U.S. patent application number 15/426175 was filed with the patent office on 2017-07-27 for protein sequencing method and reagents.
The applicant listed for this patent is The Governing Council of the University of Toronto. Invention is credited to Warren C.W. Chan, Andrew Emili, Megan McLaughlin, Jonathan Buchanan Olsen, Sachdev S. Sidhu, Kyrylo Zagorovsky.
Application Number | 20170212126 15/426175 |
Document ID | / |
Family ID | 57964311 |
Filed Date | 2017-07-27 |
United States Patent
Application |
20170212126 |
Kind Code |
A1 |
Emili; Andrew ; et
al. |
July 27, 2017 |
PROTEIN SEQUENCING METHOD AND REAGENTS
Abstract
The invention describes methods and reagents useful for
sequencing polypeptide molecules. The method comprises affixing a
polypeptide to a substrate and contacting the polypeptide with a
plurality of probes. Each probe selectively binds to an N-terminal
amino acid or an N-terminal amino acid derivative. Probes bound to
the polypeptide molecule are then identified before cleaving the
N-terminal amino acid or N-terminal amino acid derivative of the
polypeptide. Also provided are methods for the sequencing a
plurality of polypeptide molecules in a sample and probes specific
for N-terminal amino acids or N-terminal amino acid
derivatives.
Inventors: |
Emili; Andrew; (Milton,
CA) ; McLaughlin; Megan; (Red Deer, CA) ;
Zagorovsky; Kyrylo; (Toronto, CA) ; Olsen; Jonathan
Buchanan; (Kitchener, CA) ; Chan; Warren C.W.;
(Toronto, CA) ; Sidhu; Sachdev S.; (Toronto,
CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Governing Council of the University of Toronto |
Toronto |
|
CA |
|
|
Family ID: |
57964311 |
Appl. No.: |
15/426175 |
Filed: |
February 7, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12891313 |
Sep 27, 2010 |
9566335 |
|
|
15426175 |
|
|
|
|
61245875 |
Sep 25, 2009 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
G01N 33/6824 20130101;
A61K 45/06 20130101; G01N 33/582 20130101; G01N 2333/952 20130101;
C07K 14/245 20130101 |
International
Class: |
G01N 33/68 20060101
G01N033/68; G01N 33/58 20060101 G01N033/58; C07K 14/245 20060101
C07K014/245 |
Claims
1. A method of sequencing a polypeptide comprising: a. affixing the
polypeptide to a substrate; b. contacting the polypeptide with a
plurality of probes, wherein each probe selectively binds to an
N-terminal amino acid or a N-terminal amino acid derivative; c.
detecting the probe bound to the polypeptide molecule, thereby
identifying the N-terminal amino acid of the polypeptide; d.
cleaving the N-terminal amino acid or N-terminal amino acid
derivative of the polypeptide; and e. repeating steps (b) to (d) to
determine the sequence of at least a portion of the
polypeptide.
2. The method of claim 1, wherein the polypeptide is a single
polypeptide molecule.
3. The method of claim 1, wherein step b) further comprises
derivatizing the N-terminal amino acid of the polypeptide prior to
contacting the polypeptide with the plurality of probes.
4. The method of claim 1, wherein step a) comprises affixing the
polypeptide to the substrate through a C'-terminal carboxyl group
or a side chain functional group of the polypeptide.
5. The method of claim 1, wherein the polypeptide is covalently
affixed to the substrate.
6. (canceled)
7. The method of claim 1, wherein the substrate comprises a
plurality of spatially resolved attachment points.
8. The method of claim 7, wherein step a) comprises affixing the
polypeptide to a spatially resolved attachment point.
9. The method of claim 1, wherein the plurality of probes
comprises: a. one or more probes that selectively bind to one of 20
natural proteinogenic amino acids; b. one or more probes that
selectively bind to a post-translationally modified amino acid; or
c. one or more probes that selectively bind to a derivative of a)
or b).
10. The method of claim 11, wherein at least one probe comprises an
affinity capture reagent and a detectable label.
11. The method of claim 10, wherein the step of detecting the probe
bound to the polypeptide comprises detecting the detectable
label
12. The method of claim 10, wherein the affinity capture reagent
comprises a polypeptide.
13. (canceled)
14. (canceled)
15. The method of claim 1, wherein step e) comprises cleaving the
N-terminal amino acid or N-terminal amino acid derivative of the
polypeptide using Edman degradation.
16. (canceled)
17. A method of sequencing a plurality of polypeptide molecules in
a sample comprising: a. affixing the polypeptide molecules in the
sample to a plurality of spatially resolved attachment points on a
substrate; b. contacting the polypeptides with a plurality of
probes, wherein each probe selectively binds to an N-terminal amino
acid or a N-terminal amino acid derivative; c. for a plurality of
polypeptides molecule that are spatially resolved and affixed to
the substrate, identifying the probe bound to each polypeptide; d.
cleaving the N-terminal amino acid or N-terminal amino acid
derivative of each of the polypeptides; and e. repeating steps b)
to d) to determine the sequence of at least a portion of one or
more of the plurality of polypeptide molecules that are spatially
resolved and affixed to the substrate.
18. The method of claim 17, wherein the sample comprises a
biological fluid, cell extract or tissue extract.
19. (canceled)
20. (canceled)
21. A probe comprising a variant of a polypeptide wherein the
variant binds to an N-terminal amino acid or a N-terminal amino
acid derivative with a different selectivity than the
polypeptide.
22. (canceled)
23. The probe of claim 21, wherein the polypeptide is a ClpS
polypeptide and the variant of the ClpS polypeptide comprises at
least 80% sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2.
24. The probe of claim 23, wherein the variant comprises one or
more mutations at positions that correspond to residues 12, 13, 14,
16, 17, 18, 21, 40, 43, 44, 76 or 77 as set forth in SEQ ID NO:
1.
25. The probe of claim 23, wherein the variant CIpS polypeptide
comprises cystein residues at positions that correspond to residues
21 and 40 in SEQ ID NO: 1.
26. The probe of claim 21, wherein the variant comprises a
polypeptide with at least 80% sequence identify to the polypeptide
sequence as set forth in SEQ ID NO: 2 and wherein the variant
selectively binds the N-terminal amino acid tryptophan.
27. The probe of claim 21, further comprising a detectable label.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. provisional
application no. 61/245,875 titled SINGLE MOLECULE PROTEIN
SEQUENCING METHOD filed on Sep. 25, 2009, the contents which of are
herein incorporated by reference.
NON-PUBLICATION REQUEST
[0002] A non-publication request has been submitted with this
application upon filing. This application is not to be published
under 35 U.S.C. 122(b)
INCORPORATION OF SEQUENCE LISTING
[0003] A computer readable form of the Sequence Listing
"13795-15_Sequence_Listing.txt" (4,636 bytes), submitted via
EFS-WEB and created on Sep. 27, 2010, is herein incorporated by
reference.
FIELD OF THE INVENTION
[0004] This invention relates to the field of protein sequencing.
More specifically, the invention relates to methods, assays and
reagents for sequencing protein or polypeptide molecules as well as
to methods and assays for the parallel sequencing of proteins or
polypeptides.
BACKGROUND OF THE INVENTION
[0005] Proteins mediate the biological activity, and function, of
virtually every biological process in cells, while misexpression is
associated with various human diseases. The identification and
quantification of proteins present in biological samples is
therefore a fundamental problem applicable to most biomedical
research studies, and a cornerstone of the emerging field of
Proteomics.
[0006] Protein sequencing has traditionally relied on the
sequential detection of individually cleaved N-terminal amino acids
from a population of identical polypeptide molecules using Edman
degradation chemistry and the detection and identification of the
different amino acid Edman derivatives using techniques such as
differential HPLC retention and UV absorption. More recently, mass
spectrometry has been used to sequence and/or identify proteins or
polypeptides with increased speed, accuracy and sensitivity. These
methods are generally low-throughput, computationally demanding and
require the use of expensive equipment. However, even the most
sensitive mass spectrometers require relatively large amounts of
sample, with current limits of detection on the order of 10.sup.8
molecules (equivalent to nanogram or femtomole levels) and are not
able to exhaustively sequence complex mixtures of proteins due to
ion-ion interference, preferential (biased) detection of certain
molecules, limited dynamic range and general under-sampling.
[0007] While dramatic improvements have been made in the past
couple of years with respect to the speed, comprehensiveness and
availability of high-throughput massively parallel DNA sequencing
platforms capable of sequencing large numbers of different nucleic
acid molecules simultaneously, advances in mass spectrometer
performance have been incremental. Relatively little progress has
been made towards the development of "next generation" platforms
for global protein sequencing at the individual single molecule
level. Furthermore, the relative complexity of protein mixtures
such as blood, tissue or cell extracts, as well as the lack of
PCR-based amplification or properties such as duplex formation and
base-pairing, have hampered the development of single-molecule
protein sequencing such as those described for polynucleotides
(Harris et aL Science 4 Apr. 2008: Vol. 320. no. 5872).
[0008] Accordingly, there remains a need for novel methods and
assays for sequencing single polypeptide molecules and for methods
and assays able to perform the simultaneous parallel sequencing of
large-numbers of polypeptides present in one or more samples.
SUMMARY OF THE INVENTION
[0009] In a broad aspect there are provided methods for sequencing
polypeptides wherein the polypeptides are contacted with probes
that selectively bind to N-terminal amino acid residues. In another
broad aspect, there are provided probes that selectively bind to
N-terminal amino acid residues. In one embodiment the methods and
reagents are useful for sequencing a single polypeptide molecule,
multiple molecules of a single polypeptide, or for the parallel
sequencing of a plurality of different polypeptides. The described
methods and reagents are also useful for the massively parallel
sequencing of mixtures of proteins, such as for the analysis of
single cells or biological or environmental samples. In a further
aspect, the methods are useful for the both the qualitative (i.e.
determining the sequence identity) and quantitative (i.e.
determining the abundance) analysis of protein expression in one or
more samples.
[0010] Accordingly, in one embodiment, there is provided a method
of sequencing a polypeptide comprising affixing the polypeptide to
a substrate and contacting the polypeptide with a plurality of
probes where each probe selectively binds to an N-terminal amino
acid or a N-terminal amino acid derivative. The probe bound to the
polypeptide is then detected thereby identifying the N-terminal
amino acid of the polypeptide. In one embodiment, the N-terminal
amino acid or N-terminal amino acid derivative of the polypeptide
is cleaved, and the steps of contacting the polypeptide with a
plurality of probes, detecting the probe bound to the polypeptide,
and cleaving the N-terminal amino acid of the polypeptide are
repeated to determine the sequence of at least a portion of the
polypeptide. In some embodiments, rinse or wash steps are included
before or after each step of the method. Optionally, the
polypeptide is a single polypeptide molecule.
[0011] In one embodiment, one or more polypeptides are affixed to a
substrate and contacted with a plurality of probes before washing
the substrate to remove any non-specifically bound probes.
[0012] In one embodiment, the N-terminal amino acid of a
polypeptide affixed to the substrate is derivatized prior to
contacting the polypeptide with the plurality of probes. For
example, in one embodiment the N-terminal amino acid is derivatized
with an Edman reagent such as phenyl isothiocyanate (PITC).
[0013] In one embodiment, the polypeptide is affixed to the
substrate through a C'-terminal carboxyl group or a side chain
functional group of the polypeptide. In some embodiments the
polypeptide is covalently or non-covalently affixed to the
substrate.
[0014] In one embodiment, the substrate is optically transparent.
For example, the substrate is optionally a glass slide or silicon
wafer. Optionally, the substrate is embedded in a microfluidic
device.
[0015] In one embodiment, the substrate comprises a plurality of
spatially resolved attachment points. In some embodiments, the
attachment points include a molecular linker, such as a
polyethylene glycol (PEG) moiety. In some embodiments, the
polypeptide is affixed to the substrate through a spatially
resolved attachment point.
[0016] In one embodiment, the polypeptide affixed to the substrate
is contacted with a plurality of probes. In one embodiment, the
plurality of probes includes one or more probes that selectively
bind to one of 20 natural proteinogenic amino acids, one or more
probes that selectively bind to a post-translationally modified
amino acid, or one or more probes that selectively bind to an amino
acid derivative or modified amino acid derivative. In one
embodiment, the probes selectively bind a N-terminal amino acid or
a N-terminal amino acid derivative. The 20 natural proteinogenic
amino acids include those amino acids commonly found in proteins
and coded for by the standard genetic code. In some embodiments,
the amino acid derivative is an Edman reagent derivative such as a
phenylthiocarbamyl (PTC) derivative.
[0017] In some embodiments, the probe comprises an affinity capture
reagent and one or more detectable labels. Optionally, the affinity
capture reagent is a synthetic or natural antibody. In some
embodiments, the affinity capture reagent is an aptamer. In one
embodiment, the affinity capture reagent is a polypeptide, such as
a modified member of the CIpS family of adaptor proteins.
Optionally, the probe comprises a variant of a E. Coil CIpS binding
polypeptide, wherein the variant has at least 80% sequence identity
to the polypeptide set forth in SEQ ID NO: 1. In one embodiment,
the probe comprises a polypeptide with at least 80% sequence
identity to the polypeptide set forth in SEQ ID NO: 2 and is
selective for N-terminal tryptophan residues.
[0018] In one embodiment, the detectable label is optically
detectable. In some embodiments, the detectable label comprises a
fluorescently moiety, a color-coded nanoparticle, a quantum dot or
any combination thereof. In one embodiment the label comprises a
polystyrene dye encompassing a core dye molecule such as a
FluoSphere.TM..
[0019] In one embodiment, the probe bound to the polypeptide
affixed to the substrate is detected by directly or indirectly
detecting the detectable label. In some embodiments, the probe is
detected using an optical detection system. Optionally, the optical
detection system comprises a CCD camera and/or a rastering
laser/scanner. In some embodiments, the optical detection system
has single-photon resolution.
[0020] In one embodiment of the method described herein, the
N-terminal amino acid of the polypeptide affixed to the substrate
is cleaved. In one embodiment, the N-terminal amino acid or
N-terminal amino acid derivative is cleaved using Edman
degradation. For example in one embodiment, the Edman degradation
proceeds through the addition of phenylisothiocyanate under
alkaline conditions to form a cyclical phenylthiocarbamoyl
derivative followed by cleavage of the N-terminal amino acid under
acidic conditions. In one embodiment, the N-terminal amino acid is
derivatized at a pH of between 8 and 10, and the step of cleaving
the N-terminal amino acid occurs at a pH of between 2 and 6.
[0021] In one embodiment, the polypeptide to be sequenced is a
partially digested or completely digested protein. In a further
embodiment, a sample comprising a plurality of polypeptides is
treated with an endopeptidase in order to partially or completely
digest the polypeptides contained in the sample. In one embodiment,
the polypeptide or sample is digested prior to being affixed to the
substrate.
[0022] In another aspect, there is provided a method of sequencing
a plurality of polypeptide molecules in a sample comprising
affixing the polypeptide molecules in the sample to a plurality of
spatially resolved attachment points on a substrate and contacting
the polypeptides with a plurality of probes, wherein the probes
selectively bind to an N-terminal amino acid or a N-terminal amino
acid derivative. In one embodiment, for each polypeptide molecule
that is spatially resolved and affixed to the substrate, the probe
bound to each polypeptide is identified. In a further embodiment,
the N-terminal amino acid or N-terminal amino acid derivative of
each of the polypeptides is cleaved. In one embodiment, the steps
of contacting the plurality of peptides with a plurality of probes,
identifying the probes bound to the polypeptides and cleaving the
N-terminal amino acid of the polypeptide are repeated in order to
determine the sequence of at least a portion of each polypeptide
molecule that is spatially resolved and affixed to the
substrate.
[0023] In one embodiment, the N-terminal amino acid residues of the
polypeptides affixed to the substrate are derivatized prior to
contacting the polypeptide with the plurality of probes. For
example the N-terminal amino acid residues may be derivatized with
an Edman reagent, such as PITC.
[0024] In some embodiments, rinse or wash steps are included before
or after each step of the methods described herein.
[0025] In some embodiments, the sample comprises a cell extract or
tissue extract. In one embodiment, the sample comprises a single
cell. In some embodiments, the sample is a biological fluid such as
blood, plasma. The sample may also comprise an environmental sample
such as a soil sample or other biological material.
[0026] In some embodiments, the sequence information generated
using the methods described herein is used to search a reference
sequence database. For example, in one embodiment, a sequence
database is searched using the complete or partial sequence of a
polypeptide in order to determine the identity of the
polypeptide.
[0027] In another embodiment, the methods described herein are
useful for the quantitative analysis of polypeptide in a sample.
For example, the number of instances of a particular polypeptide in
a sample can be determined by comparing the sequence or partial
sequence of each polypeptide, grouping similar polypeptide
sequences and counting the number of instances of each similar
polypeptide sequence.
[0028] In one aspect, the description provides probes that
selectively bind to an N-terminal amino acid or N-terminal amino
acid derivative of a polypeptide. In one embodiment, the probe
comprises an antibody or antibody fragment. In another embodiment,
the probe comprises an affinity capture binding reagent. In some
embodiments, the affinity capture binding reagent is an aptamer. In
one embodiment, the probes further comprise a detectable label such
as a fluorescent moiety.
[0029] In one embodiment, there is provided a probe comprising a
variant of a polypeptide wherein the variant binds to an N-terminal
amino acid or a N-terminal amino acid derivative with a different
selectivity than the polypeptide. In one embodiment, probe
comprises a variant CIpS polypeptide, and the variant polypeptide
binds to an N-terminal amino acid with a different selectivity than
the CIpS polypeptide. Optionally, the CIpS polypeptide is a
truncated E. coli CIpS polypeptide comprising the following
sequence:
TABLE-US-00001 (SEQ ID NO: 1)
KPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
ICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA
[0030] The inventors have determined that variant CIpS polypeptides
with mutations at specific positions in the sequence set forth in
SEQ ID NO: 1 are useful for selectively binding specific N-terminal
amino acids and for the sequencing methods described herein. In one
embodiment, the variant polypeptides show selectivity for
N-terminal amino acids compared to the parent polypeptide used to
generate the variant, such as wildtype CIpS. In one embodiment, the
probes show affinity for different N-terminal amino acids compared
to wildtype CIpS. In one embodiment, the probes comprise variant
CIpS polypeptides with one or more substitutions, insertion,
deletions or additions at residues that correspond to residues 12,
13, 14, 16, 17, 18, 21, 40, 43, 44, 76 and 77 as set forth in SEQ
ID NO: 1. In one embodiment, the probes comprise variant CIpS
polypeptides with one or more mutations at ligand specificity
pocket residues selected from residues that correspond to positions
17, 18, 21, 40, 43, 76 and 77 as set forth in SEQ ID NO: 1. In one
embodiment, the probes comprise variant CIpS polypeptides with one
or more mutations at alpha amino binding residues selected from
residues that correspond to positions 12, 13, 14, 16, 17, 44, and
76 as set forth in SEQ ID NO: 1. In one embodiment, the probe
comprises a variant of SEQ ID NO: 1, wherein residue positions 21
and 40 are cystein.
[0031] In one embodiment, there is provided a N-terminal amino acid
probe selective for tryptophan that comprises the following
polypeptide sequence (substitutions relative to SEQ ID NO: 1 shown
in underline):
TABLE-US-00002 (SEQ ID NO: 2)
KPPSMYKVILVNDDYTPAEFCIDVLQKFFSYDVERATQLCLAAHYQGKA
ICGVFTAEVAETKVAMVNKYARENEHAALCTLEKA
[0032] In one embodiment, the probe comprises a variant CIpS
polypeptide with at least 70%, 80%, 90%, or 95% sequence identity
to SEQ ID NO: 1 or to SEQ ID NO: 2.
[0033] In another aspect, the probes are directly or indirectly
labeled with a detectable label. In one embodiment, the probes are
indirectly labeled through conjugation of a glutathione transferase
(GST) domain and glutathione. In one embodiment, the probes are
directly labeled through covalent attachment of the detectable
label and the probe. In one embodiment, the detectable label is a
fluorescent label such as a FluoSphere.TM..
[0034] The one aspect, there is also provided a cloned DNA sequence
encoding a polypeptide that selectively binds an N-terminal amino
acid enzyme. In one embodiment, the cloned DNA sequence encodes a
polypeptide with the sequence set forth in SEQ ID NO: 1 or SED ID
NO: 2.
[0035] In one aspect, there is provided a method for producing
polypeptides that selectively bind N-terminal amino acids. In one
embodiment, the method comprises generating a plurality of variant
polypeptides, expressing the polypeptides using phage display and
selecting for variants that selectively bind to one or more
N-terminal amino acids. In one embodiment, the variant polypeptides
comprise variant CIpS polypeptides. In one embodiment, the variants
are selected under competitive conditions. In one embodiment, the
method produces polypeptides that selectively bind a target
N-terminal amino acid and the competitive conditions include the
presence of peptides with N-terminal amino acids others than the
target N-terminal amino acid.
[0036] Other features and advantages of the present invention will
become apparent from the following detailed description. It should
be understood, however, that the detailed description and the
specific examples while indicating preferred embodiments of the
invention are given by way of illustration only, since various
changes and modifications within the spirit and scope of the
invention will become apparent to those skilled in the art from the
detailed description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0037] Further features and advantages of the present invention
will become apparent from the following detailed description, taken
in combination with the appended drawings, in which:
[0038] FIG. 1 is a schematic showing one embodiment of a method for
sequencing polypeptides as described herein.
[0039] FIG. 2 illustrates one embodiment of N-terminal Edman
degradation of a single polypeptide.
[0040] FIG. 3 illustrates one embodiment of affixing a polypeptide
to a substrate using a polyethylene glycol (PEG) chemical
linker.
[0041] FIG. 4 shows sequence alignment of selected bacterial CIpS
proteins (SEQ ID NOS: 6-15) together with the type 2 binding region
(UBR box) from the homologous eukaryotic UBR1 and UBR2 proteins
(SEQ ID NOS: 16-21) (from Schuenemann et al. EMBO Reports, Vol. 10,
No. 5, 2009).
[0042] FIG. 5 shows directed evolution of engineered protein
domains for use in N-terminal amino acid probes using phage
display. Large combinatorial libraries, generated by targeted
Kunkel mutagenesis or by chemical gene synthesis, of domain
variants (.about.10.sup.10 unique individuals) can be displayed as
fusions to bacteriophage coat proteins, such that the sequence of
the displayed protein on a single phage particle is encoded by the
genome packaged within. This physical connection between phenotype
and genotype makes it possible to select a displayed variant based
on its binding properties, and then to obtain its sequence from the
encapsulated phage genome. Selections are performed by immobilizing
the ligand of interest to a solid support, allowing the library of
variants an opportunity to bind, and then washing away all phage
that fail to bind. The phage that do bind the ligand are retained,
and infected into bacteria in order to replicate. The same
selection procedure can then be repeated with the new subpopulation
of phage. After repeated rounds of selection, binders will
dominate, at which point individual clones can be isolated,
sequenced and subcloned for expression as recombinant proteins and
further biochemical characterization.
[0043] FIG. 6A shows the CIpS domain displayed on page with an
N-terminal FLAG tag. FIG. 6B shows the results of phage binding to
immobilized peptides or control peptides assessed using an enzyme
linked immunosorbent assay (ELISA). Selected peptide ligands during
were synthesized with C-terminal biotin-lysine residues. The
biotinylated peptides were immobilized on neutravidin-coated wells
of a microtiter plate by passive adsorption, alongside additional
control proteins. CIpS from E. coli binds two of the Leu-peptides
specifically, without cross reactivity to any of the negative
controls (bovine serum albumin, BSA; streptavidin, SA; neutravidin,
NA). The phage-displayed Fabs are also FLAGtagged and serve as
negative controls for non-specific binding to the immobilized
peptides. FIG. 6C shows the recombinant phage coat protein
comprising the ST2 secretion signal, the flag tab, the truncated
wild type CIpS polypeptide and gene 3 (SEQ ID NO: 3) used in the
phage display experiments as set out in Example 4.
[0044] FIG. 7 shows the relative positions of the key residues hard
randomized for the CIpS (SEQ ID NO: 22) phage display libraries for
sidechain specificity (FIG. 7A) and alpha-amino binding (FIG. 7B).
FIG. 7A: Sidechain specificity is dictated by the shape and
chemical composition of the hydrophobic pocket, mediated by
sidechains of the highlighted residues. Highlighted residues were
chosen for randomization based on analysis of the CIpS structure
and available data; their sidechains contribute to the hydrophobic
pocket either directly or by influencing the orientation of direct
contacts (i.e. two proline residues). FIG. 7B: alpha-amino
recognition depends on a network of hydrogen bonds mediated by the
residues shown at positions 34, 35, 36, 38 and 66, through a
combination of sidechain and main chain interactions. The two
proline residues shown at positions 39 and 98 influence the
orientation of these critical residues as well.
[0045] FIG. 8 shows that CIpS (SEQ ID NO: 22) is structurally
tolerant of diverse residues at key specificity mediating
positions. Protease-resistant, likely well-folded variants, were
selected from each library using an immobilized anti-FLAG antibody.
The distribution of residues at each randomized position in each
set of structure-selected CIpS variants is shown as a frequency
logo. FIG. 8A: Positions in the sidechain specificity pocket are
surprisingly structurally tolerant to a wide variety of
substitutions. The exclusively hydrophobic residues in the wildtype
domain can also be substituted with polar or charged residues. FIG.
8B: Alpha-amino recognition residues are also quite structurally
tolerant to substitution. The set of structurally-tolerated
residues at each of these positions informs subsequent library
design, and provides a useful basis for comparison for residue
frequencies observed in function-selected variants.
[0046] FIG. 9 shows an indirect labeling methodology for optical
detection of recombinant probes. FIG. 9A: FluoSpheres (FS)
functionalized with glutathione (GSH) bind the GST domain of the
recombinant CIpS proteins. Each population of CIpS protein can be
tagged with its own colour label in a simple one-step process that
requires no chemical modification. FIG. 9B: Bioconjugation scheme
to adsorb GSH onto FluoSphere surface in a manner that does not
inhibit GST binding. FS surface, initially containing carboxylic
acid, is first reacted with ethylene diamine to provide amine
groups on the FluoSphere surface, which are further used to react
with Sulfo-LC-SPDP. Reaction with Sulfo-LCSPDP leaves a thiol
reactive end, which reacts with GSH upon mixing.
[0047] FIG. 10 shows a direct chemical labeling methodology for
optical detection of recombinant probes by tagging CIpS proteins or
other affinity capture reagents comprising polypeptides with
fluorescent labels using an EDC linker. Amines of CIpS proteins are
covalently conjugated to carboxylic acids on FluoSpheres through
EDC-catalyzed reaction. This labeling approach does not require GSH
functionalization of FluoSpheres, but the location of the reacting
amine cannot be controlled.
[0048] FIG. 11 shows the optical detection of preferential ligand
binding by labeled CIpS probes. FIG. 11A: Immobilized peptide
binding signal obtained with immobilized peptides probed using CIpS
covalently attached to fluospheres using EDC linker. FIG. 11B:
Binding signal produced with Fluospheres attached to probe using
indirect non-covalent GST-GSH interaction. Both labeled probes show
a fluorescent signal indicating preferential binding to the target
Leucine N-terminal amino acid.
[0049] FIG. 12 shows the sequence of CIpS variant 1 that binds
N-terminal tryptophan residues selectively. FIG. 12 A: Sequence of
the wildtype CIpS domain from E. coli that recognizes N-terminal F,
L, Y and W residues (SEQ ID NO: 1) (top) and the engineered variant
that binds N-terminal W residues selectively (SEQ ID NO: 2)
(bottom) with key residues highlighted. FIG. 12B: structure of
wildtype CIpS in complex with Lpep (PDB: 2W9R) with diversified
residues in the displayed library shown as highlighted. FIG. 12C:
Key residues in the novel CIpS variant W1 are indicated on the
wildtype structure.
[0050] FIG. 13 shows results from competitive phage ELISA
demonstrating that only Wpep is an effective competitor for binding
CIpS Variant 1. Error bars represent 95% confidence intervals
(n=2).
DETAILED DESCRIPTION OF THE INVENTION
[0051] The present description provides methods, assays and
reagents useful for sequencing proteins. In one aspect, the methods
are useful for sequencing single polypeptide molecules or multiple
molecules of a single polypeptide. In one aspect, the methods and
reagents are useful for determining the N-terminal amino acid of a
polypeptide. In one aspect, the methods are useful for the
simultaneous sequencing of a plurality of single polypeptide
molecules, such as for the basis of massively parallel sequencing
techniques. Accordingly samples comprising a mixture of different
proteins can be assayed according to the methods described herein
to generate sequence information regarding individual protein
molecules in the sample. In a further aspect, the methods are
useful for protein expression profiling in complex samples. For
example, the methods are useful for generating both quantitative
(frequency) and qualitative (sequence) data for proteins contained
in a sample.
[0052] In a further aspect, the description provides reagents such
as N-terminal amino acid affinity capture reagents and probes
comprising N-terminal amino acid affinity capture reagents suitable
for practicing the methods described herein. In one embodiment,
probes are variant CIpS polypeptides generated as set forth in
Example 4. In one embodiment, the probes comprise readily
detectable labels, such as fluorescent dyes.
[0053] The inventors have determined that probes specific for an
N-terminal amino acid of a polypeptide, or specific for a
derivative of a N-terminal amino acid of a polypeptide, can be used
to generate sequence information by sequentially identifying and
then cleaving the N-terminal amino acids of a polypeptide. The
inventors have also determined that by first affixing the
polypeptide molecule to a substrate, it is possible to determine
the sequence of that immobilized polypeptide by iteratively
detecting which probes are bound to the polypeptide at that same
location on the substrate. Each probe may contain one or more
detectable label(s) that facilitates the identification of specific
probes.
[0054] Accordingly, in one embodiment there is provided a method of
sequencing a polypeptide comprising: [0055] a) affixing the
polypeptide to a substrate; [0056] b) contacting the polypeptide
with a plurality of probes, wherein each probe selectively binds to
an N-terminal amino acid or a N-terminal amino acid derivative;
[0057] c) detecting the probe bound to the polypeptide molecule,
thereby identifying the N-terminal amino acid of the polypeptide;
[0058] d) cleaving the N-terminal amino acid or N-terminal amino
acid derivative of the polypeptide; and [0059] e) repeating steps
(b) to (d) to determine the sequence of at least a portion of the
polypeptide.
[0060] Optionally, step a) comprises affixing a plurality of
polypeptides with the same sequence to the substrate and step c)
comprises detecting a plurality of probes. In one embodiment, the
polypeptide comprises a single polypeptide molecule and step c)
comprises detecting a single probe bound to the polypeptide
molecule.
[0061] In another embodiment, there is provided a method of
sequencing a plurality of polypeptide molecules in a sample
comprising: [0062] a) affixing the polypeptide molecules in the
sample to a plurality of spatially resolved attachment points on a
substrate; [0063] b) contacting the polypeptides with a plurality
of probes, wherein each probe selectively binds to an N-terminal
amino acid or a N-terminal amino acid derivative; [0064] c) for a
plurality of polypeptide molecules that are spatially resolved and
affixed to the substrate, detecting the probe bound to each
polypeptide; [0065] d) cleaving the N-terminal amino acid or
N-terminal amino acid derivative of each of the polypeptides; and
[0066] e) repeating steps b) to d) to determine the sequence of at
least a portion of one or more of the plurality of polypeptide
molecules that are spatially resolved and affixed to the
substrate.
[0067] As used herein, "polypeptide" refers to two or more amino
acids linked together by a peptide bond. The term "polypeptide"
includes proteins that have a C-terminal end and an N-terminal end
as generally known in the art and may be synthetic in origin or
naturally occurring. As used herein "at least a portion of the
polypeptide" refers to 2 or more amino acids of the polypeptide.
Optionally, a portion of the polypeptide includes at least: 5, 10,
20, 30 or 50 amino acids, either consecutive or with gaps, of the
complete amino acid sequence of the polypeptide, or the full amino
acid sequence of the polypeptide.
[0068] As used herein the phrase "selectively binds to an
N-terminal amino acid or a N-terminal amino acid derivative" refers
to a probe with a greater affinity for one or more target
N-terminal amino acids or for one or more N-terminal amino acid
derivatives compared to other N-terminal amino acids or N-terminal
amino acid derivatives. A probe selectively binds a target
N-terminal amino acid or N-terminal amino acid derivatives if there
is a detectable relative increase in the binding of the probe to a
target N-terminal amino acid or N-terminal amino acid. For example,
as shown in Example 4 and Table 2 the CIpS Variant 1 polypeptide
selectively binds tryptophan N-terminal amino acids and the CIpS
Variant 2 selectively binds arginine and leucine N-terminal amino
acids. Optionally, a probe that is selective is specific for a
single N-terminal amino acid or N-terminal amino acid derivative.
Optionally, a probe that is selective for a N-terminal amino acid
or N-terminal amino acid derivative has at least 25%, 50%, 100%,
200%, or greater than 200% more affinity for a target N-terminal
amino acid or N-terminal amino acid derivative compared to a
non-target N-terminal amino acid or N-terminal amino acid
derivative. In one embodiment, the probes selectively bind the
N-terminal amino acid or N-terminal amino acid derivative with an
IC50 of at least 10 micromolar.
[0069] The phrase "N-terminal amino acid" refers to an amino acid
that has a free amine group and is only linked to one other amino
acid by a peptide bond in the polypeptide. The phrase "N-terminal
amino acid derivative" refers to an N-terminal amino acid residue
that has been chemically modified, for example by an Edman reagent
or other chemical in vitro or inside a cell via a natural
post-translational modification (e.g. phosphorylation)
mechanism.
[0070] As used herein, "sequencing a polypeptide" refers to
determining the amino acid sequence of a polypeptide. The term also
refers to determining the sequence of a segment of a polypeptide or
determining partial sequence information for a polypeptide.
[0071] As used herein, "affixed" refers to a connection between a
polypeptide and a substrate such that at least a portion of the
polypeptide and the substrate are held in physical proximity. The
term "affixed" encompasses both an indirect or direct connection
and may be reversible or irreversible, for example the connection
is optionally a covalent bond or a non-covalent bond.
[0072] As used herein "the cleaving the N-terminal amino acid or
N-terminal amino acid derivative of the polypeptide" refers to a
chemical reaction whereby the N-terminal amino acid or N-terminal
amino acid derivative is removed from the polypeptide while the
remainder of the polypeptide remains affixed to the substrate.
[0073] As used herein the term "sample" includes any material that
contains one or more polypeptides. Samples may be biological
samples, such as biopsies, blood, plasma, organs, organelles, cell
extracts, secretions, urine or mucous, tissue extracts and other
biological samples of fluids both natural or synthetic in origin.
The term sample also includes single cells. The sample may be
derived from a cell, tissue, organism or individual that has been
exposed to an analyte (such as a drug), or subject to an
environmental condition, genetic perturbation, or combination
thereof. The organisms or individuals may include, but are not
limited to, mammals such as humans or small animals (rats and mice
for example).
[0074] As used herein, the term "spatially resolved" refers to an
arrangement of two or more polypeptides on a substrate wherein
chemical or physical events occurring at one polypeptide can be
distinguished from those occurring at the second polypeptide. For
example, two polypeptides affixed on a substrate are spatially
resolved if a signal from a detectable label bound to one of the
polypeptides can be unambiguously assigned to one of the
polypeptides at a specific location on the substrate.
Substrate Materials
[0075] In one embodiment, polypeptides to be sequenced are affixed
to a substrate. In some embodiments, the substrate is made of a
material such as glass, quartz, silica, plastics, metals,
composites, or combinations thereof. In one embodiment, the
substrate is a flat planar surface. In another embodiment, the
substrate is 3-dimensional and exhibits surface features. In some
embodiments, the substrate is a chemically derivatized glass slide
or silica wafer.
[0076] In one embodiment, the substrate is made from material that
does not substantially affect the sequencing reagents and assays
described herein. In one embodiment, the substrate is resistant to
the basic and acidic pH, chemicals and buffers used for Edman
degradation. The substrate may also be covered with a coating. In
some embodiments, the coating is resistant to the chemical
reactions and conditions used in Edman degradation. In some
embodiments, the coating provides attachment points for affixing
polypeptides to the substrate, and/or repelling non-specific probe
adsorption.
[0077] In some embodiments, the surface of the substrate is
resistant to the non-specific adhering of polypeptides or debris,
so as to minimize background signals when detecting the probes.
[0078] In one embodiment, the substrate made of a material that is
optically transparent. As used herein, "optically transparent"
refers to a material that allows light to pass through the
material. In one embodiment, the substrate is minimally-or
non-autofluorescent.
[0079] Optionally, the substrate is embedded in a microfluidic
device. In one embodiment, the microfluidic device is able to
direct the reagents described herein to the surface of the
substrate. In another embodiment, multiple substrates are embedded
in a microfluidic device.
Affixing Polypeptides to the Substrate
[0080] In one embodiment, the polypeptides are affixed to the
substrate. Preferably, the polypeptides are affixed to the
substrate such that the N-terminal end of the polypeptide is free
to allow the binding of N-terminal amino acid probes. Accordingly,
in some embodiments the polypeptide is affixed to the substrate
through the C-terminal end of the polypeptide, the C-terminal
carboxylic acid group or a side chain function group of the
polypeptide. In some embodiments, the substrate contains one or
more attachment points that permit a polypeptide to be affixed to
the substrate.
[0081] In some embodiments, the polypeptide is affixed through a
covalent bond to the substrate. For example, the surface of the
substrate may contain a polyethylene glycol (PEG) or
carbohydrate-based coating and the polypeptides are affixed to the
substrate via an N-hydroxysuccinimide (NHS) ester PEG linker.
[0082] FIG. 3 shows one example of a polypeptide linked to a
substrate through a PEG-based molecular linker tethered to the
surface. A number of different chemistries for attaching linkers
and polypeptides to a substrate are known in the art, for example
by the use of specialized coatings that include aldehydesilane,
epoxysilane or other controlled reactive moieties. In one
embodiment, the substrate is glass coated with Silane or related
reagent and the polypeptide is affixed to the substrate through a
Schiff's base linkage through an exposed lysine residue.
[0083] In some embodiments the polypeptide is affixed
non-covalently to the substrate. For example, in one embodiment the
C-terminal end of the polypeptide is conjugated with biotin and the
substrate comprises avidin or related molecules. As shown in
Example 4, peptides may be biotinylated and readily attached to a
neutravidin substrate and subsequently contacted with N-terminal
amino acid probes that bind to the peptides. In another embodiment,
the C-terminal end of a polypeptide is conjugated to an antigen
that binds to an antibody or related affinity capture reagent on
the surface of the substrate. Additional coupling agents suitable
for affixing a polypeptide to a substrate have been described in
the art (See for example, Athena L. Guo and X. Y. Zhu. The Critical
Role of Surface Chemistry In Protein Microarrays in Functional
Protein Microarrays in Drug Discovery)
Pre-Treatment of the Polypeptide
[0084] In one embodiment, the polypeptide or a sample containing
one or more polypeptides is pre-treated prior to being affixed on
the substrate. For example, the sample may be concentrated and
purified to remove contaminating materials, such as by HPLC or
nuclease treatment. In another embodiment, the sample may be
treated with a protease or peptidase, which cleaves the polypeptide
at a specific residue. In one embodiment, the polypeptides are
tryptic peptides that are coupled via C-terminal lysine (or
arginine) residues, such that the last residue of the polypeptide
sequenced is inferred to be K (lysine) or R (arginine).
Washing the Substrate
[0085] Optionally, after the polypeptides are affixed to the
substrate, the substrate is washed in order to remove any debris
such as unbound probe, nucleic acids or other molecules that are
not affixed to the substrate that contribute to generating signal
noise that interference with the sequencing of specific polypeptide
molecules.
[0086] In another embodiment, the substrate is treated in order to
chemically block any unused attachment points on the surface of the
substrate that could result in non-specific binding of probes to
the substrate.
N-terminal Amino Acid Probes
[0087] In one aspect of the description, there are provided probes
that selectively bind to an N-terminal amino acid or a N-terminal
amino acid derivative. In one embodiment, probes that selectively
bind to an N-terminal amino acid or an N-terminal amino acid
derivative are used to sequence a polypeptide. In some embodiments,
the probes are detectable with single molecule sensitivity.
[0088] In some embodiments, a probe selectively binds more than one
pre-determined N-terminal amino acid. Probes that selectively bind
more than one N-terminal amino acid may also be used to determine
partial sequence information for a polypeptide.
[0089] In one embodiment, the probes include 20 probes that each
selectively bind to one of the 20 natural proteinogenic amino
acids. In another embodiment, the probes include 20 probes that
each selectively bind to a derivative of one of the 20 natural
proteinogenic amino acids. In one embodiment, the derivatives are
phenylthiocarbamyl derivatives. In a further embodiment, the probes
include probes that selectively bind to
post-translationally-modified amino acids or their derivatives.
Probes and Affinity Capture Reagents
[0090] In one embodiment, the probes comprise an affinity capture
reagent. Affinity capture reagents useful for the methods described
herein bind to N-terminal amino acids or their derivatives.
[0091] In one embodiment, the affinity capture reagent is a natural
or synthetic antibody or antibody fragment, or derivative thereof.
For example, antibodies that bind to specific amino acid are known
in the art and are available commercially from Millipore
Corporation (Billerica, Mass.).
[0092] In one embodiment, affinity capture reagents and/or
analogous N-terminal binding proteins are engineered using phage
display (i.e. experimentally via empirical selection) or through
rational protein design (i.e. computationally using structural
biology concepts/programs, like docking predictions to optimize
protein/amino acid ligand interface residues to confer N-terminal
residue binding specificity and/or adapt the binding to Edman or
other forms of modified N-terminal amino acid residues.
[0093] In one embodiment, the probe comprises a variant of a
polypeptide wherein the variant binds to an N-terminal amino acid
or a N-terminal amino acid derivative with a different selectivity
than the polypeptide. As used herein the term "variant" refers to a
polypeptide that has one or more substitutions, additions or
deletions compared to a reference non-variant polypeptide sequence
such as a naturally occurring polypeptide. For example, SEQ ID NO:
2 is a variant of the E. Coli CIpS polypeptide as set forth in SEQ
ID NO: 1. As used herein, a variant polypeptide has a "different
selectivity" than a polypeptide if has a greater affinity for one
or more N-terminal amino acids or N-terminal amino acid derivatives
than the non-variant polypeptide, or if it exhibits an binding
affinity for one or more N-terminal amino acids or a N-terminal
amino acid derivatives not seen in the non-variant polypeptide.
[0094] In one embodiment, the affinity capture reagent comprises a
member of the UBR box recognition sequence family, or a variant of
the UBR box recognition sequence family. UBR recognition boxes are
described in Tasaki et al. (Journal of Biological Chemistry, Vol.
284, No. 3 pp. 1884-1895 Jan. 16, 2009). Sequence identity between
bacterial CIpS proteins and UBR1 and UBR2 is show in FIG. 4.
[0095] In a further embodiment, the affinity capture reagent is a
member of the evolutionarily conserved CIpS family of adaptor
proteins involved in natural N-terminal protein recognition and
binding or a variant thereof. The CIpS family of adaptor proteins
in bacteria are described in Schuenemann et al. (Structural basis
of N-end rule substrate recognition in Escherichia coli by the
CIpAP adaptor protein CIpS. EMBO reports Vol. 10, No. 5, 2009),
and, Roman-Hernandez et al. (Molecular basis of substrate selection
by the N-end rule adaptor protein CIpS. PNAS Jun. 2, 2009 vol. 106
no. 22 p. 8888-8893). In some embodiments, the amino acid residues
corresponding to the CIpS hydrophobic binding pocket identified in
Schuenemann et al. are modified in order to generate affinity
capture reagents with the desired selectivity. In one embodiment,
the CIpS sequences shown in FIG. 4 are modified such as Met40 or
Met62 are modified to generate novel affinity capture reagents.
[0096] As shown in Examples 1 and 4, CIpS adaptor proteins may be
modified in order to selectively bind specific N-terminal amino
acids or N-terminal amino acid derivatives. For example, selective
N-terminal amino acid probes may be generated by creating variants
of the E. Coli CIpS polypeptide as set forth in SEQ ID NO: 1, or of
the variant Trp-binding polypeptide as set forth in SEQ ID NO: 2.
Other CIpS polypeptides, such as those isolated from different
species, may also be modified as described herein to generate
N-terminal amino acid binding peptides.
[0097] In one embodiment, the variant CIpS polypeptides comprises
one or more substitutions, deletions or additions at positions that
correspond to residues 12, 13, 14, 16, 17, 18, 21, 40, 43, 44, 76
and 77 as set forth in SEQ ID NO: 1. In one embodiment, the
N-terminal amino acid probe comprises a variant CIpS polypeptide
with cystein residues at positions 21 and 40 as set forth in SEQ ID
NO: 1. Variant CIpS polypeptides with cystein residues at positions
that correspond to residues 21 and 40 as set forth in SEQ ID NO: 1
are believed to form a disulfide bridge, thereby increasing the
stability of the variant polypeptide.
[0098] As used herein a residue position in one sequence
"corresponds to" a residue position in another polypeptide sequence
if it exists in an equivalent position in the polypeptide sequence,
as indicated by primary sequence homology, tertiary structural
homology (as shown by, e.g., crystal structure or computer
modeling) or functional equivalence. In one embodiment, sequence
alignment between two or more CIpS sequences is used to determine
sequence corresponding residues. For example, CIpS polypeptide
sequences isolated from different species can be aligned to
identify residues that correspond to the same position as shown in
FIG. 4.
[0099] As shown in Example 4 and Table 2, CIpS Variant 1 (SEQ ID
NO: 2) gave a strong signal and selectively binds polypeptides with
the N-terminal amino acid tryptophan. In one embodiment the probes
comprise variants of the polypeptide sequence set forth in SEQ ID
NO: 2. In one embodiment, the variants comprise mutations of the
amino acid residues that form the specificity binding pocket or
alpha-amino binding residues of the CIpS protein.
[0100] In one embodiment, the probes comprise polypeptides with at
least 70%, 80%, 90% or 95% sequence identity to SEQ ID 1 or SEQ ID
NO: 2. As used herein, "sequence identity" refers to the similarity
of two polypeptide sequences that are aligned so that the highest
order match is obtained. Sequence Identity is calculated according
to methods known in the art. For example, polypeptide sequence
identity may be calculated using computer programs to determine
identity between two sequences. Representative computer programs
include, but are not limited to, the GCG program package, FASTA,
BLASTP, and TBLASTN (see, e.g., D. W. Mount, 2001, Bioinformatics:
Sequence and Genome Analysis, Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, N.Y.). The BLASTP and TBLASTN programs are
publicly available from NCBI and other sources. The Smith Waterman
algorithm may also be used to determine percentage sequence
identity.
[0101] Exemplary parameters for determining polypeptide sequence
identity include the following: 1) algorithm from Needleman and
Wunsch (J. Mol. Biol., 48:443-453 (1970)); 2) BLOSSUM62 comparison
matrix from Hentikoff and Hentikoff (Proc. Natl. Acad. Sci. U.S.A.,
89:10915-10919 (1992)) 3) gap penalty=12; and 4) gap length
penalty=4. A program useful with these parameters is publicly
available as the "gap" program (Genetics Computer Group, Madison,
Wis.). The aforementioned parameters are the default parameters for
polypeptide comparisons (with no penalty for end gaps).
[0102] Alternatively, polypeptide sequence identity can be
calculated using the following equation: % sequence identity=(the
number of identical residues)/(alignment length in amino acid
residues)*100. For this calculation, alignment length includes
internal gaps but does not include terminal gaps.
[0103] Additional examples of suitable affinity capture reagents
include CIpS family related members present in non-bacterial
species, including human, or synthetic constructs developed using
principled computational modeling procedures or selected through
combinatorial genetic mutagenesis methods.
[0104] In another embodiment, affinity capture reagents suitable
for use in the probes described herein are based on structured RNA
molecules. In one embodiment, the affinity capture reagents are
aptamers derived by generating/screening randomized nucleic acid
libraries.
[0105] In one aspect, the probes and affinity capture reagents
exhibit high target selectivity and bind to a limited number
N-terminal amino acids of their derivatives, or preferably only a
single N-terminal amino acid or its derivative. In another aspect,
the affinity capture reagents are specific and exhibit a big
differential in target to non-target binding/affinity. Additional
properties of preferred affinity capture reagents include fast "on"
(association) kinetic binding rates, slow "off" (dissociation)
rates, and limited non-specific absorption. In one embodiment, the
probes and affinity capture reagents exhibit good stability in
solution at different buffers/pHs (e.g. stay folded), a long-shelf
life, do not require freezing. In one embodiment, the probes and/or
affinity capture reagents and can be dried and resolubilized
without a significant loss in activity. In one embodiment, the
affinity capture reagents are included in a kit for practicing the
methods described herein. In another embodiment, the affinity
capture reagents are readily synthesized and exhibit a good yield
in recombinant or synthetic form. In another embodiment, the
affinity capture reagents exhibit good tractability in terms of
genetic selection and screening procedures (e.g. subjected to
mutagenesis, protein engineering, or phage display, followed by in
vitro binding assay robustness and reproducibility.
Detectable Labels
[0106] In another aspect of the description, the probes include
detectable labels. Detectable labels suitable for use with the
present invention include, but are not limited to, labels that can
be detected as a single molecule.
[0107] In one embodiment, the probes are detected by contacting the
probe with a probe-specific antibody and the probe-specific
antibody is then detected.
[0108] In some embodiments, the probes or labels are detected using
magnetic or electrical impulses or signals.
[0109] In one embodiment, the labels are optically detectable, such
as labels comprising a fluorescent moiety. Examples of optically
detectable labels include, but are not limited to fluorescent dyes
including polystyrene shells encompassing core dyes such as
FluoSpheres.TM., Nile Red, fluorescein, rhodamine, derivatized
rhodamine dyes, such as TAMRA, phosphor, polymethadine dye,
fluorescent phosphoramidite, TEXAS RED, green fluorescent protein,
acridine, cyanine, cyanine 5 dye, cyanine 3 dye,
5-(2'-aminoethyl)-aminonaphthalene-1-sulfonic acid (EDANS), BODIPY,
120 ALEXA or a derivative or modification of any of the foregoing.
Additional detectable labels include color-coded nanoparticles, or
quantum dots or FluoSpheres.TM.. In one embodiment, the detectable
label is resistant to photobleaching while producing lots of signal
(such as photons) at a unique and easily detectable wavelength,
with high signal-to-noise ratio.
[0110] One or more detectable labels can be conjugated to the
affinity capture reagents described herein using techniques known
to a person of skill in the art. In one embodiment, a specific
detectable label (or combination of labels) is conjugated to a
corresponding affinity capture reagent thereby allowing the
identification of the affinity capture reagent by means of
detecting the label(s).
[0111] For example, one or more detectable labels can be conjugated
to the affinity capture reagents described herein either directly
or indirectly as shown in Example 5 and FIGS. 9 and 10.
Detecting Probes Bound to the Polypeptides
[0112] In still another aspect of the invention, probes bound to a
polypeptide affixed to the substrate are detected, thereby
identifying the N-terminal amino acid of the polypeptide. As shown
in Example 5, probes comprising a CIpS polypeptide domain can be
fluorescently labeled and used to discriminate between N-terminal
amino acid residues and generate sequence information.
[0113] In one embodiment, the probe is identified by detecting a
detectable label (or combination of labels) conjugated to the
probe. Methods suitable for detecting the probes described herein
therefore depend on the nature of the detectable label(s) used in
the method.
[0114] In one embodiment, the probes or labels bound to a
polypeptide affixed to a substrate are repeatedly detected at that
location using a high resolution rastering laser/scanner across a
pre-determined grid, unique position or path on a substrate. These
methods are useful for the accurate and repeated detection of
signals at the same spatially resolved coordinates during each
sequencing cycle of the methods described herein. In some
embodiments, the polypeptides are randomly affixed to the substrate
and the detection of probes proceeds by repeatedly scanning the
substrate to identify the co-ordinates and identities of probes
bound to polypeptides affixed to the substrate.
[0115] In one embodiment, the detecting the probes includes
ultrasensitive detection systems that are able to repeatedly detect
signals from precisely the same co-ordinates on a substrate,
thereby assigning the detected sequence information to a unique
polypeptide molecule affixed at that co-ordinate.
[0116] In one embodiment, the probes are detected using an optical
detection system. Optical detection systems include a
charge-coupled device (CCD), near-field scanning microscopy,
far-field confocal microscopy, wide-field epi-illumination, light
scattering, dark field microscopy, photoconversion, single and/or
multiphoton excitation, spectral wavelength discrimination,
fluorophore identification, evanescent wave illumination, total
internal reflection fluorescence (TIRF) microscopy,
super-resolution fluorescence microscopy, and single-molecule
localization microscopy. In general, methods involve detection of
laser-activated fluorescence using a microscope equipped with a
camera, sometimes referred to as high-efficiency photon detection
system. Suitable photon detection systems include, but are not
limited to, photodiodes and intensified CCD cameras.
[0117] In one embodiment, examples of techniques suitable for
single molecule detection of fluorescent probes include confocal
laser (scanning) microscopy, wide-field microscopy, near-field
microscopy, fluorescence lifetime imaging microscopy, fluorescence
correlation spectroscopy, fluorescence intensity distribution
analysis, measuring brightness changes induced by
quenching/dequenching of fluorescence, or fluorescence energy
transfer.
Cleaving the N-terminal Amino Acid
[0118] In a further aspect of the description, the N-terminal amino
acid of the polypeptide is cleaved. Cleaving exposes the N-terminus
of an adjacent amino acid on the polypeptide, whereby the adjacent
amino acid is available for reaction with a probe selective for
that amino acid. Optionally, the polypeptide is sequentially
cleaved until the last amino acid in the polypeptide (C-terminal
amino acid). In some embodiments, the C-terminal amino acid is
covalently affixed to the substrate and is not cleaved from the
substrate.
[0119] In one embodiment, sequential Edman degradation is used to
cleave the N-terminal amino acid of the polypeptide. Edman
degradation generally comprises two steps, a coupling step and a
cleaving step. These steps may be iteratively repeated, each time
removing the exposed N-terminal amino acid residue of a
polypeptide. As shown in FIG. 2, in one embodiment Edman
degradation proceeds by way of contacting the polypeptide with a
suitable Edman reagent such as PITC or a PITC analogue at an
elevated pH to form a N-terminal phenylthiocarbamyl derivative.
Reducing the pH, such by the addition of trifluoroacetic acid
results in the cleaving the N-terminal amino acid
phenylthiocarbamyl derivative from the polypeptide to form a free
anilinothiozolinone (ATZ) derivative. Optionally, this ATZ
derivative may be detected, or in another embodiment it may then be
washed away from the substrate. In one embodiment the pH of the
substrate's environment in controlled in order to control the
reactions governing the coupling and cleaving steps.
[0120] In some embodiments, the N-terminal amino acid is contacted
with a suitable Edman reagent such as PITC or a PITC analogue at an
elevated pH prior to contacting the affixed polypeptide with a
plurality of probes that selectively bind the N-terminal amino acid
derivative. Optionally, the cleaving step comprises reducing the pH
in order to cleave the N-terminal amino acid derivative.
[0121] In some embodiments, a probe bound to the N-terminal amino
acid or its derivative of a polypeptide is removed prior to
cleaving the residue.
[0122] In one embodiment, the steps of contacting the polypeptide
with a plurality of probes, detecting the probe bound to the
polypeptide and cleaving the N-terminal amino acid or N-terminal
amino acid derivative are repeated in order to sequence the
polypeptide. Optionally, the steps are repeated at least 2, 5, 10,
20, 30, 50, or greater than 50 times in order to sequence part of
or the complete polypeptide. Optionally at least: 5, 10, 20 30 or
50 contiguous or discontiguous amino acid residues of the amino
acid sequence of the polypeptide or the full amino acid sequence of
the polypeptide are determined.
[0123] In one embodiment, the method includes washing or rinsing
the substrate before or after any one of the steps of affixing the
substrate, contacting the polypeptide with a plurality of probes,
detecting the probe bound to the polypeptide and cleaving the
N-terminal amino acid or N-terminal amino acid derivative. Washing
or rinsing the substrate removes waste products such as cleaved
N-terminal amino acids, debris or previously unused reagents from
the substrate that could interfere with the next step in the
sequencing assay.
Parallel Sequencing
[0124] The methods described herein allow for the sequencing of
very large number of polypeptide molecules on a single substrate or
on a series of substrates. Accordingly, one aspect of the invention
provides for simultaneously sequencing a plurality of affixed
polypeptide molecules initially present in a sample. In one
embodiment, the sample comprises a cell extract or tissue extract.
In some embodiments, the methods described herein may be used to
analyze the polypeptides contained in a single cell. In a further
embodiment, the sample may comprise a biological fluid such as
blood, urine or mucous. Soil, water or other environmental samples
bearing mixed organism communities are also suitable for
analysis.
[0125] In one embodiment of the description, the method includes
comparing the sequence of each polypeptide molecule to a reference
protein sequence database. In some embodiments, small fragments
comprising 10-20 or fewer sequenced amino acid residues may be
useful for detecting the identity of a polypeptide in a sample.
[0126] In one embodiment, the method includes de novo sequencing of
polypeptides in order to generate sequence information about the
polypeptide. In another embodiment, the method includes determining
a partial sequence or an amino acid pattern and then matching the
partial sequence or amino acid patterns with reference sequences or
patterns contained in a sequence database.
[0127] In one embodiment, the method includes using the sequence
data generated by the method as a molecular fingerprint or in other
bioinformatic procedures to identify characteristics of the sample,
such as tissue type or organismal identity.
[0128] In addition, as each polypeptide affixed to the substrate is
optionally monitored individually, the method is useful for the
quantitative analysis of protein expression. For example, in some
embodiments, the method comprises comparing the sequences of each
polypeptide, grouping similar polypeptide sequences and counting
the number of instances of each similar polypeptide sequence. The
methods described herein are therefore useful for molecular
counting or for quantifying the number of polypeptides in a sample
or specific kinds of polypeptides in a sample.
[0129] In a further embodiment, cross-linked polypeptides or
proteins are sequenced using the methods described herein. For
example, a cross-linked protein may be affixed to a substrate and
two or more N-terminal amino acids are then probed and sequenced.
The overlapping signals that are detected correspond to probes each
binding the two or more N-terminal amino acids at that location. In
one embodiment, it is possible to deduce or deconvolute the two
multiplexed/mixed sequences via a computational algorithm and DB
search.
[0130] In a further embodiment, the methods described herein are
useful for the analysis and sequencing of phosphopeptides. For
example, polypeptides in a sample comprising phosphopeptides are
affixed to the surface of the substrate via metal-chelate
chemistry. The phosphopolypeptides are then sequenced according to
the methods described herein, thereby providing sequence and
quantitative information on the phosphoproteome.
[0131] The following examples illustrate embodiments of the
invention and are not intended to limit the scope of the
invention.
Example 1
Affinity Capture Reagents Based on the CIpS Adaptor Protein
Scaffold
[0132] Phage display and combinatorial site-directed mutagenesis is
used to identify variants of the natural N-terminal amino acid
binding pocket or structural domain of the CIpS adaptor protein
family that selectively bind N-terminal amino acids. Structural
modeling of the binding pocket and protein engineering are used to
further define modified variants of CIpS family members that are
suitable for use with the methods described herein.
Results
[0133] Modified CIpS adaptor proteins are selected using screening
procedures familiar to those trained in the art. Affinity capture
reagents are subsequently identified that exhibit high
affinity/selectivity by phage display to N-terminal amino
acids.
Example 2
Single Molecule Sequencing of a Synthetic Polypeptide
[0134] An artificial test polypeptide comprising of the
heptapeptide amino acid sequence TyrPheArgTyrPheArgLys (SEQ ID NO:
5) is synthesized. The polypeptide is affixed to a substrate via
its C-terminal amino acid carboxy group or the lysine side chain.
The substrate is then washed in order to remove any debris. Probes
containing an N-terminal affinity capture reagent identified as
shown in Example 1 are coupled to a fluorescent moiety. The probes
are then added to the substrate under conditions that encourage the
binding of the probes to polypeptide. The substrate is then washed
to remove any non-specifically bound probes. The probe bound to a
single affixed polypeptide is then detected using an optical
detection system. The identity of the probe bound to the
polypeptide is recorded and the N-terminal amino acid of the
polypeptide is cleaved via Edman degradation. Additional rounds of
probes are then added to the substrate in order to detect and
record the next N-terminal amino acid in the polypeptide prior to
cleaving the N-terminal amino acid.
Results
[0135] The sequential detection of the probes during each round of
sequencing corresponds to the sequence of the artificial
polypeptide from the N-terminus to the C-terminus
TyrPheArgTyrPheArgLys (SEQ ID NO: 5).
Example 3
Validation of Assay Conditions and Protocols
[0136] Variants of CIpS are derived via structural modeling,
docking, combinatorial site-directed mutagenesis, and/or the
experimental selection of high affinity and high specificity
binders by phage display as shown in Example 1.
[0137] Recombinant CIpS protein is prepared for use as a probe by
expression in E. coli, or other expression system, and purified
using standard biochemical methods, and subsequently coupled with
one or more quantum dots with defined absorbance and emission
wavelengths, including near infrared fluorescence emitters. The
labels can be coupled to an N-terminal region of CIpS that is
distinct from the C-terminal domain that serves as the actual
peptide ligand (i.e. N-terminal amino acid) binding pocket.
[0138] A glass or polystyrene substrate is coated with PEG/NHS, or
equivalent reactive carbohydrate linker, to minimize non-specific
adsorption and spurious background signal.
[0139] The test proteins and peptides include a panel of synthetic
peptides of known sequence, some with confirmed binding to CIpS and
others with permuted N-terminal residues that aren't recognized by
natural forms of CIpS, as reported in the literature, as well as
common standard proteins like bovine serum albumin (BSA) and
proteolytic digests thereof. A series of test sample dilutions
using known amounts and numbers of molecules of the
peptides/proteins at specific (serial fold) concentrations are
generated prior to peptide coupling.
[0140] The test proteins/peptides are then affixed to the
substrate, which is washed, and repeatedly probed to assess target
detection specificity and affinity, detection limits, non-specific
background signal (e.g. probe adsorption) and the response
linearity based on molecular counting as a quantitative readout.
Quantum dot signals are recorded with a suitable (i.e. CCD-enabled)
optical microscope, and specific probe binding signals deconvoluted
using suitable filters and software.
Results
[0141] The results show single-molecule detection of the test
polypeptide sequences. The system exhibits low background and is
able to consistently and accurately sequence the test
polypeptides.
Example 4
In Vitro Screens Using Phage Display to Identify N-Terminal Amino
Acid Probes
[0142] The present inventors have engineered protein domains that
recognize N-terminal residues of polypeptides and are able to
discriminate between different residues. Such protein domains are
useful for the polypeptide sequencing methods as described herein
and also constitute a valuable resource for other applications. The
bacterial protein CIpS contains a domain that preferentially binds
leucine, phenylalanine, tyrosine and tryptophan N-termini with
single-digit micromolar to nanomolar affinities, whereupon it
mediates the transfer of these substrates to the CIpAP protease for
degradation (Schuenemann et al. (2009) Structural basis of N-end
rule substrate recognition in Escherichia coli by the CIpAP adaptor
protein CIpS. EMBO Reports 10:508-514 2009; Tasaki et al., (2009)
The substrate recognition domains of the N-end rule pathway. J Biol
Chem 284: 1884-1895 2009).
[0143] The CIpS binding domain coordinates the alpha-amino group
with a network of hydrogen bonds while the side chain specificity
in CIpS results from insertion of the first side chain into a
hydrophobic pocket.
[0144] In order to investigate and identify N-terminal amino acid
probes based on the CIpS protein, a truncated wildtype CIpS
polypeptide comprising 84 amino acids of wildtype E. coli CIpS (See
UNIPROT Accession No. POA8Q6) was used as follows:
TABLE-US-00003 (SEQ ID NO: 1) 1 11 21 31 KPPSMYKVIL VNDDYTPMEF
VIDVLQKFFS YDVERATQLM 41 51 61 71 81 LAVHYQGKAI CGVFTAEVAE
TKVAMVNKYA RENEHPLLCT LEKA
[0145] However, the natural CIpS binding domain has only a limited
repertoire of specificities, with only low to moderate selectivity.
Using modeling and directed evolution approaches, new domains or
"variants" starting with the natural CIpS domain as a scaffold have
been generated with different specificities and improved
selectivity.
[0146] Large custom combinatorial libraries of variants surface
displayed on bacteriophage (i.e. phage display) were generated on
the basis of available structural information generated by x-ray
crystallographic analysis of the ligand binding interfaces. In
vitro selection (`panning`) was then used to recover subsets of
variants with desirable binding properties as shown in FIG. 5. The
in vitro selection conditions were manipulated to control the
selective pressure for the recovery of highly discriminating
binders.
[0147] N-terminal affinity capture probes were thereby generated
that exhibit (i) highly selective peptide binding (i.e. single
N-terminal residue specificities), and (ii) have novel binding
capabilities not seen with the wildtype CIpS scaffold).
Phage Display
[0148] CIpS domains from two different bacterial species (the gram
negatives E. coli and Caulobacter crescentus) were tested to
demonstrate that the CIpS domains displayed on phage as N-terminal
fusions to a phage surface protein were functional, i.e. able to
bind their cognate ligands. The CIpS domains were N-terminally
FLAG-tagged as shown in FIG. 6A so that display of the recombinant
phage coat protein would be detectable (using commercial anti-FLAG
antibody), even if the domains were not able to bind ligand.
Several linkers were also tested for the presentation of suitable
synthetic peptide ligands to find sequences that supported domain
binding without exhibiting undue non-specific binding (data not
shown). The expressed proteins also contained an ST2 secretion
signal that is cleaved off and a C-terminal phage coat protein p3
(that is, fused to the C-terminus/residue 106 of E. coli CIpS) as
shown in FIG. 6C. The WT CIpS expression protein used for
Phage-displayed CIpS from Escherichia coli (E. coil) was able to
bind its cognate ligand (immobilized Leucine) as shown in FIG. 6B,
indicating that the CIpS domain was functionally displayed and
hence suitable for use as a scaffold.
Library Construction
[0149] Combinatorial libraries of CIpS domain variants were
generated using oligo-directed mutagenesis to introduce amino acid
diversity into key positions (i.e. putative ligand
determinants).
[0150] The CIpS libraries were used to gather extensive data on the
sort of amino acid diversity that would be structurally tolerated
at key positions forming (i.e. near or in) the ligand binding
pocket with the goal of generating a highly functional library that
exploits as much amino acid diversity as possible, while minimizing
the number of library variants that destabilize or result in an
unfolded scaffold.
[0151] Given that there are two components to N-terminal ligand
recognition (specificity pocket residues, and alpha-amino
recognition), two libraries were designed as shown in FIG. 7. In
the first library, the specificity pocket residues were hard
randomized to generate variants with all possible genetically
encoded amino acids at the designated residues shown in FIG. 7A
(corresponding to residue positions 17, 18, 21, 40, 43, 76 and 77
of the WT truncated CIpS polypeptide (SEQ ID NO: 1) shown as
positions 39, 40, 43, 62, 65, 98 and 99 in FIG. 7A). In the second
library, the residues responsible for alpha-amino recognition were
hard randomized as shown in FIG. 7B (corresponding to residue
positions 12, 13, 14, 16, 17, 44, and 76 of the WT truncated CIpS
polypeptide (SEQ ID NO: 1) shown as positions 34, 35, 36, 38, 39,
66 and 98 in FIG. 7B).
Target Selection
[0152] The N-terminal FLAG tag was used to select for protease
resistant domains expressed on the phage surface using an
immobilized anti-FLAG antibody. Only domains that are reasonably
well folded will escape degradation by host bacterial proteases
during the phage amplification process. These domain were recovered
and a large number were sequenced in order to determine a sense of
the amino acid diversity that is structurally tolerated at each
randomized position. The results of these structure selections
indicate that the specificity pocket residues of CIpS are
surprisingly tolerant to the full range of amino acid
diversity.
[0153] For example, as seen in FIG. 8A, while the most frequently
observed residue at position 99 is the same as the wildtype (Leu),
followed by other aliphatic residues, polar and charged residues
are also commonly observed at that position. Likewise, the
alpha-amino recognition positions shown in FIG. 8B are also very
tolerant for residue alterations.
[0154] Given the discovery that the specificity pocket library was
functionally robust, selections against synthetic peptide ligands
were carried out using this library. The specificity pocket library
was selected against 20 biotinylated peptides, each with a
different N-terminal residue atop a common leader sequence
(X-SDGMFTAGSLIGK(biotin)) (SEQ ID NO: 4). The peptides were
immobilized individually to the bottom wells of a microtiter plate.
In order to recover highly selective binders, competitors were
included in solution, i.e., non-biotinylated peptides with
different N-terminal residues, during each round of panning against
the immobilized ligands. The most stringent competition employed
was to include eighteen peptides with the other N-terminal residues
(excluding the immobilized residue and cysteine) at a concentration
slightly higher than the reported dissociation constant of the
wildtype ClpS:Leu-peptide interaction (Kd=4.8 uM; competitor
concentration=10 .mu.M). Consequently, CIpS mutant variants that
prefer other residues in addition to the ligand `bait` would bind
those competing peptides in solution and simply be washed away.
Only selective variants that bound to the immobilized target(s)
were amplified during each subsequent round of selection.
[0155] In addition to the pooled competitor selection, two less
stringent competition strategies were also performed: a) Leu- and
Phe-peptides (both at 10 .mu.M), in order to recover variants that
prefer anything other than the wildtype ligands; and Gly-peptide
(at 10 .mu.M), in order to recover domains that have higher
affinity for any N-terminus side chain rather than for no side
chain. Additionally, selections without any competition were
carried out, as a baseline for evaluating the effectiveness of the
competition strategies and concentrations.
[0156] To evaluate the specificity and selectivity of individual
clones, both wild-type CIpS and the selected variants' binding to
each of the biotinylated peptides independently were tested. The
same approach was also used to monitor the progress of the
selections and to prioritize particular pools of phage for further
investigation. The resulting specificity profile of the phage
displaying wildtype CIpS is shown in Table 1. As expected, CIpS
showed a clear preference for Leu, Tyr, Phe and, more weakly, Trp
peptides.
TABLE-US-00004 TABLE 1 Phage displayed wild-type E. coli CIpS shows
binding preferences for a panel of immobilized peptides consistent
with published biophysical data and peptide profiling. N-terminal
amino acid CIpS Wt A -0.29 C -0.23 D -0.29 E -0.26 F 1.81 G -0.04 H
-0.03 I -0.016 K 0.05 M -0.11 N -0.05 P -0.07 Q -0.18 R 0.13 S
-0.01 T 0.01 V -0.09 W 0.77 Y 1.08 L 1.57 N/A -0.29 N/A -0.11
[0157] Promising single clones were picked from the selection pools
and their specificity was evaluated using the same panel of
biotinylated peptides and various amounts of phage supernatant. As
shown in Table 2, probe variants exhibiting markedly different
binding properties compared to the native CIpS protein were
generated. In particular, CIpS Variant 1 bound specifically to
tryptophan alone, a level of specificity which has not been
reported before, and also gave a much stronger signal than wildtype
CIpS, indicating it is more efficiently displayed and/or more
stable than the wildtype sequence. Accordingly, Variant 1
represents a selective N-terminal amino acid capture probe for
tryptophan useful for the sequencing methods described herein.
Variant 1 also represents a useful scaffold for performing further
generation and selection of variants with desirable properties for
use as additional N-terminal amino acid capture probes.
[0158] In addition, Variant 2 was shown to have good selectivity
for lysine. Variants 3 and 4 preferentially recognized glutamine
and aspartic acid respectively, amino acids that are not recognized
by wildtype CIpS. Accordingly, probes that exhibit (i) highly
selective ligand binding (single N-terminal residue specificities),
and (ii) different binding capabilities as compared to the wildtype
CIpS scaffold can readily be generated using the methods described
herein.
TABLE-US-00005 TABLE 2 Engineered CIpS variants shows differential
binding to peptide ligand N-termini. CIpS WT Variant 1 Variant 2
Variant 3 Variant 4 10X 1X 5X 1X 1X A -0.29 0.018 -0.049 -0.015
0.009 C -0.23 0.066 -0.059 -0.005 0.021 D -0.29 -0.017 -0.07 -0.003
0.91 E -0.26 0.032 -0.087 -0.023 0.033 F 1.81 0.083 -0.207 -0.006
0.035 G -0.04 0.028 -0.135 -0.006 0.011 H -0.03 -0.001 -0.113
-0.031 0 I -0.16 -0.023 -0.079 -0.027 -0.022 K 0.05 0.129 -0.201
-0.007 0.01 M -0.11 -0.003 -0.072 -0.017 -0.003 N -0.05 0.052
-0.063 -0.011 0.002 P -0.07 0.062 0.153 -0.039 -0.022 Q -0.18 0.065
-0.178 0.356 -0.016 R 0.13 0.04 0.429 -0.082 -0.051 S -0.01 -0.001
-0.108 0.022 0.013 T 0.01 -0.005 -0.033 -0.042 -0.029 V -0.09 0.032
-0.234 -0.002 -0.006 W 0.77 2.636 -0.223 -0.019 -0.017 Y 1.08 0.045
-0.235 0.006 -0.001 L 1.57 0.069 1.609 -0.031 -0.006 NA -0.29 0.064
-0.015 0.025 0.031 NA -0.11 -0.023 -0.052 0.014 0.016 FLAG -- -- --
-- -- sub Fab sub Fab sub Fab sub Fab sub Fab
Materials and Experimental Methods
[0159] Phage screens
[0160] The selection and ELISA protocols are very similar. Briefly,
each well of a 96-well Maxisorp plate was coated overnight at
4.degree. C. with 100 .mu.lof 10 .mu.g/ml neutravidin in PBS, or
1:500 dilution of anti-FLAG antibody. Plates were washed three
times with PBS+0.50% TWEEN-20 (PT) and blocked for 1 hour at room
temperature with 200 ul of PBS+0.5% BSA (PB). Plates were washed
again three times with PT. Stock solutions of biotinylated peptides
(4mg/m1 in 100% DMSO) were diluted to 500 pM in PBS+5% DMSO. Dilute
peptide solution was incubated on neutravidin-coated wells for 1
hour at room temperature, and then plates were washed three times
with PT.
[0161] For selections, 100 ul of PEG-precipitated library phage, or
pH adjusted phage supernatant from overnight culture, was added to
appropriate wells and allowed to bind for 2 hours at 4.degree. C.
The plate was then washed six times with cold PT. Phage were eluted
by addition of 100 ul of log-phase XL1Blue culture OD600=0.4)
directly to the selection plate and incubation for 30 minutes at
37C with 200 rpm. Helper phage (M13K07) was then added to a final
concentration of 1010 phage/ml and the selection plate was
incubated for another 45 minutes at 37C with 200 rpm. Finally, the
cells were transferred to 1.3 ml of 2YT+carbenicillin (100
pg/ml)+kanamycin (25 pg/ml) in a deep well plate and grown
overnight at 37.degree. C. with 200 rpm. The following day, the
cells were precipitated by 10 minute centrifugation at 3000xg at
4.degree. C. The phage supernatant was then transferred to a clean
deep well plate and the pH adjusted by addition of 10X PBS to a
final concentration of 1X.
Enzyme-Linked Immunoassays
[0162] For the ELISA readouts, 100 .mu.l of pH adjusted phage
supernatant or polyethylene glycol (PEG) precipitated concentrated
phage was added to appropriate wells and allowed to bind for 1 hour
at 4.degree. C. The plate was then washed three times with cold PT.
anti-M13:HRP conjugated antibody was diluted 1:3000 in cold
blocking buffer and 100 .mu.l aliquotted to each well, for
incubation at 4.degree. C. for 15 minutes. The plate was then
washed six times with cold PT. 90 .mu.l of TMB detection substrate
was added to each well and allowed to develop for approximately 5
minutes. The reaction was stopped by addition of 90 .mu.l of 1M
H3PO4 and the absorbance at A450nm was read.
Example 5
CIpS Probe Labeling and Detection
[0163] In order to allow for the detection of N-terminal amino acid
affinity capture probes bound to individual surface-immobilized
polypeptides, the probes are optionally detectably labeled with a
fluorescence-based marker. Accordingly, various methods of labeling
the probes were investigated using FluoSpheres.TM. (FS)
(Invitrogen), which comprise polystyrene shells encompassing core
dye molecules. FluoSpheres.TM. with the same surface chemistry are
available in a useful range of sizes (20nm-1 .mu.m diameter). In
addition, FluoSpheres with a number of different dyes with varying
emission spectra to generate discernible probes for multiplex
analysis are available.
[0164] 20 nm diameter FluoSpheres (FS20) with the Nile Red dye were
selected to minimize the footprint of the peptide-bound labeled
CIpS. However, if the fluorescence intensity is found to be
inadequate for a single-molecule detection, a larger particle can
also be used.
[0165] Two different (indirect and direct) conjugation schemes were
used to attach fluorescent labels to CIpS proteins as shown in
FIGS. 9 and 10. The first (indirect) labeling approach is based on
the fact that the recombinant CIpS used for the present Experiments
was expressed and isolated from E. coli as fusions with an
N-terminal glutathione transferase (GST) domain, which strongly
binds glutathione (GSH). Therefore, after the FluoSpheres are
functionalized with GSH, mixing FS20 with the purified protein
should effectively fluorescently label the CIpS probe through the
GST-GSH interaction. Furthermore, since this conjugation approach
involves an interaction with the GST rather than the amino
acid-binding domain of CIpS, it is not expected to significantly
interfere with the peptide-binding functionality of the probes.
Indirect Probe Labeling
[0166] Glutathione is a tripeptide of glutamine, cysteine and
glycine, with cysteine in the central position. To prevent GSH
immobilization from interfering with GST binding, GSH was attached
to the FluoSpheres through thiol of the cystein residue using a
long linker molecule (see Chen et al. Effect of Linker for
Immobilization of Glutathione on BSA Assembled Controlled Pore
Glass Beads. Bull. Kor. Chem. Soc. 25 (2004) 1366-1370).
Sulfo-LC-SPDP was selected as a suitable .about.1.5 nm long
heterofunctional linker molecule with thiol and amine-reactive
ends. In order for this molecule to be used for GSH immobilization
on FS20, the Fluosphere surface was first functionalized with
amines. This was achieved by reacting FS20 with ethylenediamine in
a process catalyzed by the 1-ethyl-3-(3-dimethylaminopropyl)
carbodiimide (EDC) crosslinker, which forms an amide bond between
the carboxylic acids and amines. Amine-functionalized FS20
(diaminated FS20-DA) was then reacted with Sulfo-LC-SPDP, leaving
the thiol reactive end for further conjugation to the GSH. Once the
FluoSpheres containing different dyes were functionalized with GSH,
they were used to fluorescently label end-terminal amino acid
binding CIpS proteins simply by mixing the two populations
together. Probes directed to different N-terminal amino acids can
also readily be labeled with a differentially colored dye, allowing
for the use of multiplexing in probe detection.
Direct Probe Labeling
[0167] The second (direct) labeling approach involves direct
covalent attachment of the fluorescent label to the probe. This is
achieved by using EDC to form an amide bond between the carboxylic
acids on FS20 surface, and the primary amines of the CIpS probe.
This scheme is simpler than the first one, since it does not
require Fluosphere.TM. functionalization with glutathione, however,
the drawback is that the location of the reacting amine on the CIpS
protein cannot be controlled. If the attachment preferentially
takes place on the ClpS peptide-binding domain rather than the GST
moiety, it might interfere with the primary function of CIpS
protein to bind a terminal amino acid on a peptide.
Making Amine-Functionalized Fluo-Spheres
[0168] 20 nm diameter FluoSpheres.TM. (FS20), purchased from
Invitrogen, contained carboxylic acid functional groups on their
surface. The synthetic scheme for adsorbing glutathione (GSH) onto
their surface required the presence of amine groups instead. Amine
functionalization of FS20 (FS20-DA) was performed by mixing FS20
and ethylene diamine (DA) in the presence of
1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) crosslinker,
which catalyzes the formation of a stable amide bond between a
carboxylic acid and an amine.
[0169] The resulting FluoSpheres were evaluated by agarose gel
electrophoresis by fluorescence imaging of the gel (data not
shown). FS20 functionalized with carboxylic acids have a negative
(-) surface charge, and therefore migrate in the direction of the
cathode (+). When functionalized with amines, FS20-DA surface is
expected to attain a more positive charge (negative carboxylic
acids are replaced with positive amines). This should lead to a
slower gel migration of FS20-DA than of FS20 in the (+) direction
(assuming only a fraction of carboxyl groups get modified, so that
overall surface charge is still negative; if majority or carboxylic
acids are modified the net surface charge will be positive, leading
to migration in the (-) direction). In agreement with these
predictions, for FS20 reacted with dilution series of ethylene
diamines, as the concentration of the diamine was increased, a
larger number of carboxyl groups get replaced with amines, leading
to a slower migration of the FluoSpheres.TM. on the gel. The
results further demonstrated that only a portion of carboxylic
acids reacts with diamines: even in the conditions of diamine
saturation, FS20-DA still migrate in the direction of cathode,
indicating net negative surface charge remains.
[0170] Amine-functionalization of FS20 was further confirmed by
reacting FS20-DA with a FITC dye that reacts and forms bonds with
amine groups (Fluorescein isothiocyanate isomer I). The expectation
was that as the FS20-DA amine density increases when generated
using higher concentrations of diamine, the quantities of dye
associated with FS20-DA should increase as well. Since FITC
emission peaks at a different wavelength than Nile Red, the
presence of FITC dye could be detected by looking at the spectral
emission profile of the samples. Excitation of FITC at 495 nm also
excites Nile Red, so that normalization of FITC emission to the
Nile Red emission peak accounts of the inter-sample variation of
Fluosphere.TM. concentration. This allows for a quantitative
comparison of FS20-DA surface-immobilized FITC dye. The results
(data not shown) showed normalized FITC emission for the dye
reacted with the FS20-DA dilution series samples. Moreover, the
magnitude of FITC emission increased with higher concentrations of
diamine reacted with FluoSpheres in a manner similar to the gel
shifts.
Reacting Sulfo-LC-SPDP with the Amines on Fluosphere Surface
[0171] FS samples (1 M, 100 mM, and 10 mM) were reacted with
Sulfo-LC-SPDP (referred to as SPDP) to form SPDP-functionalized
FluoSpheres.TM. (FS20-SPDP). Following the reactions, FS20-SPDP
were visualized using agarose gel electrophoresis. SPDP conjugation
to amines on the surface of FluoSpheres blocks the (+) charge
associated with the amines (SPDP is a neutral molecule and does not
contribute to the charge). This leads to a more negative net
surface charge, resulting in faster gel migration (effectively
negating some of the charge difference between FS20 and FS20-DA).
The SPDP-functionalized fluosphere samples were further probed with
the amine-reactive FITC dye described above. Since some of the
surface amine groups react with SPDP, FS20-SPDP should have fewer
amine groups on their surface than FS20-DA. As a result, FITC dye
association with FS20-SPDP should be lower as well. Indeed, this
was the observed trend: after reaction with SPDP the different
FS20-DA samples showed lower FITC dye binding (data not shown).
Conjugating SPDP-Functionalized FS20 to Glutathione (GSH)
[0172] In a new set of reactions, FS20 was sequentially reacted
with ethylene diamine and SPDP. FS20-SPDP were then further
conjugated to GSH (FS20-GSH). All of the samples were visualized on
the agarose gel. As observed previously, amination of FluoSpheres
leads to a slower migration of the particles on the gel.
Introduction of SPDP groups blocks some of positive amine charges,
and some of the fluosphere mobility is restored. Since GSH is
negatively charged, FS20-GSH have higher net negative surface
charge, and migrate faster towards the cathode than FS20-SPDP.
Taken together, the data demonstrates the stepwise
functionalization of carboxy-functionalized FS20 with
glutathione.
Labeling CIpS Proteins with FS20 Through EDC-Catalyzed Reaction
[0173] CIpS proteins were conjugated directly to
carboxyl-functionalized FS20 using EDC to crosslink carboxylic
acids on FS20 with amines on CIpS. Three different concentrations
of CIpS were used (2.8, 28, and 280 CIpS-to-FS20 ratio). In
addition, controls without EDC were included to estimate
non-specific binding between CIpS and F520. All of the samples were
visualized by gel electrophoresis: robust EDC-catalyzed
crosslinking was observed, and the number of CIpS per FS20
(represented by the magnitude of the band shift) increased with
increasing CIpS-to-FS20 ratio. Some residual adsorption of CIpS
onto FS20 was observed in the absence of EDC crosslinker, but the
EDC-based covalent association was much stronger.
[0174] These results demonstrate that recombinant CIpS can be
fluorescently labeled directly with carboxyl-functionalized
FluoSpheres in a simple one-step process.
Labeling of CIpS with FS20-GSH Through GSH-GST Interaction
[0175] FS20-GSH was incubated with the GST-tagged recombinant CIpS
protein with a ClpS/FS20-GSH ratio of 250. The expectation was that
the GSH immobilized on FluoSpheres would interact with the GST
domains of CIpS, leading to the association between the proteins
and FS20 molecules. The interaction between FS20-GSH and CIpS was
probed using agarose gel electrophoresis followed by fluorescent
imaging (data not shown). While the association between FS20-GSH
and CIpS does take place, the data suggest that the degree of
association is lower than for the EDC-catalyzed reaction.
Binding of Labeled CIpS Protein to Surface-Immobilized Peptides
[0176] Arg- and Leu-terminated biotinylated peptides were
immobilized in NeutrAvidin-coated wells of a 96-well plate through
biotin-NeutrAvidin interactions. Wells containing NeutrAvidin alone
but no peptides were included as controls to estimate non-specific
adsorption. Fluorescently labeled CIpS protein was then added to
the wells and incubated to allow for the protein-peptide binding to
occur. To exclude the possibility this might be due to non-specific
binding, the wells were incubated with bound FS20-GSH-Clps in
buffer containing reduced GSH. GSH present in excess was expected
to compete for binding to the GST domain of recombinant proteins,
thus releasing FS20-GSH into solution (observing fluorescence in
solution should lead to lower background signal, since in the case
of immobilized peptide the excitation laser focuses on the bottom
of the well, thus maximizing the plate plastic's
autofluorescence).
[0177] As shown in FIG. 12, CIpS labeled by FluoSpheres.TM. both
through covalent conjugation or GST-GSH based interaction showed
preferential binding for the Leu-terminated peptide. The magnitude
of this interaction appeared stronger for the covalently labeled
protein, which is consistent with observed lower CIpS-FluoSphere
association with the GST-GSH labeling method.
[0178] Accordingly, CIpS proteins can be detectably labeled and
used to identify the N-terminal residues on immobilized peptides.
The results of these experiments, combined with the agarose gel
data that indicates stable FluoSphere-protein association,
demonstrate the advantages of the two labeling methods investigated
in this pilot study: (i) direct EDC-catalyzed covalent conjugation
leads to higher protein-to-FS20 loading ratios, which translates to
stronger association (and hence signal) between FS20-CIpS and
(plate) immobilized peptides; and (ii) indirect labeling through
GST-GSH interaction.
Materials and Experimental Methods
Imaging Materials and Equipment
[0179] 20 nm Nile Red (535/575) FluoSpheres.TM. were purchased from
Invitrogen Canada Inc. (Burlington, ON). All other reagents were
purchased from Sigma-Aldrich Canada Ltd. (Oakville, ON), except for
Sulfo-LC-SPDP (X-Link Bioscience Inc., Freeport, Ill.). NAP-5
Sephadex desalting columns were purchased from GE Healthcare Life
Sciences (Baie d'Urfe, QC). All agarose gels (1%) were run at 50 V.
Fluorescence spectral measurements were performed using FluoroMax-3
spectrofluorometer (HORIBA Instruments Inc., Ann Arbor, Mich.).
Functionalizing FluoSpheres with Glutathione (GSH)
[0180] All of the reactions were performed in 0.1 M sodium
phosphate buffer with 0.05% TWEEN (SPBT). The buffer was kept at pH
6.8 for EDC-based reactions, and adjusted to pH 7.2 for the SPDP
conjugation. To make amine-functionalized FluoSpheres (FS20-DA),
100 .mu.L of 20 nm Nile Red FluoSpheres (FS20) (2 mg/mL in SPBT)
were mixed with 100 .mu.L of 100 mM ethylenediamine dihidrochloride
solution (in SPBT), then EDC (40 mg/mL in H2O, prepared immediately
before use) was added to a final concentration of 2 mg/mL. The
samples were incubated for 2 hours at room temperature, then
purified by 2 rounds of desalting using NAP-5 SEPHADEX column. When
generating FS20-DA using dilution series of diamine (1 M, 100 mM,
10 mM, 1 mM, 100 .mu.M, or 10 .mu.M, all in SPBT), 8 rounds of
ultracentrifugation (300,000.times.g, 1 hour each) were used for
purification.
[0181] To make SPDP-functionalized FS20 (FS20-SPDP), FS20-DA
solution was adjusted to pH 7.2 by addition of NaOH, then 50 .mu.L
of Sulfo-LC-SPDP (5.2 mg/mL in H2O, prepared immediately before
use) was added per 1 mL of FS20-DA suspension. The samples were
incubated for 2 hours and purified by one round of desalting. When
FS20-SPDP were generated from the diamine dilution series FS20-DA,
8 rounds of ultracentrifugation (300,000.times.g, 1 hour each) were
used for purification.
[0182] To make GSH-functionalized FS20 (FS20-GSH), 50 .mu.L of
reduced L-Glutathione suspension in H2O(5.4 mg/mL, prepared
immediately before use) was added per 1 mL of FS20-SPDP solution.
The samples were incubated overnight, then purified by 3 rounds of
desalting (to remove any remaining unbound GSH, Sulfo-LC-SPDP,
diamine).
Reacting Amine and Sulfo-LC-SPDP Functionalized FS20 with
Amine-Reactive Fluorescent FITC Dye
[0183] 10 .mu.L of 1 mM Fluorescein isothiocyanate isomer I dye
solution (suspension in H2O was added to 90 .mu.L of FS20-DA or
FS20-SPDP. The samples were incubated for 2 hours, and purified by
3 rounds of ultracentrifugation (300,000.times.g, 1 hour each) in
the case of FS20-DA, and 5 rounds of purification for
FS20-SPDP.
Labeling CIPS Protein Through GSH-GST Interaction
[0184] The labeling was achieved simply by mixing the suspensions
of FS20-GSH and CIpS protein. No purification step was
performed.
Labeling CIpS by EDC-Catalyzed Covalent Crosslinking
[0185] Equal volumes of the protein suspension (CIpS) and stock
carboxylfunctionalized FS20 were mixed together. EDC (40 mg/mL in
H2O, prepared immediately before use) was added to a final
concentration of 2 mg/mL. The samples were incubated for 2 hours.
No purification step was performed.
Binding of Labeled CIpS protein to Surface-Immobilized Peptides
[0186] NeutrAvidin and anti-GST antibodies were immobilized in the
wells of 96-well Nunc-Immuno.TM. Plates (100 .mu.L of 10 pg/mL
solution incubated for 2 hours at room temperature). Peptides
(arginine and leucine terminated) conjugated to biotin were further
adsorbed onto the NeutrAvidi-coated surface through
biotin-NeutrAvidin interaction (50 pM per well). Labeled FS20-CIpS
and FS20-GSH-CIpS were added at 10 particles/mL in SPBT buffer and
incubated at 4.degree. C. for 1 hour. The wells were then washed 6
times with SPBT, and fluorescence measurements were taken (dry well
measurements). SPBT buffer with 10 mM GSH was then added to wells
with F520-GSH-CIpS, and incubated for 1 hour to release FS20-GSH
into solution, following which the fluorescence measurements were
taken. Fluorescent measurements were made using PHERAstar
fluorescence plate reader (BMG Labtech, Offenburg, Germany).
Example 6
Characterization of the CIpS Variant 1 Trp-Binding N-terminal Amino
Acid Probe
[0187] The Trp-binding CIpS Variant 1 identified in Example 4 was
isolated and sequenced in order to further characterize the
properties of the N-terminal amino acid probe. The sequence of
Variant 1 was determined to be as follows:
TABLE-US-00006 (SEQ ID NO: 2)
KPPSMYKVILVNDDYTPAEFCIDVLQKFFSYDVERATQLCLAAHYQGKA
ICGVFTAEVAETKVAMVNKYARENEHAALCTLEKA
[0188] Compared to the wildtype CIpS sequence, the Trp-binding CIpS
Variant had mutations at positions 18, 21, 40, 43, 76 and 77 as
shown in SEQ ID NO: 2. It is noted that the cystein variants at
positions 21 and 40 may form a disulfide bond, which serves to
stabilize the variant polypeptide while still allowing for
N-terminal amino acid binding. FIG. 12 shows the sequence of
wildtype CIpS (delta 1-34) as well as the Trp binding CIpS variant
with key residues highlighted.
[0189] Competitive phage was also used to investigate the Trp
binding CIpS variant and demonstrate that only Wpep is an effective
competitor for binding. Phage bearing CIpS variant W1 were
incubated with the indicated concentration of non-biotinylated
peptide (X=N-terminal residue as indicated in FIG. 12,
XSDGMFTAGSLI) and binding was allowed to reach equilibrium. Each
phage pool was then briefly incubated in wells of a microtitre
plate with Wpep (ASDGMFTAGSLIGK(biotin)) immobilized on
neutravidin. Non-binding phage were washed away, and retained phage
were detected using an enzymatically-labeled antibody against the
filamentous phage particle and an appropriate colorimetric
substrate. The value for W1 binding to neutravidin alone was
subtracted from the binding signal from every well to correct for
non-specific binding. The ELISA values were then expressed as
proportions, relative to the maximum ELISA signal in absence of
competitor. Error bars represent 95% confidence intervals (n=2). As
shown in FIG. 12, the concentration of Wpep competitor required to
block 50% of variant W1 binding (inhibitory concentration 50 or
IC50) is approximately 1 uM. Wpep competitor at 10 uM reduces
binding to 11%. At that same concentration, peptides with other
N-terminal residues are much less effective competitors (F, Y, I,
G, L) or ineffective (all other natural residues), demonstrating
CIpS variant W1's binding selectivity.
[0190] While the invention has been described in connection with
specific embodiments thereof, it will be understood that it is
capable of further modifications and this application is intended
to cover any variations, uses, or adaptations of the invention
following, in general, the principles of the invention and
including such departures from the present disclosures as come
within known or customary practice within the art to which the
invention pertains and as may be applied to the essential features
herein before set forth, and as follows in the scope of the
appended claims.
[0191] All publications, patents and patent applications are herein
incorporated by reference in their entirety to the same extent as
if each individual publication, patent or patent application was
specifically and individually indicated to be incorporated by
reference in its entirety.
Sequence CWU 1
1
22184PRTEscherichia coli 1Lys Pro Pro Ser Met Tyr Lys Val Ile Leu
Val Asn Asp Asp Tyr Thr 1 5 10 15 Pro Met Glu Phe Val Ile Asp Val
Leu Gln Lys Phe Phe Ser Tyr Asp 20 25 30 Val Glu Arg Ala Thr Gln
Leu Met Leu Ala Val His Tyr Gln Gly Lys 35 40 45 Ala Ile Cys Gly
Val Phe Thr Ala Glu Val Ala Glu Thr Lys Val Ala 50 55 60 Met Val
Asn Lys Tyr Ala Arg Glu Asn Glu His Pro Leu Leu Cys Thr 65 70 75 80
Leu Glu Lys Ala 284PRTArtificial SequenceSynthetic 2Lys Pro Pro Ser
Met Tyr Lys Val Ile Leu Val Asn Asp Asp Tyr Thr 1 5 10 15 Pro Ala
Glu Phe Cys Ile Asp Val Leu Gln Lys Phe Phe Ser Tyr Asp 20 25 30
Val Glu Arg Ala Thr Gln Leu Cys Leu Ala Ala His Tyr Gln Gly Lys 35
40 45 Ala Ile Cys Gly Val Phe Thr Ala Glu Val Ala Glu Thr Lys Val
Ala 50 55 60 Met Val Asn Lys Tyr Ala Arg Glu Asn Glu His Ala Ala
Leu Cys Thr 65 70 75 80 Leu Glu Lys Ala 3277PRTArtificial
SequenceSynthetic 3Met Lys Lys Asn Ile Ala Phe Leu Leu Ala Ser Met
Phe Val Phe Ser 1 5 10 15 Ile Ala Thr Asn Ala Tyr Ala Ser Met Gly
Ser Asp Tyr Lys Asp Asp 20 25 30 Asp Asp Lys Gly Ser Lys Pro Pro
Ser Met Tyr Lys Val Ile Leu Val 35 40 45 Asn Asp Asp Tyr Thr Pro
Met Glu Phe Val Ile Asp Val Leu Gln Lys 50 55 60 Phe Phe Ser Tyr
Asp Val Glu Arg Ala Thr Gln Leu Met Leu Ala Val 65 70 75 80 His Tyr
Gln Gly Lys Ala Ile Cys Gly Val Phe Thr Ala Glu Val Ala 85 90 95
Glu Thr Lys Val Ala Met Val Asn Lys Tyr Ala Arg Glu Asn Glu His 100
105 110 Pro Leu Leu Cys Thr Leu Glu Lys Ala Ser Arg Ser Gly Ser Gly
Asp 115 120 125 Phe Asp Tyr Glu Lys Met Ala Asn Ala Asn Lys Gly Ala
Met Thr Glu 130 135 140 Asn Ala Asp Glu Asn Ala Leu Gln Ser Asp Ala
Lys Gly Lys Leu Asp 145 150 155 160 Ser Val Ala Thr Asp Tyr Gly Ala
Ala Ile Asp Gly Phe Ile Gly Asp 165 170 175 Val Ser Gly Leu Ala Asn
Gly Asn Gly Ala Thr Gly Asp Phe Ala Gly 180 185 190 Ser Asn Ser Gln
Met Ala Gln Val Gly Asp Gly Asp Asn Ser Pro Leu 195 200 205 Met Asn
Asn Phe Arg Gln Tyr Leu Pro Ser Leu Pro Gln Ser Val Glu 210 215 220
Cys Arg Pro Phe Val Phe Ser Ala Gly Lys Pro Tyr Glu Phe Ser Ile 225
230 235 240 Asp Cys Asp Lys Ile Asn Leu Phe Arg Gly Val Phe Ala Phe
Leu Leu 245 250 255 Tyr Val Ala Thr Phe Met Tyr Val Phe Ser Thr Phe
Ala Asn Ile Leu 260 265 270 Arg Asn Lys Glu Ser 275
413PRTArtificial SequenceSynthetic 4Ser Asp Gly Met Phe Thr Ala Gly
Ser Leu Ile Gly Lys 1 5 10 57PRTArtificial SequenceSynthetic 5Tyr
Phe Arg Thr Phe Arg Lys 1 5 618PRTEscherichia coli 6Met Tyr Lys Val
Ile Leu Val Asn Asp Asp Tyr Thr Pro Met Glu Phe 1 5 10 15 Val Ile
79PRTEscherichia coli 7Leu Met Leu Ala Val His Tyr Gln Gly 1 5
818PRTCaulobacter crescentus 8Leu Tyr Arg Val Leu Ile Leu Asn Asp
Asp Tyr Thr Pro Met Glu Phe 1 5 10 15 Val Val 99PRTCaulobacter
crescentus 9Ile Met Leu His Val His Gln Asn Gly 1 5
1018PRTPseudomonas aeruginosa 10Leu Tyr Lys Val Val Leu Phe Asn Asp
Asp Tyr Thr Pro Met Asp Phe 1 5 10 15 Val Val 119PRTPseudomonas
aeruginosa 11Ile Met Leu Thr Val His Thr Gln Gly 1 5
1218PRTMycobacterium tuberculosis 12Ala Trp Val Thr Ile Val Trp Asp
Asp Pro Val Asn Leu Met Ser Tyr 1 5 10 15 Val Thr
139PRTMycobacterium tuberculosis 13Leu Met Leu Gln Val His Asn Glu
Gly 1 5 1418PRTSynechococcus RS9916 14Arg Tyr Lys Val Leu Leu His
Asn Asp Pro Val Asn Ser Met Glu Tyr 1 5 10 15 Val Val
159PRTSynechococcus RS9916 15Val Met Leu Glu Ala His Asn Ser Gly 1
5 1618PRTSaccharomyces cerevisiae 16Asn Tyr Thr Val Ile Ile Tyr Asn
Asp Glu Tyr His Asn Tyr Ser Gln 1 5 10 15 Ala Thr
179PRTSaccharomyces cerevisiae 17Leu Thr Ser Arg Ile Asp Gly Glu
Arg 1 5 1818PRTHomo sapiens 18Arg Tyr Tyr Cys Val Leu Phe Asn Asp
Glu His His Ser Tyr Asp His 1 5 10 15 Val Ile 199PRTHomo sapiens
19His Thr Thr Ala Ile Asp Lys Glu Gly 1 5 2018PRTHomo sapiens 20Thr
Tyr Tyr Cys Met Leu Phe Asn Asp Glu Val His Thr Tyr Glu Gln 1 5 10
15 Val Ile 219PRTHomo sapiens 21Phe Ala Thr Thr Val Asp Arg Asp Gly
1 5 2297PRTEscherichia coli 22Gln Leu Ala Glu Glu Lys Val Arg Asp
Ala Leu Lys Pro Pro Ser Met 1 5 10 15 Tyr Lys Val Ile Leu Val Asn
Asp Asp Tyr Thr Pro Met Glu Phe Val 20 25 30 Ile Asp Val Leu Gln
Lys Phe Phe Ser Tyr Asp Val Glu Arg Ala Thr 35 40 45 Gln Leu Met
Leu Ala Val His Tyr Gln Gly Lys Ala Ile Cys Gly Val 50 55 60 Phe
Thr Ala Glu Val Ala Glu Thr Lys Val Ala Met Val Asn Lys Tyr 65 70
75 80 Ala Arg Glu Asn Glu His Pro Leu Leu Cys Thr Leu Glu Lys Ala
Gly 85 90 95 Ala
* * * * *