U.S. patent application number 15/420000 was filed with the patent office on 2017-07-27 for ask 1 inhibiting pyrrolopyrimidine derivatives.
The applicant listed for this patent is CALCHAN LIMITED. Invention is credited to Ghislaine LORTHIOIR, David NORTON, Karen Louise PHILPOTT, Mairi SIME, Jason Paul TIERNEY, David R. WITTY.
Application Number | 20170210748 15/420000 |
Document ID | / |
Family ID | 45444639 |
Filed Date | 2017-07-27 |
United States Patent
Application |
20170210748 |
Kind Code |
A1 |
WITTY; David R. ; et
al. |
July 27, 2017 |
ASK 1 INHIBITING PYRROLOPYRIMIDINE DERIVATIVES
Abstract
This invention relates to pyrrolopyrimidine derivatives of
formula (I): ##STR00001## where R.sub.1, X, p, R.sub.4, R.sub.2 and
R.sub.3 are as defined herein, and their use as
pharmaceuticals.
Inventors: |
WITTY; David R.; (Cambridge,
GB) ; NORTON; David; (Cambridge, GB) ;
TIERNEY; Jason Paul; (Cambridge, GB) ; LORTHIOIR;
Ghislaine; (Cambridge, GB) ; SIME; Mairi;
(Cambridge, GB) ; PHILPOTT; Karen Louise;
(Cambridge, GB) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
CALCHAN LIMITED |
London |
|
GB |
|
|
Family ID: |
45444639 |
Appl. No.: |
15/420000 |
Filed: |
January 30, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14698489 |
Apr 28, 2015 |
9585886 |
|
|
15420000 |
|
|
|
|
13994691 |
Oct 21, 2013 |
9045485 |
|
|
PCT/GB2011/052484 |
Dec 15, 2011 |
|
|
|
14698489 |
|
|
|
|
61423865 |
Dec 16, 2010 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07D 487/04 20130101;
A61P 1/04 20180101; A61P 21/02 20180101; A61P 25/16 20180101; A61P
27/06 20180101; A61P 29/00 20180101; A61P 27/02 20180101; A61P
37/08 20180101; A61P 1/12 20180101; A61P 19/08 20180101; A61P 17/06
20180101; A61P 7/06 20180101; A61K 31/5377 20130101; A61P 21/04
20180101; A61P 17/00 20180101; A61P 19/02 20180101; A61P 25/28
20180101; C07D 401/14 20130101; A61P 5/14 20180101; A61P 37/02
20180101; A61P 3/00 20180101; A61P 1/02 20180101; C07D 401/04
20130101; A61P 11/06 20180101; A61P 43/00 20180101; A61P 11/00
20180101; A61K 31/4523 20130101; A61P 21/00 20180101; A61P 9/00
20180101; A61P 25/00 20180101; A61P 11/02 20180101; A61P 3/04
20180101; A61P 9/14 20180101; A61P 13/12 20180101; A61P 3/10
20180101; A61P 17/02 20180101; A61K 31/519 20130101; A61P 1/00
20180101; A61P 9/12 20180101; A61P 1/10 20180101; A61P 9/10
20180101; A61P 1/16 20180101; A61P 25/14 20180101; A61P 35/00
20180101 |
International
Class: |
C07D 487/04 20060101
C07D487/04 |
Claims
1-29. (canceled)
30. A compound of formula (I) ##STR00119## where X is
(CH.sub.2).sub.m or CH.sub.2O, where m is 1 or 2; p is 0 or 1;
R.sub.1 is phenyl or a 5 or 6 membered heteroaryl group selected
from the group consisting of imidazolyl, isoxazolyl, pyridinyl,
pyridazinyl or pyrimidinyl, which phenyl or heteroaryl group is
optionally substituted with 1 or 2 substituents selected from the
group consisting of (C.sub.1-4)alkyl, (C.sub.1-4)alkoxy, halo,
(CH.sub.2).sub.nNR.sub.5R.sub.6 where R.sub.5 and R.sub.6 are
independently H or (C.sub.1-4)alkyl and n is 0 or 1, pyrrolidinyl,
morpholinyl, piperidinyl, pyrrolidin(C.sub.1-4)alkyl,
morpholin(C.sub.1-4)alkyl, piperidin(C.sub.1-4)alkyl,
pyrrolidin(C.sub.1-4)alkoxy, morpholin(C.sub.1-4)alkoxy,
piperidin(C.sub.1-4)alkoxy wherein said pyrrolidinyl, morpholinyl
or piperidinyl groups are optionally substituted with halo or
(C.sub.1-4)alkyl, with the proviso that when R.sub.1 is phenyl or a
6 membered heteroaryl group, which phenyl or 6 membered heteroaryl
group has a substitutent on the atom at the para position, said
substituent is selected from the group consisting of methyl, ethyl,
isopropyl, methoxy, halo or (CH.sub.2).sub.nNR.sub.5R.sub.6 where
R.sub.5 and R.sub.6 are methyl; R.sub.2 is H, methoxy, ethoxy or
CH.sub.2OCH.sub.3; R.sub.3 is H, (C.sub.1-4)alkyl,
(C.sub.2-4)alkenyl, halo, cyano, furanyl or pyrazolyl, which
pyrazolyl is optionally substituted with 1 methyl group; R.sub.4 is
H or (C.sub.1-4)alkyl; or a pharmaceutically acceptable salt
thereof.
31. A compound according to claim 30 where p is 0, or a
pharmaceutically acceptable salt thereof.
32. A compound according to claim 30 where p is 1, or a
pharmaceutically acceptable salt thereof.
33. A compound according to claim 32 where X is methyl or methoxy,
or a pharmaceutically acceptable salt thereof.
34. A compound according to claim 30 where R.sub.2 is H, or a
pharmaceutically acceptable salt thereof.
35. A compound according to claim 30 where R.sub.3 is methyl, or a
pharmaceutically acceptable salt thereof.
36. A compound according to claim 30 where R.sub.4 is H, or a
pharmaceutically acceptable salt thereof.
37. A compound according to claim 30 where R.sub.1 is unsubstituted
phenyl or an unsubstituted 5 or 6 membered heteroaryl group
selected from the group consisting of imidazolyl, isoxazolyl,
pyridinyl, pyridazinyl or pyrimidinyl, or a pharmaceutically
acceptable salt thereof.
38. A compound according to claim 37 where R.sub.1 is unsubstituted
phenyl.
39. A compound according to claim 30 where R.sub.1 is phenyl
substituted with (C.sub.1-4)alkyl or (C.sub.1-4)alkoxy.
40. A compound according to claim 30 where R.sub.1 is pyridinyl
substituted with (C.sub.1-4)alkyl or (C.sub.1-4)alkoxy, or a
pharmaceutically acceptable salt thereof.
41. A compound according to claim 30 where R.sub.1 is isoxazolyl
substituted with 1 or 2 (C.sub.1-4)alkyl groups, or a
pharmaceutically acceptable salt thereof.
42. A compound according to claim 30 where R.sub.1 is imidazolyl
substituted with 1 or 2 (C.sub.1-4)alkyl groups, or a
pharmaceutically acceptable salt thereof.
43. A compound according to claim 30 which is selected from the
group consisting of:
N-[1-(7H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
3-(Methyloxy)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzam-
ide;
3-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]benzamide;
4-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide;
2-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperi-
dinyl]benzamide;
3-[(Dimethylamino)methyl]-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperi-
dinyl]benzamide;
3-(1-Pyrrolidinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]b-
enzamide;
3-(4-Morpholinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piper-
idinyl]benzamide;
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-2-pyridinecarboxami-
de;
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-pyridinecarbox-
amide;
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridinecar-
boxamide;
2-Methyl-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-
-pyridinecarboxamide;
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridazinecarboxa-
mide;
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-5-pyrimidineca-
rboxamide;
2-(Methyloxy)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidi-
nyl]-4-pyridinecarboxamide;
5-Methyl-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-isoxazol-
ecarboxamide;
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
N-[1-(5-Ethyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
N-{1-[5-(1-Methylethenyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}-
benzamide;
N-{1-[5-(1-Methylethyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-pipe-
ridinyl}benzamide;
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-2-pyridine-
carboxamide;
6-Methyl-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-
-pyridinecarboxamide;
2-(Methyloxy)-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidin-
yl]-4-pyridinecarboxamide;
3-(Methyloxy)-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidin-
yl]benzamide;
2-Methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-
-pyridinecarboxamide;
2-Methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide;
N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4--
pyridinecarboxamide;
3,5-dimethyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]-4-isoxazolecarboxamide;
N-[1-(5-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
N-methyl-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
2,6-dimethyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]benzamide;
N-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide;
1-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperi-
dinyl]-1H-imidazole-5-carboxamide;
N-[3-(methyloxy)-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidin-
yl]benzamide;
N-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-
-pyridinecarboxamide;
N-[1-(5-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-N-methyl-4--
pyridinecarboxamide;
N-{1-[5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-pip-
eridinyl}benzamide;
N-{1-[5-(3-furanyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}benzam-
ide;
N-[3-[(methyloxy)methyl]-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-
-4-piperidinyl]benzamide;
N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-{[2-(1-p-
yrrolidinyl)ethyl]oxy}benzamide;
N-[1-(5-chloro-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
N-[1-(5-cyano-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-{[2-(4-m-
orpholinyl)ethyl]oxy}benzamide;
3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)-N-[1-(5-methyl-1H-pyrrolo[-
2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}-N-[1-(5-methyl-1H-pyrrolo[2-
,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)-N-[1-(5-methyl-7H-pyrrolo[-
2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
2-(phenyloxy)-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]acetam-
ide; and
2-phenyl-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ace-
tamide, or a pharmaceutically acceptable salt thereof.
44. The compound according to claim 43 which is
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
or a pharmaceutically acceptable salt thereof.
45. A method of treating or preventing pain or a disease or
disorder where an inhibitor of human ASK1 is required, which
comprises administering to a subject in need thereof an effective
amount of a compound as defined in claim 30, or a pharmaceutically
acceptable salt thereof.
46. A method according to claim 45 where the pain indication is
selected from the group consisting of: chronic articular pain
(rheumatoid arthritis, osteoarthritis, rheumatoid spondylitis,
gouty arthritis or juvenile arthritis); musculoskeletal pain; lower
back and neck pain; sprains and strains; neuropathic pain;
sympathetically maintained pain; myositis; pain associated with
cancer and fibromyalgia; pain associated with migraine; pain
associated with influenza or other viral infections, such as the
common cold; rheumatic fever; pain associated with functional bowel
disorders such as non-ulcer dyspepsia, non-cardiac chest pain and
irritable bowel syndrome; pain associated with myocardial ischemia;
post operative pain; headache; toothache; dysmenorrhea; diabetic
neuropathy; sciatica; non-specific lower back pain; multiple
sclerosis pain; fibromyalgia; HIV-related neuropathy; post-herpetic
neuralgia; trigeminal neuralgia; paraesthesias; dysesthesias;
hyperesthesia; dynamic, static or thermal allodynia; thermal, cold
or mechanical hyperalgesia; hyperpathia; hypoalgesia and pain
resulting from physical trauma, amputation, cancer, toxins or
chronic inflammatory conditions.
47. A method according to claim 45 where the disease or disorder is
inflammation.
48. A method according to claim 47 where the inflammation is
selected from the group consisting of: skin conditions (sunburn,
burns, eczema, dermatitis or psoriasis); ophthalmic diseases
(glaucoma, retinitis, retinopathies, uveitis and acute injury to
the eye tissue); lung disorders (asthma, bronchitis, emphysema,
allergic rhinitis, respiratory distress syndrome, pigeon fancier's
disease, farmer's lung, COPD); gastrointestinal tract disorders
(aphthous ulcer, Crohn's disease, atopic gastritis, gastritis
varialoforme, ulcerative colitis, coeliac disease, regional
ileitis, irritable bowel syndrome, inflammatory bowel disease,
gastrointestinal reflux disease, diarrhoea, constipation); organ
transplantation; rheumatoid arthritis; vascular disease; migraine;
periarteritis nodosa; thyroiditis; aplastic anaemia; Hodgkin's
disease; sclerodoma; myaesthenia gravis; multiple sclerosis;
sorcoidosis; nephrotic syndrome; Bechet's syndrome; polymyositis;
gingivitis; myocardial ischemia; pyrexia; systemic lupus
erythematosus; polymyositis; tendonitis; bursitis and Sjogren's
syndrome.
49. A pharmaceutical composition comprising a) the compound as
defined in claim 30, or a pharmaceutically acceptable salt thereof,
and b) a pharmaceutically acceptable carrier.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 14/698,489, filed Apr. 28, 2015, which is a
divisional of U.S. patent application Ser. No. 13/994,691, filed
Oct. 21, 2013, which is the U.S. national stage application of
International Patent Application No. PCT/GB2011/052484, filed on
Dec. 15, 2011, which claims priority to U.S. Provisional
Application No. 61/423,865, filed on Dec. 16, 2010, each of which
is incorporated herein by reference in its entirety.
[0002] This invention relates to pyrrolopyrimidine derivatives and
their use as pharmaceuticals.
[0003] Apoptosis signal-regulating kinase (ASK1) is a ubiquitously
expressed Ser/Thr kinase on the mitogen-activated protein kinase
(MAPK) signalling pathway inducing response to stress stimuli
including proinflammatory molecules such as tumor necrosis
factor-.alpha. (TNF-.alpha.) and lipopolysaccharide (LPS),
endoplasmic stress, oxidative stress, genotoxic stress, free
radicals, Fas ligand and calcium overload (Takeda K et al (2008)
Annu Rev Pharacol Toxicol 248 pp 199-225; Nagai H et al (2007) J
Biochem Mol Biol 40 pp 1-6).
[0004] ASK1 is one of a number of MAP kinase kinase kinases
(MAP3Ks) which signal through MAP kinase kinases (MKKs). In the
case of ASK1 signalling, MKK3 and MKK6 activate the p38 pathway and
MKK4 and MKK7 activate the JNK pathway (Davis R J (2000) Cell 103
pp 239-252; Ichijo H et al (1997) Science 275 pp 90-94). Therefore
inhibitors of ASK1 have the potential to suppress signalling
pathways through both p38 and JNK.
[0005] The use of soluble TNF receptor: Fc fusion protein Enbrel
(etanercept) has been shown to be efficacious in the clinic for
inflammatory pain and also in pre-clinical models for neuropathic
pain (Hao S et al (2007) Gene Therapy 14 pp 1010-1016) implying
that TNF-.alpha. is a key mediator in pain response. IL-6 is a key
downstream mediator of TNF-.alpha. signalling and there is clinical
evidence supporting anti-IL-6 therapy as a valid therapeutic
approach for rheumatoid arthritis (Roche has published positive
Phase III results for Actemra/Tocilizumab in May 2008).
[0006] A number of cells that do not have functional ASK1 (isolated
from ASK1 knockout mice, or following gene silencing) are resistant
to TNF-.alpha. induced apoptosis (Tobiume K, et al (2001) EMBO Rep
2 pp 222-228). ASK1 is therefore pivotal in the TNF-.alpha. pathway
and supports the hypothesis that disrupting the TNF-.alpha.
signalling pathway via ASK1 inhibition would lead to beneficial
downstream effects such as relief from pain. There is strong
evidence to link activation of p38 and/or JNK with the production
of pro-inflammatory mediators and subsequent pain response (Ji R-R
and Suter M R (2007) Molecular Pain 3 pp 33-41; Cheng H T et al
(2008) Neuroscience 155 pp 948-958; Ji R-R and Gao Y-J (2008)
Neurosci Lett 437 pp 180-183). As ASK1 activation can lead to the
activation of both p38 and JNK, inhibition of ASK1 has the
potential to be more powerful than p38 inhibitors alone and, as it
is higher up in the signalling cascade, may limit the likelihood of
unwanted liabilities.
[0007] WO08/016131 discloses fused heterocyclic ASK1 inhibitors for
use in the treatment of diabetes and inflammatory disease.
WO04/048565 describes a novel peptide which has ASK1 activity which
may be useful in the treatment of cancer and degenerative diseases.
WO2009/123986 and WO2009/027283 both describe ASK1 inhibitors.
WO2008/075172 discloses nicotinamide derivatives as inhibitors of
h-pgds and their use for treating prostaglandin d2 mediated
diseases. WO01/39777 discloses compounds specific to adenosine a1
a2a, and a3 receptors. EP 2058309 discloses fused heterocyclic
compound.
[0008] The present invention describes a series of
pyrrolopyrimidine derivatives which are inhibitors of the ASK1
kinase and which may be useful in the prevention or treatment of
diseases and disorders where an inhibitor of ASK1 is required for
example pain or inflammation.
[0009] Accordingly the present invention provides a compound of
formula (I)
##STR00002##
where X is (CH.sub.2).sub.m or CH.sub.2O, where m is 1 or 2; p is 0
or 1; R.sub.1 is phenyl or a 5 or 6 membered heteroaryl group
selected from the group consisting of imidazolyl, isoxazolyl,
pyridinyl, pyridazinyl or pyrimidinyl, which phenyl or heteroaryl
group is optionally substituted with 1 or 2 substituents selected
from the group consisting of (C.sub.1-4)alkyl, (C.sub.1-4)alkoxy,
halo, (CH.sub.2).sub.nNR.sub.5R.sub.6 where R.sub.5 and R.sub.6 are
independently H or (C.sub.1-4)alkyl and n is 0 or 1, pyrrolidinyl,
morpholinyl, piperidinyl, pyrrolidin(C.sub.1-4)alkyl,
morpholin(C.sub.1-4)alkyl, piperidin(C.sub.1-4)alkyl,
pyrrolidin(C.sub.1-4)alkoxy, morpholin(C.sub.1-4)alkoxy,
piperidin(C.sub.1-4)alkoxy wherein said pyrrolidinyl, morpholinyl
or piperidinyl groups are optionally substituted with halo or
(C.sub.1-4)alkyl, with the proviso that when R.sub.1 is phenyl or a
6 membered heteroaryl group, which phenyl or 6 membered heteroaryl
group has a substitutent on the atom at the para position, said
substituent is selected from the group consisting of methyl, ethyl,
isopropyl, methoxy, halo or (CH.sub.2).sub.nNR.sub.5R.sub.6 where
R.sub.5 and R.sub.6 are methyl; R.sub.2 is H, methoxy, ethoxy or
CH.sub.2OCH.sub.3; R.sub.3 is H, (C.sub.1-4)alkyl,
(C.sub.2-4)alkenyl, halo, cyano, furanyl or pyrazolyl, which
pyrazolyl is optionally substituted with 1 methyl group; R.sub.4 is
H or (C.sub.1-4)alkyl; or a pharmaceutically acceptable salt
thereof.
[0010] In one embodiment R.sub.1 is unsubstituted phenyl or an
unsubstituted 5 or 6 membered heteroaryl group selected from the
group consisting of imidazolyl, isoxazolyl, pyridinyl, pyridazinyl
or pyrimidinyl.
[0011] In one embodiment R.sub.1 is unsubstituted phenyl. In an
alternative embodiment R.sub.1 is phenyl which is substituted at
the 2 and 6 positions with methyl.
[0012] In one embodiment p is 0.
[0013] In one embodiment p is 1.
[0014] In one embodiment p is 1 and X is methyl or methoxy.
[0015] In one embodiment p is 1 and R.sub.1 is unsubstituted
phenyl.
[0016] In one embodiment R.sub.1 is phenyl substituted with
(C.sub.1-4)alkyl or (C.sub.1-4)alkoxy. In another embodiment
R.sub.1 is phenyl optionally substituted with methyl or
methoxy.
[0017] In one embodiment R.sub.1 is phenyl substituted with
(CH.sub.2).sub.nNR.sub.5R.sub.6 where R.sub.5 and R.sub.6 are
independently H and n is 0 or 1.
[0018] In one embodiment R.sub.1 is phenyl substituted with
pyrrolidinyl, morpholinyl, piperidinyl, pyrrolidin(C.sub.1-4)alkyl,
morpholin(C.sub.1-4)alkyl, piperidin(C.sub.1-4)alkyl,
pyrrolidin(C.sub.1-4)alkoxy, morpholin(C.sub.1-4)alkoxy,
piperidin(C.sub.1-4)alkoxy, halopyrrolidinylethoxy or
dihalopyrrolidinylethoxy. In another embodiment R.sub.1 is phenyl
substituted with pyrrolidinylethoxy, morpholinylmethoxy,
fluoropyrrolidinylethoxy or difluorpyrrolidinylethoxy.
[0019] In one embodiment R.sub.1 is pyridinyl substituted with
(C.sub.1-4)alkyl or (C.sub.1-4)alkoxy. In another embodiment
R.sub.1 is pyridinyl optionally substituted with methyl or
methoxy.
[0020] In one embodiment R.sub.1 is isoxazolyl substituted with 1
or 2 (C.sub.1-4)alkyl groups. In another embodiment R.sub.1 is
isoxazolyl substituted with 1 or 2 methyl groups.
[0021] In one embodiment R.sub.1 is imidazolyl substituted with 1
or 2 (C.sub.1-4)alkyl groups. In another embodiment R.sub.1 is
imidazolyl substituted with 1 or 2 methyl groups
[0022] In one embodiment R.sub.4 is H. In another embodiment
R.sub.4 is methyl.
[0023] In one embodiment R.sub.2 is H.
[0024] In one embodiment R.sub.3 is methyl.
[0025] In one embodiment R.sub.2 is methoxy or methoxymethyl.
[0026] In one embodiment R.sub.1 is phenyl, R.sub.2 is H and
R.sub.3 is methyl. In a further embodiment, R.sub.1 is phenyl,
R.sub.2 is H, R.sub.3 is methyl, R.sub.4 is H and p is 0.
[0027] For the avoidance of doubt the substituent
pyrrolidin(C.sub.1-4)alkyl or pyrrolidin(C.sub.1-4)alkoxy groups,
and the morpholinyl and piperidinyl equivalents thereof, are
attached to the phenyl or heteroaryl via the alkyl or alkoxy
moiety.
[0028] When the compound contains a (C.sub.1-4)alkyl group, whether
alone or forming part of a larger group, e.g. (C.sub.1-4)alkoxy,
the alkyl group may be straight chain, branched or cyclic, or
combinations thereof. Examples of (C.sub.1-4)alkyl are methyl or
ethyl. An example of a branched alkyl group is methylethyl. An
example of a cyclic alkyl is cyclopropyl. An example of
(C.sub.1-4)alkoxy is methoxy.
[0029] Examples of (C.sub.1-4)alkoxy include methoxy and
ethoxy.
[0030] Examples of (C.sub.2-4)alkenyl include ethenyl and
n-propenyl.
[0031] Halogen or "halo" means fluoro, chloro, bromo or iodo.
[0032] It is to be understood that the present invention covers all
combinations of particularised groups and substituents described
herein above.
[0033] In one embodiment the invention provides the compound of
formula (I) selected from the group consisting of: [0034]
N-[1-(7H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
[0035]
3-(Methyloxy)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzam-
ide; [0036]
3-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide; [0037]
4-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide; [0038]
2-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide; [0039]
3-[(Dimethylamino)methyl]-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperi-
dinyl]benzamide; [0040]
3-(1-Pyrrolidinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]b-
enzamide; [0041]
3-(4-Morpholinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide; [0042]
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-2-pyridinecarboxami-
de; [0043]
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-pyridin-
ecarboxamide; [0044]
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridinecarboxami-
de; [0045]
2-Methyl-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]--
4-pyridinecarboxamide; [0046]
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridazinecarboxa-
mide; [0047]
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-5-pyrimidinecarboxa-
mide; [0048]
2-(Methyloxy)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyr-
idinecarboxamide; [0049]
5-Methyl-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-isoxazol-
ecarboxamide; [0050]
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
[0051]
N-[1-(5-Ethyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benza-
mide; [0052]
N-{1-[5-(1-Methylethenyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}-
benzamide; [0053]
N-{1-[5-(1-Methylethyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}be-
nzamide; [0054]
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-2-pyridine-
carboxamide; [0055]
6-Methyl-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-
-pyridinecarboxamide; [0056]
2-(Methyloxy)-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidin-
yl]-4-pyridinecarboxamide; [0057]
3-(Methyloxy)-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidin-
yl]benzamide; [0058]
2-Methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-
-pyridinecarboxamide; [0059]
2-Methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide; [0060]
N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridine-
carboxamide; [0061]
3,5-dimethyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]-4-isoxazolecarboxamide; [0062]
N-[1-(5-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
[0063]
N-methyl-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benz-
amide; [0064]
2,6-dimethyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]benzamide; [0065]
N-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide; [0066]
1-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-1-
H-imidazole-5-carboxamide; [0067]
N-[3-(methyloxy)-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidin-
yl]benzamide; [0068]
N-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-
-pyridinecarboxamide; [0069]
N-[1-(5-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-N-methyl-4--
pyridinecarboxamide; [0070]
N-{1-[5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-pip-
eridinyl}benzamide; [0071]
N-{1-[5-(3-furanyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}benzam-
ide; [0072]
N-[3-[(methyloxy)methyl]-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-p-
iperidinyl]benzamide; [0073]
N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-{[2-(1-p-
yrrolidinyl)ethyl]oxy}benzamide; [0074]
N-[1-(5-chloro-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide;
[0075]
N-[1-(5-cyano-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benza-
mide; [0076]
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-{[2-(4-m-
orpholinyl)ethyl]oxy}benzamide; [0077]
3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)-N-[1-(5-methyl-1H-pyrrolo[-
2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide; [0078]
3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}-N-[1-(5-methyl-H-pyrrolo[2,-
3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide; [0079]
3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)-N-[1-(5-methyl-7H-pyrrolo[-
2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide; [0080]
2-(phenyloxy)-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]acetam-
ide; and [0081]
2-phenyl-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]acetamide,
or a pharmaceutically acceptable salt thereof.
[0082] In a further embodiment the invention provides the compound
of formula (I) which is
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
(E17) or a pharmaceutically acceptable salt thereof.
[0083] It will be appreciated that for use in medicine the salts of
the compounds of formula (I) should be pharmaceutically acceptable.
Suitable pharmaceutically acceptable salts will be apparent to
those skilled in the art. Pharmaceutically acceptable salts include
those described by Berge, Bighley and Monkhouse J Pharm Sci (1977)
66 pp 1-19. Such pharmaceutically acceptable salts include acid
addition salts formed with inorganic acids e.g. hydrochloric,
hydrobromic, sulphuric, nitric or phosphoric acid and organic acids
e.g. succinic, maleic, acetic, fumaric, citric, tartaric, benzoic,
p-toluenesulfonic, methanesulfonic or naphthalenesulfonic acid.
Other salts e.g. oxalates or formates, may be used, for example in
the isolation of compounds of formula (I) and are included within
the scope of this invention.
[0084] Certain of the compounds of formula (I) may form acid
addition salts with one or more equivalents of the acid. The
present invention includes within its scope all possible
stoichiometric and non-stoichiometric forms.
[0085] The compounds of formula (I) may be prepared in crystalline
or non-crystalline form and, if crystalline, may optionally be
solvated, eg. as the hydrate. This invention includes within its
scope stoichiometric solvates (eg. hydrates) as well as compounds
containing variable amounts of solvent (eg. water).
[0086] It will be understood that the invention includes
pharmaceutically acceptable derivatives of compounds of formula (I)
and that these are included within the scope of the invention.
[0087] As used herein "pharmaceutically acceptable derivative"
includes any pharmaceutically acceptable ester or salt of such
ester of a compound of formula (I) which, upon administration to
the recipient is capable of providing (directly or indirectly) a
compound of formula (I) or an active metabolite or residue
thereof.
[0088] The compounds of formula (I) may be achiral or R or S
enantiomers. Where additional chiral centres are present in
compounds of formula (I), the present invention includes within its
scope all possible enantiomers and diastereoisomers, including
mixtures thereof. The different isomeric forms may be separated or
resolved one from the other by conventional methods, or any given
isomer may be obtained by conventional synthetic methods or by
stereospecific or asymmetric syntheses. The invention also extends
to any tautomeric forms or mixtures thereof.
[0089] The subject invention also includes isotopically-labeled
compounds which are identical to those recited in formula (I) but
for the fact that one or more atoms are replaced by an atom having
an atomic mass or mass number different from the atomic mass or
mass number most commonly found in nature. Examples of isotopes
that can be incorporated into compounds of the invention include
isotopes of hydrogen, carbon, nitrogen, oxygen, fluorine, iodine
and chlorine such as .sup.3H, .sup.11C, .sup.14C, .sup.18F,
.sup.123I or .sup.125I.
[0090] Compounds of the present invention and pharmaceutically
acceptable salts of said compounds that contain the aforementioned
isotopes and/or other isotopes of other atoms are within the scope
of the present invention. Isotopically labeled compounds of the
present invention, for example those into which radioactive
isotopes such as .sup.3H or .sup.14C have been incorporated, are
useful in drug and/or substrate tissue distribution assays.
Tritiated, ie. .sup.3H, and carbon-14, ie. .sup.14C, isotopes are
particularly preferred for their ease of preparation and
detectability. .sup.11C and .sup.18F isotopes are particularly
useful in PET (positron emission tomography).
[0091] Since the compounds of formula (I) are intended for use in
pharmaceutical compositions it will readily be understood that they
are each preferably provided in substantially pure form, for
example at least 60% pure, more suitably at least 75% pure and
preferably at least 85%, especially at least 98% pure (% are given
on a weight for weight basis). Impure preparations of the compounds
may be used for preparing the more pure forms used in the
pharmaceutical compositions.
Schemes
[0092] According to a further aspect of the present invention there
is provided a process for the preparation of compounds of formula
(I) and derivatives thereof. The following schemes, schemes 1 to
13, are examples of synthetic schemes that may be used to
synthesise the compounds of the invention. In the following schemes
reactive groups can be protected with protecting groups and
deprotected according to well established techniques.
##STR00003##
##STR00004##
##STR00005##
##STR00006##
##STR00007##
##STR00008##
##STR00009##
##STR00010##
##STR00011##
##STR00012##
##STR00013##
##STR00014##
##STR00015##
[0093] It will be understood by those skilled in the art that
certain compounds of the invention can be converted into other
compounds of the invention according to standard chemical
methods.
[0094] The starting materials for use in the schemes are
commercially available, known in the literature or can be prepared
by known methods.
[0095] Pharmaceutically acceptable salts may be prepared
conventionally by reaction with the appropriate acid or acid
derivative.
[0096] The present invention provides compounds of formula (I) or a
pharmaceutically acceptable salt thereof for use in therapy.
[0097] The compounds of formula (I) or their pharmaceutically
acceptable salts may be of use for the treatment or prophylaxis of
a disease or disorder where an inhibitor of a human ASK1 is
required.
[0098] The compounds of formula (I) or their pharmaceutically
acceptable salts may be of use for the treatment or prophylaxis of
pain, for example, chronic articular pain (e.g. rheumatoid
arthritis, osteoarthritis, rheumatoid spondylitis, gouty arthritis
and juvenile arthritis) including the property of disease
modification and joint structure preservation; musculoskeletal
pain; lower back and neck pain; sprains and strains; neuropathic
pain; sympathetically maintained pain; myositis; pain associated
with cancer and fibromyalgia; pain associated with migraine; pain
associated with influenza or other viral infections, such as the
common cold; rheumatic fever; pain associated with functional bowel
disorders such as non-ulcer dyspepsia, non-cardiac chest pain and
irritable bowel syndrome; pain associated with myocardial ischemia;
post operative pain; headache; toothache; and dysmenorrhea.
[0099] The compounds of formula (I) or their pharmaceutically
acceptable salts may be particularly useful in the treatment or
prophylaxis of neuropathic pain and symptoms associated therewith.
Neuropathic pain syndromes include: diabetic neuropathy; sciatica;
non-specific lower back pain; multiple sclerosis pain;
fibromyalgia; HIV-related neuropathy; post-herpetic neuralgia;
trigeminal neuralgia; and pain resulting from physical trauma,
amputation, cancer, toxins, chemotherapy induced neuropathy or
chronic inflammatory conditions. Symptoms of neuropathic pain
include spontaneous shooting and lancinating pain, or ongoing,
burning pain. In addition, there is included pain associated with
normally non-painful sensations such as "pins and needles"
(paraesthesias and dysesthesias), increased sensitivity to touch
(hyperesthesia), painful sensation following innocuous stimulation
(dynamic, static or thermal allodynia), increased sensitivity to
noxious stimuli (thermal, cold or mechanical hyperalgesia),
continuing pain sensation after removal of the stimulation
(hyperpathia) or an absence of or deficit in selective sensory
pathways (hypoalgesia).
[0100] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment or prophylaxis
of inflammation, for example in the treatment of skin conditions
(e.g. sunburn, burns, eczema, dermatitis, psoriasis); ophthalmic
diseases such as glaucoma, retinitis, retinopathies, uveitis and of
acute injury to the eye tissue (e.g. conjunctivitis); lung
disorders (e.g. asthma, bronchitis, emphysema, allergic rhinitis,
respiratory distress syndrome, pigeon fancier's disease, farmer's
lung, COPD); gastrointestinal tract disorders (e.g. aphthous ulcer,
Crohn's disease, atopic gastritis, gastritis varialoforme,
ulcerative colitis, coeliac disease, regional ileitis, irritable
bowel syndrome, inflammatory bowel disease, gastrointestinal reflux
disease, diarrhoea, constipation); organ transplantation; other
conditions with an inflammatory component such as rheumatoid
arthritis, vascular disease, steatohepatitis, migraine,
periarteritis nodosa, thyroiditis, aplastic anaemia, Hodgkin's
disease, sclerodoma, myaesthenia gravis, multiple sclerosis,
sorcoidosis, nephrotic syndrome, Bechet's syndrome, polymyositis,
gingivitis, myocardial ischemia, pyrexia, systemic lupus
erythematosus, polymyositis, tendinitis, bursitis, and Sjogren's
syndrome.
[0101] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment or prophylaxis
of cardiovascular diseases such as hypertension or myocardial
ischemia; functional or organic venous insufficiency; varicose
therapy; haemorrhoids; shock states associated with a marked drop
in arterial pressure (e.g. septic shock); cardiac hypertrophy,
ventricular fibrosis, myocardial remodelling and
atherosclerosis.
[0102] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment or prophylaxis
of neurodegenerative diseases and neurodegeneration such as
dementia, particularly degenerative dementia (including senile
dementia, Alzheimer's disease, Pick's disease, Huntingdon's chorea,
Parkinson's disease and Creutzfeldt-Jakob disease, ALS and motor
neuron disease); vascular dementia (including multi-infarct
dementia); as well as dementia associated with intracranial space
occupying lesions; trauma; infections and related conditions
(including HIV infection); metabolism; toxins; anoxia and vitamin
deficiency; and mild cognitive impairment associated with ageing,
particularly Age Associated Memory Impairment.
[0103] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment or prophylaxis
of the underlying neuronal degeneration in neurodegenerative
diseases (including peripheral neuropathies, retinopathies,
glaucoma, macular degeneration, motor neurone disease, Parkinson's
disease, Alzheimer's disease, multiple sclerosis, Huntingdon's
chorea, stroke, cerebral ischemia and traumatic brain injury).
[0104] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment or prophylaxis
of neurological disorders and may be useful as neuroprotecting
agents. The compounds of the invention may also be useful in the
treatment of neurodegeneration following stroke, cardiac arrest,
pulmonary bypass, traumatic brain injury, spinal cord injury or the
like.
[0105] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment of
complications of Type 1 diabetes (e.g. diabetic microangiopathy,
diabetic retinopathy, diabetic nephropathy, macular degeneration,
glaucoma), nephrotic syndrome, diabetic cardiomyopathy, aplastic
anaemia, uveitis, Kawasaki disease and sarcoidosis as well as
disorders of fat metabolism which may be associated with diabetes
or obesity for example hepatic steatosis.
[0106] The compounds of formula (I) or their pharmaceutically
acceptable salts may also be useful in the treatment of cancers for
example hepatocellular carcinoma, melanoma, gastric cancer,
liposarcoma and cancers caused by oxidative stresses for example
cervical spondylotic myelopathy.
[0107] The invention also provides a method of treating or
preventing pain, for example those pain indications mentioned
hereinabove, or a disease or disorder mentioned hereinabove, which
comprises administering to a subject in need thereof an effective
amount of a compound of formula (I) or a pharmaceutically
acceptable salt thereof.
[0108] The invention also provides a compound of formula (I), or a
pharmaceutically acceptable salt thereof, for use in the treatment
or prophylaxis of pain, for example those pain indications
mentioned hereinabove, or a disease or disorder mentioned
hereinabove.
[0109] The invention also provides the use of a compound of formula
(I), or a pharmaceutically acceptable salt thereof, in the
manufacture of a medicament for the treatment or prophylaxis of
pain, for example those pain indications mentioned hereinabove, or
a disease or disorder mentioned hereinabove.
[0110] For use in therapy the compounds of the invention are
usually administered as a pharmaceutical composition. The invention
also provides a pharmaceutical composition comprising a compound of
formula (I), or a pharmaceutically acceptable salt thereof, and a
pharmaceutically acceptable carrier.
[0111] The compounds of formula (I) or their pharmaceutically
acceptable salts may be administered by any convenient method, e.g.
by oral, parenteral, buccal, sublingual, nasal, rectal or
transdermal administration, and the pharmaceutical compositions
adapted accordingly.
[0112] The compounds of formula (I) or their pharmaceutically
acceptable salts which are active when given orally can be
formulated as liquids or solids, e.g. as syrups, suspensions,
emulsions, tablets, capsules or lozenges.
[0113] A liquid formulation will generally consist of a suspension
or solution of the active ingredient in a suitable liquid
carrier(s) e.g. an aqueous solvent such as water, ethanol or
glycerine, or a non-aqueous solvent, such as polyethylene glycol or
an oil. The formulation may also contain a suspending agent,
preservative, flavouring and/or colouring agent.
[0114] A composition in the form of a tablet can be prepared using
any suitable pharmaceutical carrier(s) routinely used for preparing
solid formulations, such as magnesium stearate, starch, lactose,
sucrose and cellulose.
[0115] A composition in the form of a capsule can be prepared using
routine encapsulation procedures, e.g. pellets containing the
active ingredient can be prepared using standard carriers and then
filled into a hard gelatin capsule; alternatively a dispersion or
suspension can be prepared using any suitable pharmaceutical
carrier(s), e.g. aqueous gums, celluloses, silicates or oils and
the dispersion or suspension then filled into a soft gelatin
capsule.
[0116] Typical parenteral compositions consist of a solution or
suspension of the active ingredient in a sterile aqueous carrier or
parenterally acceptable oil, e.g. polyethylene glycol, polyvinyl
pyrrolidone, lecithin, arachis oil or sesame oil. Alternatively,
the solution can be lyophilised and then reconstituted with a
suitable solvent just prior to administration.
[0117] Compositions for nasal administration may conveniently be
formulated as aerosols, drops, gels and powders. Aerosol
formulations typically comprise a solution or fine suspension of
the active ingredient in a pharmaceutically acceptable aqueous or
non-aqueous solvent and are usually presented in single or
multidose quantities in sterile form in a sealed container which
can take the form of a cartridge or refill for use with an
atomising device.
[0118] Alternatively the sealed container may be a disposable
dispensing device such as a single dose nasal inhaler or an aerosol
dispenser fitted with a metering valve. Where the dosage form
comprises an aerosol dispenser, it will contain a propellant which
can be a compressed gas e.g. air, or an organic propellant such as
a fluorochlorohydrocarbon or hydrofluorocarbon. Aerosol dosage
forms can also take the form of pump-atomisers.
[0119] Compositions suitable for buccal or sublingual
administration include tablets, lozenges and pastilles where the
active ingredient is formulated with a carrier such as sugar and
acacia, tragacanth, or gelatin and glycerin.
[0120] Compositions for rectal administration are conveniently in
the form of suppositories containing a conventional suppository
base such as cocoa butter.
[0121] Compositions suitable for transdermal administration include
ointments, gels and patches.
[0122] In one embodiment the composition is in unit dose form such
as a tablet, capsule or ampoule.
[0123] The dose of the compound of formula (I), or a
pharmaceutically acceptable salt thereof, used in the treatment or
prophylaxis of the abovementioned disorders or diseases will vary
in the usual way with the particular disorder or disease being
treated, the weight of the subject and other similar factors.
However, as a general rule, suitable unit doses may contain from
0.1% to 100% by weight, for example from 10 to 60% by weight, of
the active material, depending on the method of administration. The
composition may contain from 0% to 99% by weight, for example 40%
to 90% by weight, of the carrier, depending on the method of
administration. The composition may contain from 0.05 mg to 1000
mg, for example from 1.0 mg to 500 mg, of the active material,
depending on the method of administration. The composition may
contain from 50 mg to 1000 mg, for example from 100 mg to 400 mg of
the carrier, depending on the method of administration. The dose of
the compound used in the treatment of the aforementioned disorders
will vary in the usual way with the seriousness of the disorders,
the weight of the sufferer, and other similar factors. However, as
a general guide suitable unit doses may be 0.05 to 1000 mg, more
suitably 1.0 to 500 mg, and such unit doses may be administered
more than once a day, for example two or three a day. Such therapy
may extend for a number of weeks or months.
[0124] Compounds of the invention may be identified and
characterised using screening procedures and assays including, for
example, activity assays and functional assays.
[0125] An example of an assay that may be used to characterise
compounds which inhibit the activity of ASK1 is one that uses
IMAP.TM. technology. In this method ASK1 activity is measured in an
immobilised metal ion affinity-based fluorescence polarisation
(IMAP.TM. FP) assay, which measures the degree of phosphorylation
of a fluorescently labelled peptide substrate. IMAP.TM. technology
is based on high affinity binding of phosphate at high salt
concentrations by immobilized metal (M.sup.III). The IMAP.TM.
"binding reagent" complexes with phosphate groups on the
phosphopeptide generated by the kinase reaction. Binding causes a
change in the rate of the molecular motion of the peptide,
resulting in an increase in fluorescence polarization (FP)
observed. Hence, inhibition of activity is seen as a decrease in FP
signal due to a lack of phospho-peptide.
[0126] Another example of an activity assay is an AlphaLISA.RTM.
assay (Eglen R M et al. (2008) Curr Chem Genomics 1 p 2). In this
assay ASK1 activity is determined by measuring the degree of
phosphorylation of a protein substrate (for example MKK4 or MKK7).
AlphaLISA.RTM. technology is based on the binding of a substrate to
two types of beads: acceptor and donor. Binding to one bead is
through the tag of the substrate protein. Binding of the second
bead is through phosphospecific binding of an antibody to the
phosphosite of the substrate. This forms a sandwich, with the
acceptor and donor beads in close proximity. When the donor beads
are excited by light in the 680 nm range, a singlet oxygen is
released and causes emission of light from the acceptor in the 620
nm range which can be detected in a suitable reader.
[0127] A suitable binding assay for determining ASK1 activity is a
fluorescence polarisation (FP) ligand binding assay. As an example,
this assay may involve the use of a Rhodamine Green labelled
promiscuous kinase inhibitor that can be used as a competitor.
[0128] The present invention also provides ASK1 inhibitors, or
their pharmaceutically acceptable salts, for use in the treatment
or prophylaxis of pain, for example chronic articular pain (e.g.
rheumatoid arthritis, osteoarthritis, rheumatoid spondylitis, gouty
arthritis and juvenile arthritis) including the property of disease
modification and joint structure preservation; musculoskeletal
pain; lower back and neck pain; sprains and strains; neuropathic
pain; sympathetically maintained pain; myositis; pain associated
with cancer and fibromyalgia; pain associated with migraine; pain
associated with influenza or other viral infections, such as the
common cold; rheumatic fever; pain associated with functional bowel
disorders such as non-ulcer dyspepsia, non-cardiac chest pain and
irritable bowel syndrome; pain associated with myocardial ischemia;
post operative pain; headache; toothache; and dysmenorrhea.
[0129] In particular ASK1 inhibitors or their pharmaceutically
acceptable salts may be particularly useful in the treatment or
prophylaxis of neuropathic pain and symptoms associated therewith.
Neuropathic pain syndromes include: diabetic neuropathy; sciatica;
non-specific lower back pain; multiple sclerosis pain;
fibromyalgia; HIV-related neuropathy; post-herpetic neuralgia;
trigeminal neuralgia; and pain resulting from physical trauma,
amputation, cancer, toxins or chronic inflammatory conditions.
Symptoms of neuropathic pain include spontaneous shooting and
lancinating pain, or ongoing, burning pain. In addition, there is
included pain associated with normally non-painful sensations such
as "pins and needles" (paraesthesias and dysesthesias), increased
sensitivity to touch (hyperesthesia), painful sensation following
innocuous stimulation (dynamic, static or thermal allodynia),
increased sensitivity to noxious stimuli (thermal, cold or
mechanical hyperalgesia), continuing pain sensation after removal
of the stimulation (hyperpathia) or an absence of or deficit in
selective sensory pathways (hypoalgesia).
[0130] The invention also provides a method of treating pain, for
example those pain indications mentioned hereinabove, which
comprises administering to a subject in need thereof an effective
amount of an ASK1 inhibitor or a pharmaceutically acceptable salt
thereof.
[0131] The invention also provides an ASK1 inhibitor, or a
pharmaceutically acceptable salt thereof, for use in the treatment
or prophylaxis of pain, for example those pain indications
mentioned hereinabove.
[0132] The invention also provides the use of an ASK1 inhibitor, or
a pharmaceutically acceptable salt thereof, in the manufacture of a
medicament for the treatment or prophylaxis of pain, for example
those pain indications mentioned hereinabove.
[0133] For use in therapy the ASK1 inhibitors are usually
administered as a pharmaceutical composition for example a
composition comprising an ASK1 inhibitor or a pharmaceutically
acceptable salt thereof, and a pharmaceutically acceptable carrier.
Examples of such compositions, and methods of administration
thereof, which compositions comprise a compound of formula (I) or a
pharmaceutically acceptable salt thereof, are described
hereinabove. Such compositions and methods of administration may
also be used for other ASK1 inhibitors or pharmaceutically
acceptable salts thereof, in the treatment of pain, for example
those pain indications mentioned hereinabove.
[0134] ASK1 inhibitors for use in the treatment of pain, for
example those pain indications mentioned hereinabove may be
identified and characterised using screening procedures as
described hereinabove.
[0135] Throughout the specification and claims which follow, unless
the context requires otherwise, the word `comprise`, and variations
such as `comprises` and `comprising` will be understood to imply
the inclusion of a stated integer or step or group of integers but
not to the exclusion of any other integer or step or group of
integers or steps.
[0136] All publications, including but not limited to patents and
patent applications, cited in this specification are herein
incorporated by reference as if each individual publication were
specifically and individually indicated to be incorporated by
reference herein as though fully set forth.
[0137] The following Examples illustrate the preparation of certain
compounds of formula (I) or salts thereof. The Descriptions 1 to 54
illustrate the preparation of intermediates used to make compounds
of formula (I) or salts thereof.
[0138] In the procedures that follow, after each starting material,
reference to a description is typically provided. This is provided
merely for assistance to the skilled chemist. The starting material
may not necessarily have been prepared from the Description
referred to.
[0139] The yields were calculated assuming that products were 100%
pure if not stated otherwise.
ABBREVIATIONS
[0140] ACN Acetonitrile [0141] Aza-HOBt
1-Hydroxy-7-azabenzotriazole [0142] BOC t-Butyloxycarbonyl [0143]
nBu-Li n-Butyl Lithium [0144] CDCl.sub.3 deuterated chloroform
[0145] CHCl.sub.3 Chloroform [0146] DCM Dichloromethane [0147]
DIPEA N,N-Diisopropylethylamine [0148] DMF N,N-Dimethylformamide
[0149] DMSO Dimethylsulphoxide [0150] EA Ethyl acetate [0151] EDC
N-(3-Dimethylaminopropyl)-N'-ethylcarbodiimide hydrochloride [0152]
e.e Enantiomeric excess [0153] Et.sub.2O Diethyl ether [0154] EtOAc
Ethyl acetate [0155] ETOH Ethanol [0156] HATU
O-(7-Azabenzotriazol-1-yl)-N,N,N',N'-tetramethyluronium [0157]
hexafluorophosphate [0158] HCl Hydrogen chloride [0159] H.sub.2O
Water [0160] HOAt 1-Hydroxy-7-azabenzotriazole [0161] HOBt
1-Hydroxybenzotriazole [0162] H.sub.2SO.sub.4 Sulfuric acid [0163]
K.sub.2CO.sub.3 Potassium carbonate [0164] LCMS Liquid
chromatography coupled to mass spectrometer [0165] LiBF.sub.4
Lithium tetrafluoroborate [0166] MDAP Mass-directed auto
preparative high performance liquid chromatography [0167] MeCN
Acetonitrile [0168] MeOH Methanol [0169] MgSO.sub.4 Magnesium
Sulfate [0170] Na.sub.2CO.sub.3 Sodium carbonate [0171] NaHCO.sub.3
Sodium bicarbonate [0172] NaOH Sodium hydroxide [0173]
Na.sub.2SO.sub.4 Sodium Sulfate [0174] NBS N-Bromo succinimide
[0175] NCS N-Chloro succinimide [0176] NH.sub.3 Ammonia [0177]
NH.sub.4Cl Ammonium chloride [0178] NH.sub.4HCO.sub.3 Ammonium
bicarbonate [0179] NMP 1-methyl 2-pyrrolidinone [0180] NMR nuclear
magnetic resonance [0181] Pd/C Palladium on carbon [0182]
PdCl.sub.2(dppf)-CH.sub.2Cl.sub.2
[1,1'-Bis(diphenylphosphino)ferrocene]dichloropalladium(II); [0183]
complex with Dichloromethane [0184] Pet Eth petroleum ether [0185]
Pol-NMM Polymer supported morpholine [0186] SCX-2 silica-based
sorbent with a chemically bonded propylsulfonic acid functional
group [0187] Si--NH.sub.2 Silica based sorbant with chemically
bonded aminopropyl functional group [0188] TEA Triethylamine [0189]
TFA Trifluoroacetic acid [0190] THF Tetrahydrofuran
Mass-Directed Automated HPLC
[0191] Where applicable, purification by mass-directed automated
HPLC was carried out using the following apparatus and
conditions:
Hardware:
[0192] Waters 2525 Binary Gradient Module [0193] Waters 515 Makeup
Pump [0194] Waters Pump Control Module [0195] Waters 2767 Inject
Collect [0196] Waters Column Fluidics Manager [0197] Waters 2996
Photodiode Array Detector [0198] Waters ZQ Mass Spectrometer [0199]
Gilson 202 fraction collector [0200] Gilson Aspec waste collector
Software: Waters MassLynx version 4 SP2 Column: the columns used
were Waters Atlantis, the dimensions of which are 19 mm.times.100
mm (small scale) and 30 mm.times.100 mm (large scale). The
stationary phase particle size is 5 .mu.m.
Acidic Method:
Solvents:
[0201] A: Aqueous solvent=Water+0.1% Formic Acid B: Organic
solvent=Acetonitrile+0.1% Formic Acid Make up solvent=Methanol:
Water 80:20 Needle rinse solvent=Methanol
Methods:
[0202] There are five methods used depending on the analytical
retention time of the compound of interest. They have a 13.5-minute
runtime, which comprises of a 10-minute gradient followed by a 3.5
minute column flush and re-equilibration step.
Large/Small Scale 1.0-1.5 (HPLC), 0.4-0.6 (UPLC)=5-30% B
Large/Small Scale 1.5-2.2 (HPLC), 0.6-0.9 (UPLC)=15-55% B
Large/Small Scale 2.2-2.9 (HPLC), 0.9-1.2 (UPLC)=30-85% B
Large/Small Scale 2.9-3.6 (HPLC), 1.2-1.4 (UPLC)=50-99% B
[0203] Large/Small Scale 3.6-5.0 (HPLC), 1.4-2.0 (UPLC)=80-99% B
(in 6 minutes followed by 7.5 minutes flush and re-equilibration)
Flow rate: all of the above methods have a flow rate of either 20
mls/min (Small Scale) or 40 mls/min (Large Scale).
High pH Method:
[0204] Column: the HPLC analysis was conducted on an XBridge C18
column (100 nm.times.19 nm i.d. 5 .mu.m packing diameter) at
ambient temperature
Solvents:
[0205] A: 10 mM Ammonium bicarbonate in water, adjusted to pH 10
with ammonia solution.
B: Acetonitrile.
Methods:
[0206] There are five methods used depending on the analytical
retention time of the compound of interest. They have a 15-minute
runtime, which comprises of a 10 minute gradient followed by a 5
minute column flush and re-equilibration step.
Large/Small Scale 1.0-1.5 (HPLC), 0.4-0.6 (UPLC)=1-30% B
Large/Small Scale 1.5-2.2 (HPLC), 0.6-0.9 (UPLC)=15-55% B
Large/Small Scale 2.2-2.9 (HPLC), 0.9-1.2 (UPLC)=30-85% B
Large/Small Scale 2.9-3.6 (HPLC), 1.2-1.4 (UPLC)=50-99% B
[0207] Large/Small Scale 3.6-5.0 (HPLC), 1.4-2.0 (UPLC)=80-99% B
(in 6 minutes followed by 7.5 minutes flush an re-equilibration)
Flow rate: all of the above methods have a flow rate of either 20
ml/min (small scale) or 40 ml/min (large scale)
Liquid Chromatography/Mass Spectrometry
[0208] Analysis of the above Examples by Liquid Chromatography/Mass
Spectrometry (LC/MS) was carried out using the apparatus and
conditions indicated in the methods shown below:
Liquid Chromatography:
5 Minute Method:
Formic Acid Generic Analytical HPLC Open Access LC/MS
[0209] The HPLC analysis was conducted on a Sunfire C18 column (30
mm.times.4.6 mm i.d. 3.5 m packing diameter) at 30 degrees
centigrade.
[0210] The solvents employed were:
A: 0.1% v/v solution of Formic Acid in Water. B: 0.1% v/v solution
of Formic Acid in Acetonitrile.
TABLE-US-00001 Time Flow Rate (min) (ml/min) % A % B 0 3 97 3 0.1 3
97 3 4.2 3 0 100 4.8 3 0 100 4.9 3 97 3 5.0 3 97 3
[0211] The UV detection was an averaged signal from wavelength of
210 nm to 350 nm and mass spectra were recorded on a mass
spectrometer using alternate-scan positive and negative mode
electrospray ionization.
2 Minute Method:
Formic Acid Generic Analytical UPLC Open Access LC/MS
[0212] The UPLC analysis was conducted on an Acquity UPLC BEH C18
column (2.1 mm.times. 50 mm i.d. 1.7 m packing diameter) at 40
degrees centigrade.
[0213] The solvents employed were:
A: 0.1% v/v solution of Formic Acid in Water. B: 0.1% v/v solution
of Formic Acid in Acetonitrile.
TABLE-US-00002 Time Flow Rate (min) (ml/min) % A % B 0 1 97 3 1.5 1
0 100 1.9 1 0 100 2.0 1 97 3
[0214] The UV detection was an averaged signal from wavelength of
210 nm to 350 nm and mass spectra were recorded on a mass
spectrometer using alternate-scan positive and negative mode
electrospray ionization.
High pH 5 minute Method:
High pH Generic Analytical HPLC Open Access LC/MS 5 Minute
Method
[0215] The HPLC analysis was conducted on an XBridge C18 column (50
mm.times.4.6 mm i.d. 3.5 .mu.m packing diameter) at 30 degrees
centigrade.
[0216] The solvents employed were:
A: 10 mM Ammonium bicarbonate in water, adjusted to pH 10 with
ammonia solution.
B: Acetonitrile.
[0217] The gradient employed was:
TABLE-US-00003 Time (min) Flow Rate (ml/min) % A % B 0 3 99 1 0.1 3
99 1 4.0 3 3 97 5.0 3 3 97
[0218] The UV detection was an averaged signal from wavelength of
210 nm to 350 nm and mass spectra were recorded on a mass
spectrometer suing alternate-scan positive and negative mode
electrospray ionization.
High pH 2 minute Method: High pH Generic analytical UPLC Open
Access LC/MS 2 Minute Method The UPLC analysis was conducted on an
Acquity UPLC BEH C18 column (2.1 mm.times.50 mm i.d. 1.7 m packing
diameter) at 40 degrees centigrade.
[0219] The solvents employed were:
A: 10 mM Ammonium bicarbonate in water adjusted to pH 10 with
ammonia solution.
B: Acetonitrile.
[0220] The gradient employed was:
TABLE-US-00004 Time (min) Flow Rate (ml/min) % A % B 0 1 99 1 1.5 1
3 97 1.9 1 3 97 2.0 1 0 100
[0221] The UV detection was an averaged signal from wavelength of
220 nm to 350 nm and mass spectra were recorded on a mass
spectrometer using alternate-scan positive and negative mode
electrospray iodization.
Description 1 (D1)
1,1-dimethylethyl[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbam-
ate
##STR00016##
[0223] A mixture of 4-chloro-7H-pyrrolo[2,3-d]pyrimidine (0.154 g,
1 mmol) and 1,1-dimethylethyl 4-piperidinylcarbamate (0.240 g,
1.200 mmol) in ethanol (3 mL) was microwaved at 130.degree. C. for
15 minutes. The white solid precipitate was filtered and washed
with Et.sub.2O to give the title product D1 (171 mg), .sup.1H NMR
(d6-DMSO) .delta. 11.68 (1H, brs), 8.12 (1H, s), 7.17 (1H, dd),
6.87 (1H, d), 6.56 (1H, dd), 4.59 (2H, dt), 3.58 (1H, m), 3.15 (2H,
dt), 1.83 (2H, m), 1.39 (9H, s), 1.36 (2H, m), MS(ES+) 318
[M+H].sup.+.
Description 2 (D2)
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
##STR00017##
[0225] Trifluoroacetic acid (TFA) (5 ml) was added to
1,1-dimethylethyl[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carba-
mate D1 (0.945 g). The mixture was stirred at room temperature for
1 hour the TFA was evaporated. The crude mixture was purified by a
10 g Isolute SCX-2 silica cartridge (Biotage) eluting with MeOH
then with a 2M NH.sub.3 in MeOH solution. The product-containing
fraction was evaporated and the crude product was triturated with
Et.sub.2O to give the title product D2 (653 mg), .sup.1H NMR
(d6-DMSO) .delta. 11.68 (1H, brs), 8.12 (1H, s), 7.16 (1H, dd),
6.60 (1H, d), 4.56 (2H, dt), 4.10 (1H, brs), 3.30 (3H, m), 2.90
(1H, m), 1.80 (2H, m), 1.25 (2H, m), MS(ES+) 218 [M+H].sup.+.
Description 3 (D3)
5-Bromo-4-chloro-7H-pyrrolo[2,3-d]pyrimidine
##STR00018##
[0227] To a solution of 4-chloro-7H-pyrrolo[2,3-d]pyrimidine (2 g,
13.02 mmol) in DMF (40 mL) was added N-bromosuccinimide (2.318 g,
13.02 mmol) and the solution was stirred for 1 hour. LCMS showed
almost complete conversion, but 50 mg of NBS was added to complete
the reaction. The solvent was removed in vacuo and the resulting
solid triturated with water and then washed with further water
before drying in a vacuum oven for 18 hours at 50.degree. C. D3
(2.613 g) was obtained as a pale brown solid, .sup.1H NMR (d6-DMSO)
.delta. 13.0 (1H, brs), 8.63 (1H, s), 7.96 (1H, s), MS(ES+) 232
[M(C.sub.6H.sub.3.sup.79Br.sup.35ClN.sub.3)+H].sup.+.
Description 4 (D4)
4-Chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine
##STR00019##
[0229] To a solution of
5-bromo-4-chloro-7H-pyrrolo[2,3-d]pyrimidine D3 (300 mg) in THF (10
mL) at -78.degree. C. under argon was added n-butyllithium (1.16
mL, 2.90 mmol, 2.5M in hexanes) and the reaction was stirred for 20
minutes. Iodomethane (0.11 mL, 1.742 mmol) was then added dropwise
and the reaction allowed to warm to room temperature in the cold
bath. The reaction was quenched with water (1 mL) and the mixture
concentrated in vacuo. The residue was partitioned between EtOAc
(20 mL) and water (10 mL) and the organic phase was washed with
brine (10 mL) before it was dried (MgSO.sub.4), filtered and the
solvent removed in vacuo. Attempting to dissolve the compound in
DCM with some MeOH, gave some precipitate that was filtered off.
This precipitate corresponds to pure D4. The filtrate was purified
by silica chromatography, eluting 0-5% MeOH in DCM to give D4 as a
pale grey solid. The pure D4 fractions were combined (136 mg) and
analysed, NMR (d6-DMSO) .delta. 12.25 (1H, brs), 8.51 (1H, s), 7.44
(1H, s), 2.41 (3H, s), MS(ES+) 168
[M(C.sub.7H.sub.6.sup.35ClN.sub.3)+H].sup.+.
Description 5 (D5)
5-bromo-4-chloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidine
##STR00020##
[0231] To a solution of
5-bromo-4-chloro-7H-pyrrolo[2,3-d]pyrimidine D3 (1.00 g) in DMF (10
mL) at 0.degree. C. was added sodium hydride (0.224 g, 5.59 mmol)
and the mixture stirred for 20 minutes. Benzenesulfonyl chloride
(0.66 mL, 5.16 mmol) was then added dropwise and the reaction
mixture stirred in the cool bath for 1 hour. The mixture was poured
onto water (140 mL) and the precipitate filtered, washed with water
and dried in a vacuum oven to give D5 (1.60 g) as an off white
solid, .sup.1H NMR (CDCl.sub.3) .delta. 8.77 (1H, s), 8.23 (2H,
dd), 7.85 (1H, s), 7.70 (1H, m), 7.59 (2H, ddd), MS(ES+) 372
[M(C.sub.12H.sub.7.sup.79Br.sup.35ClN.sub.3O.sub.2S)+H].sup.+. The
crude product was used without further purification into the
preparation of D6.
Description 6 (D6)
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperi-
dinyl}benzamide
##STR00021##
[0233] A mixture of
5-bromo-4-chloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidine
(1.60 g) D5, N-4-piperidinylbenzamide (1.316 g, 6.44 mmol) and
DIPEA (1.87 mL, 10.73 mmol) in NMP (8 mL) was heated in the
microwave at 150.degree. C. for 20 minutes. The mixture was
partitioned between EtOAc (70 mL) and water (60 mL), and the
organic phase washed with water (2.times.60 mL) and brine (50 mL)
before it was dried (MgSO.sub.4), filtered and the solvent removed
in vacuo. The crude material was purified by silica chromatography,
eluting 0-5% MeOH in DCM to give D6 as a pure white solid (338 mg),
.sup.1H NMR (CDCl.sub.3) .delta. 8.47 (1H, s), 8.23 (2H, dd), 7.75
(2H, dd), 7.63 (2H, m), 7.52 (3H, m), 6.95 (2H, m), 6.02 (1H, d),
4.28 (1H, m), 4.24 (2H, dt), 3.22 (2H, dt), 2.19 (2H, m), 1.73 (2H,
m), MS(ES+) 540 [M(C.sub.24H.sub.22.sup.79BrN.sub.5O3
S)+H].sup.+.
Description 7 (D7)
N-{1-[5-ethyl-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperi-
dinyl}benzamide
##STR00022##
[0235] To a suspension of
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piper-
idinyl}benzamide D6 (200 mg) in 1,4-dioxane (3 mL) under a flush of
argon was added diethylzinc (0.74 mL, 0.740 mmol) (1M in THF)
followed by PdCl.sub.2(dppf)-CH.sub.2Cl.sub.2 adduct (30.2 mg,
0.037 mmol) and the mixture heated to reflux at 100.degree. C. for
1 hour. The mixture was allowed to cool and was partioned between
EtOAc (10 mL) and aqueous sodium bicarbonate (10 mL). The organic
phase was washed with water (10 mL) and brine (10 mL) before it was
dried (MgSO.sub.4), filtered and the solvent removed in vacuo to
give crude D7 (174 mg), which was used directly for the preparation
of Example 18. MS(ES+) 490 [M+H].sup.+.
Description 8 (D8)
N-{1-[5-(1-methylethenyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4--
yl]-4-piperidinyl}benzamide
##STR00023##
[0237] To a mixture of
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piper-
idinyl}benzamide D6 (600 mg),
4,4,5,5-tetramethyl-2-(1-methylethenyl)-1,3,2-dioxaborolane (373
mg, 2.220 mmol) and sodium carbonate (235 mg, 2.220 mmol) in
1,2-dimethoxyethane (7 mL) and water (3 mL) was added
bis(triphenylphosphine)palladium(II) chloride (39.0 mg, 0.056
mmol). The mixture was heated in the microwave at 100.degree. C.
for 20 minutes. The mixture was partitioned between EtOAc (50 mL)
and water (40 mL) and the layers separated. The organic phase was
washed with water (2.times.40 mL) and brine (30 mL), dried
(MgSO.sub.4) and the solvent removed in vacuo. The crude product
was purified by silica column, eluting 0-5% MeOH in DCM to give D8
(442 mg) as a white solid, .sup.1H NMR (d6-DMSO) .delta. 8.39 (1H,
s), 8.20 (2H, dd), 7.80 (4H, m), 7.72 (2H, m), 7.51 (1H, m), 7.46
(2H, dd), 5.24 (1H, d), 5.17 (1H, d), 4.05 (2H, dt), 3.65 (1H, m),
3.05 (2H, dt), 2.11 (3H, s), 1.82 (2H, m), 1.62 (2H, m), MS(ES+)
502 [M+H].sup.+.
Description 9 (D9)
N-{1-[5-(1-methylethyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl-
]-4-piperidinyl}benzamide
##STR00024##
[0239] To a solution of
N-{1-[5-(1-methylethenyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-
-yl]-4-piperidinyl}benzamide D8 (150 mg) in ethanol (40 mL) was
added Pd on carbon (20 mg) and the reaction stirred under an
atmosphere of hydrogen for 3 hours. The reaction was left for a
further 18 hours before the mixture was filtered through celite and
the filtrate concentrated in vacuo to give D9 (143 mg). The product
was not purified further, but used crude for the synthesis of
Example 20, .sup.1H NMR (d6-DMSO) .delta. 8.40 (1H, s), 8.20 (2H,
dd), 7.80 (4H, m), 7.72 (2H, m), 7.51 (1H, m), 7.46 (2H, dd), 4.07
(1H, m), 3.90 (2H, dt), 3.15 (1H, m), 3.05 (2H, dt), 1.90 (2H, m),
1.60 (2H, m), 1.29 (3H, d), 1.27 (3H, d), MS(ES+) 504
[M+H].sup.+.
Description 10 (D10)
1,1-dimethylethyl
[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbamate
##STR00025##
[0241] A mixture of 4-chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine
D4 (1.50 g), 1,1-dimethylethyl 4-piperidinylcarbamate (2.69 g,
13.43 mmol) and DIPEA (3.91 mL, 22.38 mmol) in NMP (10 mL) was
heated in the microwave at 150.degree. C. for 20 minutes. The
mixture was partitioned between EtOAc (70 mL) and water (70 mL) and
the organic phase washed with water (2.times.50 mL) and brine (50
mL) before it was dried (MgSO.sub.4), filtered and the solvent
removed in vacuo. The crude product was purified by silica
chromatography, eluting 40-100% EtOAc in isohexane to give D10
(1.395 g), .sup.1H NMR (d6-DMSO) .delta. 11.55 (1H, brs), 8.18 (1H,
s), 7.04 (1H, s), 6.90 (1H, d), 3.94 (2H, dt), 3.47 (1H, m), 2.96
(2H, dt), 2.32 (3H, s), 1.86 (2H, m), 1.53 (2H, m), 1.36 (9H, s),
MS(ES+) 332 [M+H].sup.+.
Description 11 (D11)
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride
##STR00026##
[0243] 4M HCl in dioxane (10 mL) was added to 1,1-dimethylethyl
[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbamate
D10 (1.39 g) and the mixture stirred at room temperature for 1.5
hour. The white precipitate was filtered off, washed with dioxane
and then Et.sub.2O before it was dried in a vacuum oven to give D11
(1.149 g) as a white solid, .sup.1H NMR (d6-DMSO) .delta. 12.60
(1H, brs), 8.36 (1H, s), 8.34 (2H, m), 7.35 (1H, s), 4.20 (3H, m),
3.40 (2H, dt), 2.37 (3H, s), 2.10 (2H, m), 1.80 (2H, m), MS(ES+)
232 [M+H].sup.+.
Description D11a (D11a)
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
##STR00027##
[0245] Trifluoroacetic acid (TFA) (5 ml) was added to a solution of
1,1-dimethylethyl
[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbamate
D10 (580 mg, 1.313 mmol). The mixture was stirred at room
temperature during one hour. The solvent was evaporated and
purified using and SCX cartridge (5 g). The cartridge was washed
sequentially with MeOH and then Ammonia in MeOH (0.5M and 1M). The
washings with Amonia in methanol 0.5M and 1M were combined and
evaporated to give D11a (280 mg) as a white solid. LCMS [M+H].sup.+
232 @ 0.36 mins (2 minute run).
Description 12 (D12)
1,1-dimethylethyl
methyl[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbamate
##STR00028##
[0246] 1) a mixture of 4-chloro-1H-pyrrolo[2,3-d]pyrimidine (307
mg, 2 mmol, commercially available from e.g. Aldrich, Apollo or
Matrix) and 1,1-dimethylethyl methyl(4-piperidinyl)carbamate (429
mg, 2.000 mmol, commercially available from e.g. Fluorochem,
Astatech or Apollo) in Ethanol (4 ml) was microwaved twice at
130.degree. C. for 15 min on normal absorption. After evaporation
of the solvent, the crude product was purified via MDAP using the
High pH extended method. Fractions containing product from each
MDAP were combined and evaporated to give D12 as a white solid in
139 mg. LCMS [M+H]+ 332.06 @0.76 min (2 min run) 2) a mixture of
4-chloro-1H-pyrrolo[2,3-d]pyrimidine (307 mg, 2 mmol, commercially
available from e.g. Aldrich, Apollo or Matrix) and
1,1-dimethylethyl methyl(4-piperidinyl)carbamate (429 mg, 2.000
mmol, commercially available from e.g. Fluorochem, Astatech or
Apollo)) in Ethanol (4 ml) was microwaved at 120.degree. C. for 1 h
on normal absorption. After evaporation of the solvent, the crude
product was purified via MDAP using the High pH extended method.
Fractions containing product from each MDAP were combined and
evaporated to give D12 as a white solid in 158 mg. LCMS [M+H]+
332.06 @0.76 min (2 min run)
Description 13 (D13)
N-methyl-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
##STR00029##
[0248] Trifluoroacetic acid (TFA) (2 ml) was added to a solution of
1,1-dimethylethyl
methyl[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbamate
D12 (287 mg). The mixture was stirred at room temperature during
one hour. The solvent was evaporated and the mixture was checked by
LCMS, the LCMS showed the desired product. Then the mixture was
purified by a cartridge SCX (5 g). The fraction containing the
product was evaporated, triturate with diethyl ether to give the
title product D13 in 177 mg. LCMS [M+H]+ 231.99 @0.32 min (2 min
run)
Description 14 (D14)
1,1-dimethylethyl
4-[methyl(phenylcarbonyl)amino]-1-piperidinecarboxylate
##STR00030##
[0250] In a round bottomed flask benzoic acid (0.627 g, 5.13 mmol,
commercially available from e.g. Sigma-Aldrich) and HATU (2.129 g,
5.60 mmol) were dissolved in DCM (10 mL). The reaction mixture was
stirred at room temperature for 30 minutes before
1-boc-4-methylaminopiperidine (1 g, 4.67 mmol, commercially
available from e.g. Apollo, Fluorochem or Astatech) was added
followed by triethylamine (1.626 mL, 11.67 mmol). The reaction was
stirred at room temperature overnight. Solvent was removed in vacuo
and the crude dissolved in DCM then organic phase was extracted
with a saturated NaHCO.sub.3 solution (twice), a 10% citric acid
solution (twice) then washed with brine and dried over MgSO.sub.4.
Solvent was removed in vacuo and the crude purified on a silica
column (40+M) eluting with DCM/MeOH; 90/10. Fractions containing
desired compound were joined and solvents were removed in vacuo, to
give title compound D14 as a pale yellow oil in 1.66 g. LCMS [M+H]+
319.13 [M+H-tBu]+263.03 @1.01 min (2 min run)
Description 15 (D15)
N-methyl-N-4-piperidinylbenzamide
##STR00031##
[0252] 1,1-dimethylethyl
4-[methyl(phenylcarbonyl)amino]-1-piperidinecarboxylate D14 (1.66
g) was dissolved in DCM (5 mL) then TFA (4.02 mL, 52.1 mmol) was
slowly added. The reaction was stirred at room temperature for 30
minutes. TFA and DCM were removed in vacuo. The crude mixture was
poured on a top of an Isolute Si-SCX-2 cartridge, eluting with DCM
then MeOH then a 2M NH.sub.3 in MeOH solution. Fractions containing
desired compound were evaporated in vacuo to give title compound
D15 in 1.18 g. LCMS [M+H]+ 219.01 @ 0.45 min (2 min run)
Description 16 (D16)
1,1-dimethylethyl
3-hydroxy-4,4-bis(methyloxy)-1-piperidinecarboxylate
##STR00032##
[0254] To a solution of 1,1-dimethylethyl
4-oxo-1-piperidinecarboxylate (10 g, 0.05 mol, commercially
available from e.g. Sigma-Aldrich, Fluka or Apollo) in MeOH (100
ml), was added potassium hydroxide (5.2 g, 0.09 mol), at 0.degree.
C. A solution of iodine (14 g, 0.055 mol) in MeOH (100 ml) was
added to the above stirred reaction mixture dropwise over 0.5 hours
at 0-5.degree. C. The reaction mixture was then allowed to warm up
to room temperature and stirred for another 2 hours. After that the
resulting solution was concentrated in vacuo. The residue was
purified by column chromatography on silica gel eluting with Pet
Eth/EtOAC 10/1 to obtain the desired product D16 as a yellow oil in
11 g.
Description 17 (D17)
1,1-dimethylethyl 3,4,4-tris(methyloxy)-1-piperidinecarboxylate
##STR00033##
[0256] To a solution of 1,1-dimethylethyl
3-hydroxy-4,4-bis(methyloxy)-1-piperidinecarboxylate D16 (11 g) in
THF (150 ml) was added Potassium t-Butoxide (23.5 g, 210 mmol) at
0.degree. C. The reaction mixture was stirred for 20 mins and the
methyliodide (5.2 ml, 84 mmol) was added. The reaction mixture was
allowed to warm up to room temperature and stirred overnight. The
resulting mixture was concentrated and dissolved in EtOAc and
washed with water. The organic layer was concentrated in vacuo to
obtain crude product. Product was purified on silica gel eluting
with DCM/MeOH 50/1 to obtain the desired product D17 as a yellow
oil in 5 g. LCMS [MH+] 298 @ 1.385 min (5 min run)
Description 18 (D18)
1,1-dimethylethyl 3-(methyloxy)-4-oxo-1-piperidinecarboxylate
##STR00034##
[0258] To a solution of 1,1-dimethylethyl
3,4,4-tris(methyloxy)-1-piperidinecarboxylate D17 (4.85 g) in
HCl/1,4-Dioxane (50 mL) was heated at 50.degree. C. and stirred
overnight. Water (50 ml) was added to the reaction mixture and the
pH adjusted to 10.0 using sodium hydroxide. After that BOC
anhydride (4.22 g, 19.4 mmol) was added to the reaction mixture and
stirred for 4 hours. The resulting mixture was extracted with EtOAc
(3.times.100 ml). The organic layer was dried over anhydrous
MgSO.sub.4, concentrated in vacuo to afford the desired product D18
in 3.1 g. LCMS [M-55]=174@ 1.29 min (5 min run)
Description D19 (D19)
1,1-dimethylethyl 4-amino-3-(methyloxy)-1-piperidinecarboxylate
##STR00035##
[0260] To a solution of 1,1-dimethylethyl
3-(methyloxy)-4-oxo-1-piperidinecarboxylate D18 (2.9 g) in MeOH
(100 ml), was added sodium cyanoborohydride (7.9 g, 126 mmol) and
ammonium acetate (9.7 g, 126 mmol) at R.T. The reaction mixture was
stirred for 4 hours. The resulting mixture was concentrated in
vacuo, dissolved in water, basified with sodium hydroxide to pH10
and extracted with DCM. The organic layer was dried over anhydrous
MgSO.sub.4, concentrated in vacuo to get the desired product D19 in
2.85 g. LCMS [MH+] 231@ 0.83 min (5 min run)
Description D20 (D20)
1,1-dimethylethyl
3-(methyloxy)-4-[(phenylcarbonyl)amino]-1-piperidinecarboxylate
##STR00036##
[0262] To a solution of 1,1-dimethylethyl
4-amino-3-(methyloxy)-1-piperidinecarboxylate D19 (2.85 g) in DCM
(100 ml) was added triethylamine (5.2 ml, 37.2 mmol), and benzoyl
chloride (2.2 ml, 18.6 mmol) at room temperature. The reaction
mixture was stirred at room temperature for 4 hours. The resulting
mixture was poured into water and extracted with DCM. The organic
layer was dried over anhydrous MgSO.sub.4, concentrated in vacuo to
get the desired product D20 as an oil in 4.0 g. LCMS [MH+] 335 @
1.56 and 1.61 min (isomers seen) (5 min run)
Description 21 (D21)
N-[3-(methyloxy)-4-piperidinyl]benzamide
##STR00037##
[0264] To a solution of 1,1-dimethylethyl
3-(methyloxy)-4-[(phenylcarbonyl)amino]-1-piperidinecarboxylate D20
(4.0 g) in HCl/1,4-dioxane (30 ml) was stirred at room temperature
for overnight. The resulting mixture was dissolved in water (50 ml)
and basified with sodium hydroxide to pH 10.0 then extracted with
DCM (3.times.100 ml). The organic layer was dried over anhydrous
MgSO.sub.4, concentrated in vacuo to desired product D21 as an oil
in 500 mg. LCMS [MH+] 235 @ 1.17 and 1.19 (isomers) (5 min run)
Description 22 (D22)
1,1-dimethylethyl
methyl[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbama-
te
##STR00038##
[0266] A mixture of 4-chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine
D4 (1 g), 1,1-dimethylethyl methyl(4-piperidinyl)carbamate (1.918
g, 8.95 mmol, commercially available from e.g. Fluorochem, Apollo
or Butt Park) and N,N-diisopropylethylamine (2.61 mL, 14.92 mmol)
was heated at 150.degree. C. for 20 minutes. LC/MS showed
incomplete reaction. Further NMP (2 mL) and DIPEA (1.3 mL) was
added. The mixture was heated at 150.degree. C. for 20 minutes. The
mixture was partitioned between ethyl acetate (70 mL) and water (60
mL) and the organic phase washed with water (2.times.60 mL) and
brine (50 mL). It was dried (MgSO.sub.4), filtered and the solvent
removed in vacuo. The crude material was purified by silica
chromatography, eluting 50-100% EtOAc in isohexane. The desired
fractions collected and the solvent has been evaporated to give the
desired product D22 in 0.793 g as a white solid. LCMS [M+H]+ 345.87
a 0.88 min (2 min run)
Description 23 (D23)
N-methyl-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride
##STR00039##
[0268] 4M HCl in 1,4-Dioxane (6 mL) was added to 1,1-dimethylethyl
methyl[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]carbama-
te D22 (0.793 g) and the mixture stirred for 2 hours. The mixture
was filtered under vacuum. The solid was washed with dioxane and
Et.sub.2O. The white powder was dried under vacuum all the night to
give the desired product D23 in 0.6479 g. LCMS [M+H]+ 246.16 @ 1.58
min (5 min run)
Description 24 (D24)
1,1-dimethylethyl
{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperid-
inyl}methylcarbamate
##STR00040##
[0270] A mixture of
5-bromo-4-chloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidine D5
(1.5 g), 1,1-dimethylethyl methyl(4-piperidinyl)carbamate (1.294 g,
6.04 mmol, commercially available from e.g Fluorochem, Apollo, or
Astatech) and N,N-diisopropylethylamine (1.758 mL, 10.06 mmol) was
heated at 150.degree. C. for 20 min. Crude product needs to be
purified by silica chromatography eluting with 10-50% EtOAc in
isohexane. The fractions have been collected and the solvent has
been evaporated to give the product D24 in 0.763 g. LC/MS [M+H]+
549.71/551.79 @ 1.50 min (2 min run)
Description 25 (D25)
1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-N-methyl-4--
piperidinamine
##STR00041##
[0272] Was synthesised according to the methods described below
[0273] a) 4 M HCl in 1,4-Dioxane (20 mL) was added to
1,1-dimethylethyl
{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperid-
inyl}methylcarbamate D24 (0.52 g) and stirred for 2 hours. The
mixture was filtrated under vacuum. The solid was washed with
dioxane and Et.sub.2O. The white powder was dried under vacuum all
the night to give the product D25 in 0.1919 g. LCMS [M+H]+
449.91/451.93 @ 2.55 min (5 min run). [0274] b) 4 M HCl in
1,4-Dioxane (6 mL) was added to 1,1-dimethylethyl
{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperid-
inyl}methylcarbamate D24 (150 mg) and stirred for 2 hours. The
mixture was filtrated under vacuum. The solid was washed with
dioxane and Et.sub.2O. The white powder was dried under vacuum
overnight to give the product D25 in 0.0974 g. LCMS [M+H]+
449.93/451.93 @ 2.56 min (5 min run)
Description 26 (D26)
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperi-
dinyl}-N-methyl-4-pyridinecarboxamide
##STR00042##
[0276] 4-pyridinecarboxylic acid (30.3 mg, 0.247 mmol) was dissolve
in N,N-Dimethylformamide (DMF) (3 mL) under argon flow. HATU (86
mg, 0.226 mmol) was added. After 30 minutes of stirring,
1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-N-methyl-4-
-piperidinamine D25 (100 mg) was added. After 20 minutes of
stirring, DIPEA (0.144 mL, 0.822 mmol) was added. The mixture was
stirred at room temperature under argon flow for all the night. DCM
(10 mL) has been added to the mixture. The work-up has been done
with 2.times.10 mL of Na.sub.2CO.sub.3, 10 mL of brine. The organic
layer was filtrated by a phase separator and put under vacuo to
remove the solvent. The crude material was purified by silica
chromatography eluting by a gradiant of solvent: 0-5% of MeOH in
DCM. The fractions were collected and the solvent has been
evaporated to give the product D26 in 41 mg. LCMS [M+H]+
555.01/557.03 @ 2.64 min (5 min run)
Description 27 (D27)
N-{1-[5-(1-methyl-1H-pyrazol-4-yl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyr-
imidin-4-yl]-4-piperidinyl}benzamide
##STR00043##
[0278]
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-
-piperidinyl}benzamide D6 (400 mg),
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
(185 mg, 0.89 mmol, commercially available from Maybridge,
Sigma-Aldrich and Fluorochem), potassium phosphate trihydrate (590
mg, 2.22 mmol), palladium tetrakis (26 mg, 0.022 mmol) were
dissolved in 1,4-dioxane (10 ml) and water (2 ml) and stirred under
nitrogen at 90.degree. C. overnight. Cooled to room temperature and
the solvent removed in vacuo. Water (30 ml) was added and extracted
with EtOAc (3.times.30 ml). The combined extracts were washed with
brine and dried over MgSO.sub.4, concentrated to give crude product
which was purified by silica gel column eluting with EtOAc to give
160 mg of desired product D27. LCMS [MH+] 542.2 @1.56 min (5 min
run)
Description 28 (D28)
N-{1-[5-(3-furanyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4--
piperidinyl}benzamide
##STR00044##
[0280]
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-
-piperidinyl}benzamide D6 (450 mg),
2-(3-furanyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (240 mg,
1.245 mmol, commercially available from e.g. Maybridge,
Sigma-Aldrich or Apollo), potassium phosphate trihydrate (660 mg,
2.5 mmol), palladium tetrakis (30 mg, 0.026 mmol) were dissolved in
1,4-dioxane (20 ml) and water (4 ml) and stirred under nitrogen at
90.degree. C. overnight. Cooled to room temperature, solvent
removed in vacuo, water (150 ml) was added extracted with EtOAc
(3.times.150 ml). The combined extracts were washed with brine and
dried over MgSO.sub.4, concentrated to give crude product which was
purified by silica gel column eluting with pet eth/EtOAc 1:1 to
give 60 mg of desired product D28. LCMS [MH+] 528.2 @ 1.88 min (5
min run)
Description 29 (D29)
(E)-(1-{[(1,1-dimethylethyl)oxy]carbonyl}-4-oxo-3-piperidinylidene)
sodium methanolate
##STR00045##
[0282] Sodium (1.2 g, 50 mmol) was dissolved in diethyl ether (200
mL) and then ethanol (5 ml) was added to the reaction. The reaction
mixture was cooled to 5.degree. C. then ethyl formate (5.6 g, 75
mmol) was added dropwise and then 1,1-dimethylethyl
4-oxo-1-piperidinecarboxylate (10 g, 50 mmol, commercially
available from e.g. Sigma-Aldrich, Fluka or Apollo) was added. The
reaction mixture was stirred for 6 hours. The yellow solid formed
was filtered and washed with diethyl ether and dried in vacuo to
give the desired product D29 in 6.8 g. LCMS [M-100-23]+128.1 @ 1.14
min (5 min run)
Description 30 (D30)
1,1-dimethylethyl
(3E)-3-[(methyloxy)methylidene]-4-oxo-1-piperidinecarboxylate
##STR00046##
[0284]
(E)-(1-{[(1,1-dimethylethyl)oxy]carbonyl}-4-oxo-3-piperidinylidene)-
sodium methanolate D29 (4 g) was dissolved in acetone (30 mL) and
then potassium carbonate (4.4 g, 32 mmol) was added.
Dimethylsulfate (2.3 g, 17.6 mmol) was added and the reaction
mixture heated to 65.degree. C. for 6 hours. Solvent removed and
Ethyl acetate (excess) was added, organics were washed with water
(3.times.) and brine, dried with MgSO.sub.4, filtered and
concentrated to obtain a yellow oil of desired product D30 in 1.8
g. LCMS [M-56+H] 186.1, [M-100+H] 142.1 @1.52 min (5 min run)
Description 31 (D31)
1,1-dimethylethyl
3-[(methyloxy)methyl]-4-oxo-1-piperidinecarboxylate
##STR00047##
[0286] 1,1-dimethylethyl
(3E)-3-[(methyloxy)methylidene]-4-oxo-1-piperidinecarboxylate D30
(1.5 g) was dissolved in methanol (30 ml), and then 5% Pd/C (1 g)
was added. The reaction mixture was hydrogenated at atmospheric
pressure for 6 hours. Then the Pd/C was removed by filtration and
the solution was evaporated in vacuo to afford the desired product
D31 as a pale yellow oil in 1.2 g. LCMS [M-56+H] 188.1 @ 1.53 min
(5 min run)
Description D32 (D32)
1,1-dimethylethyl
(4Z)-4-[(methyloxy)imino]-3-[(methyloxy)methyl]-1-piperidinecarboxylate
##STR00048##
[0288] 1,1-dimethylethyl
3-[(methyloxy)methyl]-4-oxo-1-piperidinecarboxylate D31 (1.2 g) and
hydroxylamine hydrochloride (410 mg, 4.9 mmol) were dissolved in
ethanol (60 ml). The reaction mixture was heated to 78.degree. C.
for 4 hours. Solvent was removed and dichloromethane (excess) was
added. The organic layer was washed with water (3.times.), brine,
collected and solvent removed to afford a yellow oil of the desired
product D32 in 1.3 g. LCMS [M-56+H]217.1 @ 1.68 min (5 min run)
Description 33 (D33)
1,1-dimethylethyl
4-amino-3-[(methyloxy)methyl]-1-piperidinecarboxylate
##STR00049##
[0290] 1,1-dimethylethyl
(4Z)-4-[(methyloxy)imino]-3-[(methyloxy)methyl]-1-piperidinecarboxylate
D32 (1.2 g) was dissolved in methanol (40 ml), raney-nickel (0.6 g)
was added under nitrogen. The reaction mixture was then
hydrogenated at atmospheric pressure for 16 hours. The raney-nickel
was filtered off and the solution was evaporated in vacuo to afford
a yellow oil of desired product D33 in 0.7 g. LCMS [M+H] 245.2
[M-56+H] 189.1 @ 1.36 min (5 min run)
Description 34 (D34)
1,1-dimethylethyl
3-[(methyloxy)methyl]-4-[(phenylcarbonyl)amino]-1-piperidinecarboxylate
##STR00050##
[0292] 1,1-dimethylethyl
4-amino-3-[(methyloxy)methyl]-1-piperidinecarboxylate D33 (0.7 g),
and benzoyl chloride (490 mg, 3.5 mmol, commercially available from
e.g. Sigma-Aldrich, Fluka or Fisher) were dissolved in
dichloromethane (30 ml) and then triethylamine (1.3 ml, 8.7 mmol)
was added. The reaction mixture was stirred at room temperature for
18 hours, then washed with water (2.times.), brine, dried with
MgSO.sub.4, filtered and solvent removed to obtain a yellow oil of
crude product which was purified by column chromatography on silica
gel eluting with pet eth/EA (2/1) to give clean desired product D34
as a yellow oil in 0.8 g.
[0293] LCMS [M-56+H] 293.1 @ 1.62 min (5 min run)
Description 35 (D35)
N-{3-[(methyloxy)methyl]-4-piperidinyl}benzamide
##STR00051##
[0295] 1,1-dimethylethyl
3-[(methyloxy)methyl]-4-[(phenylcarbonyl)amino]-1-piperidinecarboxylate
D34 (0.8 g) was dissolved in dichloromethane (25 ml).
Trifluoroacetic acid (10 ml) was then added dropwise at room
temperature. The reaction mixture was then stirred at room
temperature for 3 hours, solvent was removed. A light yellow oil
was obtained of desired product D35 in 0.6 g. LCMS [M+H] 249.1 @
1.20 min (5 min run)
Description 36 (D36)
1-(2-chloroethyl)pyrrolidine
##STR00052##
[0297] A solution of 2-(1-pyrrolidinyl)ethanol (9.5 g, 82.5 mmol)
and thionyl chloride (11 ml) in CHCl.sub.3 (50 ml) were refluxed
for 1 hour. The reaction mixture was concentrated to give 9.2 g of
a black solid of desired product D36. LCMS [MH+] 134.1 @ 1.25 min
(5 min run)
Description 37 (D37)
Methyl 3-{[2-(1-pyrrolidinyl)ethyl]oxy}benzoate
##STR00053##
[0299] A solution of 1-(2-chloroethyl)pyrrolidine D36 (9.2 g) and
methyl 3-hydroxybenzoate (12.5 g, 82 mmol) and potassium iodide
(13.68 g, 82 mmol) and potassium carbonate (11.37 g, 82 mmol) in
acetone (200 ml) was refluxed for 2 days. The reaction was filtered
and concentrated to give crude product which was purified by
chromatography on silica gel eluting with pet eth/EtOAc 5/1 and
EtOAc and MeOH to give 1.6 g of desired product D37 as a brown
product. LCMS [MH+] 250.1 @ 1.53 min (5 min run)
Description 38 (D38)
3-{[2-(1-pyrrolidinyl)ethyl]oxy}benzoic acid
##STR00054##
[0301] A solution of methyl
3-{[2-(1-pyrrolidinyl)ethyl]oxy}benzoate D37 (1.6 g) and sodium
hydroxide (708 mg, 18.2 mmol) in MeOH (50 ml) and water (10 ml) was
refluxed for 18 hours. The reaction was concentrated and water
added and acidified to pH3 with 2M HCl solution. The reaction was
concentrated and was added MeOH and was filtered, concentrated to
give a brown solid of desired product D38 in 1.5 g. LCMS [MH+]
236.1 @ 0.96 min (5 min run)
Description 39 (D39)
4,5-dichloro-1H-pyrrolo[2,3-d]pyrimidine
##STR00055##
[0303] 4-chloro-1H-pyrrolo[2,3-d]pyrimidine (1 g, 6.5 mmol,
commercially available from e.g. Sigma-Aldrich, Apollo or Alfa
Aesar) was dissolved in DCM (30 ml) and then NCS (1.04 g, 7.8 mmol)
was added. The reaction mixture was stirred at room temperature for
16 hours, and then heated at 60.degree. C. for 22 hours. After
cooling a light yellow solid was obtained by filtration of the
desired product in 1.2 g. LCMS [MH+] 188.0 @ 1.42 min (5 min
run)
Description 40 (D40)
4,5-dichloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidine
##STR00056##
[0305] To a solution of 4,5-dichloro-1H-pyrrolo[2,3-d]pyrimidine
D39 (1 g) in DMF (20 ml) at 0.degree. C. was added sodium hydride
(60% w/w in mineral oil, 255 mg, 6.4 mmol) and the mixture stirred
for 20 mins. Phenylsulfonyl chloride (1.31 g, 7.4 mmol) was the
added dropwise and the reaction mixture was kept in a cool bath for
15 hours. The mixture was poured into water (40 ml), and the
precipitate was filtered, washed with water and Et.sub.2O, dried in
a vacuum to give the desired product D40 in 1.62 g as an ashen
solid. LCMS [MH+] 329.9 @ 1.77 min (5 min run)
Description 41 (D41)
N-{1-[5-chloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piper-
idinyl}benzamide
##STR00057##
[0307] 4,5-dichloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidine
D40 (400 mg) and N-4-piperidinylbenzamide (300 mg, 1.46 mmol) were
dissolved in NMP (4 ml), then N,N-diisopropylethylamine (315 mg,
2.44 mmol) was added dropwise. The reaction was stirred at room
temperature for 16 hours then poured into water extracted with
EtOAc (2.times.100 ml). Organic layer was washed with water
(4.times.30 ml), brine (50 ml), dried with MgSO.sub.4, filtered and
solvent removed. Yellow solid obtained was purified by flash
chromatography on silica gel eluting with pet eth/ethyl acetate 3/1
to give the desired product D41 in 260 mg as a yellow solid. LCMS
[MH+] 496.0 @ 1.54 min (5 min run)
Description 42 (D42)
4-chloro-1H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile
##STR00058##
[0309] To a solution of anhydrous THF (40 ml) containing
5-Bromo-4-chloro-7H-pyrrolo[2,3-d]pyrimidine D3 (1 g) was added
nBu-Li (2.5M, 5.2 ml, 12.9 mmol) dropwise at -78.degree. C. under
nitrogen. After this addition the resulting solution was stirred
for 1 hour at -78.degree. C. before adding 4-methylbenzenesulfonyl
cyanide (935 mg, 5.2 mmol) and the resulting solution stirred for 1
hour at -78.degree. C. and then allowed to warm up to room
temperature overnight. The reaction was quenched with a saturated
NH.sub.4Cl solution at 0.degree. C., extracted with EtOAc (100 ml)
and organic layer was washed with 5% NaHCO.sub.3 solution, dried
Na.sub.2SO.sub.4, filtered and concentrated in vacuo to afford a
yellow solid. Purified by flash chromatography on silica gel
eluting with Pet Eth/EtOAc 1/2 to give the desired product D42 as a
yellow solid in 350 mg. LCMS [MH+] 179.0 @ 1.17 min (5 min run)
Description 43 (D43)
4-chloro-7-({[2-(trimethylsilyl)ethyl]oxy}methyl)-7H-pyrrolo[2,3-d]pyrimid-
ine-5-carbonitrile
##STR00059##
[0311] 4-chloro-1H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile D42 (60
mg) and potassium carbonate (282 mg, 2.04 mmol) were dissolved in
DMF (6 ml), {2-[(chloromethyl)oxy]ethyl}(trimethyl)silane (69 mg,
0.41 mmol) was added dropwise. The reaction mixture was stirred at
R.T. for 16 hours. The reaction mixture was poured onto water (30
ml), extracted with EtOAc (60 ml). Organic layer was washed with
water (3.times.20 ml), brine (20 ml), dried (Na.sub.2SO.sub.4),
filtered and concentrated in vacuo to obtain a yellow oil of
desired product D43 in 105 mg. LCMS [MH+] 308.9 @ 1.83 min (5 min
run)
Description 44 (D44)
N-{1-[5-cyano-7-({[2-(trimethylsilyl)ethyl]oxy}methyl)-7H-pyrrolo[2,3-d]py-
rimidin-4-yl]-4-piperidinyl}benzamide
##STR00060##
[0313]
4-chloro-7-({[2-(trimethylsilyl)ethyl]oxy}methyl)-7H-pyrrolo[2,3-d]-
pyrimidine-5-carbonitrile D43 (100 mg) and N-4-piperidinylbenzamide
(86 mg, 0.42 mmol, commercially available from e.g. Fluorochem,
Alfa Aesar and Apollo) were dissolved in NMP and then
N,N-diisopropylethylamine was added dropwise. The reaction mixture
was carried out in the microwave at 120.degree. C. for 45 minutes.
The reaction mixture was poured onto water extracted with EtOAc
(2.times.60 ml). Organic layers were washed water (3.times.20 ml),
brine (30 ml), dried (MgSO.sub.4), filtered and solvent removed.
Crude product obtained was purified by flash chromatography on
silica gel eluting with Pet Eth/EtOAc 3/1-2/1 to give the desired
product D44 in 69 mg. LCMS [MH+] 477.2 @ 1.80 min (5 min run)
Description 45 (D45)
ethyl 3-hydroxybenzoate
##STR00061##
[0315] To a solution of 3-hydroxybenzoic acid (10 g, 72.4 mmol) in
Ethanol (150 mL) stirred under nitrogen was added H.sub.2SO.sub.4
(3.86 mL, 72.4 mmol). The reaction mixture was refluxed at 850
overnight. The reaction mixture was concentrated and partitioned
between ethyl acetate 100 mL and water 30 mL. The organic layers
were combined and dried over Na.sub.2SO.sub.4, evaporated in vacuo
to give the crude product D45 in 11 g. LCMS Retention time=1.45
mins, [M+H].sup.+167 (5 min run)
Description 46 (D46)
ethyl 3-[(2-bromoethyl)oxy]benzoate
##STR00062##
[0317] To a solution of ethyl 3-hydroxybenzoate D45 (5 g) and
K.sub.2CO.sub.3 (12.48 g, 90 mmol) in Acetonitrile (150 mL) stirred
under nitrogen was added 1,2-dibromoethane (33.9 g, 181 mmol). The
reaction mixture was stirred at 60.degree. C. overnight. The
reaction mixture was filtered, concentrated to give the crude as
clear oil. The crude was purified to give the expected product D46
in 4.2 g, eluting with Petroleum oil/EtOAc=3/1. LCMS Retention
time=1.76 mins, [M+H].sup.+ 273 (5 min run)
Description 47 (D47)
ethyl 3-{[2-(4-morpholinyl)ethyl]oxy}benzoate
##STR00063##
[0319] To a solution of ethyl 3-[(2-bromoethyl)oxy]benzoate D46
(100 mg), morpholine (44.7 mg, 0.513 mmol) in Acetonitrile (2 mL)
stirred under nitrogen at 25.degree. C. was added K.sub.2CO.sub.3
(106 mg, 0.769 mmol). The reaction mixture was stirred at 600
overnight. The mixture was filtered and the filtrate was
concentrated in vacuo to give 98 mg of the crude product D47
without more purification. LCMS Retention time=1.57 mins,
[M+H].sup.+ 280 (5 min run)
Description 48 (D48)
ethyl 3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)benzoate
##STR00064##
[0321] To a solution of ethyl 3-[(2-bromoethyl)oxy]benzoate D46
(200 mg) and (3R)-3-fluoropyrrolidine (129 mg, 1.025 mmol) in
Acetonitrile (10 ml) was added K.sub.2CO.sub.3 (213 mg, 1.538
mmol). The reaction mixture was stirred at 60.degree. C. overnight.
The reaction mixture was filtered and the filtrate was concentrated
to give the expected product D48 in 220 mg. LCMS: rt=1.63 min,
M+H=282.1 (5 min run)
Description 49 (D49)
ethyl 3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}benzoate
##STR00065##
[0323] To a suspension of ethyl 3-[(2-bromoethyl)oxy]benzoate D46
(476 mg) and potassium carbonate (481 mg, 3.48 mmol) in
Acetonitrile (20 mL) stirred at 20.degree. C. was added
3,3-difluoropyrrolidine (250 mg, 1.741 mmol). The reaction mixture
was stirred at 70.degree. C. for 36 h. After cooled to room
temperature the mixture was filtrated and the filtrate was
concentrated. The crude product was added to a silica gel column
and was eluted with Hexane/EtOAc/TEA in ratio 50/50/0.5. Fractions
isolated and solvent evaporated to afford the title product D49 in
400 mg as a yellow oil. LCMS Retention time=1.20 mins,
[M+H].sup.+300 (5 min run)
Description 50 (D50)
ethyl 3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)benzoate
##STR00066##
[0325] To a suspension of (2R)-2-methylpyrrolidine (300 mg, 3.52
mmol) and potassium carbonate (974 mg, 7.05 mmol) in Acetonitrile
(20 mL) stirred at room temperature was added ethyl
3-[(2-bromoethyl)oxy]benzoate D46 (962 mg). The reaction mixture
was stirred at 80.degree. C. for 24 hours. After cooled to room
temperature the mixture was filtrated and the filtrate was
concentrated. The crude product was added to a silica gel column
and was eluted with Hexane/EtOAc/TEA in ratio 50/50/0.5. The
relevant fractions were isolated and solvent evaporated to afford
the title compound D50 in 900 mg as a yellow oil. LCMS Retention
time=1.09 mins, [M+H].sup.+ 278 (5 min run)
Description 51 (D51)
3-{[2-(4-morpholinyl)ethyl]oxy}benzoic acid
##STR00067##
[0327] To the material of ethyl
3-{[2-(4-morpholinyl)ethyl]oxy}benzoate D47 (98 mg) was added HCl
(0.5 mL, 16.46 mmol) at room temperature. The reaction was stirred
at 100.degree. for 2.5 hours. The mixture was concentrated in
vacuo. To the residue was added 2 ml of ether and stirred for 0.5
hours, filtered. The filtrate was evaporated in vacuo to give the
expected product D51 in 90 mg, as a white solid. LCMS Retention
time=0.84 mins, [M+H].sup.+ 252 (5 min run)
Description 52 (D52)
3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)benzoic acid
##STR00068##
[0329] To the material of ethyl
3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)benzoate D48 (220 mg)
was added HCl (0.3 ml, 9.87 mmol) at room temperature. The reaction
was stirred at 100.degree. for 2.5 hours. The mixture was
concentrated in vacuo. To the residue was added 5 ml of ether and
stirred 0.5 hours, filtered and the filtrate was evaporated in
vacuo to give the expected product D52 in 160 mg. LCMS Retention
time=0.90 mins, [M+H].sup.+ 254 (5 min run)
Description 53 (D53)
3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}benzoic acid
##STR00069##
[0331] To a solution of ethyl
3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}benzoate D49 (400 mg)
in Methanol (20 mL) stirred at 20.degree. C. was added a solution
of lithium hydroxide (100 mg, 2.383 mmol) in water (5 mL). The
reaction mixture was stirred at 80.degree. C. for 12 hours. The
solvent was removed and the residue was purified with combined
flash. (Mobile Phase: A=0.05% TFA/H.sub.2O, B=MeCN, 20% MeCN) to
afford the title compound D53 in 200 mg, as a pale solid. LCMS
Retention time=1.15 mins, [M+H].sup.+ 272 (5 min run)
Description 54 (D54)
3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)benzoic acid
##STR00070##
[0333] To a solution of ethyl
3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)benzoate D50 (900 mg)
in Methanol (30 mL) stirred at 20.degree. C. was added a solution
of lithium hydroxide (200 mg, 4.77 mmol) in Water (6 mL). The
reaction mixture was stirred at 80.degree. C. overnight. The
solvent was removed and the residue was purified with combined
flash. (Mobile Phase: A=0.05% TFA/H.sub.2O, B=MeCN, 20% MeCN) to
afford the title compound D54 in 300 mg, as a pale solid. LCMS
Retention time=1.15 mins, [M+H].sup.+ 272 (5 min run)
Example 1 (E1)
N-[1-(7H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00071##
[0335] A mixture of 4-chloro-7H-pyrrolo[2,3-d]pyrimidine (0.15 g,
1.0 mmol) and N-4-piperidinylbenzamide (0.24 g, 1.200 mmol) in
ethanol (3 mL) was microwaved at 150.degree. C. for 20 minutes. The
white solid appearing after cooling was filtered, washed with
Et.sub.2O then purified by MDAP using a high pH method to afford E1
(59 mg); .sup.1H NMR (d6-DMSO) .delta. 11.60 (1H, brs), 8.29 (1H,
d), 8.15 (1H, s), 7.84 (2H, dd), 7.52 (1H, m), 7.49 (2H, dd), 7.19
(1H, d), 6.65 (1H, d), 4.70 (2H, dt), 4.18 (1H, m), 3.24 (2H, dt),
1.91 (2H, m), 1.60 (2H, m), MS(ES+) 322 [M+H].sup.+.
Example 2 (E2)
3-(Methyloxy)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzami-
de
##STR00072##
[0337] A mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65 mg),
3-(methyloxy)benzoyl chloride (61.2 mg, 0.359 mmol) and
N-methylmorpholine (0.1 mL, 0.897 mmol) in DMF (1.5 mL) was stirred
at room temperature for 3 hours. The solvent was removed in vacuo.
The crude mixture was purified by MDAP using a formic acid method
to provide E2 (45 mg); .sup.1H NMR (d6-DMSO) .delta. 11.60 (1H,
brs), 8.25 (1H, d), 8.15 (1H, s), 7.45 (1H, dd), 7.35 (2H, m), 7.20
(1H, d), 7.06 (1H, dd), 6.62 (1H, d), 4.72 (2H, dt), 4.17 (1H, m),
3.32 (3H, s), 3.20 (2H, dt), 1.95 (2H, m), 1.60 (2H, m), MS(ES+)
352 [M+H].sup.+.
Example 3 (E3)
3-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ben-
zamide
##STR00073##
[0339] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
3-(dimethylamino)benzoic acid (49.6 mg, 0.300 mmol), HATU (137 mg,
0.360 mmol) and HOAt (24.5 mg, 0.180 mmol) in DMF (1.5 mL) was
added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred overnight at room temperature then the solvent was removed
in vacuo. The crude mixture was purified by MDAP using a formic
acid method to afford E3 (7 mg), .sup.1H NMR (d6-DMSO) .delta.
11.60 (1H, brs), 8.15 (2H, m), 7.25 (2H, m), 7.15 (2H, m), 6.85
(1H, dd), 6.62 (1H, d), 4.72 (2H, dt), 4.17 (1H, m), 3.20 (2H, dt),
2.91 (6H, s), 1.90 (2H, m), 1.60 (2H, m), MS(ES+) 365
[M+H].sup.+.
Example 4 (E4)
4-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ben-
zamide
##STR00074##
[0341] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
4-(dimethylamino)benzoic acid (49.6 mg, 0.300 mmol), HATU (137 mg,
0.360 mmol) and HOAt (24.5 mg, 0.180 mmol) in DMF (1.5 mL) was
added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred overnight at room temperature then the solvent was removed
in vacuo. The crude mixture was purified by MDAP using a formic
acid method to afford E4 (41 mg), .sup.1H NMR (d6-DMSO) .delta.
11.67 (1H, brs), 8.15 (1H, d), 7.88 (1H, d), 7.70 (2H, dd), 7.17
(1H, d), 6.67 (2H, dd), 6.61 (1H, d), 4.70 (2H, dt), 4.15 (1H, m),
3.17 (2H, dt), 2.95 (6H, s), 1.88 (2H, m), 1.57 (2H, m). MS(ES+)
365 [M+H].sup.+.
Example 5 (E5)
2-(Dimethylamino)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ben-
zamide
##STR00075##
[0343] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
2-(dimethylamino)benzoic acid (74.3 mg, 0.450 mmol), EDC (103 mg,
0.450 mmol) and HOAt (12.25 mg, 0.090 mmol) in DMF (1.5 mL) was
added DIPEA (131 .mu.L, 0.750 mmol).
[0344] The reaction mixture was stirred overnight at room
temperature then solvent was removed in vacuo. The crude mixture
was purified by MDAP using a formic acid method to afford E5 (48.5
mg), .sup.1H NMR (d6-DMSO) .delta. 11.70 (1H, brs), 9.00 (1H, d),
8.15 (1H, s), 7.57 (1H, dd), 7.37 (1H, m), 7.19 (1H, d), 7.12 (1H,
d), 7.02 (1H, m), 6.60 (1H, d), 4.60 (2H, dt), 4.15 (1H, m), 3.45
(2H, dt), 2.69 (6H, s), 1.97 (2H, m), 1.55 (2H, m), MS(ES+) 365
[M+H].sup.+.
Example 6 (E6)
3-[(Dimethylamino)methyl]-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperid-
inyl]benzamide, formic acid salt
##STR00076##
[0346] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
3-[(dimethylamino)methyl]benzoic acid (81 mg, 0.450 mmol), EDC (103
mg, 0.450 mmol) and HOAt (12.25 mg, 0.090 mmol) in DMF (1.5 mL) was
added DIPEA (131 .mu.L, 0.750 mmol). The reaction mixture was
stirred overnight at room temperature then the solvent was removed
in vacuo. The crude mixture was purified by MDAP using a formic
acid method to afford E6 (40 mg), .sup.1H NMR (d6-DMSO) .delta.
11.70 (1H, brs), 8.30 (1H, d), 8.15 (2H, s), 7.79 (1H, s), 7.75
(1H, dd), 7.40 (2H, m), 7.20 (1H, d), 6.60 (1H, d), 4.70 (2H, dt),
4.17 (1H, m), 3.42 (2H, s), 3.20 (2H, dt), 2.15 (6H, s), 1.90 (2H,
m), 1.60 (2H, m), MS(ES+) 379 [M+H].sup.+.
Example 7 (E7)
3-(1-Pyrrolidinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]be-
nzamide
##STR00077##
[0348] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
3-(1-pyrrolidinyl)benzoic acid (57.4 mg, 0.300 mmol), HATU (137 mg,
0.360 mmol) and HOAt (24.50 mg, 0.180 mmol) in DMF (1.5 mL) was
added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred overnight at room temperature then the solvent was removed
in vacuo. The crude mixture was purified by MDAP using a formic
acid method to afford E7 (50 mg), .sup.1H NMR (d6-DMSO) .delta.
11.70 (1H, brs), 8.17 (1H, s), 8.12 (1H, d), 7.20 (2H, m), 7.07
(1H, d), 6.97 (1H, s), 6.62 (2H, m), 4.70 (2H, dt), 4.17 (1H, m),
3.27 (4H, m), 3.18 (2H, dt), 1.95 (6H, m), 1.57 (2H, m), MS(ES+)
391 [M+H].sup.+.
Example 8 (E8)
3-(4-Morpholinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ben-
zamide
##STR00078##
[0350] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
3-(4-morpholinyl)benzoic acid (62.2 mg, 0.300 mmol), HATU (137 mg,
0.360 mmol) and HOAt (24.50 mg, 0.180 mmol) in DMF (1.5 mL) was
added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred overnight at room temperature then the solvent was removed
in vacuo. The crude mixture was purified by MDAP using a formic
acid method to afford E8 (45 mg); .sup.1H NMR (d6-DMSO) .delta.
11.70 (1H, brs), 8.17 (2H, d), 7.35 (1H, s), 7.30 (2H, d), 7.20
(1H, d), 7.07 (1H, d), 6.60 (1H, d), 4.70 (2H, dt), 4.17 (1H, m),
3.72 (4H, t), 3.20 (2H, dt), 3.13 (4H, t), 1.90 (2H, m), 1.57 (2H,
m), MS(ES+) 407 [M+H].sup.+.
Example 9 (E9)
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-2-pyridinecarboxamid-
e
##STR00079##
[0352] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
2-pyridinecarboxylic acid (36.9 mg, 0.300 mmol), HATU (137 mg,
0.360 mmol) and HOAt (24.50 mg, 0.180 mmol) in DMF (1.5 mL) was
added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred overnight at room temperature then the solvent was removed
in vacuo. The crude mixture was purified by MDAP using a formic
acid method to afford E9 (23 mg), .sup.1H NMR (d6-DMSO) .delta.
11.70 (1H, brs), 8.70 (1H, d), 8.65 (1H, d), 8.17 (1H, s), 8.05
(1H, d), 8.0 (1H, m), 7.60 (1H, m) 7.20 (1H, d) 6.60 (1H, d), 4.70
(2H, dt), 4.17 (1H, m), 3.20 (2H, dt), 1.90 (2H, m), 1.70 (2H, m),
MS(ES+) 323 [M+H].sup.+.
Example 10 (E10)
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-pyridinecarboxamid-
e
##STR00080##
[0354] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (100 mg),
3-pyridinecarboxylic acid (56.7 mg, 0.460 mmol), HATU (210 mg,
0.552 mmol) and HOAt (37.60 mg, 0.276 mmol) in DMF (2.3 mL) was
added DIPEA (386 L, 2.209 mmol). The reaction mixture was stirred
at room temperature for 2 hours then the solvent was removed in
vacuo. The crude mixture was purified by MDAP using a high pH
method to afford E10 (113 mg), .sup.1H NMR (d6-DMSO) .delta. 11.70
(1H, brs), 9.0 (1H, s), 8.70 (1H, d), 8.50 (1H, d), 8.17 (2H, m),
7.50 (1H, m), 7.17 (1H, d), 6.62 (1H, d), 4.70 (2H, dt), 4.17 (1H,
m), 3.22 (2H, dt), 1.95 (2H, m), 1.55 (2H, m), MS(ES+) 323
[M+H].sup.+.
Example 11 (E11)
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridinecarboxamid-
e
##STR00081##
[0356] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (100 mg),
4-pyridinecarboxylic acid (56.7 mg, 0.460 mmol), HATU (210 mg,
0.552 mmol) and HOAt (37.60 mg, 0.276 mmol) in DMF (2.3 mL) was
added DIPEA (386 L, 2.209 mmol). The reaction mixture was stirred
at room temperature for 2 hours then the solvent was removed in
vacuo. The crude mixture was purified by MDAP using a high pH
method to afford E11 (75 mg), .sup.1H NMR (d6-DMSO) .delta. 11.70
(1H, brs), 8.70 (2H, d), 8.57 (1H, d), 8.17 (1H, s), 7.72 (2H, d),
7.18 (1H, d), 6.60 (1H, d), 4.70 (2H, dt), 4.15 (1H, m), 3.20 (2H,
dt), 1.90 (2H, m), 1.60 (2H, m), MS(ES+) 323 [M+H].sup.+.
Example 12 (E12)
2-Methyl-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridinec-
arboxamide
##STR00082##
[0358] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (100 mg),
2-methyl-4-pyridinecarboxylic acid (63.1 mg, 0.460 mmol), HATU (210
mg, 0.552 mmol) and HOAt (37.60 mg, 0.276 mmol) in DMF (2.3 mL) was
added DIPEA (386 .mu.L, 2.209 mmol). The reaction mixture was
stirred at room temperature for 2 hours then the solvent was
removed in vacuo. The crude mixture was purified by MDAP using a
high pH method to afford E12 (72 mg), .sup.1H NMR (d6-DMSO) .delta.
11.70 (1H, brs), 8.55 (2H, m), 8.17 (1H, s), 7.62 (1H, s), 7.53
(1H, d), 7.18 (1H, d), 6.60 (1H, d), 4.70 (2H, dt), 4.15 (1H, m),
3.35 (3H, s), 3.25 (2H, dt), 1.90 (2H, m), 1.53 (2H, m), MS(ES+)
337 [M+H].sup.+.
Example 13 (E13)
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridazinecarboxam-
ide
##STR00083##
[0360] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (100 mg),
4-pyridazinecarboxylic acid (57.1 mg, 0.460 mmol), HATU (210 mg,
0.552 mmol) and HOAt (37.60 mg, 0.276 mmol) in DMF (2.3 mL) was
added DIPEA (386 .mu.L, 2.209 mmol). The reaction mixture was
stirred at room temperature for 2 hours then the solvent was
removed in vacuo. The crude mixture was purified by MDAP using a
formic acid method to afford E13 (44 mg), .sup.1H NMR (d6-DMSO)
.delta. 11.70 (1H, brs), 9.55 (1H, s), 9.42 (1H, d), 8.80 (1H, d),
8.17 (1H, s), 8.0 (1H, d), 7.20 (1H, d), 6.60 (1H, d), 4.70 (2H,
dt), 4.15 (1H, m), 3.25 (2H, dt), 1.90 (2H, m), 1.60 (2H, m),
MS(ES+) 324 [M+H].sup.+.
Example 14 (E14)
N-[1-(1H-Pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-5-pyrimidinecarboxam-
ide
##STR00084##
[0362] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
5-pyrimidinecarboxylic acid (37.2 mg, 0.300 mmol), HATU (137 mg,
0.360 mmol) and HOAt (24.50 mg, 0.180 mmol) in DMF (1.5 mL) was
added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred at room temperature until reaction was complete then
solvent was removed in vacuo. The crude mixture was purified by
MDAP using a high pH method to afford E14 (21 mg), .sup.1H NMR
(d6-DMSO) .delta. 11.70 (1H, brs), 9.30 (1H, s), 9.15 (2H, s), 8.65
(1H, d), 8.17 (1H, s), 7.17 (1H, d), 6.60 (1H, d), 4.65 (2H, dt),
4.15 (1H, m), 3.25 (2H, dt), 1.90 (2H, m), 1.55 (2H, m), MS(ES+)
324 [M+H]+.
Example 15 (E15)
2-(Methyloxy)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyri-
dinecarboxamide
##STR00085##
[0364] To a mixture of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (65.2 mg),
2-(methyloxy)-4-pyridinecarboxylic acid (45.9 mg, 0.300 mmol), HATU
(137 mg, 0.360 mmol) and HOAt (24.50 mg, 0180 mmol) in DMF (1.5 mL)
was added DIPEA (252 .mu.L, 1.440 mmol). The reaction mixture was
stirred at room temperature for 3 hours then the solvent was
removed in vacuo. The crude mixture was purified by MDAP using a
high pH method to afford E15 (40 mg); .sup.1H NMR (d6-DMSO) .delta.
11.70 (1H, brs), 8.50 (1H, d), 8.30 (1H, d), 8.17 (1H, s), 7.35
(1H, d), 7.20 (2H, d), 6.60 (1H, d), 4.67 (2H, dt), 4.15 (1H, m),
3.88 (3H, s), 3.20 (2H, dt), 1.90 (2H, m), 1.55 (2H, m), MS(ES+)
353 [M+H].sup.+.
Example 16 (E16)
5-Methyl-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-isoxazole-
carboxamide
##STR00086##
[0366] 5-methyl-3-isoxazolecarbonyl chloride (0.029 g, 0.200 mmol)
in DCM (1 mL) and DMF (0.5 mL) was added to a solution of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (0.043 g)
in DMF (1.5 mL) in the presence of polymer-supported morpholine
(0.279 g, 0.600 mmol, loading 2.15 mmol/g). The reaction mixture
was shaken overnight at room temperature. The morpholine resin was
filtered off and washed with a DCM:DMF (1:1) mixture. The unreacted
acid chloride was removed by filtration on a Si--NH.sub.2 cartridge
[Biotage] eluting with a DCM:DMF 1:1 mixture, and then the solvents
were removed in vacuo. The crude mixture was purified by MDAP using
a formic acid method to afford E16 (23.4 mg); .sup.1H NMR (d6-DMSO)
.delta. 11.70 (1H, brs), 8.64 (1H, d), 8.14 (1H, s), 7.18 (1H, d),
6.59 (1H, d), 6.52 (1H, s), 4.71 (2H, dt), 4.12 (1H, m), 3.15 (2H,
dt), 2.44 (3H, s), 1.85 (2H, m), 1.60 (2H, m), MS(ES+) 326
[M+H].sup.+.
Example 17 (E17)
N-[1-(5-Methyl-H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00087##
[0368] A mixture of 4-chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine
D4 (136 mg), N-4-piperidinylbenzamide (249 mg, 1.217 mmol) and
DIPEA (0.354 mL, 2.029 mmol) in NMP (1 mL) was heated in the
microwave at 150.degree. C. for 20 minutes. EtOAc (10 mL) was added
to the mixture and a precipitate formed which was filtered
off--this was shown to be remaining piperidinylbenzamide starting
material. The filtrate was diluted with further EtOAc (10 mL) and
washed with water (3.times.15 mL). On the third washing a
precipitate formed--this was filtered off and found to be mainly
desired product. The filtrate was dried (phase separator) and
concentrated to give further solid. Both solids were purified by
MDAP and the clean fractions combined and concentrated in vacuo
before drying in a drying pistol to give E17 (117 mg); .sup.1H NMR
(d6-DMSO) .delta. 11.54 (1H, brs), 8.48 (1H, d), 8.21 (1H, s), 7.86
(2H, d), 7.52 (1H, t), 7.45 (2H, t), 7.08 (1H, s), 4.13-3.98 (3H,
m), 3.04 (2H, t), 2.33 (3H, s), 1.93 (2H, dd), 1.72 (2H, ddd),
MS(ES+) 336 [M+H].sup.+.
Example 18 (E18)
N-[1-(5-Ethyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00088##
[0370] A mixture of
N-{1-[5-ethyl-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piper-
idinyl}benzamide D7 (174 mg) and cesium carbonate (347 mg, 1.066
mmol) in MeOH (1.5 mL) and THF (3 mL) was stirred at room
temperature for 3 hours. LCMS showed loss of starting material so
the mixture was partitioned between EtOAc (10 mL) and water (10
mL). The organic phase was isolated (phase separator) and then
concentrated. The crude material was purified by MDAP to give E18
(6 mg), .sup.1H NMR (d6-DMSO) .delta. 11.59 (1H, brs), 8.38 (1H,
d), 8.24 (1H, s), 8.78 (2H, d), 7.52 (1H, t), 7.46 (2H, t), 7.09
(1H, s), 4.06 (1H, m), 3.95 (2H, d), 3.02 (2H, t), 2.77 (2H, q),
1.94 (2H, d), 1.76 (2H, ddd), 1.26 (3H, t), MS(ES+) 350
[M+H].sup.+.
Example 19 (E19)
N-{1-[5-(1-Methylethenyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}b-
enzamide
##STR00089##
[0372] A mixture of
N-{1-[5-(1-methylethenyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-
-yl]-4-piperidinyl}benzamide D8 (100 mg) and cesium carbonate (195
mg, 0.598 mmol) in THF (1.4 mL) and MeOH (0.7 mL) was stirred at
room temperature for 4 hours. LCMS showed complete loss of starting
material, but a few products were present. The mixture was
partitioned between EtOAc (15 mL) and water (15 mL) and then the
organic layer was washed with water (15 mL) and brine (15 mL)
before it was dried (MgSO.sub.4), filtered and the solvent removed
in vacuo. The crude product was purified by MDAP and the one clean
fraction was concentrated in vacuo to give E19 (12 mg) as a white
solid, .sup.1H NMR (d6-DMSO) .delta. 11.88 (1H, s), 8.32 (1H, d),
8.27 (1H, s), 7.85 (2H, d), 7.51 (1H, t), 7.44 (2H, t), 7.31 (1H,
s), 5.10 (2H, s), 4.10 (2H, d), 4.02 (1H, m), 2.97 (2H, t), 2.13
(3H, s), 1.83 (2H, d), 1.67 (2H, ddd), MS(ES+) 362 [M+H].sup.+.
Example 20 (E20)
N-{1-[5-(1-Methylethyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}ben-
zamide
##STR00090##
[0374] To a solution of
N-{1-[5-(1-methylethyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-y-
l]-4-piperidinyl}benzamide D9 (140 mg) in THF (2 mL) and MeOH (1
mL) was added cesium carbonate (272 mg, 0.834 mmol) and the mixture
stirred for 2 hours. LCMS showed a small amount of starting
material so the reaction was stirred for a further 2 hours. The
mixture was then partitioned between EtOAc (20 mL) and water (20
mL) and the organic phase washed with water (20 mL) and brine (20
mL) before it was dried (MgSO.sub.4), filtered and the solvent
removed in vacuo. The crude product was purified by MDAP. The
compound-containing fractions were concentrated and dried in a
vacuum oven to give E20 (23 mg) as a white solid, .sup.1H NMR
(d6-DMSO) .delta. 11.62 (1H, s), 8.39 (1H, d), 8.26 (1H, s), 7.88
(2H, d), 7.52 (1H, t), 7.46 (2H, t), 7.09 (1H, s), 4.05 (1H, m),
3.90 (2H, d), 3.16 (1H, septet), 3.00 (2H, t), 1.94 (2H, d), 1.77
(2H, ddd), 1.28 (6H, d), MS(ES+) 364 [M+H].sup.+.
Example 21 (E21)
N-[1-(5-Methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-2-pyridinec-
arboxamide
##STR00091##
[0376] To a mixture of 2-pyridine carboxylic acid (41.4 mg, 0.336
mmol), EDC (68.7 mg, 0.359 mmol), HOBt (54.9 mg, 0.359 mmol) and
DIPEA (0.098 mL, 0.560 mmol) in DCM (1 mL), prestirred for 10
minutes, was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (60 mg) and the mixture stirred for 18 hours. The
mixture was partitioned between DCM (4 mL) and aqueous sodium
bicarbonate (4 mL) and the aqueous phase extracted with further DCM
(4 mL). The combined organic fractions were concentrated in vacuo
and purified by MDAP. The solvent was then removed in vacuo from
the product-containing fractions, to afford E21 (34 mg), .sup.1H
NMR (d6-DMSO) .delta. 11.52 (1H, s), 8.69 (1H, d), 8.65 (1H, d),
8.21 (1H, s), 8.06 (1H, d), 8.00 (1H, t), 7.61 (1H, t), 7.06 (1H,
s), 4.08 (1H, m), 4.00 (2H, d), 3.05 (2H, t), 2.37 (3H, s), 2.0-1.7
(4H, m), MS(ES+) 337 [M+H].sup.+.
Example 22 (E22)
6-Methyl-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3--
pyridinecarboxamide
##STR00092##
[0378] To a mixture of 6-methyl-3-pyridinecarboxylic acid (46.1 mg,
0.336 mmol), EDC (68.7 mg, 0.359 mmol), HOBt (54.9 mg, 0.359 mmol)
and DIPEA (0.098 mL, 0.560 mmol) in DCM (1 mL), prestirred for 10
minutes, was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (60 mg) and the mixture stirred for 18 hours. The
mixture was partitioned between DCM (4 mL) and aqueous sodium
bicarbonate (4 mL) and the aqueous phase was extracted with further
DCM (4 mL). The combined organic fractions were concentrated in
vacuo and purified by MDAP. The solvent was then removed in vacuo
from the product containing fractions, to afford E22 (14 mg),
.sup.1H NMR (d6-DMSO) .delta. 11.53 (1H, s), 8.90 (1H, s), 8.47
(1H, d), 8.22 (1H, s), 8.10 (1H, d), 7.35 (1H, d), 7.07 (1H, s),
4.08 (1H, m), 4.02 (2H, d), 3.95 (2H, t), 2.47 (3H, s), 2.37 (3H,
s), 1.95 (2H, d), 1.73 (2H, ddd), MS(ES+) 351 [M+H].sup.+.
Example 23 (E23)
2-(Methyloxy)-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]-4-pyridinecarboxamide
##STR00093##
[0380] A mixture of 2-(methyloxy)-4-pyridinecarboxylic acid (40 mg,
0.261 mmol), EDC (80 mg, 0.418 mmol), HOBt (64.1 mg, 0.418 mmol)
and DIPEA (0.114 mL, 0.654 mmol) in DCM (1 mL) was prestirred for
10 minutes before adding
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (70 mg) and the mixture was stirred at room
temperature for 18 hours. The reaction mixture was then partitioned
between DCM (4 mL) and 2M NaOH (4 mL) and the organic phase dried
(phase separator) before it was concentrated in vacuo. The crude
material was then purified by MDAP. After concentrating the
product-containing fractions in vacuo the mixture was triturated
with Et.sub.2O and filtered to give the title compound E23 as white
solid (16 mg), .sup.1H NMR (d6-DMSO) .delta. 11.54 (1H, s), 8.59
(1H, d), 8.28 (1H, d), 8.22 (1H, s), 7.36 (1H, d), 7.21 (1H, s),
7.07 (1H, s), 4.14-3.99 (3H, m), 3.89 (3H, s), 3.05 (2H, t), 2.36
(3H, s), 1.94 (2H, d), 1.73 (2H, ddd), MS(ES+) 367 [M+H].sup.+.
Example 24 (E24)
3-(Methyloxy)-N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]benzamide
##STR00094##
[0382] To a mixture of
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (70 mg) and DIPEA (0.159 mL, 0.908 mmol) in DCM
(1 mL) was added 3-(methyloxy)benzoyl chloride (56.8 mg, 0.333
mmol) and the reaction stirred for 18 hours. The mixture was
partitioned between DCM (4 mL) and aqueous sodium bicarbonate (4
mL). The organic phase was then washed with 2M HCl (4 mL) before it
was dried (phase separator) and concentrated. The crude product was
purified by MDAP but the product was not clean, so it was then
purified by silica chromatography eluting 2-10% MeOH in DCM to give
E24 (17 mg) as a white solid, .sup.1H NMR (d6-DMSO) .delta. 11.53
(1H, s), 8.33 (1H, d), 8.22 (1H, s), 7.45 (1H, d), 7.41 (1H, s),
7.37 (1H, t), 7.08 (1H, d), 7.07 (1H, s), 4.12-3.99 (3H, m), 3.81
(3H, s), 3.04 (2H, t), 2.37 (3H, s), 1.94 (2H, d), 1.74 (2H, ddd),
MS(ES+) 366 [M+H].sup.+.
Example 25 (E25)
2-Methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4--
pyridinecarboxamide
##STR00095##
[0384] To a mixture of 2-methyl-4-pyridinecarboxylic acid (41 mg,
0.299 mmol), EDC (86 mg, 0.448 mmol), HOBt (68.6 mg, 0.448 mmol)
and DIPEA (0.130 mL, 0.747 mmol) in DCM (1 mL), prestirred for 10
minutes, was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (80 mg) and the mixture stirred at room
temperature for 18 hours. The solvent was removed in vacuo and the
mixture purified by MDAP to give the title compound E25 (37 mg),
.sup.1H NMR (d6-DMSO) .delta. 11.52 (1H, s), 8.59 (1H, d), 8.57
(1H, d), 8.22 (1H, s), 7.65 (1H, d), 7.56 (1H, d), 7.07 (1H, s),
4.11-3.99 (3H, m), 3.06 (2H, t), 2.53 (3H, s), 2.37 (3H, s), 1.94
(2H, d), 1.73 (2H, ddd), MS(ES+) 351 [M+H].sup.+.
Example 26 (E26)
2-Methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ben-
zamide
##STR00096##
[0386] To a mixture of
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (70 mg) and DIPEA (0.11 mL, 0.605 mmol) in DCM (1
mL) was added 2-methylbenzoyl chloride (70.2 mg, 0.454 mmol) and
the reaction stirred at room temperature for 18 hours. The solvent
was removed in vacuo and the mixture purified by MDAP to give the
title compound E26 (25 mg) as a pale pink solid, .sup.1H NMR
(d6-DMSO) .delta. 11.55 (1H, brs), 8.26 (1H, d), 8.21 (1H, s), 7.30
(2H, m), 7.25 (2H, m), 7.06 (1H, s), 4.0 (3H, m), 3.06 (2H, t),
2.35 (3H, s), 2.35 (3H, s), 1.94 (2H, m), 1.67 (2H, m), MS(ES+) 350
[M+H].sup.+.
Example 27 (E27)
N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4-pyridinec-
arboxamide
##STR00097##
[0388] To a solution of 4-pyridinecarboxylic acid (59.8 mg, 0.486
mmol), EDC.HCl (115 mg, 0.598 mmol), HOBt (92 mg, 0.598 mmol) and
N,N-diisopropylethylamine (0.163 mL, 0.934 mmol) in
N,N-dimethylformamide (1 mL), stirred for 10 minutes, was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride (100 mg), D11, and the reaction stirred for 18 h. The
solvent was removed in vacuo and the mixture purified by high pH
MDAP to give the title compound E27 (45 mg). .sup.1H NMR (d6-DMSO)
.delta. 11.53 (1H, s), 8.72 (2H, d), 8.66 (1H, d), 8.22 (1H, s),
7.78 (2H, d), 7.07 (1H, s), 4.09 (1H, m), 4.02 (2H, d), 3.06 (2H,
t), 2.37 (3H, s), 1.95 (2H, d), 1.74 (2H, ddd), MS(ES+) 337
[M+H].sup.+.
Example 28 (E28)
3,5-dimethyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl-
]-4-isoxazolecarboxamide
##STR00098##
[0390] To a mixture of 3,5-dimethyl-4-isoxazolecarboxylic acid
(68.5 mg, 0.486 mmol), EDC.HCl (115 mg, 0.598 mmol), HOBt (92 mg,
0.598 mmol) and N,N-diisopropylethylamine (0.163 mL, 0.934 mmol) in
N,N-dimethylformamide (1 mL), stirred for 10 minutes, was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride (100 mg), D11, and the reaction stirred for 18 h. The
solvent was removed in vacuo and the mixture purified by high pH
MDAP to give the title compound E28 (60 mg). .sup.1H NMR (d6-DMSO)
.delta. 11.53 (1H, s), 8.21 (1H, s), 8.00 (1H, d), 7.07 (1H, s),
4.02-3.94 (3H, m), 3.07 (2H, t), 2.48 (3H, s), 2.36 (3H, s), 2.28
(3H, s), 1.96 (2H, d), 1.68 (2H, ddd), MS(ES+) 355 [M+H].sup.+.
Example 29 (E29)
N-[1-(5-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00099##
[0392] To a mixture of
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piper-
idinyl}benzamide (100 mg), D6, in methanol (1 mL) and
tetrahydrofuran (2 mL) was added cesium carbonate (181 mg, 0.555
mmol) and the mixture stirred at room temperature for 3 h. The
reaction mixture was partitioned between water (10 mL) and ethyl
acetate (15 mL) and the organic phase dried (phase separator) and
the solvent removed in vacuo. The crude material was purified by
MDAP to give the title compound E29 (32 mg) as a white solid.
.sup.1H NMR (d6-DMSO) .delta. 12.24 (1H, s), 8.38 (1H, d), 8.29
(1H, s), 7.87 (2H, d), 7.55 (1H, s), 7.53 (1H, t), 7.46 (2H, t),
4.18 (2H, d), 4.08 (1H, m), 3.09 (2H, t), 1.94 (2H, d), 1.81 (2H,
ddd), MS(ES+) 400
[M(C.sub.18H.sub.18.sup.79BrN.sub.5O)+H].sup.+.
Example 30 (E30)
N-methyl-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00100##
[0394] DIPEA (642 .mu.l, 3.67 mmol) was added to a mixture of
N-methyl-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D13
(177 mg), benzoic acid (93 mg, 0.765 mmol), HATU (349 mg, 0.918
mmol), aza-HOBt (62.5 mg, 0.459 mmol) in N,N-Dimethylformamide
(DMF) (2551 .mu.l). The mixture was stirred at room temperature
during 2 h. Then the solvents were evaporated. The crude was
finally purified via MDAP using a high pH method. Because of the
NMR the solid was purified again using the High pH MDAP method.
Fractions of each MDAP were combined and evaporated together to
give a white solid of E30 in 51 mg. LCMS [M+H]+ 336.19 @ 0.62 min
(2 min run)
Example 31 (E31)
2,6-dimethyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl-
]benzamide hydrochloride
##STR00101##
[0396] To a mixture of
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
(D11a) (60 mg) and 2,6-dimethylbenzoyl chloride (40.5 mg, 0.240
mmol, commercially available from e.g. fluorochem or butt park) in
Dichloromethane (DCM) (1 mL) at 0.degree. C. was added
N,N-diisopropylethylamine (0.063 mL, 0.361 mmol) and the mixture
stirred at room temperature for 6 h. LCMS showed incomplete
reaction plus by-products. Further 2,6-dimethylbenzoyl chloride
(40.5 mg, 0.240 mmol) and N,N-diisopropylethylamine (0.063 mL,
0.361 mmol) were added and the reaction stirred for 1 h and allowed
to stand for 60 h (over weekend. The solvent was removed in vacuo
and the crude product purified by MDAP to give 20 mg of product.
This was very insoluble and was dissolved in 2M HCl followed by
evaporation of the solvent to form the hydrochloride salt of E31 as
a bright pink solid in 15 mg. LCMS [M+H]+ 364.16 @ 0.71 min (2 min
run)
Example 32 (E32)
N-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]ben-
zamide
##STR00102##
[0398] To 4-chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine D4 (0.154
g) and N-methyl-N-4-piperidinylbenzamide D15 (0.2 g) was added
Ethanol (5 mL) and the reaction was heated at 150.degree. C. for 30
minutes in the microwave. The reaction was heated again at
150.degree. C. for 20 minutes. During the cooling, a white
precipitate formed. This precipitate was filtered off and washed
with Ethanol before being dried in vacuo at 40.degree. C. to afford
product in 49 mg.
[0399] The filtrate was removed in vacuo and the crude residue
purified by MDAP using the formic acid method. Fractions
corresponding to the desired product were combined and solvent
removed to give the product E32 in 22 mg. LCMS [M+H]+ 350.12 @ 0.66
min (2 min run)
Example 33 (E33)
1-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-1H-
-imidazole-5-carboxamide
##STR00103##
[0401] To a mixture of 1-methyl-1H-imidazole-5-carboxylic acid
(61.2 mg, 0.486 mmol, commercially available from e.g. Maybridge,
Apollo or Butt Park), EDC (107 mg, 0.560 mmol), HOBt (86 mg, 0.560
mmol) and N,N-diisopropylethylamine (0.163 mL, 0.934 mmol) in
Dichloromethane (DCM) (2 mL), prestirred for 10 minutes, was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (100 mg) and the mixture stirred for 18 h. The
reaction mixture was partitioned between DCM and aqueous sodium
bicarbonate. The aqueous layer was extracted with further DCM and
then the combined organic fractions were dried (phase separator)
and the solvent removed in vacuo. The crude product was purified by
high pH MDAP to give the product E33 in 33 mg as a white solid.
LCMS [M+H]+ 340.23 @ 1.66 min (5 min run)
Examples 34-35
N-[3-(methyloxy)-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidiny-
l]benzamide (E34 and E35)
##STR00104##
[0403] To a suspension of N-[3-(methyloxy)-4-piperidinyl]benzamide
D21 (440 mg), 4-chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine (D4)
(315 mg, 1.88 mmol) and cesium carbonate (306 mg, 0.94 mmol) in
EtOH (5 ml) was microwaved at 130.degree. C. for 2 hours. The
resulting mixture was poured into water (50 ml), extracted with DCM
(3.times.50 ml). The organic layer was dried over anhydrous
MgSO.sub.4, concentrated in vacuo. The crude product was purified
on silica gel eluting with DCM/MeOH 50/1, DCM/MeOH 15/1 to obtain 1
clean isomer E34 in 150 mg as a white solid. LCMS [MH+] 366 @ 1.54
min (5 min run)
[0404] The other isomer needed a further purification by prep-HPLC
(column: shimadzu 20 mm.times.250 mm.times.2; mobile phase A 10
mmol/L NH.sub.4HCO.sub.3 solution B MeCN; flow rate 30 ml/min
0.about.7.5 min 40% MeCN, 7.5.about.7.8 min 40-.about.95%,
7.8.about.12.8 min 95% MeCN) to obtain other isomer E35 in 85 mg as
a white solid. LCMS [MH+] 366 @ 1.51 min (5 min run)
Chiral Separation of E35 to Give E36 and E37.
Analytical Conditions:
[0405] Chiralpak AD (4.6 mm.times.250 mm, 10 .mu.m) Heptane:
Ethanol (50:50) v/v pump-mixed; flow rate=1.0 ml/min
U.V. Absorbance @254 nm
[0406] Autosampler injection (10 .mu.l or 25 ul on column)
Isocratic Run-time=20 minutes
Preparative Conditions
[0407] Chiralpak AD (4.6 mm.times.250 mm, 10 .mu.m) Heptane:
Ethanol (50:50) v/v pump-mixed; flow rate=17.0 ml/min
U.V. Absorbance @215 nm
[0408] Autosampler injection (900 .mu.l on column) Isocratic
Run-time=20 minutes
Method:
[0409] 50 mg were submitted for prep of which approximately 1 mg
was removed and dissolved in 1 ml of EtOH for method development.
Method developed as described in analytical conditions section:
Faster eluting enantiomer=6.2 minutes Slower eluting
enantiomer=10.8 minutes 49 mg were dissolved in 4 ml of ethanol.
900 ul injected onto column.times.4 and sample purified using the
preparative method described hereinabove.
[0410] The faster eluting enantiomer (Vial 11 in representative
chromatogram) were collected and combined. A small aliquot (1 ml)
was removed for QC analysis. The sample was dried using a rotary
evaparator. 23 mg recovered of faster eluting enantiomer, E36.
e.e=>99.9% (no evidence of the other enantiomer)
[0411] The slower eluting enantiomer (Vial 12 in representative
chromatogram) were collected and combined. A small aliquot (1 ml)
was removed for QC analysis. The sample was dried using a rotary
evaparator. 23 mg recovered of slower eluting enantiomer, E37.
e.e.=98.5%
Example 38 (E38)
N-methyl-N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-4--
pyridinecarboxamide
##STR00105##
[0413] 4-pyridinecarboxylic acid (52.4 mg, 0.426 mmol) was dissolve
in N,N-Dimethylformamide (DMF) (5 mL) under argon flow. HATU (148
mg, 0.390 mmol) was added. After 30 minutes of stirring,
N-methyl-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D23 (100 mg) was added. After 20 minutes of stirring,
diisopropylethylamine (45.9 mg, 0.355 mmol) was added. The mixture
was stirred at room temperature under argon flow for 2 h00. DCM 10
mL has been added to the mixture. A work-up has been done with
2.times.10 mL of Na.sub.2CO.sub.3, 10 mL of brine. The organic
layer was filtrated with a phase separator. The solvent was removed
in vacuo. The crude material was purified by high pH MDAP. The
fractions have been collected and evaporated to give the product
E38 in 14 mg. The product was dried overnight in the vacuum drier.
LCMS [M+H]+ 351.14 @ 1.74 min (5 min run) Some material left in a
vial after MDAP--this was purified by further MDAP to give a
further 14 mg of desired material E38. LCMS [M+H]+ 351.08 @ 1.75
min (5 min run)
Example 39 (E39)
N-[1-(5-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-N-methyl-4-p-
yridinecarboxamide
##STR00106##
[0415]
N-{1-[5-bromo-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-
-piperidinyl}-N-methyl-4-pyridinecarboxamide D26 (41 mg) was
dissolved with Tetrahydrofuran (THF) (1 mL) and Methanol (0.500
mL). Cesium carbonate (72.2 mg, 0.221 mmol) was added. The mixture
was stirred at room temperature for 30 min. The mixture was
partitioned between ethyl acetate (15 mL) and water (5 mL). The
aqueous layer was extracted with ethyl acetate (15 mL). The
combined organic phase was filtered by a phase separator and the
solvent was removed in vacuo. The crude material was purified by
MDAP. Evaporated the solvent and put in the vacuum oven to give the
product E39 in 0.0168 g as a white powder. LCMS [M+H]+
414.94/416.94 @ 1.86 min (5 min run)
Example 40 (E40)
N-{1-[5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-pipe-
ridinyl}benzamide
##STR00107##
[0417]
N-{1-[5-(1-methyl-1H-pyrazol-4-yl)-7-(phenylsulfonyl)-7H-pyrrolo[2,-
3-d]pyrimidin-4-yl]-4-piperidinyl}benzamide D27 (160 mg) and cesium
carbonate (285 mg, 0.88 mmol) in MeOH (2 ml) and THF (4 ml) was
stirred under nitrogen at room temperature for 1 hour.
[0418] EtOAc was added followed by water and the aqueous layer was
extracted with EtOAc. The combined extracts were washed with brine,
dried over MgSO.sub.4 and concentrated to give crude product. This
was purified by TLC preparation eluting with EtOAc to give 50 mg of
desired product E40. LCMS [MH+] 402.2 @ 1.44 min (5 min run)
Example 41 (E41)
N-{1-[5-(3-furanyl)-1H-pyrrolo[2,3-d]pyrimidin-4-yl]-4-piperidinyl}benzami-
de
##STR00108##
[0420]
N-{1-[5-(3-furanyl)-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-
-yl]-4-piperidinyl}benzamide D28 (60 mg) and cesium carbonate (110
mg, 0.34 mmol) in MeOH (1.5 ml) and THF (3 ml) were stirred under
nitrogen for 1 hour. Reaction filtered, concentrated to give crude
product. Purified by TLC preparation to give 30 mg of impure
product. Repurified by prep HPLC (Venusti XBP C18 10 uM, 100 A m
30.times.250 mm, A: 0.1% TFA/Water, B: MeCN 0-6.8 mins 25-75% MeCN,
6.8-7.0 min 75-95% MeCN, 7.0-10 min 95-95% MeCN, flow rate 40
ml/min) to give 10 mg of desired product E41. LCMS [MH+]388.2 @
1.12 min (5 min run)
Example 42 (E42)
N-[3-[(methyloxy)methyl]-1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-pi-
peridinyl]benzamide
##STR00109##
[0422] 4-chloro-5-methyl-7H-pyrrolo[2,3-d]pyrimidine D4 (218 mg),
N-{3-[(methyloxy)methyl]-4-piperidinyl}benzamide D35 (500 mg) and
N,N-diisopropylethylamine (504 mg, 3.9 mmol) were dissolved in NMP
(10 ml). The tube was sealed and the reaction carried out in the
microwave. The reaction was heated at 150.degree. C. for 3 hours.
The reaction mixture was poured into ethyl acetate (120 ml), washed
with water (3.times.30 ml), brine (2.times.30 ml). Organic layer
collected and dried with MgSO.sub.4, filtered and solvent removed.
Purification of the crude product by chromatography on silica gel
eluting with DCM/MeOH 30/1 to give product. Repurified by prep-HPLC
(column: x-bridge C18sun, 30.times., 50 mm; mobile phase: A 10
mmol/L NH.sub.3.H.sub.2O B ACN; gradient: 35-40% ACN in 6-7 min. Rt
6.3 min to give the product E42 as a yellow solid in 86 mg. LCMS
[M+H] 380.2 @ 1.57 min (mixture of 2 isomers) (5 min run)
Example 43 (E43)
N-[1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-{[2-(1-py-
rrolidinyl)ethyl]oxy}benzamide
##STR00110##
[0424] 3-{[2-(1-pyrrolidinyl)ethyl]oxy}benzoic acid D38 (200 mg)
and 2-chloro-4,6-dimethoxy-1,3,5-triazine (171 mg, 0.98 mmol) was
dissolved under argon in MeCN (20 ml) and cooled down to 0.degree.
C. Then N-methylmorpholine (0.3 ml) was added and the mixture was
stirred at 0.degree. C. for 2 hours. To this mixture was added
1-(5-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine
hydrochloride D11 (240 mg) in small portions, afterwards the
reaction was then warmed up to room temperature. After stirring for
16 hours, the reaction was filtered and concentrated to give crude
product. This product was purified by prep-HPLC (A 0.01%
NH.sub.4HCO.sub.3/Water, B: ACN, 0.about.8 min 25-50%,
50%.about.60% 8-12 min, 60%.about.95% 12-15 min, 95.about.95% 15-18
min) to give 50 mg of white solid of desired product E43. LCMS
[MH+]449.2 @ 1.52 min (5 min run)
Example 44 (E44)
N-[1-(5-chloro-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00111##
[0426]
N-{1-[5-chloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yl]--
4-piperidinyl}benzamide D41 (240 mg) and sodium methoxide (157 mg,
2.9 mmol) were dissolved in MeOH (15 ml). The reaction mixture was
heated at 75.degree. C. for 30 min and then extracted with EtOAc
(150 ml); washed with water (60 ml), brine (2.times.60 ml). Yellow
oil obtained, solvent removed to afford a yellow solid which was
purified by prep HPLC (mobile phase: A: 0.01%
NH.sub.4HCO.sub.3/H.sub.2O B; ACN. Column shimazu PRC-ODS 10.0 uM,
20.times.250 mm. Method 0.about.7.8 min 40-50% ACN 8-10 min
95.about.95% ACN. Flow rate 30 ml/min to give product E44 as an
ashen solid in 73 mg. LCMS [MH+] 356.0 @ 1.58 min (5 min run)
Example 45 (E45)
N-[1-(5-cyano-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
##STR00112##
[0428]
N-{1-[5-cyano-7-({[2-(trimethylsilyl)ethyl]oxy}methyl)-7H-pyrrolo[2-
,3-d]pyrimidin-4-yl]-4-piperidinyl}benzamide D44 (69 mg) and
LiBF.sub.4 (85 mg, 0.9 mmol) were dissolved in MeCN (10 ml) and
then the reaction mixture was heated at 80.degree. C. for 16
hours.
[0429] Crude product purified by flash chromatography on silica gel
eluting with pet eth/EtOAc 3/1-.about.1/1 to give the desired
product E45 as a yellow solid in 48 mg. LCMS [MH+] 347.0 @1.49 min
(5 min run)
Example 46 (E46)
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]-3-{[2-(4-mo-
rpholinyl)ethyl]oxy}benzamide hydrochloride
##STR00113##
[0431] To a solution of
1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D11a
(99 mg), 3-{[2-(4-morpholinyl)ethyl]oxy}benzoic acid D51 (90 mg,
0.358 mmol) and DIPEA (0.188 mL, 1.075 mmol) in the mixture solvent
of NMP (5 mL) and DCM (5 mL) stirred at 20.degree. C. was added EDC
(200 mg, 1.043 mmol) and HOBT (200 mg, 1.306 mmol). The reaction
mixture was stirred at 20.degree. C. overnight. Then the reaction
mixture was washed with water (50 ml) and extracted with DCM (50
ml.times.3). The combined organic layer was dried with
Na.sub.2SO.sub.4 and concentrated. The residue was purified via
Gilson GX-281.
Instrument: Gilson 281
[0432] Mobile Phase: A=0.010% NH.sub.4HCO.sub.3/H.sub.2O, B=MeCN
Flow Rate: 30.0 ml/minute Column: Shimadzu PRC-ODS 15 .mu.m 19
mm.times.250 mm
TABLE-US-00005 Method: B:A = 35%:65% to 45%:55% 0 to 7 minutes
95%:5% 7 to 14 minutes
Target peak: at 8.0 minutes
[0433] The target peak was collected and concentrated and acidified
to be HCl salt of the target compound E46 in 145 mg as a white
solid. LCMS Retention time=1.48 minutes,
[M-C.sub.6H.sub.12NO].sup.+350 (5 minutes run)
Example 47 (E47)
3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)-N-[1-(5-methyl-1H-pyrrolo[2-
,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide hydrochloride
##STR00114##
[0435] To a solution of
1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D11a
(241 mg), 3-({2-[(3R)-3-fluoro-1-pyrrolidinyl]ethyl}oxy)benzoic
acid D52 (220 mg) and DIPEA (400 mg, 3.09 mmol) in the mixture
solvent of NMP (5 ml) and DCM (15 mL) stirred at 20.degree. C. was
added EDC (237 mg, 1.236 mmol) and HOBT (220 mg, 1.437 mmol). The
reaction mixture was stirred at 20.degree. C. overnight. Then the
reaction mixture was washed with water (50 ml) and extracted with
DCM (50 ml.times.3). The combined organic layer was dried with
Na.sub.2SO.sub.4 and concentrated.
[0436] The residue was purified via Gilson GX-281.
Instrument: Gilson 281
[0437] Mobile Phase: A=0.010% NH.sub.4HCO.sub.3/H.sub.2O, B=MeCN
Flow Rate: 30.0 ml/minute Column: Shimadzu PRC-ODS 15 m 19
mm.times.250 mm
TABLE-US-00006 Method: B:A = 35%:65% to 45%:55% 0 to 7 minutes
95%:5% 7 to 14 minutes
Target peak: at 7.5 min
[0438] The target peak was collected and concentrated and acidified
to be HCl salt of the title compound E47 as a pink solid. LCMS
Retention time=1.56 minutes, [M+H].sup.+ 467 (5 minutes run)
Example E48 (E48)
3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}-N-[1-(5-methyl-1H-pyrrolo[2,-
3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide hydrochloride
##STR00115##
[0440] To a solution of
3-{[2-(3,3-difluoro-1-pyrrolidinyl)ethyl]oxy}benzoic acid D53 (127
mg), EDC (149 mg, 0.778 mmol) and HOBT (119 mg, 0.778 mmol) in DCM
(15 mL) stirred at 25.degree. C. was added a solution of
1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D11a
(90 mg) and DIEA (201 mg, 1.556 mmol) in N-Methyl-2-pyrrolidone
(NMP) (5 mL). The reaction mixture was stirred at 25.degree. C.
overnight. Then the mixture was washed with water (30 ml) and the
organic layer was separated. The aqueous layer was extracted with
DCM (20 ml.times.2) and the combined organic layer was
concentrated.
[0441] The residue was purified by silica gel (DCM/MeOH=100/5, 0.5%
TEA) and about 130 mg of the crude product was got. The crude
product was purified by preparing HPLC on a Gilson GX-281.
Instrument: Gilson 281
[0442] Mobile Phase: A=10M NH.sub.4HCO.sub.3/H.sub.2O, B=MeCN Flow
Rate: 30.0 ml/minute Column: Shimadzu PRC-ODS 15 .mu.m 19
mm.times.250 mm
TABLE-US-00007 Method: B:A = 40%:60% to 60%:40% 0 to 7 minutes
95%:5% 7 to 14 minutes
Target peak: at 8.5 min
[0443] The target peak was collected and concentrated and acidified
to be HCl salt of the title compound E48 in 61.6 mg as a white
solid.
Example E49 (E49)
3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)-N-[1-(5-methyl-7H-pyrrolo[2-
,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide hydrochloride
##STR00116##
[0445] To a solution of
3-({2-[(2R)-2-methyl-1-pyrrolidinyl]ethyl}oxy)benzoic acid D54 (116
mg), HOBT (119 mg, 0.778 mmol) and EDC (149 mg, 0.778 mmol) in
Dichloromethane (DCM) (15 mL) stirred at 25.degree. C. was added a
solution of
1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D11a
(90 mg, 0.389 mmol) and DIEA (201 mg, 1.556 mmol) in
N-Methyl-2-pyrrolidone (NMP) (5 mL). The reaction mixture was
stirred at 25.degree. C. overnight. Then the mixture was washed
with water (30 ml) and the organic layer was separated. The aqueous
layer was extracted with DCM (20 ml.times.2) and the combined
organic layer was concentrated.
[0446] The residue was purified by silica gel (DCM/MeOH=100/5, 0.5%
TEA) and 120 mg of the crude product was got. The crude product was
purified by preparing HPLC on a Gilson GX-281.
Instrument: Gilson 281
[0447] Mobile Phase: A=10M NH.sub.4HCO.sub.3/H.sub.2O, B=MeCN Flow
Rate: 30.0 ml/minute Column: Shimadzu PRC-ODS 15 m 19 mm.times.250
mm
TABLE-US-00008 Method: B:A = 46%:54% to 55%:45% 0 to 7.2 minutes
55%:45% to 95%:5% 7.2 to 7.5 minutes 95%:5% 7.5 to 11.5 minutes
[0448] The target peak was collected and concentrated and acidified
to be HCl salt of the title compound E49 in 78.2 mg as a white
solid. LCMS Retention time=1.55 minutes, [M+H].sup.+463 (5 minutes
run)
Example 50:
2-(phenyloxy)-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]acetam-
ide (Formate Salt)
##STR00117##
[0450] Phenyloxy)acetyl chloride (0.033 ml, 0.240 mmol,
commercially available from e.g. Sigma-aldrich, or Fluka) in DCM
(1.5 ml) was added to a solution of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (0.043 g,
0.200 mmol) and POL-NMM (0.279 g, 0.600 mmol) in DMF (1.5 ml). The
mixture was shaked overnight at room temperature on a mini block.
The resulting mixture was washed using DCM DMF (1:1) and the acid
chloride left was removed using an NH2 cartridge. Then the solvents
were evaporated overnight using the genevac. The crude was finally
purified via MDAP using a formic acid method to afford the product
E50 in 36 mg. LCMS: [M+H]+ 352.05 @ 064 min (2 min run) free
base.
Example 51:
2-phenyl-N-[1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]acetamide
(Formate Salt)
##STR00118##
[0452] Phenylacetyl chloride (0.037 g, 0.240 mmol, commercially
available from e.g sigma-aldrich or fluka) in Dichloromethane (DCM)
(1.5 ml) was added to a solution of
1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinamine D2 (0.043 g)
and POL-NMM (0.279 g, 0.600 mmol) in DMF (1.5 ml). The mixture was
shaked overnight at room temperature on a mini block. The resulting
mixture was washed using DCM DMF (1:1) and the acid chloride left
was removed using an NH2 cartridge. Then the solvents were
evaporated overnight using the genevac. The crude was finally
purified via MDAP using a formic acid method to obtain the desired
product E51 in 24 mg. LCMS [M+H]+ 336.06 @0.62 min (2 min run)
Example 52: Determination of ASK1 Inhibitor Activity
IMAP.TM. Technology Description
[0453] ASK1 activity was measured in an Immobilised Metal Ion
Affinity-Based Fluorecence Polarisation (IMAP.TM. FP) assay
(Sportsman R J et al (2004) ASSAY and Drug Development Technologies
(2) p205), which measures the degree of phosphorylation of a
fluorescently labelled peptide substrate. IMAP.TM. technology is
based on high affinity binding of phosphate at high salt
concentrations by immobilized metal (M.sup.III). The IMAP.TM.
"binding reagent" complexes with phoshate groups on the
phosphopeptide generated by the kinase reaction. Binding causes a
change in the rate of the molecular motion of the peptide,
resulting in an increase in fluorescence polarization (FP)
observed. Hence, inhibition of activity is seen as a decrease in FP
signal due to a lack of phospho-peptide.
ASK1 Assay Description
[0454] The peptide substrate that was used in the ASK1 assay was
derived from a `parent` peptide, RP7140, which was identified by
the screening of ASK1 against Molecular Devices Corporation's (MDC)
proprietary IMAP.TM. Substrate Finder kit.
[0455] RP7140, which is labelled at the N-terminus with 5FAM, has
the following amino acid sequence: 5FAM-GTFRSSIRRLSTRRR-OH (SEQ ID
NO: 1).
[0456] However, it was noted that RP7140 contained multiple
phosphorylation sites and therefore a number of derivative peptides
were designed and synthesised which had just single phosphorylation
sites. Of these derivative peptides the T2 peptide was identified
as the preferential substrate peptide for the assay.
[0457] T2 peptide, which is labelled at the N-terminus with 5TAMRA,
has the following amino acid sequence and forms part of the present
invention: 5TAMRA-GTFRAAIRRLAARRR-OH (SEQ ID NO: 2). The T2 peptide
is not a native substrate for ASK1 and it does not share any
homology with MKK7. MKK7 is believed to be the native substrate for
ASK1 (Ichijo H et al (2002) Journal of Cellular Physiology 191(1)
p95).
ASK1 Assay Conditions and Protocol
[0458] The assay was configured to run using the following
conditions; [0459] 100 .mu.M ATP (0.5 K.sub.m) [0460] 100 nM
peptide [0461] 3 nM ASK1. The ASK1 used in the assay was
full-length human ASK1 (GenBank accession number NP_005914) having
a GST tag attached to the N-terminal methionine; the GST tag having
the sequence:
TABLE-US-00009 [0461] (SEQ ID NO: 3)
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGS
[0462] The assay used the following buffer conditions; [0463] 10 mM
Tris Cl pH7.2 [0464] 10 mM MgCl.sub.2 [0465] 0.05% NaN.sub.3 [0466]
0.01% Tween-20 [0467] 1 mM DTT
[0468] The IMAP.TM. reagents were purchased in a kit format from
MDC (RP8124).
Experimental
[0469] 1) 100 nl or 50 nl of the test compound in 100% DMSO were
added to low volume 384 or 1536 well plates, respectively. For a
single concentration experiment 50 nl of test compound (1.25 mM
final assay concentration) was used and for a dose response
experiment a 1 in 4 dilution of compound (20 .mu.M top final
concentration) was used; 2) 3 .mu.l of ASK1 (3 nM final assay
concentration) were added to each well except in the control well
to which 3 .mu.l buffer were added; 3) the plates were incubated
for 15 minutes at room temperature; 4) 3 .mu.l of substrate (100 nM
peptide and 100 .mu.M ATP final assay concentration) were added to
each well; 5) the plates were incubated for 60 minutes at room
temperature; 6) 6 .mu.l of IMAP.TM. binding reagent were added to
each well and spun for 1 minute at 1000 rpm; 7) the plates were
incubated for 60 minutes at room temperature; 8) the plates were
read on a Perkin Elmer Envision plate reader.
Data Analysis
[0470] Data was exported from the Envision in a text file and
transferred into Activity Base. A Microsoft Excel template analysis
the imported data using the ID Business Solutions (IDBS) XC50v2
curve fitting addin.
[0471] The data was normalised to the controls using the following
equation to give a percentage inhibition (% I):
(High Control-Sample)/ABS(High Control-Low Control)*100
[0472] The analysis used the following key settings; [0473] Minimum
constrained if less than -20% I or greater than 20% I [0474]
Maximum constrained if less than 80% I or greater than 120% I
[0475] Slope constrained if less than 0.5 or greater than 2.5
Example 53: Determination of ASK1 Inhibitor Activity
AlphaLISA.RTM. Technology Description
[0476] ASK1 activity was quantified in an AlphaLISA.RTM..sup.3
assay (Eglen R M et al (2008) Curr Chem Genomics 1 p2) which
measures the degree of phosphorylation of a protein substrate (MKK4
or MKK7). AlphaLISA.RTM. technology is based on the binding of a
substrate to two types of beads, acceptor and donor. Binding to one
bead is through the tag of the substrate protein. Binding of the
second bead is through phosphospecific binding of a antibody to the
phosphosite of the substrate. This forms a sandwich, with the
acceptor and donor beads in close proximity. When the donor beads
are excited by light in the 680 nm range, a singlet oxygen is
released and causes emission of light from the acceptor in the 620
nm range which can be detected using a suitable plate reader.
[0477] ASK1 AlphaLISA.RTM. Assay Description
[0478] The ASK1 AlphaLISA.RTM. assays were enabled by binding of
full length MKK4 or MKK7 to glutathione donor beads through the use
of GST-tags. The phosphorylation site on MKK4 (Thr275) or MKK7
(Ser271/Thr275) is then recognised by a phosphospecific antibody.
The phosphospecific antibody is bound to the AlphaLISA.RTM.
acceptor beads through a Protein-A interaction. Phosphorylation of
MKK4 or MKK7 by ASK1 subsequently facilitates the bringing together
of the donor and acceptor beads into close proximity whereupon the
transfer of the singlet oxygen leads to the generation of the
AlphaLISA.RTM. signal.
ASK1 AlphaLISA.RTM. Reagents, Conditions and Protocol
[0479] Human ASK1 (GenBank accession number NP_005914) with an
N-terminal 6His-Avi tag (MGHHHHHHAGGLNDIFEAQKIEWHETSTSLYKKAGT; SEQ
ID NO: 4) attached to the N terminal methionine.
[0480] Rat ASK1 (NCBI protein sequence XP_001073260.1 but (i) which
has no lysine at position 604 and (ii) where the residues 959 to
965 are ALSTGSN in place of the corresponding GMWLHGE in the NCBI
sequence) and having an N-terminal GST tag and linker attached to
the N-terminal methionine of the rat ASK1 sequence, the GST tag and
linker having the sequence:
TABLE-US-00010 (SEQ ID NO: 5)
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGSAAAPFT
[0481] Mouse MKK4 (residues 34-397 of GenBank accession number
AAB81554) having a GST tag attached to the N-terminal residue, the
GST tag having the sequence:
TABLE-US-00011 (SEQ ID NO: 6)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFEL
GLEFPNPLYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLE
GAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLHMFEDRLCHKTYLN
GDHVTHPDFMLYDALAVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKY
LKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRG
[0482] Human MKK7 (residues 2 to 419 of GenBank accession number
NP_660186 having a GST and a Flag tag attached to the N-terminal
residue, the GSK and Flag tag having the sequence:
TABLE-US-00012 (SEQ ID NO: 7)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFEL
GLEFPNPLYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLE
GAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLHMFEDRLCHKTYLN
GDHVTHPDFMLYDALAVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKY
LKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSATMDYKDDDDK
[0483] Phospho-SEK1/MKK4 (Thr261) antibody (Cell Signalling
Technologies product no. 9151) detects endogenous levels of
SEK1/MKK4 protein only when phosphorylated at threonine 261. This
antibody does not cross-react with the corresponding phosphorylated
residues of MEK1, MEK2 or MKK3.
[0484] Phospho-MKK7 (Ser171/Thr275) antibody (Cell Signalling
Technologies product no. 4171) detects endogenous levels of MKK7
phosphorylated at serine 271 and threonine 275.
ASK1-MKK4
[0485] The assay was configured to run using the following
conditions; [0486] 230 .mu.M ATP (K.sub.m) [0487] 400 nM MKK4
(K.sub.m) [0488] 2.5 nM ASK1
ASK1-MKK7
[0489] The assay was configured to run using the following
conditions; [0490] 150 .mu.M ATP (K.sub.m) [0491] 200 nM MKK4
(K.sub.m) [0492] 80 pM ASK1
Rat ASK1-MKK7
[0493] The assay was configured to run using the following
conditions; [0494] 150 .mu.M ATP (K.sub.m) [0495] 200 nM MKK7
(K.sub.m) [0496] 200 pM rat ASK1
[0497] All AlphaLISA assays used the following buffer conditions;
[0498] 50 mM HEPES pH 7.4 [0499] 150 mM NaCl [0500] 10 mM
MgCl.sub.2/60 mM EDTA (MgCl.sub.2 is used for the enzyme reaction
additions, EDTA is used for the quench/bead additions) [0501] 1 mM
CHAPS [0502] 1 mM DTT
Experimental
[0503] 1) 100 nl of test compound (1 in 3 dilution from 20 .mu.M
top final concentration) in 100% DMSO was added to low volume 384
well plates 2) 2.5 .mu.l of human ASK1 or rat ASK1 (80 pM/200 pM
final concentration, respectively) was added to each well except in
the control well to which 2.5 .mu.l buffer were added 3) the plate
was incubated for 15 minutes at room temperature 4) 2.5 .mu.l of
MKK4 or MKK7 (400 nM or 200 nM final concentration, respectively)
were added to the wells 5) the plate was incubated for 60 minutes
at room temperature 6) the Protein-A acceptor beads and
phospho-specific antibody was incubated for 30 minutes 7) 2.5 .mu.l
of Protein-A acceptor beads/phospho-specific antibody mix (5
.mu.g/ml acceptor beads final concentration and 1/400 antibody
final dilution) was added to each well 8) the plate was incubated
for 30 minutes at room temperature 9) 2.5 .mu.l of GSH donor beads
(40 .mu.g/ml acceptor beads final concentration) were added to each
well 10) the plate was spun for 1 minute at 1000 rpm 11) the plate
was incubated for 60 minutes at room temperature 12) the plate was
read on a Perkin Elmer Envision plate reader.
Data Analysis
[0504] Data was exported from the Envision plate reader in a text
file and analysed in Microsoft Excel using the IDBS XC50v2 curve
fitting addin.
[0505] The data was normalised to the controls using the following
equation to give a percentage inhibition (% I);
(High Control-Sample)/ABS(High Control-Low Control)*100
The analysis used the following key settings; [0506] Min
constrained if less than -20% I or greater than 20% I [0507] Max
constrained if less than 80% I or greater than 120% I [0508] Slope
constrained if less than 0.5 or greater than 2.5
[0509] Compounds of Examples 1 to 51 were tested according to the
method of example 52 or the method of example 53. All compounds
gave pIC50 values from 5.5 to 8.6 at the human ASK1 kinase.
[0510] The compound
4-(1-pyrrolidinyl)-N-[1-(1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]b-
enzamide gives a pIC50 value of 4.6.
Example 54: ASK1 Kinase Dead Knock-in (ki) Mice have a Protective
Phenotype in the FCA-Induced Model of Mechanical
Hypersensitivity
[0511] To test the role of ASK1 in pain responses, the behaviour of
mice homozygous for an ASK1 dead allele (lysine at amino acid 716
substituted with arginine) were tested in pain models.
Hypersensitivity to mechanical stimulus following acute
inflammation was tested using the established model of intraplantar
Freund's Complete Adjuvant (FCA)-induced inflammation. Animals were
tested for changes in mechanical hypersensitivity using an
analgesymeter (mean paw withdrawal latency) at 1, 5, 9 and 14 days
following FCA injection or weight bearing 24 hours after FCA
injection. Results were expressed as mean ipsilateral/contralateral
ratio for each test day and analysed using 2-way analysis of
variance in Statistica with genotype and days post FCA being used
as independent variables. Follow up analysis was carried out using
Duncan's test. The results are shown in FIG. 1.
[0512] Following intraplantar FCA injection, analysis of the
ipsilateral/contralateral weight bearing ratio or paw withdrawal
thresholds revealed a significant effect of genotype between
ASK1.sup.ki/ki and WT mice. ASK1.sup.ki/ki mice, homozygous for a
loss of function ASK1 allele, failed to develop significant
hypersensitivity at any time after FCA injection, whereas the WT
mice displayed a significant reduction in ipsilateral/contralateral
ratios. These data are consistent with the hypothesis that ASK1 may
play a role in pain sensitivity.
Example 55: A Small Molecule Inhibitor of ASK1 Reverses
Inflammatory Mechanical Hypersensitivity
[0513] In order to replicate the phenotype observed with the ASK1
knock-in mice from example 54, but using a pharmacological tool, a
small molecule inhibitor of ASK1 was used. The anti-hyperalgesic
properties of
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
(the compound of example 17) was trailed using the established
model of intraplantar Freund's Complete Adjuvant (FCA)-induced
inflammation. 24 hours after injection of FCA the compound was
dosed orally and the effect on mechanical hypersensitivity assessed
using weight bearing. The results are shown in FIG. 2.
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
was found to partially reverse the inflammatory mechanical
hypersensitivity caused by FCA at 30 mg/kg. This data is consistent
with the hypothesis that ASK1 may play a role in inflammatory
mechanical hypersensitivity.
Example 56: A Small Molecule ASK1 Inhibitor Significantly Decreases
Chronic Constriction Injury Induced Mechanical Allodynia
[0514] In order to establish if an ASK1 inhibitor is able to
reverse hypersensitivity caused by neuronal injury in addition to
inflammatory hypersensitivity,
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
was trailed in the rat chronic constriction injury (CCI) model of
neuropathic pain. The results are shown in FIG. 3.
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
partially reversed the mechanical allodynia caused by the nerve
injury in the CCI model. This data suggests that ASK1 inhibitors
may have therapeutic potential in neuropathic, in addition to
inflammatory, pain states.
BRIEF EXPLANATION OF THE FIGURES
[0515] FIGS. 1a and 1b. Delayed mechanical hypersensitivity of
ASK1.sup.ki/ki mice following FCA induced inflammation. Animals
were tested for changes in mechanical hypersensitivity after FCA
injection (30 L, 1 mg/mL) using either: (FIG. 1a) weight bearing at
24 h in female mice, (n=12 per group) or (FIG. 1b) paw withdrawal
latency average at 1, 5, 9 and 14 days following FCA injection in
male mice (n=12 ASK1.sup.ki/ki mice and n=12 wild-type
littermates). (FIG. 1a WT vs Baseline ***P<0.001; FIG. 1b
***P<0.001 at day 1, 5, 9 and 14 for WT versus Baseline).
[0516] FIG. 2 A small molecule inhibitor of ASK1,
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide,
reverses inflammatory mechanical hypersensitivity. 24 hours after
intraplantar injection of FCA (100 .mu.L), rats (n=7 per group)
were dosed with 1% methylcellulose vehicle,
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
(3 mg/kg po, 30 mg/kg po) or celebrex (10 mg/kg po) and 1 hour
later mechanical hypersensitivity was measured by weight bearing.
(*P=0.013, **P=0.0004; statistical significance was determined
using ANOVA followed by Fisher's LSD posthoc test comparing vehicle
to response).
[0517] FIG. 3.
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
partially reverses mechanical allodynia in the CCI model of nerve
injury. Chronic constriction injury was performed on rats. Baseline
readings of mechanical thresholds were taken on days -1 and 19 post
surgery. Randomized groups of rats with allodynia (n=9-10) were
dosed from day 20 to day 27 with either vehicle,
N-[1-(5-methyl-1H-pyrrolo[2,3-d]pyrimidin-4-yl)-4-piperidinyl]benzamide
(3 mg/kg po, 30 mg/kg po bid) or pregabalin (30 mg/kg pop bid).
Mechanical allodynia was measured using Von Frey hairs 1 hour post
morning dose on days 22, 25 and 27. The hypersensitivity observed
was expressed as the area under the curve in grams.days (AUC),
calculated using the Trapezoidal rule. (*p<0.05, **p<0.01,
statistical significance was determined using one way ANOVA
followed by Fisher's LSD posthoc test comparing to vehicle
response).
Sequence CWU 1
1
7115PRTArtificialSynthetic Peptide 1Gly Thr Phe Arg Ser Ser Ile Arg
Arg Leu Ser Thr Arg Arg Arg 1 5 10 15 215PRTArtificialSynthetic
Peptide 2Gly Thr Phe Arg Ala Ala Ile Arg Arg Leu Ala Ala Arg Arg
Arg 1 5 10 15 3236PRTHuman 3Met Ala Pro Ile Leu Gly Tyr Trp Lys Ile
Lys Gly Leu Val Gln Pro 1 5 10 15 Thr Arg Leu Leu Leu Glu Tyr Leu
Glu Glu Lys Tyr Glu Glu His Leu 20 25 30 Tyr Glu Arg Asp Glu Gly
Asp Lys Trp Arg Asn Lys Lys Phe Glu Leu 35 40 45 Gly Leu Glu Phe
Pro Asn Leu Pro Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60 Leu Thr
Gln Ser Met Ala Ile Ile Arg Tyr Ile Ala Asp Lys His Asn 65 70 75 80
Met Leu Gly Gly Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu Glu 85
90 95 Gly Ala Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile Ala Tyr
Ser 100 105 110 Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu Ser Lys
Leu Pro Glu 115 120 125 Met Leu Lys Met Phe Glu Asp Arg Leu Cys His
Lys Thr Tyr Leu Asn 130 135 140 Gly Asp His Val Thr His Pro Asp Phe
Met Leu Tyr Asp Ala Leu Asp 145 150 155 160 Val Val Leu Tyr Met Asp
Pro Met Cys Leu Asp Ala Phe Pro Lys Leu 165 170 175 Val Cys Phe Lys
Lys Arg Ile Glu Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190 Leu Lys
Ser Ser Lys Tyr Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195 200 205
Thr Phe Gly Gly Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro Arg 210
215 220 His Asn Gln Thr Ser Leu Tyr Lys Lys Ala Gly Ser 225 230 235
436PRTArtificialSynthetic Peptide 4Met Gly His His His His His His
Ala Gly Gly Leu Asn Asp Ile Phe 1 5 10 15 Glu Ala Gln Lys Ile Glu
Trp His Glu Thr Ser Thr Ser Leu Tyr Lys 20 25 30 Lys Ala Gly Thr 35
5242PRTRat 5Met Ala Pro Ile Leu Gly Tyr Trp Lys Ile Lys Gly Leu Val
Gln Pro 1 5 10 15 Thr Arg Leu Leu Leu Glu Tyr Leu Glu Glu Lys Tyr
Glu Glu His Leu 20 25 30 Tyr Glu Arg Asp Glu Gly Asp Lys Trp Arg
Asn Lys Lys Phe Glu Leu 35 40 45 Gly Leu Glu Phe Pro Asn Leu Pro
Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60 Leu Thr Gln Ser Met Ala
Ile Ile Arg Tyr Ile Ala Asp Lys His Asn 65 70 75 80 Met Leu Gly Gly
Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu Glu 85 90 95 Gly Ala
Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile Ala Tyr Ser 100 105 110
Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu Ser Lys Leu Pro Glu 115
120 125 Met Leu Lys Met Phe Glu Asp Arg Leu Cys His Lys Thr Tyr Leu
Asn 130 135 140 Gly Asp His Val Thr His Pro Asp Phe Met Leu Tyr Asp
Ala Leu Asp 145 150 155 160 Val Val Leu Tyr Met Asp Pro Met Cys Leu
Asp Ala Phe Pro Lys Leu 165 170 175 Val Cys Phe Lys Lys Arg Ile Glu
Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190 Leu Lys Ser Ser Lys Tyr
Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195 200 205 Thr Phe Gly Gly
Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro Arg 210 215 220 His Asn
Gln Thr Ser Leu Tyr Lys Lys Ala Gly Ser Ala Ala Ala Pro 225 230 235
240 Phe Thr 6225PRTMouse 6Met Ser Pro Ile Leu Gly Tyr Trp Lys Ile
Lys Gly Leu Val Gln Pro 1 5 10 15 Thr Arg Leu Leu Leu Glu Tyr Leu
Glu Glu Lys Tyr Glu Glu His Leu 20 25 30 Tyr Glu Arg Asp Glu Gly
Asp Lys Trp Arg Asn Lys Lys Phe Glu Leu 35 40 45 Gly Leu Glu Phe
Pro Asn Pro Leu Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60 Leu Thr
Gln Ser Met Ala Ile Ile Arg Tyr Ile Ala Asp Lys His Asn 65 70 75 80
Met Leu Gly Gly Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu Glu 85
90 95 Gly Ala Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile Ala Tyr
Ser 100 105 110 Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu Ser Lys
Leu Pro Glu 115 120 125 Met Leu His Met Phe Glu Asp Arg Leu Cys His
Lys Thr Tyr Leu Asn 130 135 140 Gly Asp His Val Thr His Pro Asp Phe
Met Leu Tyr Asp Ala Leu Ala 145 150 155 160 Val Val Leu Tyr Met Asp
Pro Met Cys Leu Asp Ala Phe Pro Lys Leu 165 170 175 Val Cys Phe Lys
Lys Arg Ile Glu Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190 Leu Lys
Ser Ser Lys Tyr Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195 200 205
Thr Phe Gly Gly Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro Arg 210
215 220 Gly 225 7237PRTHuman 7Met Ser Pro Ile Leu Gly Tyr Trp Lys
Ile Lys Gly Leu Val Gln Pro 1 5 10 15 Thr Arg Leu Leu Leu Glu Tyr
Leu Glu Glu Lys Tyr Glu Glu His Leu 20 25 30 Tyr Glu Arg Asp Glu
Gly Asp Lys Trp Arg Asn Lys Lys Phe Glu Leu 35 40 45 Gly Leu Glu
Phe Pro Asn Pro Leu Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60 Leu
Thr Gln Ser Met Ala Ile Ile Arg Tyr Ile Ala Asp Lys His Asn 65 70
75 80 Met Leu Gly Gly Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu
Glu 85 90 95 Gly Ala Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile
Ala Tyr Ser 100 105 110 Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu
Ser Lys Leu Pro Glu 115 120 125 Met Leu His Met Phe Glu Asp Arg Leu
Cys His Lys Thr Tyr Leu Asn 130 135 140 Gly Asp His Val Thr His Pro
Asp Phe Met Leu Tyr Asp Ala Leu Ala 145 150 155 160 Val Val Leu Tyr
Met Asp Pro Met Cys Leu Asp Ala Phe Pro Lys Leu 165 170 175 Val Cys
Phe Lys Lys Arg Ile Glu Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190
Leu Lys Ser Ser Lys Tyr Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195
200 205 Thr Phe Gly Gly Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro
Arg 210 215 220 Gly Ser Ala Thr Met Asp Tyr Lys Asp Asp Asp Asp Lys
225 230 235
* * * * *