned peptides.
Antibodies were purified according to known methods. In a preferred
embodiment of the invention, this was achieved preferably by ligand
specific affinity chromatography by coupling the peptides via the
amino terminal cystein residue to SulfoLink-Gel of Pierce (Boston,
USA) according to the methods of Pierce. In a preferred embodiment
the antibodies were tagged with a marker to enable detection. The
marker used is preferably a luminescent marker and in a yet more
preferred embodiment, the antibody was tagged with a
chemiluminescent marker and in a yet further preferred embodiment
the antibodies against PATV17 (0413-pAK) and PLAY17 (0417-pAK) were
tagged with a chemiluminescent marker.
[0034] The invention in a further preferred embodiment involves the
use of the generated antibodies for detection of copeptin in
accordance with the present invention in samples of body fluids, as
well as a kit comprising a certain quantity of such an antibody or
more antibodies specific to detect molecules in accordance with the
present invention. Different assays can be used to detect the
molecules as are known to the person skilled in the art comprising
competitive or sandwich immunoassays in manual, automated or point
of care test formats employing various kinds of labels.
[0035] Methods for the detection of binding of the antibody to the
respective molecule are also known by the person skilled in the
art. All such known assay formats can be used in the context of the
determination of copeptin. It is, for example, within the scope of
the present invention to determine copeptin with the aid of a rapid
test device, e.g. of the immunochromatographic type, as so-called
POC (Point of Care) test. The determination of copeptin can also be
conducted with a homogeneous assay of the so-called KRYPTOR.RTM.
type, using the so-called TRACE.RTM. technology.
[0036] A preferred embodiment of the present invention discloses
the use of antibodies generated against the above mentioned
peptides, 0413-pAK and 0417-pAK, in particular for a two-site
immunoassay of the sandwich type. Another preferred embodiment of
the invention discloses the use of these antibodies for the
detection and the determination of the concentration of the
molecules of the present invention, copeptin in particular in
various body fluids and other biomaterials. In a preferred
embodiment copeptin can be detected at concentrations above 50
pg/ml of body fluid (FIG. 1).
[0037] In one embodiment the invention is based on and uses the
discovered long term stability of copeptin ex vivo in plasma and
serum (Table 2). In plasma and serum copeptin levels were
surprisingly stable even after two days storage at room
temperature. Thus copeptin is by far more suitable for diagnostic
purposes than vasopressin.
[0038] A preferred embodiment of the invention discloses the use of
antibodies generated against PLAY17 and PATV17 for the detection of
copeptin in healthy individuals, in patients with sepsis, cardiac
infarction and increased arterial blood pressure (FIG. 2), and for
determining the severity of chronic or congestive heart failure
(CHF) (FIG. 4).
[0039] The invention further permits the determination of the
presence and stability of the molecules of the present invention,
copeptin in particular in body fluids, and the determination of the
difference in peptide concentration in healthy controls and
patients of various diseases comprising those mentioned above (FIG.
2; FIG. 4). The median of healthy control individuals is at about
13 pg/ml.
[0040] The invention further discloses a significant change of the
concentration of the humoral biomarker copeptin in body fluids in
state of disease comprising those mentioned above.
[0041] A preferred embodiment of the invention is based on the
surprising finding of a highly significant change i.e. an about 10
fold increase in copeptin concentration in plasma of sepsis
patients (median 150,5 pg/ml) and in cardiac infarction (median
129,5 pg/ml) and an about 35 fold increase in patients with
increased arterial blood pressure (median 459,5 pg/ml).
[0042] In patients with CHF the measured levels of copeptin
correlates well with the severity of the illness which is generally
evaluated using the New York Heart Association (NYHA) functional
classification system, wherein NYHA classes I to IV correspond to
the following typical functional capacities: NYHA class
I--asymptomatic; NYHA class II--symptoms with moderate exertion;
NYHA class III--symptoms with minimal exertion; NYHA class
IV--symptoms (dyspnea) at rest. In a study in which copeptin levels
in plasma samples of a total of 348 CHF patients (25 in NYHA class
I; 124 in NYHA class II; 127 in NYHA class III; 72 in NYHA class
IV; see Table 1) were determined, the medians for the different
classes showed a clear tendency (see Table 1 below).
[0043] The invention also provides a diagnostic method, kit and
assay for the above mentioned diseases, using one or more
antibodies of copeptin in particular.
DESCRIPTION OF THE FIGURES
[0044] FIG. 1 shows the standard curve for the sandwich-immunoassay
for copeptin immunoreactivity using the peptide PAY33 as a standard
material.
[0045] FIG. 2 shows the concentration of copeptin immunoreactivity
in samples of healthy individuals and different groups of patients
(sepsis, cardiac infarction and increased arterial blood
pressure).
[0046] FIG. 3 shows the vasopressin prohormone amino acid sequence
(one-letter code; cf. also SEQ ID NO:4).
[0047] FIG. 4 shows the concentrations of copeptin immunoreactivity
in samples of patients with CHF (chronic heart failure) classified
according to the NYHA classification system.
MATERIALS, METHODS AND MEASUREMENTS
EXAMPLE 1
[0048] Peptide Synthesis
[0049] Peptides were synthesized and their quality was controlled
by mass spectrometry and reversed phase HPLC and lyophiliysed in
aliquots (Jerini AG, Berlin, Germany) according to standard
procedures known to the person skilled in the art. The amino acid
sequences of the peptides are the following (numbers refer to
corresponding positions in the human provasopressin-neurophysin
2-copeptin-precursors (positions 132-147 and 149-164):
TABLE-US-00003 PATV 17 (132-147 + N-terminal cystein residue):
[Sequence ID 1] CATQLDGPAGALLLRLV, PLAY 17 (149-164 + N-terminal
cystein residue): [Sequence ID 2] CLAGAPEPFEPAQPDAY, Standard
peptide PAY 33 (132-164) [Sequence ID 3]
ATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY.
EXAMPLE 2
[0050] Conjugation and Immunization
[0051] Peptides of Sequence IDs 1-2 were conjugated to the carrier
protein KLH (keyhole limpet hemocyanin) by MBS
(-Maleimid-obenzoyl-N-hydroxysuccinimid ester) according to the
protocols for "NHS-esters-maleimide crosslinkers" by PIERCE,
Rockford, Ill., USA. Sheep were immunized receiving 100 .mu.g of
conjugate (.mu.g according to the peptide content of the conjugate)
and subsequently 50 .mu.g of conjugate every four weeks (quantitiy
related to the peptide content of the conjugate). Starting at month
4 after immunization every four weeks 700 ml of blood were
withdrawn from every sheep and antiserum was gained by
centrifugation. Conjugation, immunizations and production of
antisera were done by MicroPharm, Carmerthenshire, UK.
EXAMPLE 3
[0052] Purification of Antibodies
[0053] The polyclonal antibodies from sheep were purified using
ligand specific affinity purification. For that step the peptides
PATV 17 and PLAY 17 were linked to SulfoLink-Gel supplied by Pierce
(Boston, USA). The binding occurred according to the protocol of
Pierce. 5 mg of peptide were added per 5 ml of gel.
[0054] In summary, columns were washed three times with 10 ml
elution buffer (50 mM citric acid, pH 2.2) and binding buffer (100
mM sodium phosphate, 0.1% Tween, pH 6.8). 100 ml of sheep antiserum
were filtered using a filter diameter of 0.2 .mu.m and added to the
column material, which had been transferred from the column to a
beaker with 10 ml binding buffer. The material was incubated over
night at room temperature by gentle rotation. The material was
transferred to empty columns (NAP 25, Pharmacia, emptied). The
eluates were discarded. Subsequently the columns were washed with
250 ml protein-free binding buffer (protein content of washed
eluate <0.02 A 280 nm): Elution buffer was added to the washed
columns and fractions of 1 ml were collected. The protein content
of each fraction was determined by the BCA-method (according to the
protocol of PIERCE, Rockford, Ill., USA). Fractions of a protein
content >0.8 mg/ml were pooled. After determination of protein
content 39 mg of anti-PATV 17 antibody 0413-pAk and 103 mg of
anti-PLAY 17 antibody 0417-pAk were gained.
EXAMPLE 4
[0055] Tagging
[0056] The anti-PLAY 17 antibody 0417-pAk was treated as follows:
500 .mu.l of affinity purified antibodies generated were rebuffered
in 1 ml 100 mM potassium phosphate buffer (pH 8.0) via a NAP-5 gel
filtration column (Pharmacia) according to the protocol of
Pharmacia. The protein concentration of antibody solution was 1,5
mg/ml.
[0057] For the tagging with a chemiluminescent marker 10 .mu.l of
MA70-Akridinium-NHS-ester (lmg/ml; Hoechst Behring) were added to
67 .mu.l of antibody solution and incubated for 15 minutes at room
temperature. Then 423 .mu.l of 1 M glycin was added and incubated
for 10 minutes. The solution was rebuffered in 1 ml solvent A (50
mM potassium phosphate, 100 mM NaCl, pH 7.4) using a NAP-5 gel
filtration column according to the protocols of Pharmacia. For
final elimination of unbound label a gel filtration HPLC was done
(Column: Waters Protein Pak SW300). The sample was added and
chromatographed at a flow rate of 1 ml/minute in solvent A. The
flow was continuously monitored in a UV-meter at wave length of 280
and 368 nm to determine the degree of tagging. The absorption ratio
368/280 nm of labelled antibody was 0,1. The fractions containing
monomeric antibodies were collected (retention time 8-10 minutes)
and taken up in 3 ml 100 mM sodium phosphate, 150 mM NaCl, 5%
bovine serum albumin, 0,1% sodium azide, pH 7.4)
EXAMPLE 5
[0058] Coupling
[0059] The anti-PATV 17 antibody 0413-pAk was immobilized on
irradiated 5 ml polystyrol tubes (Greiner, Germany). For that
procedure the antibody solution was diluted to a protein
concentration of 6.6 .mu.g/ml with 50 mM Tris, 100 mM NaCl, pH 7.8.
300 .mu.l of diluted protein solution per tube were pipetted. These
were incubated for 20 hours at 22.degree. C., the solution was
removed. Then 4.2 ml of a 10 mM sodium phosphate, 2% Karion FP,
0.3% bovine serum albumin, pH 6.5 solution were added to each tube.
After 20 hours the solution was removed and the tubes were dried in
a vacuum drier.
EXAMPLE 6
[0060] Immunoassay
[0061] The following assay buffer was used: 100 mM sodium
phosphate, 150 mM NaCl, 5% bovine serum albumin, 0.1% unspecified
sheep IgG, 0.1% sodium azide, pH 7.4.
[0062] The copeptin concentration of EDTA-plasma of healthy
individuals and patients of various diseases/diseases mentioned
above was determined, heart diseases and diseases of the
circulation in particular.
[0063] As a standard material chemically synthesized peptide
(peptide PAY 33) was used which corresponds to positions 132-164 of
vasopressin-neurophysin 2-copeptin precursor. The standard was
diluted in normal horse serum (Sigma).
[0064] In the test tubes 100 .mu.l of standards or sample as well
as 100 .mu.l of assay buffer was pipetted. The tubes were incubated
for two hours at 22.degree. C. using gentle rotation. After washing
4 times with 1 ml of washing buffer (0.1% Tween 20), the
supernatant was discarded. Then 200 .mu.l of assay buffer,
containing 1 million RLU (relative light units) of MA70-tagged
antibody was added and incubated for a further two hours under
gentle rotation at 22.degree. C. After washing 4 times with 1 ml of
washing buffer (0.1% Tween 20), the chemiluminescence bound to the
tube was determined in a luminometer (Berthold, LB952T, basic
reagents Brahms AG). Using the software MultiCalc (Spline Fit) the
concentrations of the samples were determined.
EXAMPLE 7
[0065] Determination of Copeptin Concentration
[0066] The term copeptin immunoreactivity describes the amount of
substrate detected by the developed sandwich immunoassay. The
sandwich immunoassay uses antibodies raised against positions
132-147 and 149-164 of the vasopressin-neurophysin
2-copeptin-precursor for detection of the substrate. A typical
standard curve for the developed assay is described in FIG. 1.
Using the assay concentrations above 50 pg/ml copeptin
immunoreactivity in plasma or serum can be determined
quantitatively.
EXAMPLE 8
[0067] Concentration of Copeptin Immunoreactivity in Healthy
Individuals and State of Disease
[0068] Serum and plasma of healthy individuals and patients
suffering from various diseases comprising sepsis, cardiac
infarction and increased arterial blood pressure were analysed
(FIG. 2): The copeptin immunoreactivity was determined. Compared to
healthy individuals copeptin immunoreactivity was surprisingly
increased in state of disease. Healthy individuals showed a median
of about 13 pg/ml, sepsis patients a median of about 150 pg/ml, in
cardiac infarction the median was about 129 pg/ml and in increased
arterial blood pressure the median was about 459 pg/ml.
EXAMPLE 9
[0069] Concentration of Copeptin Immunoreactivity in Patients with
Chronic Heart Failure (CHF) of NYHA Classes I to IV
[0070] In serum and plasma samples of a total of 348 CHF patients
(25 in NYHA class I; 124 in NYHA class II; 127 in NYHA class III;
72 in NYHA class IV; see Table 1) copeptin levels were determined
using the assay described above. The results are shown in
diagrammatic form in FIG. 4. As can be seen, the medians of the
copeptin concentration in pg/ml for the different classes showed a
clear tendency to increase in that the median for patients of NYHA
class I was found to be 20.30 pg/ml, class II 33.25 pg/ml, class
III 49,60 pg/ml, and class IV 85.80 pg/ml (see the statistical data
in Table 1 below).
TABLE-US-00004 TABLE 1 NYHA I NYHA II NYHA III NYHA IV Number of 25
124 127 72 values Median 20.30 33.25 49.60 85.80 Mean 27.00 45.32
63.91 184.7 Lower 95% CI 17.45 38.79 55.29 118.9 of mean Upper 95%
CI 36.56 51.86 72.54 250.5 of mean CI = confidence interval
[0071] The finding that there is a close correlation of the
severity of CHF with the copeptin levels in plasma makes copeptin a
biomarker candidate for use in the diagnosis (positive or negative
diagnosis) of CHF, the monitoring of the course and evolution of
CHF and the monitoring and control of a CHF therapy. Further, in
view of current attempts to evaluate the usefulness of vasoporessin
receptor antagonists in the therapy of heart failure [27], the
determination of copeptin in serum or. plasma samples of heart
failure patients can allow the identification of such patients who
would benefit more than others from a treatment with vasopressin
receptor antagonists.
EXAMPLE 10
[0072] Stability of Copeptin Immunoreactivity
[0073] Copeptin immunoreactivity was found to be surprisingly
stable in plasma and serum (Table 2). Table 2 shows the ex vivo
stability of endogenous immunoreactive copeptin in serum and plasma
of sepsis patients.
TABLE-US-00005 TABLE 2 Storage Recovery Sample (days/temperature)
(%) Serum 1 d/4.degree. C. 98.0% (n = 3) 2 d/4.degree. C. 99.2% 1
d/RT 94.1% 2 d/RT 103.7% Plasma 1 d/4.degree. C. 103.4% (n = 5) 2
d/4.degree. C. 101.6% 1 d/RT 99.9% 2 d/RT 104.9%
[0074] Even after two days storage at room temperature (RT) no
decrease in immunoreactivity could be detected.
[0075] Thus the ex vivo stability of copeptin immunoreactivity is
surprisingly remarkably increased as compared to vasopressin.
LITERATURE
[0076] 1. Singh Ranger G: The physiology and emerging roles of
antidiuretic hormone. Int. J. Clin. Pract. 56: 777-782, 2002;
[0077] 2. Landry D W, Oliver J A: The pathogenesis of vasodilatory
shock. N. Engl. J. Med. 345: 588-595;
[0078] 3. Coates L C, Birch N P: Differential cleavage of
provasopressin by the major molecular forms of SPC3. J. Neurochem.
70: 1670-1678, 1998;
[0079] 4. Wilson M F, Brackett D J, Tompkins P, Benjamin B, Archer
L T, Hinshaw L B: Elevated plasma vasopressin concentrations during
endotoxin and E.coli shock. Adv. Shock. Res. 6: 15-26, 1981;
[0080] 5. Landry D W, Levin H R, Gallant E M, Ashton R C, Jr., Seo
S, D'Alessandro D, Oz M C, Oliver J A: Vasopressin deficiency
contributes to the vasodilation of septic shock. Crit. Care Med.
30: 497-500;
[0081] 6. Sharshar T, Carlier R, Blanchard A, Paillard M, Raphael J
C, Gajdos P, Annane D: Depletion of neurohypophyseal content of
vasopressin in septic shock. Crit Care Med 30: 497-500, 2002;
[0082] 7. Sharshar T, Blanchard A, Paillard M, Raphael J C, Gajdos
P, Annane D: Circulating vasopressin levels in septic shock. Crit
Care Med 31: 1752-1758, 2003;
[0083] 8. Forrest P: Vasopressin and shock. Anaesth Intensive Care
29: 463-472, 2001;
[0084] 9. Vincent JL: Endocrine support in the critically ill. Crit
Care Med 30: 702-703, 2002;
[0085] 10. Holmes C L, Landry D W, Granton J T: Science Review:
Vasopressin and the cardiovascular system part 2--clinical
physiology. Crit Care 8: 15-23, 2004;
[0086] 11. Lindner K H, Strohmenger H U, Ensinger H, Hetzel W D,
Ahnefeld F W, Georgieff M: Stress hormone response during and after
cardiopulmonary resuscitation. Anaesthiology 77: 662-668, 1992;
[0087] 12. Wenzel V, Krismer A C, Arntz H R, Sitter H, Stadlbauer K
H, Lindner K H: A comparison of vasopressin and epinephrine for
out-of-hospital cardiopulmonary resuscitation. N Engl J Med 350:
105-113, 2004;
[0088] 13. North W G: Gene regulation of vasopressin and
vasopressin receptors in cancer. Exp Physiol 85 Spec No: 27 S-40 S,
2000;
[0089] 14. Baumann G, Dingmann J F: Distribution, blood transport
and degradation of antidiuretic hormone in man. J Clin Invest 57:
1109-1116, 1976;
[0090] 15. Smyth D G, Massey D E: A new glycopeptide in pig, ox and
sheep pituitary. Biochem Biophys Res Commun 87: 1006-1010,
1979;
[0091] 16. de Bree F M, Burbach J P: Structure-function
relationships of the vasopressin prohormone domains. Cell Mol
Neurobiol 18: 173-191, 1998;
[0092] 17. Holwerda D A: A glycopeptide from the posterior lobe of
pituitaries. I. Isolation and characterization. Eur J Biochem 28:
334-339, 1972;
[0093] 18. Nagy G, Mulchahey J J, Smyth D G, Neill J D: The
glycopeptide moiety of vasopressin-neurophysin precursor is
neurohypophysial prolactin releasing factor. Biochem Biophys Pes
Commun 151: 524-529, 1988;
[0094] 19. Hyde J F, North W G, Ben-Jonathan N: The
vasopressin-associated glycopeptide is not a prolactin-releasing
factor: studies with lactating Brattleboro rats. Endocrinology 124:
35-40, 1989;
[0095] 20. North, W. G. "Biosynthesis of vasopressin and
neurophysins" in: D. Gash and G. Boer (eds.), Vasopressin:
Principles and Properties, pp. 175-209. New York: Plenum Press,
1987);
[0096] 21. Chesney et al., J. Lab. Clin. Med. 1985, S. 106,
abrufbar unter www.ncbi.nih.gov;
[0097] 22. Kluge et al., Clinical Chemistry 1999, S. 98-100
[0098] 23. Robertson et al., Journal of Clinical Investigation,
Vol. 52, 1973, S. 2340-2352;
[0099] 24. North, W. G. et al, "Immunohistochemical Evaluation of
Vasopressin Expression in Breast Fibrocystic Disease and Ductal
Carcinoma In Situ (DOTS)", Endocrine Pathology, 2003, Vol. 14,
No.3, 2003, pages 257-262; 25. North W. G. et al., "Vasopressin
gene related products are markers of human breast cancer". Breast
Cancer Research and Treatment, Vol. 34, 1995, pages 229-235;
[0100] 26. North W.G.: "Neuropeptide Production by Small Cell
Carcinoma: Vasopressin and Oxytocin as Plasma Markers of Disease",
J Clin Endocrinol Metab, Vol. 73, 1991, No. 6, pages 1316-1320;
[0101] 27. Thibonnier M., Vasopressin receptor antagonists in heart
failure, Current Opinion in Pharmacology 2003, 3:683-687.
Sequence CWU 1
1
4117PRTArtificialmisc_feature1..16Synthetic peptide 1Cys Ala Thr
Gln Leu Asp Gly Pro Ala Gly Ala Leu Leu Leu Arg Leu 1 5 10 15 Val
217PRTArtificialmisc_feature1..16Synthetic peptide 2Cys Leu Ala Gly
Ala Pro Glu Pro Phe Glu Pro Ala Gln Pro Asp Ala 1 5 10 15 Tyr
333PRTArtificialmisc_feature1..33Synthetic peptide 3Ala Thr Gln Leu
Asp Gly Pro Ala Gly Ala Leu Leu Leu Arg Leu Val 1 5 10 15 Gln Leu
Ala Gly Ala Pro Glu Pro Phe Glu Pro Ala Gln Pro Asp Ala 20 25 30
Tyr 4164PRTHomo sapiens 4Met Pro Asp Thr Met Leu Pro Ala Cys Phe
Leu Gly Leu Leu Ala Phe 1 5 10 15 Ser Ser Ala Cys Tyr Phe Gln Asn
Cys Pro Arg Gly Gly Lys Arg Ala 20 25 30 Met Ser Asp Leu Glu Leu
Arg Gln Cys Leu Pro Cys Gly Pro Gly Gly 35 40 45 Lys Gly Arg Cys
Phe Gly Pro Ser Ile Cys Cys Ala Asp Glu Leu Gly 50 55 60 Cys Phe
Val Gly Thr Ala Glu Ala Leu Arg Cys Gln Glu Glu Asn Tyr 65 70 75 80
Leu Pro Ser Pro Cys Gln Ser Gly Gln Lys Ala Cys Gly Ser Gly Gly 85
90 95 Arg Cys Ala Ala Phe Gly Val Cys Cys Asn Asp Glu Ser Cys Val
Thr 100 105 110 Glu Pro Glu Cys Arg Glu Gly Phe His Arg Arg Ala Arg
Ala Ser Asp 115 120 125 Arg Ser Asn Ala Thr Gln Leu Asp Gly Pro Ala
Gly Ala Leu Leu Leu 130 135 140 Arg Leu Val Gln Leu Ala Gly Ala Pro
Glu Pro Phe Glu Pro Ala Gln 145 150 155 160 Pro Asp Ala Tyr
* * * * *
References