U.S. patent application number 15/447019 was filed with the patent office on 2017-07-13 for light-sensitive ion-passing molecules.
The applicant listed for this patent is The Board of Trustees of the Leland Stanford Junior University. Invention is credited to Karl Deisseroth, Viviana Gradinaru, Feng Zhang.
Application Number | 20170198017 15/447019 |
Document ID | / |
Family ID | 44649837 |
Filed Date | 2017-07-13 |
United States Patent
Application |
20170198017 |
Kind Code |
A1 |
Deisseroth; Karl ; et
al. |
July 13, 2017 |
LIGHT-SENSITIVE ION-PASSING MOLECULES
Abstract
The invention provides polynucleotides and methods for
expressing light-activated proteins in animal cells and altering an
action potential of the cells by optical stimulation. The invention
also provides animal cells and non-human animals comprising cells
expressing the light-activated proteins.
Inventors: |
Deisseroth; Karl; (Stanford,
CA) ; Zhang; Feng; (Cambridge, MA) ;
Gradinaru; Viviana; (Menlo Park, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Board of Trustees of the Leland Stanford Junior
University |
Stanford |
CA |
US |
|
|
Family ID: |
44649837 |
Appl. No.: |
15/447019 |
Filed: |
March 1, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15153299 |
May 12, 2016 |
9604073 |
|
|
15447019 |
|
|
|
|
13623612 |
Sep 20, 2012 |
9359449 |
|
|
15153299 |
|
|
|
|
13577565 |
Sep 14, 2012 |
9079940 |
|
|
PCT/US2011/028893 |
Mar 17, 2011 |
|
|
|
13623612 |
|
|
|
|
61314969 |
Mar 17, 2010 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A01K 67/0275 20130101;
A61N 5/0601 20130101; C12N 2799/025 20130101; C07K 7/08 20130101;
A61P 25/00 20180101; C07K 19/00 20130101; A01K 2207/05 20130101;
A01K 2227/105 20130101; A01K 2267/0393 20130101; A61K 38/00
20130101; A61N 2005/0626 20130101; C12N 2750/14143 20130101; C07K
7/06 20130101; A61N 5/062 20130101; A01K 67/0271 20130101; C07K
14/00 20130101; A61N 2005/0651 20130101; A61N 2005/0663 20130101;
A61K 48/00 20130101; A61N 2005/063 20130101; C12N 15/86 20130101;
C07K 14/405 20130101; A61P 25/16 20180101; C07K 2319/01
20130101 |
International
Class: |
C07K 14/405 20060101
C07K014/405; C12N 15/86 20060101 C12N015/86; A01K 67/027 20060101
A01K067/027; A61N 5/06 20060101 A61N005/06 |
Claims
1.-77. (canceled)
78. A light-activated protein comprising: a) a core polypeptide
comprising an amino acid sequence at least 80% identical to the
sequence shown in SEQ ID NO:3, SEQ ID NO:1, SEQ ID NO:2, or SEQ ID
NO:4; b) an endoplasmic reticulum (ER) export signal; and c) a
membrane trafficking signal.
79. The light-activated protein of claim 78, wherein the core
polypeptide comprises an amino acid sequence at least 85% identical
to the sequence shown in SEQ ID NO:3, SEQ ID NO:1, SEQ ID NO:2, or
SEQ ID NO:4.
80. The light-activated protein of claim 78, wherein the core
polypeptide comprises an amino acid sequence at least 90% identical
to the sequence shown in SEQ ID NO:3, SEQ ID NO:1, SEQ ID NO:2, or
SEQ ID NO:4.
81. The light-activated protein of claim 78, wherein the ER export
signal comprises the amino acid sequence FCEYENEV (SEQ ID
NO:12).
82. The light-activated protein of claim 78, wherein the membrane
trafficking signal comprises the amino acid sequence
KSRITSEGEYIPLDQIDINV (SEQ ID NO:11).
83. The light-activated protein of claim 78, wherein the core amino
acid sequence is at least 95% identical to amino acids 25-265 of
SEQ ID NO:2.
84. The light-activated protein of claim 78, wherein the core amino
acid sequence is at least 95% identical to SEQ ID NO:3.
85. The light-activated protein of claim 78, wherein the core amino
acid sequence is at least 95% identical to SEQ ID NO:4.
86. An isolated polynucleotide comprising a nucleotide sequence
encoding the light-activated protein of claim 78.
87. The polynucleotide of claim 86, wherein the light-activated
protein-encoding nucleotide sequence is operably linked to a
promoter.
88. The polynucleotide of claim 86, wherein the promoter is a
CaMKIIa promoter.
89. The polynucleotide of claim 86, wherein the promoter is a
synapsin I promoter.
90. The polynucleotide of claim 86, wherein the polynucleotide is
in an expression vector.
91. The polynucleotide of claim 90, wherein the expression vector
is a viral vector.
92. The polynucleotide of claim 91, wherein the viral vector is an
adenoassociated virus vector, a retroviral vector, an adenoviral
vector, a herpes simplex virus vector, or a lentiviral vector.
93. A system comprising: a) a delivery device comprising a
polynucleotide that comprises a nucleotide sequence encoding the
light-activated polypeptide of claim 78; b) a light source; and c)
a control device that controls generation of light by the light
source.
94. An animal cell comprising the light-activated polypeptide of
claim 78 on its cell membrane.
95. A method of modulating an activity of a cell that expresses on
its membrane the light-activated polypeptide of claim 78, the
method comprising activating the light-activated polypeptide with
light, wherein said activating modulates the activity of the cell.
Description
RELATED PATENT DOCUMENT
[0001] This patent document claims the benefit, under 35 U.S.C.
.sctn.119(e), of U.S. Provisional Patent Application Ser. No.
61/314,969 filed on Mar. 17, 2010, and entitled "Light-Sensitive
Ion-Passing Molecules;" this patent document and the Appendices
filed in the underlying provisional application are fully
incorporated herein by reference.
OVERVIEW AND SUMMARY
[0002] Aspects of the present disclosure relate generally to
systems and approaches for stimulating target cells, and more
particularly to using optics to stimulate the target cells. The
stimulation of various cells of the body has been used to produce a
number of beneficial effects. One method of stimulation involves
the use of electrodes to introduce an externally generated signal
into cells. One problem faced by electrode-based brain stimulation
techniques is the distributed nature of neurons responsible for a
given mental process. Conversely, different types of neurons reside
close to one another such that only certain cells in a given region
of the brain are activated while performing a specific task.
Alternatively stated, not only do heterogeneous nerve tracts move
in parallel through tight spatial confines, but the cell bodies
themselves may exist in mixed, sparsely embedded configurations.
This distributed manner of processing seems to defy the best
attempts to understand canonical order within the CNS, and makes
neuromodulation a difficult therapeutic endeavor. This architecture
of the brain poses a problem for electrode-based stimulation
because electrodes are relatively indiscriminate with regards to
the underlying physiology of the neurons that they stimulate.
Instead, physical proximity of the electrode poles to the neuron is
often the single largest determining factor as to which neurons
will be stimulated. Accordingly, it is generally not feasible to
absolutely restrict stimulation to a single class of neuron using
electrodes.
[0003] Another issue with the use of electrodes for stimulation is
that because electrode placement dictates which neurons will be
stimulated, mechanical stability is frequently inadequate, and
results in lead migration of the electrodes from the targeted area.
Moreover, after a period of time within the body, electrode leads
frequently become encapsulated with glial cells, raising the
effective electrical resistance of the electrodes, and hence the
electrical power delivery required to reach targeted cells.
Compensatory increases in voltage, frequency or pulse width,
however, may spread the electrical current and increase the
unintended stimulation of additional cells.
[0004] Another method of stimulus uses photosensitive bio-molecular
structures to stimulate target cells in response to light. For
instance, light activated proteins can be used to control the flow
of ions through cell membranes. By facilitating or inhibiting the
flow of positive or negative ions through cell membranes, the cell
can be briefly depolarized, depolarized and maintained in that
state, or hyperpolarized. Neurons are an example of a type of cell
that uses the electrical currents created by depolarization to
generate communication signals (i.e., nerve impulses). Other
electrically excitable cells include skeletal muscle, cardiac
muscle, and endocrine cells. Neurons use rapid depolarization to
transmit signals throughout the body and for various purposes, such
as motor control (e.g., muscle contractions), sensory responses
(e.g., touch, hearing, and other senses) and computational
functions (e.g., brain functions). Thus, the control of the
depolarization of cells can be beneficial for a number of different
purposes, including (but not limited to) psychological therapy,
muscle control and sensory functions.
[0005] Various aspects of the present invention are directed toward
a blue-light sensing opsin capable of inhibiting neural activity.
The opsin comes from cryptophytes Guillardia theta (G. theta). The
opsin of interest is the third opsin isolated from G. theta, and is
abbreviated GtR3. GtR3 is capable of mediating a hyperpolarizing
current when illuminated with light. Characterization of the action
spectra for GtR3 suggests that the absorption maxima are around 490
nm, and GtR3 is not activated by yellow light.
[0006] Various aspects of the present invention are directed to a
blue-light sensing channelrhodopsin capable of exciting neural
activity. The channelrhodopsin is derived from Dunaliella salina.
The channelrhodopsin of interest is abbreviated as DChR. DChR can
be heterologously expressed in mammalian neurons and mediates a
robust depolarizing current when illuminated with blue light. The
action maxima for DChR are around 500 nm.
[0007] Consistent with an embodiment of the present disclosure, an
inhibitory current flow is created by engineering a protein derived
from Guillardia theta that responds to light by producing an
inhibitory current to dissuade depolarization of a neuron. The
protein is delivered to a neuron of interest and the neuron is
exposed to light.
[0008] Consistent with another embodiment of the present
disclosure, a method of optical stimulation of a cell expressing a
GtR3 proton pump comprises providing a sequence of stimuli to the
cell, each stimulus increasing the probability of a depolarizing
event occurring in the cell. Light is provided to the cell to
activate the expression of the GtR3 proton pump, thereby decreasing
the probability of the depolarizing event occurring in the cell. In
certain specific embodiments the light provided is in the blue
light spectrum.
[0009] Consistent with another embodiment of the present
disclosure, a system for controlling an action potential of a
neuron or other cell in vivo is disclosed. The system comprises a
delivery device that introduces a protein responsive to blue light
to the neuron or cell. The protein responsive to blue light
produces an inhibitory current in response to blue light. The
system includes a blue light source that generates light for
stimulation of the blue light responsive protein and a control
device that controls the generation of light by the light
source.
[0010] Consistent with another embodiment of the present
disclosure, a method for providing a light responsive protein for
mammalian expression is disclosed. A light responsive protein is
isolated from G. theta. The isolated protein has a C-terminus and
an N-terminus. An endoplasmic reticulum (ER) export signal is added
to the C-terminus of the isolated protein to create an enhanced
light responsive protein. The enhanced protein is placed in an
empty virus vector for delivery to a cell of interest. The virus
vector with the enhanced protein is then delivered to the cell of
interest.
[0011] Consistent with an embodiment of the present disclosure an
animal cell is provided. The animal cell includes an integrated
exogenous molecule which expresses a proton pump responsive to blue
light. The exogenous molecule is derived from G. theta. In certain
embodiments the animal cell is a neural cell. The animal cell may
also be a muscle cell or a cell line, for example.
[0012] The above discussion of the present disclosure is not
intended to describe each illustrated embodiment or every
implementation of the present invention. The figures and detailed
description that follow more particularly exemplify these
embodiments.
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] The invention may be more completely understood in
consideration of the detailed description of various embodiments of
the invention that follows in connection with the accompanying
drawings as follows:
[0014] FIG. 1A shows an ion pump in an organelle membrane;
[0015] FIG. 1B shows an ion pump in a cell membrane;
[0016] FIG. 2A shows cell populations expressing combinations of
light responsive proteins;
[0017] FIG. 2B shows a stimulus profile for use with certain
embodiments in which two or more light responsive proteins are
introduced into the same cell population;
[0018] FIG. 3 shows a block diagram of a system for stimulating
target cells, according to an example embodiment of the present
invention;
[0019] FIG. 4 shows a block diagram of an implantable device for
stimulating target cells, according to an example embodiment of the
present invention;
[0020] FIG. 5 shows a block diagram of an implantable device,
according to an example embodiment of the present invention;
[0021] FIG. 6A shows a block diagram of an implantable device,
according to an example embodiment of the present invention;
[0022] FIG. 6B shows a circuit diagram corresponding to the block
diagram of FIG. 6A, according to an example embodiment of the
present invention;
[0023] FIG. 7A and FIG. 7B show a diagram of a mesh for containing
photosensitive bio-molecules, according to an example embodiment of
the present invention;
[0024] FIG. 8A and FIG. 8B show a diagram of a viral matrix,
according to an example embodiment of the present invention;
[0025] FIG. 9 shows a circuit diagram of a circuit that produces
light in response to a magnetic field, according to an example
embodiment of the present invention;
[0026] FIGS. 10A, 10B and 10C show a block diagram and circuits for
the production of light in response to a RF signal, according to an
example embodiment of the present invention;
[0027] FIG. 11A and FIG. 11B each show a diagram of a fiber-optic
device, according to an example embodiment of the present
invention;
[0028] FIGS. 12A, 12B, 12C and 12D depict various stages in the
production of a photosensitive biological portion, according to an
example embodiment of the present invention; and
[0029] FIG. 13 shows an implantation device, according to an
example embodiment of the present invention;
[0030] FIG. 14A and FIG. 14B show a diagram for another
implantation device, according to an example embodiment of the
present invention;
[0031] FIG. 15 depicts an arrangement with multiple light sources,
according to an example embodiment of the present invention;
[0032] FIG. 16 shows a system for controlling electrical properties
of one or more cells in vivo, according to an example embodiment of
the present invention;
[0033] FIG. 17 shows a system for controlling electrical properties
of one or more cells in vivo, according to an example embodiment of
the present invention
[0034] FIG. 18A shows a block diagram of a system for optical drug
screening, according to an example embodiment of the present
invention;
[0035] FIG. 18B shows a specific system diagram of a large-format,
quasi-automated system for drug screening in accordance with the
present methodology, according to an example embodiment of the
present invention;
[0036] FIG. 19 shows a system diagram of a small-format, fully
automated drug screening system which operates in accordance with
the invented methodology, according to an example embodiment of the
present invention;
[0037] FIG. 20A depicts the workings of an example of
emitter/detector units, according to an example embodiment of the
present invention;
[0038] FIG. 20B depicts the workings of another embodiment of
emitter/detector units, according to an example embodiment of the
present invention;
[0039] FIGS. 21A and 21B depict an electronic circuit mechanism for
activating the LED emitters used within the emitter/detector units,
according to an example embodiment of the present invention;
[0040] FIG. 22 shows a timeline for a sequence of events in the
context of an example screening process, according to an example
embodiment of the present invention;
[0041] FIG. 23 illustrates an example of a layout of cell and drug
samples within the wells of a well-plate, according to an example
embodiment of the present invention; and
[0042] FIG. 24 illustrates the context in which the disclosed
invention may be employed within a larger system that facilitates
high-throughput drug screening, according to an example embodiment
of the present invention.
[0043] FIG. 25D shows representative photocurrent traces showing in
cells transduced with eNpHR3.0 and cells transduced with eNpHR2.0,
and summary plots thereof;
[0044] FIG. 25E shows representative hyperpolarization voltage
traces showing in cells transduced with eNpHR3.0 and cells
transduced with eNpHR2.0, and summary plots thereof;
[0045] FIG. 26B shows a model of trans-synaptic gene activation by
WGA-Cre-fusion. The schematic depicts two injection sites (one with
WGA-Cre-fusion gene and another with Cre-dependent opsin virus) and
long range projections; Cre can be trans-synaptically delivered
from transduced cells to activate distant gene expression only in
synaptically connected neurons that have received the Cre-dependent
virus.
[0046] FIG. 26C shows construct design for the WGA-Cre and
Cre-dependent AAV vectors optimized with mammalian codons;
[0047] FIG. 27A shows that six hundred thirty nanometer light
evokes robust photocurrents in neurons transduced with eNpHR3.0
(representative voltage clamp trace at left). Summary plot
comparing eNpHR2.0- and eNpHR3.0-expressing neurons (at right);
eNpHR2.0, 42.7.+-.4.5 pA; eNpHR3.0, 239.4.+-.28.7 pA; unpaired t
test p=0.00004; n=10).
[0048] FIG. 27B shows that six hundred thirty nanometer
illumination evoked robust hyperpolarization (representative
voltage clamp trace at left). Summary plot comparing eNpHR2.0- and
eNpHR3.0-expressing neurons (right); 15.6.+-.3.2 mV for eNpHR2.0
and 43.3.+-.6.1 mV for eNpHR3.0; unpaired t test p=0.00116;
n=10).
[0049] FIG. 27C shows a summary of outward photocurrents evoked by
different wavelengths of red and far-red/infrared border
illumination: 630 nm, 239.4.+-.28.7 pA (left, n=10); 660 nm,
120.5.+-.16.7 pA (middle, n=4); and 680 nm: 76.3.+-.9.1 pA (right,
n=4). Power density: 3.5 mW/mm.sup.2 (630 nm) and 7 mW/mm.sup.2
(660 nm, 680 nm).
[0050] FIG. 27D shows that illumination with red and
far-red/infrared border light inhibited spiking induced by current
injection in neurons expressing eNpHR3.0. Typical current-clamp
traces show optical inhibition at 630 nm (top left), 660 nm (top
right), and 680 nm (bottom). Power density: 3.5 mW/mm.sup.2 (630
nm) and 7 mW/mm.sup.2 (660 nm, 680 nm).
[0051] FIG. 27G shows that blue light (445 nm, 5 ms pulses) drove
spiking at 20 Hz (left) and 10 Hz (right), while simultaneous
application of yellow light (590 nm) inhibited spikes.
[0052] FIG. 27F shows activation spectrums for eNPAC, ChR2 (H134R),
and eNpHR3.0 alone;
[0053] FIG. 28B shows five hundred sixty nanometer light induced
outward photocurrents in eBR cells, and the corresponding sample
trace in voltage clamp;
[0054] FIG. 28C shows five hundred sixty nanometer light induced
hyperpolarizations in eBR cells, and the corresponding sample trace
in current clamp;
[0055] FIG. 29A shows general subcellular targeting strategies for
adapting microbial opsin genes to metazoan intact-systems
biology;
[0056] FIG. 29B shows refinement of targeting at the tissue and
subcellular levels;
[0057] FIG. 30A shows stability and recovery of potent
photocurrents in cells expressing eNpHR3.0 when exposed to pairs of
10 second long yellow light pulses separated in time by: 2.5
seconds, 5 seconds, 10 seconds, and 20 seconds;
[0058] FIG. 30B shows a timecourse of eNpHR3.0 normalized
photocurrents for long-term continuous light exposure;
[0059] FIG. 30C shows stability of outward current of eNpHR3.0 over
greater than 10 minutes; and
[0060] FIG. 31C shows sample current clamp and voltage clamp traces
and summary data of GtR3 function under 472 nm light.
[0061] While the invention is amenable to various modifications and
alternative forms, examples thereof have been shown by way of
example in the drawings and will be described in detail. It should
be understood, however, that the intention is not to limit the
invention to the particular embodiments shown and/or described. On
the contrary, the intention is to cover all modifications,
equivalents, and alternatives falling within the spirit and scope
of the invention.
DETAILED DESCRIPTION
[0062] The present invention is believed to be useful for
facilitating practical application of a variety of photosensitive
bio-molecular structures, and the invention has been found to be
particularly suited for use in arrangements and methods dealing
with cellular membrane voltage control and stimulation. While the
present invention is not necessarily limited to such applications,
various aspects of the invention may be appreciated through a
discussing of various examples using this context.
[0063] As used herein, stimulation of a target cell is generally
used to describe modification of properties of the cell. For
instance, the stimulus of a target cell may result in a change in
the properties of the cell membrane that can lead to the
depolarization or polarization of the target cell. In a particular
instance, the target cell is a neuron and the stimulus affects the
transmission of impulses by facilitating or inhibiting the
generation of impulses by the neuron.
[0064] Consistent with one example embodiment of the present
invention, a light-responsive protein is engineered in a cell. The
protein affects a flow of ions (anions, cations or protons) across
the cell membrane in response to light. This change in ion flow
creates a corresponding change in the electrical properties of the
cells including, for example, the voltage and current flow across
the cell membrane. In one instance, the protein functions in vivo
using an endogenous cofactor to modify ion flow across the cell
membrane. In another instance, the protein changes the voltage
across the cell membrane so as to dissuade or encourage action
potential firing in the cell. In yet another instance, the protein
is capable of changing the electrical properties of the cell within
several milliseconds of the light being introduced.
[0065] An inhibitory protein dissuades firing of the action
potential by moving the potential of the cell away from the action
potential trigger level for the cell. In many neurons, this means
that the protein increases the negative voltage seen across the
cell membrane. In a specific instance, the protein acts as a proton
pump that actively transfers protons out of the cell. In this
manner, the protein generates an inhibitory current across the cell
membrane. More specifically, the protein responds to light by
lowering the voltage across the cell, thereby decreasing the
probability that an action potential or depolarization will
occur.
[0066] Certain aspects of the present invention are based on the
identification and development of a molecule/protein that functions
as a proton pump. This proton pump is derived from the cryptophyte
Guillardia theta (G. theta) and has been developed for expression
in target cells. In certain more specific embodiments the cell is a
neuron. The engineered protein, GtR3, responds to blue light by
producing an inhibitory current to dissuade depolarization of the
cell. When expressed in neural cells the proton pump (GtR3) can be
used to inhibit neural activity in response to blue light
stimulation. The GtR3 pump responds to optical stimulus by creating
an inhibitory current across the neural membrane. This current
inhibits action potentials while the modified cell is exposed to
(blue) light.
[0067] The present disclosure also provides for the modification of
light-activated proteins expressed in a cell by the addition of one
or more amino acid sequence motifs which enhance transport to the
plasma membranes of mammalian cells. Light-activated proteins
derived from evolutionarily simpler organisms may not be expressed
or tolerated by mammalian cells or may exhibit impaired subcellular
localization when expressed at high levels in mammalian cells.
Consequently, in some embodiments, the light-activated protein
expressed in a cell is fused to one or more amino acid sequence
motifs selected from the group consisting of a signal peptide, an
endoplasmic reticulum (ER) export signal, a membrane trafficking
signal, and an N-terminal golgi export signal. The one or more
amino acid sequence motifs which enhance light-activated protein
transport to the plasma membranes of mammalian cells can be fused
to the N-terminus, the C-terminus, or to both the N- and C-terminal
ends of the light-activated protein. Optionally, the
light-activated protein and the one or more amino acid sequence
motifs may be separated by a linker. Additional protein motifs
which can enhance light-activated protein transport to the plasma
membrane of a cell are described in U.S. patent application Ser.
No. 12/041,628 which is incorporated herein in its entirety.
[0068] The present disclosure additionally provides for
light-activated proteins which contain amino acid substitutions,
deletions, and insertions in the amino acid sequence of a native
light-activated protein (such as, but not limited to, native GtR3,
NpHR, DChR, and BR). Light-activated proteins include those in
which one or more amino acid residues have undergone an amino acid
substitution while retaining the ability to respond to light and
the ability to control the polarization state of a plasma membrane.
For example, light-activated proteins can be made by substituting
one or more amino acids into the native or wild type amino acid
sequence of the protein. In some embodiments, the invention
includes proteins comprising altered amino acid sequences in
comparison with a native amino acid sequence, wherein the altered
light-activated protein retains the characteristic light-activated
nature and/or the ability to regulate ion flow across plasma
membranes of the precursor protein but may have altered properties
in some specific aspects (for example, an increased or decreased
sensitivity to light, an increased or decreased sensitivity to
particular wavelengths of light, and/or an increased or decreased
ability to regulate the polarization state of the plasma membrane
of a mammalian cell, as compared to the native protein) Amino acid
substitutions in a native protein sequence may be conservative or
non-conservative and such substituted amino acid residues may or
may not be one encoded by the genetic code. The standard twenty
amino acid "alphabet" is divided into chemical families based on
chemical properties of their side chains. These families include
amino acids with basic side chains (e.g., lysine, arginine,
histidine), acidic side chains (e.g., aspartic acid, glutamic
acid), uncharged polar side chains (e.g., glycine, asparagine,
glutamine, serine, threonine, tyrosine, cysteine), nonpolar side
chains (e.g., alanine, valine, leucine, isoleucine, proline,
phenylalanine, methionine, tryptophan), beta-branched side chains
(e.g., threonine, valine, isoleucine) and side chains having
aromatic groups (e.g., tyrosine, phenylalanine, tryptophan,
histidine). A "conservative amino acid substitution" is one in
which the amino acid residue is replaced with an amino acid residue
having a chemically similar side chain (i.e., replacing an amino
acid possessing a basic side chain with another amino acid with a
basic side chain). A "non-conservative amino acid substitution" is
one in which the amino acid residue is replaced with an amino acid
residue having a chemically different side chain (i.e., replacing
an amino acid having a basic side chain with an amino acid having
an aromatic side chain).
[0069] Certain aspects of the present invention are directed to an
animal cell expressing the GtR3 molecule. In this manner, the
animal cell includes an integrated exogenous molecule which
expresses a proton pump responsive to blue light. In certain
non-limiting embodiments the animal cell can be a neural cell, a
muscle cell, a rod or cone cell or a cell line. In some
embodiments, the animal cell is a mammalian cell.
[0070] Provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein is responsive to blue light and is derived from Guillardia
theta, wherein the protein is capable of mediating a
hyperpolarizing current in the cell when the cell is illuminated
with light. In some embodiments the light has a wavelength between
about 450 and 495 nm. In some embodiments, the light has a
wavelength about 490 nm. In some embodiments, the light-activated
protein comprises an amino acid sequence at least 95% identical to
the sequence shown in SEQ ID NO: 1. In some embodiments, the
light-activated protein comprises an amino acid sequence at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical
to the sequence shown in SEQ ID NO: 1. In some embodiments, the
light-activated protein comprises substitutions, deletions, and/or
insertions introduced into a native amino acid sequence to increase
or decrease sensitivity to light, increase or decrease sensitivity
to particular wavelengths of light, and/or increase or decrease the
ability of the light-activated protein to regulate the polarization
state of the plasma membrane of the cell. In some embodiments, the
light-activated protein contains one or more conservative amino
acid substitutions. In some embodiments, the light-activated
protein contains one or more non-conservative amino acid
substitutions. The light-activated protein comprising
substitutions, deletions, and/or insertions introduced into the
native amino acid sequence suitably retains the ability to
hyperpolarize the plasma membrane of a neuronal cell in response to
light.
[0071] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 1 and an endoplasmic reticulum (ER)
export signal. The ER export signal may be fused to the C-terminus
of the core amino acid sequence or may be fused to the N-terminus
of the core amino acid sequence. In some embodiments, the ER export
signal is linked to the core amino acid sequence by a linker. The
linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125,
150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in
length. The linker may further comprise a fluorescent protein, for
example, but not limited to, a yellow fluorescent protein, a red
fluorescent protein, a green fluorescent protein, or a cyan
fluorescent protein. In some embodiments, the ER export signal
comprises the amino acid sequence FXYENE, where X can be any amino
acid. In some embodiments, the ER export signal comprises the amino
acid sequence VXXSL, where X can be any amino acid. In some
embodiments, the ER export signal comprises the amino acid sequence
FCYENEV.
[0072] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 1 and a signal peptide (e.g., which
enhances transport to the plasma membrane). The signal peptide may
be fused to the C-terminus of the core amino acid sequence or may
be fused to the N-tetiiiinus of the core amino acid sequence. In
some embodiments, the signal peptide is linked to the core amino
acid sequence by a linker. The linker can comprise any of 5, 10,
20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300,
400, or 500 amino acids in length. The linker may further comprise
a fluorescent protein, for example, but not limited to, a yellow
fluorescent protein, a red fluorescent protein, a green fluorescent
protein, or a cyan fluorescent protein. In some embodiments, the
signal peptide comprises the amino acid sequence
MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNG. In some
embodiments, other signal peptides (such as signal peptides from
other opsins) may be used.
[0073] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 1 and a trafficking signal (e.g.,
which enhances transport to the plasma membrane). The signal
peptide may be fused to the C-terminus of the core amino acid
sequence or may be fused to the N-terminus of the core amino acid
sequence. In some embodiments, the signal peptide is linked to the
core amino acid sequence by a linker. The linker can comprise any
of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250,
275, 300, 400, or 500 amino acids in length. The linker may further
comprise a fluorescent protein, for example, but not limited to, a
yellow fluorescent protein, a red fluorescent protein, a green
fluorescent protein, or a cyan fluorescent protein. In some
embodiments, the trafficking signal is derived from the amino acid
sequence of the human inward rectifier potassium channel Kir2.1. In
some embodiments, the trafficking signal comprises the amino acid
sequence K S R I T S E G E Y I P L D Q I D I N V. Also provided
herein is an animal cell comprising a light-activated protein
expressed on the cell membrane, wherein the protein comprises a
core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ
ID NO: 1 and two or more amino acid sequence motifs which enhance
transport to the plasma membranes of mammalian cells selected from
the group consisting of a signal peptide, an ER export signal, and
a membrane trafficking signal. In some embodiments, the light
activated protein comprises an N-terminal signal peptide and a
C-terminal ER export signal. In some embodiments, the light
activated protein comprises an N-terminal signal peptide and a
C-terminal trafficking signal. In some embodiments, the light
activated protein comprises an N-terminal signal peptide, a
C-terminal ER Export signal, and a C-terminal trafficking signal.
In some embodiments, the light activated protein comprises a
C-terminal ER Export signal and a C-terminal trafficking signal. In
some embodiments, the C-terminal ER Export signal and the
C-terminal trafficking signal are linked by a linker. The linker
can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175,
200, 225, 250, 275, 300, 400, or 500 amino acids in length. The
linker may further comprise a fluorescent protein, for example, but
not limited to, a yellow fluorescent protein, a red fluorescent
protein, a green fluorescent protein, or a cyan fluorescent
protein. In some embodiments the ER Export signal is more
C-terminally located than the trafficking signal. In some
embodiments the trafficking signal is more C-terminally located
than the ER Export signal.
[0074] Also provided herein are isolated polynucleotides encoding
any of the proteins described herein, such as a light-activated
protein comprising a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 1. Also provided herein are expression
vectors (such as a viral vector described herein) comprising a
polynucleotide encoding any of the proteins described herein, such
as a light-activated protein comprising a core amino acid sequence
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
identical to the sequence shown in SEQ ID NO: 1. The
polynucleotides may be used for expression of the light-activated
protein in animal cells.
[0075] Provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein is responsive to blue light and is derived from Dunaliella
salina, wherein the protein is capable of mediating a depolarizing
current in the cell when the cell is illuminated with light. In
some embodiments the light has a wavelength between about 450 and
495 nm. In some embodiments, the light has a wavelength about 490
nm. In some embodiments, the light-activated protein comprises an
amino acid sequence at least 95% identical to the sequence shown in
residues 25-365, 24-365, 23-365, 22-365, 21-365, 20-365, 19-365,
18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365,
11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365,
2-365, or 1-365 of SEQ ID NO: 2. In some embodiments, the
light-activated protein comprises an amino acid sequence at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical
to the sequence shown in residues 25-365, 24-365, 23-365, 22-365,
21-365, 20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365,
13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365,
5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2. In some
embodiments, the light-activated protein comprises substitutions,
deletions, and/or insertions introduced into a native amino acid
sequence to increase or decrease sensitivity to light, increase or
decrease sensitivity to particular wavelengths of light, and/or
increase or decrease the ability of the light-activated protein to
regulate the polarization state of the plasma membrane of the cell.
In some embodiments, the light-activated protein contains one or
more conservative amino acid substitutions. In some embodiments,
the light-activated protein contains one or more non-conservative
amino acid substitutions. The light-activated protein comprising
substitutions, deletions, and/or insertions introduced into the
native amino acid sequence suitably retains the ability to
depolarize the plasma membrane of a neuronal cell in response to
light.
[0076] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365,
20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365,
13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365,
4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and an endoplasmic
reticulum (ER) export signal. The ER export signal may be fused to
the C-terminus of the core amino acid sequence or may be fused to
the N-terminus of the core amino acid sequence. In some
embodiments, the ER export signal is linked to the core amino acid
sequence by a linker. The linker can comprise any of 5, 10, 20, 30,
40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or
500 amino acids in length. The linker may further comprise a
fluorescent protein, for example, but not limited to, a yellow
fluorescent protein, a red fluorescent protein, a green fluorescent
protein, or a cyan fluorescent protein. In some embodiments, the ER
export signal comprises the amino acid sequence FXYENE, where X can
be any amino acid. In some embodiments, the ER export signal
comprises the amino acid sequence VXXSL, where X can be any amino
acid. In some embodiments, the ER export signal comprises the amino
acid sequence FCYENEV.
[0077] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365,
20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365,
13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365,
4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and a signal peptide
(e.g., which enhances transport to the plasma membrane). The signal
peptide may be fused to the C-terminus of the core amino acid
sequence or may be fused to the N-terminus of the core amino acid
sequence. In some embodiments, the signal peptide is linked to the
core amino acid sequence by a linker. The linker can comprise any
of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250,
275, 300, 400, or 500 amino acids in length. The linker may further
comprise a fluorescent protein, for example, but not limited to, a
yellow fluorescent protein, a red fluorescent protein, a green
fluorescent protein, or a cyan fluorescent protein. In some
embodiments, the signal peptide comprises the amino acid sequence
MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNG. In some
embodiments, other signal peptides (such as signal peptides from
other opsins) may be used.
[0078] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365,
20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365,
13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365,
4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and a trafficking
signal (e.g., which enhances transport to the plasma membrane). The
signal peptide may be fused to the C-terminus of the core amino
acid sequence or may be fused to the N-terminus of the core amino
acid sequence. In some embodiments, the signal peptide is linked to
the core amino acid sequence by a linker. The linker can comprise
any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225,
250, 275, 300, 400, or 500 amino acids in length. The linker may
further comprise a fluorescent protein, for example, but not
limited to, a yellow fluorescent protein, a red fluorescent
protein, a green fluorescent protein, or a cyan fluorescent
protein. In some embodiments, the trafficking signal is derived
from the amino acid sequence of the human inward rectifier
potassium channel Kir2.1. In some embodiments, the trafficking
signal comprises the amino acid sequence K S R I T S E G E Y I P L
D Q I D I N V.
[0079] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365,
20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365,
13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365,
4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and two or more amino
acid sequence motifs which enhance transport to the plasma
membranes of mammalian cells selected from the group consisting of
a signal peptide, an ER export signal, and a membrane trafficking
signal. In some embodiments, the light activated protein comprises
an N-terminal signal peptide and a C-terminal ER export signal. In
some embodiments, the light activated protein comprises an
N-terminal signal peptide and a C-terminal trafficking signal. In
some embodiments, the light activated protein comprises an
N-terminal signal peptide, a C-terminal ER Export signal, and a
C-terminal trafficking signal. In some embodiments, the light
activated protein comprises a C-terminal ER Export signal and a
C-terminal trafficking signal. In some embodiments, the C-terminal
ER Export signal and the C-terminal trafficking signal are linked
by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50,
75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino
acids in length. The linker may further comprise a fluorescent
protein, for example, but not limited to, a yellow fluorescent
protein, a red fluorescent protein, a green fluorescent protein, or
a cyan fluorescent protein. In some embodiments the ER Export
signal is more C-terminally located than the trafficking signal. In
some embodiments the trafficking signal is more C-terminally
located than the ER Export signal.
[0080] Also provided herein are isolated polynucleotides encoding
any of the proteins described herein, such as a light-activated
protein comprising a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365,
20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365,
13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365,
4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2. Also provided herein
are expression vectors (such as a viral vector described herein)
comprising a polynucleotide encoding any of the proteins described
herein, such as a light-activated protein comprising a core amino
acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, or 100% identical to the sequence shown in residues 25-365,
24-365, 23-365, 22-365, 21-365, 20-365, 19-365, 18-365, 17-365,
16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365,
9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of
SEQ ID NO: 2. The polynucleotides may be used for expression of the
light-activated protein in animal cells.
[0081] Provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein is responsive to amber as well as red light and is derived
from Natronomonas pharaonic, wherein the protein is capable of
mediating a hyperpolarizing current in the cell when the cell is
illuminated with light. In some embodiments the light has a
wavelength between about 580 and 630 nm. In some embodiments, the
light has a wavelength about 589 nm. In some embodiments, the light
has a wavelength greater than about 630 nm (e.g. less than 740 nm).
In some embodiments, the light has a wavelength around 630 nm. In
some embodiments, the light-activated protein comprises an amino
acid sequence at least 95% identical to the sequence shown in SEQ
ID NO: 3. In some embodiments, the light-activated protein
comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in
SEQ ID NO: 3. In some embodiments, the light-activated protein
comprises substitutions, deletions, and/or insertions introduced
into a native amino acid sequence to increase or decrease
sensitivity to light, increase or decrease sensitivity to
particular wavelengths of light, and/or increase or decrease the
ability of the light-activated protein to regulate the polarization
state of the plasma membrane of the cell. In some embodiments, the
light-activated protein contains one or more conservative amino
acid substitutions. In some embodiments, the light-activated
protein contains one or more non-conservative amino acid
substitutions. The light-activated protein comprising
substitutions, deletions, and/or insertions introduced into the
native amino acid sequence suitably retains the ability to
hyperpolarize the plasma membrane of a neuronal cell in response to
light.
[0082] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 3 and an endoplasmic reticulum (ER)
export signal. The ER export signal may be fused to the C-terminus
of the core amino acid sequence or may be fused to the N-terminus
of the core amino acid sequence. In some embodiments, the ER export
signal is linked to the core amino acid sequence by a linker. The
linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125,
150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in
length. The linker may further comprise a fluorescent protein, for
example, but not limited to, a yellow fluorescent protein, a red
fluorescent protein, a green fluorescent protein, or a cyan
fluorescent protein. In some embodiments, the ER export signal
comprises the amino acid sequence FXYENE, where X can be any amino
acid. In some embodiments, the ER export signal comprises the amino
acid sequence VXXSL, where X can be any amino acid. In some
embodiments, the ER export signal comprises the amino acid sequence
FCYENEV.
[0083] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 3 and a trafficking signal (e.g.,
which enhances transport to the plasma membrane). The signal
peptide may be fused to the C-terminus of the core amino acid
sequence or may be fused to the N-terminus of the core amino acid
sequence. In some embodiments, the signal peptide is linked to the
core amino acid sequence by a linker. The linker can comprise any
of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250,
275, 300, 400, or 500 amino acids in length. The linker may further
comprise a fluorescent protein, for example, but not limited to, a
yellow fluorescent protein, a red fluorescent protein, a green
fluorescent protein, or a cyan fluorescent protein. In some
embodiments, the trafficking signal is derived from the amino acid
sequence of the human inward rectifier potassium channel Kir2.1. In
some embodiments, the trafficking signal comprises the amino acid
sequence K S R I T S E G E Y I P L D Q I D I N V.
[0084] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 3 and two or more amino acid sequence
motifs which enhance transport to the plasma membranes of mammalian
cells selected from the group consisting of an ER export signal and
a membrane trafficking signal. In some embodiments, the light
activated protein comprises a C-terminal ER Export signal and a
C-terminal trafficking signal. In some embodiments, the C-terminal
ER Export signal and the C-terminal trafficking signal are linked
by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50,
75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino
acids in length. The linker may further comprise a fluorescent
protein, for example, but not limited to, a yellow fluorescent
protein, a red fluorescent protein, a green fluorescent protein, or
a cyan fluorescent protein. In some embodiments the ER Export
signal is more C-terminally located than the trafficking signal. In
some embodiments the trafficking signal is more C-terminally
located than the ER Export signal.
[0085] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 3, wherein the N-terminal signal
peptide of SEQ ID NO:3 is deleted or substituted In some
embodiments, the light-activated protein comprises an amino acid
sequence at least 95% identical to the sequence shown in residues
40-291, 39-291, 38-291, 37-291, 36-291, 35-291, 34-291, 33-291,
32-291, 31-291, 30-291, 29-291, 28-291, 27-291, 26-291, 25-291,
24-291, 23-291, 22-291, 21-291, 20-291, 19-291, 18-291, 17-291,
16-291, 15-291, 14-291, 13-291, 13-291, 12-291, 11-291, 10-291,
9-291, 8-291, 7-291, 6-291, 5-291, 4-291, 3-291, 2-291, or 1-291 of
SEQ ID NO:3. In some embodiments, other signal peptides (such as
signal peptides from other opsins) may be used. The light-activated
protein may further comprise an ER transport signal and a membrane
trafficking signal described herein.
[0086] Also provided herein are polynucleotides encoding for any of
the proteins described herein, such as a light-activated protein
comprising a core amino acid sequence at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence
shown in SEQ ID NO: 3, an ER export signal, and a membrane
trafficking signal. The polynucleotides may be in an expression
vector (such as a viral vector described herein). The
polynucleotides may be used for expression of the light-activated
protein in animal cells.
[0087] Provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein is responsive to green light and is derived from
Halobacterium salinarum wherein the protein is capable of mediating
a hyperpolarizing current in the cell when the cell is illuminated
with light. In some embodiments the light has a wavelength between
about 520 and 570 nm. In some embodiments, the light has a
wavelength about 560 nm. In some embodiments, the light-activated
protein comprises an amino acid sequence at least 95% identical to
the sequence shown in SEQ ID NO: 4. In some embodiments, the
light-activated protein comprises an amino acid sequence at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical
to the sequence shown in SEQ ID NO: 4. In some embodiments, the
light-activated protein comprises substitutions, deletions, and/or
insertions introduced into a native amino acid sequence to increase
or decrease sensitivity to light, increase or decrease sensitivity
to particular wavelengths of light, and/or increase or decrease the
ability of the light-activated protein to regulate the polarization
state of the plasma membrane of the cell. In some embodiments, the
light-activated protein contains one or more conservative amino
acid substitutions. In some embodiments, the light-activated
protein contains one or more non-conservative amino acid
substitutions. The light-activated protein comprising
substitutions, deletions, and/or insertions introduced into the
native amino acid sequence suitably retains the ability to
hyperpolarize the plasma membrane of a neuronal cell in response to
light.
[0088] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 4 and an endoplasmic reticulum (ER)
export signal. The ER export signal may be fused to the C-terminus
of the core amino acid sequence or may be fused to the N-terminus
of the core amino acid sequence. In some embodiments, the ER export
signal is linked to the core amino acid sequence by a linker. The
linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125,
150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in
length. The linker may further comprise a fluorescent protein, for
example, but not limited to, a yellow fluorescent protein, a red
fluorescent protein, a green fluorescent protein, or a cyan
fluorescent protein. In some embodiments, the ER export signal
comprises the amino acid sequence FXYENE, where X can be any amino
acid. In some embodiments, the ER export signal comprises the amino
acid sequence VXXSL, where X can be any amino acid. In some
embodiments, the ER export signal comprises the amino acid sequence
FCYENEV.
[0089] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 4 and a trafficking signal (e.g.,
which enhances transport to the plasma membrane). The signal
peptide may be fused to the C-terminus of the core amino acid
sequence or may be fused to the N-terminus of the core amino acid
sequence. In some embodiments, the signal peptide is linked to the
core amino acid sequence by a linker. The linker can comprise any
of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250,
275, 300, 400, or 500 amino acids in length. The linker may further
comprise a fluorescent protein, for example, but not limited to, a
yellow fluorescent protein, a red fluorescent protein, a green
fluorescent protein, or a cyan fluorescent protein. In some
embodiments, the trafficking signal is derived from the amino acid
sequence of the human inward rectifier potassium channel Kir2.1. In
some embodiments, the trafficking signal comprises the amino acid
sequence K S R I T S E G E Y I P L D Q I D I N V.
[0090] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 4 and two or more amino acid sequence
motifs which enhance transport to the plasma membranes of mammalian
cells selected from the group consisting of an ER export signal and
a membrane trafficking signal. In some embodiments, the light
activated protein comprises a C-terminal ER Export signal and a
C-terminal trafficking signal. In some embodiments, the C-terminal
ER Export signal and the C-terminal trafficking signal are linked
by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50,
75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino
acids in length. The linker may further comprise a fluorescent
protein, for example, but not limited to, a yellow fluorescent
protein, a red fluorescent protein, a green fluorescent protein, or
a cyan fluorescent protein. In some embodiments the ER Export
signal is more C-terminally located than the trafficking signal. In
some embodiments the trafficking signal is more C-terminally
located than the ER Export signal.
[0091] Also provided herein is an animal cell comprising a
light-activated protein expressed on the cell membrane, wherein the
protein comprises a core amino acid sequence at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the
sequence shown in SEQ ID NO: 4, wherein the N-terminal signal
peptide of SEQ ID NO:4 is deleted or substituted. In some
embodiments, the light-activated protein comprises an amino acid
sequence at least 95% identical to the sequence shown in residues
40-262, 39-262, 38-262, 37-262, 36-262, 35-262, 34-262, 33-262,
32-262, 31-262, 30-262, 29-262, 28-262, 27-262, 26-262, 25-262,
24-262, 23-262, 22-262, 21-262, 20-262, 19-262, 18-262, 17-262,
16-262, 15-262, 14-262, 13-262, 13-262, 12-262, 11-262, 10-262,
9-262, 8-262, 7-262, 6-262, 5-262, 4-262, 3-262, 2-262, or 1-262 of
SEQ ID NO:4. In some embodiments, other signal peptides (such as
signal peptides from other opsins) may be used. The light-activated
protein may further comprise an ER transport signal and/or a
membrane trafficking signal described herein.
[0092] Also provided herein are polynucleotides encoding for any of
the proteins described herein, such as a light-activated protein
comprising a core amino acid sequence at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence
shown in SEQ ID NO: 4, an ER export signal, and a membrane
trafficking signal. The polynucleotides may be in an expression
vector (such as a viral vector described herein). The
polynucleotides may be used for expression of the light-activated
protein in animal cells.
[0093] In certain more particular embodiments, a method for
providing a light responsive protein for mammalian expression is
provided. A light responsive protein is isolated from G. theta
(GtR3). GtR3 has a C-terminus and an N-terminus. A promoter is
added to the C-terminus of GtR3. In certain embodiments the
promoter is an endoplasmic reticulum (ER) export signal. For more
specifics on optimizing GtR3 for expression in mammalian cells, see
Appendix A as filed in the underlying provisional application and
entitled, "Molecular and Cellular Approaches for Diversifying and
Extending Optogenetics."
[0094] An excitatory protein encourages firing of the action
potential by moving the potential of the cell toward the action
potential trigger level for the cell. In many neurons, this means
that the protein decreases the negative voltage seen across the
cell membrane. In a specific instance, the protein acts an
additional ion channel that transfers cations into the cell. In
this manner, the protein generates an excitatory current across the
cell membrane. More specifically, the protein responds to light by
raising the voltage across the cell membrane, thereby increasing
the probability that an action potential or depolarization will
occur. In certain instances the voltage across the cell membrane
can be increased to the action potential trigger level or higher,
causing depolarization of the cell.
[0095] Certain aspects of the present invention are based on the
identification and development of a channel (DChR) that is derived
from Dunaliella salina. Channelrhodopsin DChR mediates a robust
depolarizing current when illuminated with blue light. The
depolarizing current may cause a cell to become excited in response
to exposure to blue light. In certain embodiments DChR is expressed
as an exogenous protein in a cell of interest. For neural cells,
DChR can function as an excitatory protein that uses an endogenous
cofactor when delivered to a cell of interest.
[0096] The introduction of GtR3 and DChR to the field of
optogenetics opens the door for a variety of applications. For
instance, GtR3 and DChR can be used in combination with other
optogenetic ion-passing molecules, such as ChR2 (developed from
Chlamydomonas reinhardtii). GtR3 and DChR have different operating
parameters, relative to other light-responsive molecules. This
facilitates the development of a cell or a cell population that has
a precisely-tuned response to different wavelengths of light. The
parameter that can be tuned include, but are not limited to,
current density, hyperpolarization level, membrane conductance,
stimulus frequency, resting potential, optical wavelength and/or
optical intensity.
[0097] In another example embodiment, a method for controlling
action potential of a neuron involves the following steps:
engineering a first light responsive protein in the neuron;
producing, in response to light, an inhibitory current in the
neuron and from the first light responsive protein; engineering a
second light responsive protein in the neuron; and producing, in
response to light, an excitation current in the neuron from the
second light responsive protein. The first light responsive protein
and the second light responsive protein may be responsive to
different wavelengths of light. In certain instances, the use of
DChR or GtR3 can facilitate specific current densities for this
excitation or inhibitory current and/or optical wavelength at which
such current is generated.
[0098] In another example embodiment, a method for controlling
action potential of a neuron involves the following steps:
engineering a first light responsive protein in the neuron;
producing, in response to light, an inhibitory current in the
neuron and from the first light responsive protein; engineering a
second light responsive protein in the neuron; and producing, in
response to light, a second inhibitory current from the second
light responsive protein, the combination of the two currents more
strongly inhibiting the neuron than a single light responsive
protein. For instance, the first light responsive protein could be
NpHR and the second light responsive protein could be GtR3.
[0099] Another method for controlling a voltage level across a cell
membrane of a cell includes measuring the voltage level of the cell
membrane. A light responsive protein is engineered and introducing
the light responsive protein into the cell, where it is expressed.
A light of a particular wavelength is provided, which produces a
reaction in the cell by the light responsive protein. The response
by the light responsive protein produces a current across the cell
membrane. The current is responsive to the measured voltage
level.
[0100] Another aspect of the present invention is directed to a
system for controlling an action potential of a neuron in vivo. The
system includes a delivery device, a light source, and a control
device. The delivery device introduces a light responsive protein
to the neuron, with the light responsive protein producing an
inhibitory current. The light source generates light for
stimulating the light responsive protein, and the control device
controls the generation of light by the light source. In other
embodiments the light responsive protein introduced into the neuron
produces an excitatory current.
[0101] In more detailed embodiments, such a system is further
adapted such that the delivery device introduces the light
responsive protein by one of transfection, transduction and
microinjection, and/or such that the light source introduces light
to the neuron via one of an implantable light generator and
fiber-optics. For additional detail regarding method of delivery
and expression of genes, see, PCT Publication No. WO2010/019619 A1
(PCT/US2009/053474), entitled "Method and Composition for
Controlling Gene Expression," which is fully incorporated herein by
reference.
[0102] Another aspect of the present disclosure is directed to a
method for treatment of a disorder. The method targets a group of
neurons associated with the disorder; and in this group, the method
includes engineering inhibitory proteins to respond to light by
producing an inhibitory current to dissuade depolarization of the
neurons, and exposing the neurons to light, thereby dissuading
depolarization of the neurons.
[0103] Yet another aspect of the present disclosure is directed to
a further method for treatment of a disorder. The method targets a
group of neurons associated with the disorder; and in this group,
the method includes engineering excitatory proteins to respond to
light by producing an excitatory current to encourage
depolarization of the neurons, and exposing the neurons to light,
thereby encouraging depolarization of the neurons. In other aspects
of the present invention both inhibitory and excitatory proteins,
responsive to different wavelengths of light, are introduced into a
targeted group of neurons. The neurons are exposed alternatively to
different wavelengths of light to excite, and inhibit the
depolarization of the neurons.
[0104] More detailed embodiments expand on such techniques. For
instance, another aspect of the present invention co-expresses GtR3
and DChR with other known opsins, such as NpHR and VChR1 in the
species (e.g., a mouse and C. elegans). Also, opsins creating
currents of opposite polarity and having different color
sensitivity are integrated with calcium imaging in acute mammalian
brain slices for bidirectional optical modulation and readout of
neural activity. Likewise, the coupled opsins can be targeted to C.
elegans muscle and cholinergic motoneurons to control locomotion
bidirectionally. Together coupled opsins can be used as a complete
and complementary optogenetic system for multimodal, high-speed,
genetically-targeted, all-optical interrogation of living neural
circuits. Further, more than one set of cells may be targeted with
different couplings of opsins, allowing for precise control of
multiple sets of cells independently from each other.
[0105] In addition to GtR3 and DChR, there are a number of
channelrhodopsins, halorhodopsins, and microbial opsins that can be
engineered to optically regulate ion flux or second messengers
within cells. Various embodiments of the invention include
codon-optimized, mutated, truncated, fusion proteins, targeted
versions, or otherwise modified versions of such ion optical
regulators. For example, GtR3 and DChR (e.g., Appendices B and C as
filed in the underlying provisional application). The cited opsins
are used as representative of a number of different embodiments.
Discussions specifically identifying GtR3 and DChR are not meant to
limit the invention to such specific examples of optical regulators
unless specified. For further details regarding the above mentioned
sequences, reference can be made to "Multimodal fast optical
interrogation of neural circuitry" by Feng Zhang, et al, Nature
(Apr. 5, 2007) Vol. 446: 633-639, which is fully incorporated
herein by reference.
[0106] Table 1 shows identified opsins for inhibition of cellular
activity across the visible spectrum:
TABLE-US-00001 TABLE 1 Fast optogenetics: inibition across the
visible spectrum Biological Wavelength Opsin Type Origin
Sensitivity Defined action NpHR natronomonas 680 nm utility
Inhibition pharaonis (with 3.0 series) (hyperpolarization) 589 nm
max BR halobacterium 570 nm max Inhibition helobium
(hyperpolarization) AR Acetabulaira 518 nm max Inhibition
acetabulum (hyperpolarization) GtR3 Guillardia 472 nm max
Inhibition theta (hyperpolarization)
[0107] Table 2 show identified opsins for excitation and modulation
across the visible spectrum:
TABLE-US-00002 TABLE 2 Fast optogenetics: excitation and modulation
across the visible spectrum Opsin Wavelength Type Biological Origin
Sensitivity Defined action VChR1 Volvox carteri 589 nm utility
Excitation 535 nm max (depolarization) optoXRs Bos taurus 505 nm
max Modulation (Gs, Gq pathways) DChR Dunaliella salina 500 nm max
Excitation (depolarization) SFOs Chlamydomonas 546 nm deactivate
modulation reinhardtii 470 nm activate (electrical up states) ChR2
Chlamydomonas 470 nm max Excitation reinhardtii 380-405 nm utility
(depolarization)
[0108] Opsins described in U.S. patent application Ser. Nos.
12/988,567 and 12/996,753, U.S. Patent Application Publication Nos:
2007/0054319, 2010/0234273, 2007/0261127, 2007/0053996,
2010/0145418, 2009/0093403, 2008/0085265, 2010/0190229,
2009/0099038, and PCT Publication No. PCT/US09/64355 are
incorporated herein by reference in their entirety.
[0109] In certain embodiments of the present invention, various
combinations of the listed opsins, for example, are delivered to a
cell population. A second combination can be delivered to a
different cell population. Using the defined action and the
wavelength sensitivity information for each opsin, combinations of
opsins may be chosen to excite certain cell populations while
inhibiting others, for example.
[0110] Consistent with one example embodiment of the present
invention, target cells are stimulated using an implantable
arrangement. The implantable arrangement includes a biological
portion that facilitates the stimulation of the target cells in
response to receipt of light. The implantable arrangement also
includes a light generator for creating light to trigger the
stimulus of the target cells. In certain embodiments the
implantable arrangement includes a microcontroller and a feedback
loop. The color of light created by the light generator is
dependent on the voltage of the cell. The target cell can include
multiple light sensitive proteins which respond to different
wavelengths of light to inhibit or encourage depolarization of the
target cell.
[0111] Consistent with another example embodiment of the present
invention, a method is implemented for stimulating target cells in
vivo using gene transfer vectors (for example, viruses) capable of
inducing photosensitive ion channel growth (for example, DChR ion
channels) or photosensitive ion pumps (for example, GtR3 proton
pumps). The vectors are implanted in the body, along with the
electronic components of the apparatus. A light producing device is
implanted near the target cells. The target cells are stimulated in
response to light generated by the light producing device. In
certain more specific embodiments, gene transfer vectors are
capable of inducing growth of more than one ion channel or ion
pump.
[0112] Consistent with a particular embodiment of the present
invention, a protein is introduced to one or more target cells.
When introduced into a cell, the protein changes the potential of
the cell in response to light having a certain frequency. This may
result in a change in resting potential that can be used to control
(dissuade) action potential firing. In a specific example, the
protein is GtR3 which acts as a membrane pump for transferring
charge across the cell membrane in response to light. Membrane
pumps are energy transducers which use electromagnetic or chemical
bond energy for translocation of ions across the membrane. In other
specific examples, the protein is a halorhodopsin which acts as the
membrane pump. The halorhodopsin membrane pump moves specific ions
across the membrane. For further information regarding
halorhodopsin membrane pumps, reference can be made to
"Halorhodopsin Is a Light-driven Chloride Pump" by Brigitte
Schobert et al, The Journal of Biological Chemistry Vol. 257, No.
17. Sep. 10, 1982, pp. 10306-10313, which is fully incorporated
herein by reference.
[0113] In specific embodiments GtR3 and NpHR may be introduced into
different target cell populations, respectively. The two inhibitors
are responsive to different wavelengths of light allowing the two
proteins to be used to inhibit different target cell populations
independently. GtR3 and NpHR may also be introduced into the same
cell population for gradient control over the inhibition of a cell
population. For instance, GtR3 and NpHR molecules within the same
cell can be activated relatively independent from one another.
Thus, a first level of inhibition can be implemented by activating
the molecule type (GtR3 or NpHR) that provides the lowest current
levels for the cell conditions. The next level could be implemented
by deactivating this first molecule type and activating the other
molecule type. A third level can be implemented by activating both
molecules simultaneously. Further gradient control can be achieved
by varying the wavelength of light, or by varying the light
intensity at or near the maxima of each protein, for example.
[0114] The combination of multiple inhibitors can also lead to
shunting inhibition, which combined with hyperpolarizing inhibition
can lead to stronger hyperpolarization in the combination approach
than from using a single inhibitor protein. In a cell membrane the
reversal potential (also known as the Nernst potential) of an ion
is the membrane potential at which there is no net (overall) flow
of ions from one side of the membrane to the other. Each type of
ion channel has a specific reversal potential. At the Nernst
potential the outward and inward rates of ion movement are the same
(the ion flux is in equilibrium for the ion type). A change of
membrane potential on either side of the Nernst potential reverses
the overall direction of ion flux. If the reversal potential of an
ion channel is below the resting potential (or instant potential in
the case where a light responsive protein ion channel been
stimulated and changed the "resting" potential) of the cell
membrane, the ion channel will contribute to inhibition through
hyperpolarization of the cell. In contract, if the reversal
potential for an ion channel is between the resting potential and
the threshold for the generation of action potentials, the ion
channel will have a shunting effect. The concentration gradient for
any given ion (for example Cl--) is determined in part by the
balance between the activity of the other ions (for example Na+ and
K+). Shunting inhibition is termed "shunting" because the channel
conductance short-circuits currents that are generated at adjacent
excitatory channels. Accordingly, the addition of a light
responsive protein channel with inhibitory characteristics can
lower the membrane potential to a point where an existing ion
channel reverses direction and "shunts" the current, creating an
additional path which prevents the membrane potential from reaching
the action potential.
[0115] Provided herein are populations of cells, tissues, and
non-human animals comprising a cell expressing one or more of the
light-activated proteins described herein on the cell membrane.
Methods of using the cells, population of cells, tissues, and
non-human animals are also provided.
[0116] FIG. 1A shows a light responsive ion-passing molecule (a
pump or channel) 150 in a cell membrane 160. In general, ion
channels allow flow toward the channel's reversal potential (or
equilibrium potential for the channel); the direction is based on
whether the membrane potential is above or below the channel's
reversal potential. Ion channels do not require additional energy
to transport the ion. Ion pumps transport ions against the
equilibrium flow and require introduction of some form of energy,
such as ATP, to transport the ion across the membrane. Ions 162 may
be anions or cations. The hydrogen ion is a proton (as well as a
cation). The direction the ions flow along with the ions polarity
will determine whether the ion-passing molecule has a
hyperpolarizing effect or a depolarizing effect on the cell. In
certain embodiments, the ion-passing molecule 150 transports
protons out of the cell, causing hyperpolarization of the cell and
inhibition of the firing of the cell. The light responsive ion
channel/pump 150 is not open/active unless light of the appropriate
frequency is present.
[0117] FIG. 1B shows an alternative embodiment of the present
invention where a light responsive ion-passing molecule 150 is
expressed within membranes that are internal to a cell. Many of the
internal components of the cell have membranes similar to the cell
membrane that encloses the cell. The membrane of organelle 152
contains naturally occurring ion pump/channels before introduction
of a light responsive protein. Depending on the promoters
introduced along with the exogenous light responsive protein, the
light responsive protein can express as an ion pump/channel in the
membrane of variety of different organelles, in the cell membrane,
or a combination of different organelles and/or the cell membrane.
In certain embodiments the light responsive ion-passing molecule
150 is a proton pump. In other embodiments the pump can be a
pump/channel for a specific cation or a specific anion. The ion
pump/channel 150 is located in the membrane 156 of the
organelle.
[0118] The transfer of protons across a membrane in which the
ion-passing molecule is expressed can be used to change the
membrane potential of either or both membrane 156 and membrane 160.
The transport of protons out of the cytoplasm can cause a cell to
become hyperpolarized, resulting in inhibition of the cell.
[0119] In certain instances, the pump/channel 150 can be used to
change the pH of the organelle 152 and the surrounding cytoplasm
154. In addition, the pH of the organelle in which the protein is
expressed can be changed and/or controlled. Because most enzymes
within a cell are pH sensitive, the pH of each organelle critically
determines the coordinated bio-chemical reactions occurring along
the endocytic and secretory pathways. Aberrations of the normal
organellar pH homeostasis can lead to significant functional
changes. Depending on the level of expression of the light
responsive protein, and the location (i.e. which organelle) various
functions of the cell may be enhanced or retarded. At high enough
levels of expression the cell may be killed. This can be desirable
in unwanted (i.e. cancer) cells. For instance, cells can be locally
transfected at a cancerous tumor location and then carefully
directed light pulses can be used to shrink or eliminate the
tumor.
[0120] FIG. 2A shows two examples of the use of light responsive
proteins, each example including three cell populations, A, B, and
C. As discussed briefly above, two or more light responsive
proteins can be introduced into the same cell populations. The
light responsive proteins introduced can cause the same response or
different response when activated. The different proteins can also
have different reaction times, or strengths of reactions. Two
proteins of the same polarity can be activated at the same time
causing an additive effect. Two depolarizing proteins, for example,
may be alternatively stimulated. This can allow for an increase in
frequency of firing. In example 1, cell populations A and B express
the same inhibiting protein, but different excitatory proteins.
Cell population C has an excitatory protein which reacts to light
around the same wavelength as the inhibiting protein of cell
populations A and B. The inhibitor of cell population C reacts to a
wavelength similar to the excitatory protein of cell population A.
This arrangement allows for a variety of combinations of cell
population reactions to the light provided to stimulate the cell
populations. As example 1 is set up, cell population B may be
excited without exciting or inhibiting either of the other two
populations. However, cell populations A and C react in almost an
inverse way to the light provided.
[0121] Example 2 includes cell population A with three light
responsive proteins and cell populations B and C with two light
responsive proteins. Cell population A includes two excitatory
proteins which react to different light wavelengths, and one
inhibitory protein. Cell populations B and C each have one of the
excitatory proteins of cell population A and an inhibitory protein
which responses to wavelengths in the same spectrum as the
excitatory protein present in the other cell population (B or C).
This arrangement allows for the combination of cell populations A
and B to be excited, or cell populations B and C to be excited,
while the third cell population is inhibited. It allows for cell
population A to be inhibited without affecting either cell
population B or C, and for cell population A to be excited while
both cell populations B and C are inhibited. The example
combination of FIG. 2A are not meant to be limiting, but to
illustrate some of the many combinations of light responsive
proteins in both a single cell population, and the combinations
across cell populations.
[0122] Consistent with another example embodiment of the present
invention, target cells are neurons located in the brain of a
mammal. The target cells are genetically modified to express
photosensitive bio-molecular arrangement, for example, DChR ion
channels. Light can then be used to stimulate the neurons.
Depending upon a number of factors, such as the location within the
brain and the frequency and length of stimulation, different
objectives can be achieved. For instance, current techniques for
deep brain stimulus (DBS) use electrodes to apply a current
directly to the targeted area of the brain. The frequency of the
electrical stimulus is sometimes referred to as either
low-frequency DBS or high-frequency DBS. Studies have suggested
that high-frequency DBS inhibits the generation of impulses from
the stimulated cells, while low-frequency DBS facilitates the
generation of impulses from the stimulated cells. The frequencies
that produce the effects of high-frequency of low-frequency DBS
have also been shown to vary depending upon the specific area of
the brain being stimulated. According to one example of
high-frequency DBS, the neurons are stimulated using electrodes
supplying current pulses at frequencies around 100 Hz or more. Such
a frequency has been shown to be effective in certain applications,
as discussed further herein.
[0123] In various cell populations, similar to those illustrated in
FIG. 2A, two or more light responsive proteins may be present. Some
(or all) of the two or more light responsive proteins can direct
the same action (i.e., excitation or inhibition) within the cell
population. For example cell population A of example 2 includes two
excitatory light responsive proteins, DChR and VChR1. FIG. 2B shows
a stimulus profile for use with certain embodiments in which two or
more types of light responsive proteins, for example DChR and
VChR1, may be introduced into the same cell population. Each
ion-passing molecule has a respective stimulus frequency limit,
which can be partially responsive to environmental factors like pH.
This limit reflects the recovery time necessary for the molecule to
transition between active and inactive states. The use of two types
of light-responsive proteins, each responding to different optical
wavelengths, can allow for each type of protein to be controlled
separately. The respective ion channels can be activated
alternatively, allowing for an increased frequency of stimulation
of the brain.
[0124] For instance, example 3 shows that light pulses (solid
vertical lines) of a first wavelength and provided at a frequency
F. This wavelength is selected to activate a first type of molecule
(triangles). A second set of light pulses (dotted vertical lines)
of a second wavelength can also be provided at a frequency F. This
second set of light pulses can be used to activate a second type of
molecule (squares). The resulting activation frequency for both
cells is thus twice the frequency of activation for each individual
ion-passing molecule. Of course, the frequencies need not be
identical between the two types of molecules and can be varied over
time.
[0125] In another implementation, shown in example 4, a first type
of ion-passing molecule can be activated for a time period followed
by activation of a second type of ion-passing molecule. This can be
particularly useful for allowing each of the ion-passing molecules
to be inactive for the time period during which the other
ion-passing molecule is being activated. In certain instances, this
can facilitate recovery and sustained use of the ion-passing
molecules. Moreover, the different current types, densities and
ion-passing capabilities can be considered when deciding on the
specific stimulation profile to create the desired response.
[0126] A specific example of DBS is used for the treatment of
Parkinson's disease. In this application, DBS is often applied to
the globus pallidus interna, or the subthalamic nucleus within a
patient's brain. By implanting a biological arrangement that
modifies the cells to respond to light, a light flashing light can
be used in place of electrodes. Thus, the targeted neuron cells and
external electrical signal need not be directly applied to the
targeted cells. Moreover, light can often travel from its point of
origin farther than electricity, thereby increasing the effective
area relative to the stimulation source and only those neurons that
have been photosensitized are stimulated.
[0127] As with the electrode-based DBS methods, one embodiment of
the present invention can be implemented using high-frequency DBS
to inhibit neuron generated impulses. While high-frequency DBS has
been accomplished at frequencies around 100 Hz, high-frequency DBS
using various embodiments of the present invention may not
necessarily require the same frequency. For instance, it may be
possible to reproduce the inhibiting effects of high-frequency DBS
at lower frequencies (e.g., 50 Hz) when using light activated
techniques. For example, activation of the GtR3 pump intrinsically
favors hyperpolarization and resistance to action potential
generation. Various frequencies can be used depending upon the
particular application (e.g., the targeted portion of the brain and
the desired effect), and the stimulation modality being
applied.
[0128] Consistent with another example embodiment of the present
invention, gene transfer vectors inducing the expression of
photosensitive bio-molecules are used to target a specific type of
cell. For instance, viral-based proteins (e.g., lentiviruses,
adeno-associated viruses or retroviruses) can be created to target
specific types of cells, based upon the proteins that they uniquely
express. The targeted cells are then infected by the viral-based
gene-transfer proteins, and begin to produce a new type of ion
channel (for example DChR), thereby becoming photosensitive. This
can be particularly useful for stimulating the targeted cells
without stimulating other cells that are in proximity to the
targeted cells. For example, neurons of disparate length, diameter,
chronaxie, other membrane properties, electrical insulation,
neurotransmitter output, and overall function, lie in close
proximity to one another, and thus, can be inadvertently stimulated
when using electrodes to provide the stimulation of the neurons.
For further details on the generation of viral vectors and the in
vivo modification and stimulation of neural cells, reference may be
made to U.S. patent application Ser. No. 11/459,636 filed on Jul.
24, 2006, "An optical neural interface: in vivo control of rodent
motor cortex with integrated fiber optic and optogenetic
technology" by Alexander M. Aravanis, et al, Journal Neural
Engineering 4 (2007) S143-S156, "Neural substrates of awakening
probed with optogenetic control of hypocretin neurons" by Antoine
R. Adamantidis, et al, Nature, (Nov. 15, 2007) Vol. 450: 420-424,
"Targeting and Readout Strategies for Fast Optical Neural Control
In Vitro and In Vivo" by Viviana Gradinaru, et al, The Journal of
Neuroscience, (Dec. 26, 2007) 27(52):14231-14238, "Multimodal fast
optical interrogation of neural circuitry" by Feng Zhang, et al,
Nature (Apr. 5, 2007) Vol. 446: 633-639, "Circuit-breakers: optical
technologies for probing neural signals and systems" by Feng Zhang,
et al, Nature Reviews Neuroscience (August 2007) Vol. 8: 577-581,
which are each fully incorporated herein by reference.
[0129] A specific embodiment of the present invention employs an
implantable arrangement for in vivo use. A light-emitting diode,
laser or similar light source is included for generating light (as
shown, for example, light generator 104 in FIG. 3). A biological
portion that modifies target cells to include light responsive
molecules which facilitate stimulation of the target cells in
response to light generated by the light source.
[0130] Another embodiment of the present invention employs an
arrangement for stimulating target cells using a photosensitive
protein that allows the target cells to be stimulated in response
to light. A biological delivery device, such as those discussed in
connection with biological portion 204 of FIG. 4, is used for
implanting vectors that modify the target cells to include the
photosensitive protein. An implantation component, such as that
discussed in connection with biological portion 204, the mesh of
FIG. 7 or viral matrix of FIG. 8, is used for implanting a light
generating device near the target cells. A control device, such as
that discussed in connection control circuit 208, is used for
activating the light generating device to generate light to be
received by the target cells, thereby stimulating the target cells
in response to the generated light.
[0131] Returning now to the figures, FIG. 3 shows a block diagram
of a system for stimulating target cells, according to an example
embodiment of the present invention. Block 102 represents a
location internal to an organism (e.g., a mammal), as shown by the
in vivo designation. Light generator 104 is an implantable device
that generates light in vivo. The photosensitive biological portion
106 affects the target cells such that generated light strikes
causes stimulation of the target. In one instance, the light
generator 104 is a small electronic device on the order of a few
millimeters in size. The small size is particularly useful for
minimizing the intrusiveness of the device and associated
implantation procedure. In another instance, the light generator
104 may include a fiber optic device that can be used to transmit
light from an external source to the target cells.
[0132] In one embodiment of the present invention, the target cells
are modified to contain light-activated proton pump/channel
proteins. A specific example of such protein is GtR3, which is a
product based upon the cryptophytes Guillardia theta.
Characterization of the action spectra for GtR3 suggests that the
absorption maxima are around 490 nm. Another specific example is
DChR from Dunaliella salina. The action maxima for DChR are around
500 nm.
[0133] These light sensitive proteins can be implanted using a
number of different methods. Example methods include, but are not
limited to, the use of various delivery devices, such as gelatin
capsules, liquid injections and the like. Such methods also include
the use of stereotactic surgery techniques such as frames or
computerized surgical navigation systems to implant or otherwise
access areas of the body. For further details on delivery of such
proteins, reference may be made to U.S. patent application Ser. No.
11/459,636 filed on Jul. 24, 2006 and entitled "Light-Activated
Cation Channel and Uses Thereof', which is fully incorporated
herein by reference.
[0134] FIG. 4 shows a block diagram of an implantable device for
stimulating target cells, according to an example embodiment of the
present invention. The figure includes control circuit 208, light
source 206, biological portion 204 and target cells 202. Biological
portion 204 affects the target cells 202 such that the target cells
are stimulated in response to light
[0135] In one embodiment of the present invention, biological
portion 204 may be composed of target cells 202 that have been
modified to be photosensitive. In another embodiment of the present
invention, biological portion 204 may contain biological elements
such as gene transfer vectors, which cause target cells 202 to
become sensitive to light. An example of this is lentiviruses
carrying the gene for DChR expression. In this manner, the
stimulation of target cells 202 can be controlled by the
implantable device. For example, the control circuit 208 can be
arranged to respond to an external signal by activating, or
deactivating light source 206, or by charging the battery that
powers light source 206. In one instance, the external signal is
electromagnetic radiation that is received by control circuit 208.
For example, radio frequency (RF) signals can be transmitted by an
external RF transmitter and received by control circuit 208. In
another example, a magnetic field can be used to activate and/or
power the control circuit.
[0136] Control circuit 208 can be implemented using varying degrees
of complexity. In one instance, the circuit is a simple coil that
when exposed to a magnetic field generates a current. The current
is then used to power light source 206. Such an implementation can
be particularly useful for limiting the size and complexity as well
as increasing the longevity of the device. In another instance,
control circuit 208 can include an RF antenna. Optionally, a
battery or similar power source, such as a capacitive element, can
be used by control circuit 208. While charged, the power source
allows the circuitry to continue to operate without need for
concurrent energy delivery from outside the body. This can be
particularly useful for providing precise control over the light
emitted by light source 206 and for increased intensity of the
emitted light. In one embodiment of the present invention, light
source 206 is implemented using a light-emitting-diode (LED). LEDs
have been proven to be useful for low power applications and also
to have a relatively fast response to electrical signals.
[0137] In another embodiment of the present invention, biological
portion 204 includes a gelatin or similar substance that contains
gene transfer vectors which genetically code the target cells for
photosensitivity. In one instance, the vectors are released once
implanted into the body. This can be accomplished, for example, by
using a containment material that allows the vectors to be released
into aqueous solution (e.g., using dehydrated or water soluble
materials such as gelatins). The release of the vectors results in
the target cells being modified such that they are simulated in
response to light from light source 206.
[0138] In another embodiment of the present invention, the
biological portion 204 includes a synthetic mesh that contains the
photosensitive cells. In one instance, the cells are neurons that
have been modified to be photosensitive. The synthetic mesh can be
constructed so as to allow the dendrites and axons to pass through
the mess without allowing the entire neuron (e.g., the cell body)
to pass. One example of such a mesh has pores that are on the order
of 3-7 microns in diameter and is made from polyethylene
terephthalate. In another example embodiment, the biological
portion 204 includes an injection mechanism as discussed in further
detail herein.
[0139] FIG. 5 shows a block diagram of an implantable device,
according to an example embodiment of the present invention. The
implantable device of FIG. 3 is responsive to a field magnetic.
More specifically, an inductor constructed from windings 302 and
core 304 generates a current/voltage in response to a magnetic
field. The current is passed to control circuit 310 through
conductive path 306. In response, control circuit 310 activates
light source 312 using conductive path 308. Light source 312
illuminates biological portion 314 in order to stimulate the target
cells. In one instance, biological portion 314 includes a gelatin,
synthetic mesh or injection mechanism as discussed in further
detail herein.
[0140] In one embodiment of the present invention, the control
portion can be a simple electrical connection, resistive element,
or can be removed completely. In such an embodiment, the intensity,
duration and frequency of light generated would be directly
controlled by the current generated from a magnetic field. This can
be particularly useful for creating inexpensive, long lasting and
small devices. An example of such an embodiment is discussed
further in connection with FIG. 6A and FIG. 6B.
[0141] In another embodiment of the present invention, the control
portion can be implemented as a more complex circuit. For instance
the control circuit may include and otherwise implement different
rectifier circuits, batteries, pulse timings, comparator circuits
and the like. In a particular example, the control circuit includes
an integrated circuit (IC) produced using CMOS or other processes.
Integrated circuit technology allows for the use of a large number
of circuit elements in a very small area, and thus, a relatively
complex control circuit can be implemented for some
applications.
[0142] In a particular embodiment of the present invention, the
inductor (302 and 304 of FIG. 5) is a surface mount inductor, such
as a 100 uH inductor part number CF1008-103K supplied by Gowanda
Electronics Corp. The light generating portion is a blue LED, such
as LEDs in 0603 or 0805 package sizes. A particular example is a
blue surface mount LED having part number SML0805, available from
LEDtronics, Inc (Torrance, Calif.). Connective paths 306 and 308
can be implemented using various electrical conductors, such as
conductive epoxies, tapes, solder or other adhesive materials. LEDs
emitting light in the amber spectrum (as applicable to NpHR
channels) and other spectrums are available through commercial
sources including this same manufacturer.
[0143] FIG. 6A shows a block diagram of an implantable device,
according to an example embodiment of the present invention. FIG.
6A shows an inductor comprising coils 402 and core 404 connected to
LED 408 using conductive paths shown by 406. FIG. 6B shows a
circuit diagram corresponding to the block diagram of FIG. 6A.
Inductor 412 is connected in parallel to LED 410. Thus, current and
voltage generated by changing a magnetic field seen at inductor 412
causes LED 410 to produce light. The frequency and strength of the
changing magnetic field can be varied to produce the desired amount
and periodicity of light from LED 410.
[0144] FIG. 7A and FIG. 7B show a diagram of a mesh for containing
photosensitive bio-molecules, according to an example embodiment of
the present invention. Mesh 502 is constructed having holes 504 of
a size that allows illumination to pass but is small enough to
prevent cells 506 to pass. This allows for cells 506 to be
implanted while still receiving light from a light generator.
[0145] In one embodiment of the present invention, the cells 506
are stem cells that are modified to be photosensitive. The stem
cells are allowed to mature as shown by FIG. 7B. In a particular
instance, the stem cells mature into neurons having a cell body
512, axons/dendrites 508 and 510. The neurons are genetically
modified to be photosensitive. Holes 504 are on the order of 3-7
microns in diameter. This size allows some axons and dendrites to
pass through holes 504, while preventing the cell body 512 to
pass.
[0146] FIG. 8A and FIG. 8B show a diagram of a viral matrix,
according to an example embodiment of the present invention. The
viral matrix includes structure 602, which contains viral vectors
604. In one instance, structure 602 includes a gel or fluid
substance that contains viral vectors 604 until they are implanted
in a mammal 606. Once viral vectors 604 are released, they infect
target cells 608 in the vicinity of the implanted viral matrix as
shown by FIG. 8B. Infected target cell 610 becomes photosensitive,
and thus, light can be used to control the stimulation of target
cell 610.
[0147] According to one embodiment of the present invention,
structure 602 is a gelatin that has been impregnated, or otherwise
sealed with viral vectors 604 contained within the gelatin. When
structure 602 is implanted, the gelatin is hydrated and or
dissolved, thereby releasing viral vectors 604. Standard
commercially available gelatin mix may be used, in addition to
compounds such as Matrigel by BD Biosciences division of Becton
Dickenson and Company (Franklin Lakes, N.J.)
[0148] FIG. 9 shows a circuit diagram of a circuit that produces
light in response to a magnetic field, according to an example
embodiment of the present invention. FIG. 9 includes an input
circuit 720 and an output circuit 730. Inductor 704 generates
current in response to magnetic field 702. Due to properties of
magnetic fields, the current produced by inductor 704 is an
alternating current (AC) signal. Full-wave bridge rectifier 706
rectifies the AC signal and along with an RC circuit generates a
relatively stable voltage from the AC signal. This generated
voltage is responsive to magnetic field 702 and output circuit 730
which generates light when the generated voltage is at a sufficient
level. More specifically, power from battery 708 is used to drive
LED 710 in response to magnetic field 702. This is particularly
useful for applications where the magnetic field 702 seen by
inductor 704 is less powerful (e.g., due to the in vivo location of
inductor 704).
[0149] FIG. 10A shows a circuit diagram of a circuit that produces
light in response to RF signal 801, according to an example
embodiment of the present invention. Antenna 802 is used to receive
RF transmission 801 and convert the signal to electricity. The
received transmission is rectified by diode 803 and further
filtered by capacitor 805. In a one instance, diode 803 can be
implemented using a diode having a low forward bias and fast
switching capabilities, such as a Schottky diode.
[0150] In a particular embodiment of the present invention, RF
transmission 801 contains a power component for charging battery
815 and a signal component for controlling LED 825. Capacitor 805
can be selected to separate these components for use by the
circuit. For instance, the power component may be a relatively
low-frequency, large-amplitude signal, while the signal component
is a relatively high-frequency, small-amplitude signal. Capacitor
805 can be selected to filter the power component of the signal to
create a corresponding voltage. The remaining high-frequency
component of the RF transmission is added to this voltage. The
power component of the transmission can then be used to charge the
battery 815, and the signal component of the transmission is used
to enable LED 825. The light generated by LED 825 triggers stimulus
of the target cells 827.
[0151] FIG. 10B illustrates an alternative embodiment
radio-frequency energy accumulator, which charges a battery, which
in turn, powers a digital pulse generator, which powers a LED. An
electromagnetic signal 850 is received by loop antenna 852
generating a corresponding electrical signal. The voltage generated
from loop antenna 852 is limited by the reverse bias voltage of the
diodes 855 and 856 and stored in capacitor 854. In a particular
instance these diodes have a low reverse bias voltage that is
relatively precise, such as a Zener diode. Electromagnetic signal
850 is rectified via diode rectifier bridge 858 and filtered by
voltage regulator 859 to produce a DC voltage. The DC can be used
to charge power source 860.
[0152] Battery 860 is coupled to the input of Schmidt trigger 865
through capacitor 862. Feedback from the output of the Schmidt
trigger is provided through resistor 864 relative to the charge on
capacitor 863. Accordingly, the frequency of the square-wave output
of Schmidt trigger 865 is determined by the values of the
resistor-capacitor network including capacitor 863 and resistor
864. Resistor 864 and capacitor 863 may be fixed or variable. The
output of Schmidt trigger 865 is fed through digital inverter 867
which powers LED 866. Light from LED 866 is transmitted to
light-sensitive neurons 868 relative to the frequency of the
square-wave output of Schmidt trigger 865.
[0153] FIG. 10C illustrates block diagram for an electromagnetic
field (EMF) energy accumulator and pulsing approach in which the
received EMF 897 (for example radiofrequency energy) includes not
only energy for accumulation, but also an encoded signal regarding
instructions to microcontroller 895. In step 885 (Energy plus
Parameter Control Signal: Encoding and transmission), a control
instruction signal is encoded to ride upon the energy component by
methods known in the art, for example, by frequency modulation.
Energy receiver block 890 uses a portion of the EMF signal to
provide power to block 893. Control signal receiver block 891 uses
a portion of the EMF signal to provide control instructions to
microcontroller block 895.
[0154] The control instruction can be used to transmit information
regarding the various parameters of the generated light, such as
frequency, strength, duration, color, and the like. These
instructions can be decoded and processed using a microcontroller
or logic circuitry as shown by block 895. Block 895 can generate
control signal(s) in response to the decoded instructions.
Accordingly, the frequency (and other parameters) of the light
generated by LED 896 rate need not be fixed for the given implanted
device. Antenna 889 delivers input to the Energy Receiver 890
(providing power to voltage regulator and battery circuitry 893).
Concurrently, antenna 889 delivers encoded data to Control Signal
Receiver 891, which provides control input to microcontroller 895
that drives LED 896. Selected wavelength light 897 is then
delivered to electrically excitable cell 898. The battery in the
voltage regulator and battery circuitry 893 provides power to the
microcontroller 895 and the Control Signal Receiver 891.
[0155] The circuit diagrams of FIG. 9 and FIGS. 10A, 10B and 10C
are merely illustrative of a few particular embodiments of the
present invention, and various other implementations are
envisioned. For example, particular embodiments implement a light
source that uses a blue LED; however, other colors and light
sources can be implemented depending upon the particular
application. In other particular embodiments the light source
includes more than one color light source. The circuitry controls
not only when light is provided, but which color, depending on
whether the instructions require inhibition or excitation of the
cell. For example, in a specific example the target cell express
both an inhibitor (e.g., GtR3) and an exciter (e.g., VaR1), which
respond to different wavelengths of light. The system can also
control the level at which the cells are excited or inhibited. This
can be done by including multiple light responsive proteins in the
target cells that excite (or inhibit) and programming the
instructions to provide more than one light wavelength at a single
time.
[0156] FIG. 11A and FIG. 11B each show a diagram of a fiber-optic
device, according to an example embodiment of the present
invention. The fiber-optic device includes a control portion 908, a
light generator 906 and a fiber optic cable 902.
[0157] Fiber optic cable 902 can be positioned near a
photosensitive biological portion, such as a viral matrix or
synthetic mesh as discussed herein. This allows for control portion
908 and light generator 906 to be located at a distance from the
target cells 910 (e.g., at a distance corresponding to the length
of fiber-optic cable 902). This can be particularly useful for
minimizing the size of the portion of the implanted device that is
near the target cells, for example, where the target cells are
located at or near a sensitive location within the brain. In some
instances, the remote location of portions 908 and 906 also
facilitates modifications of the device, including, but not limited
to, replacement of various components (e.g., batteries), changes in
stimulation frequency and length.
[0158] Control portion 908 can be configured to respond to an
external signal, such as magnetic field or RF signals.
Alternatively, control portion 908 can be configured to enable
light generator 906 according to a programmed schedule or a
combination of an external signal and a programmed response.
[0159] FIGS. 12A-12D depicts various stages in the production of a
photosensitive biological portion, according to an example
embodiment of the present invention. More specifically, FIG. 12A
shows molding structure 1004 having several molds 1002. Molds 1002
are constructed to various sizes depending upon the particular
application. In one such application, the molds are a few
millimeters or less in diameter.
[0160] FIG. 12B shows the molds 1002 from FIG. 12A after applying a
layer of gelatin or similar substance as shown by 1006 and 1008.
Moreover, viral vectors (shown by `v`) are in the upper two molds.
These viruses may be suspended within media 1012, which may be a
liquid or gelatinous media. Such liquids include normal saline,
HEPES-buffered saline and other known viral substances and transfer
media. Suitable gelatinous media includes Matrigel (BD Biosciences,
San Jose Calif.). These viral vectors are designed transfer genes
for light-sensitization to the membranes of targeted cells after
implantation.
[0161] FIG. 12C shows a side view of mold 1006. 1016 represents the
molding structure that forms the shape of gelatin layer 1014.
Gelatin layer 1014 traps viral vectors contained within media 1012.
A top gelatin layer 1010 is applied to fully contain the viral
vectors.
[0162] FIG. 12D shows the resulting viral vector capsule. The viral
vectors 1018 are contained within area 1022 by casing 1020. Casing
1020 can be designed to dissolve or otherwise allow viral vectors
1018 to disseminate towards the target cells once implanted. In one
instance, the capsule is constructed of a water soluble material,
for example, gelatin, so that upon implantation the viral vectors
are allowed to escape into the body. Water soluble capsule
materials are well known in the pharmaceutical industry.
[0163] FIG. 13 shows an implantation device, according to an
example embodiment of the present invention. Biological portion
1102 and light generation device 1108 are implanted using the
implantation device. For example, the shaft of the device 1114 is
positioned near the target cells. Next, a user of the device
presses on portion 1116 which causes portion 1112 to place
biological portion 1102 and light generation device 1108 near the
target cells. The implantation device can then be removed.
[0164] FIG. 14A and FIG. 14B show a diagram for another
implantation device, according to an example embodiment of the
present invention. Implantable light generating device 1204 is
surrounded by, and permeated by fluid channels 1202. Fluid channels
1202 allow a solution 1210 containing bio-molecular material (e.g.,
photosensitizing viral vectors) to be injected immediately proximal
to light generating device 1204 and the target cells. The fluid
channels can be located outside of device 1204 and/or within device
1204, as shown by 1212 and 1214 respectively. In this manner, the
viral vectors can be injected in large quantities or over a period
of time. For instance, cells infected by viral vectors can revert
back to their pre-infection state after a period of time. Using the
device of FIG. 12A, the viral vectors can be periodically
reintroduced to the target cells. Alternatively, different viral
vectors can be introduced through the fluid channels, allowing for
targeting of different cells at the implantation site. This can be
particularly useful for staged treatment through stimulation of
different types of cells.
[0165] A specific embodiment of the present invention relates to a
method for genetically modifying neurons to express light-sensitive
ion channel DChR. In this method, pulses of blue light causes DChR
neurons to fire action potentials corresponding to each pulse.
Depolarization and repolarization occur on a millisecond timescale
making this method consistent with normal network
neurophysiology.
[0166] Specific targeted neurons are modified using viral vectors
for gene transfer. For further details on the generation of viral
vectors, reference can be made to Boyden et al. 2005, Zhang et al.
2006 entitled "Channelrhodopsin-2 and Optical Control of Excitable
Cells," Nature Methods Vol. 3, No. 10, which is fully incorporated
herein by reference. This transfection results in the introduction
of a gene for a single protein, a cell membrane ion channel, known
as "DChR". In nature, DChR resides on the cellular membrane of
Dunaliella salina. Upon absorption of blue/green light (500 nm),
this ion channel briefly opens, allowing cation influx. When
transfected into a mammalian nerve cell, affected nerves become
photosensitive, producing light-triggered action potentials.
[0167] A neuronal-type specific feature which is also a robust
promoter is inserted adjacent to the DChR code within the virus,
and the line is propagated by calcium-phosphate cotransfection of
293FT cells. The supernatant is then centrifuged into viral
pellets, which are placed within phosphate-buffered saline.
[0168] In a particular instance, application of a DChR is used for
photo stimulation. The amino-acid residues comprising DChR
channelrhodopsin from Dunaliella salina can be used to impart fast
photosensitivity upon mammalian nerve cells, by using a viral
vector to insert the gene for DChR into targeted nerve cells which
may subsequently express this gene. Upon illumination with
approximately 500 nm blue/green light, ATR isomerizes and triggers
a conformational change to open the channel pore. As DChR is a
light-sensitive ion channel, it allows an inward current to be
evoked.
[0169] In another instance, application GtR3 (derived from
Guillardia theta) is used for photostimulation. This proton pump
can be imparted upon mammalian nerve cells by using a viral vector
to insert the gene for GtR3 into targeted nerve cells, which may
subsequently express this gene. Upon illumination with
approximately 472 nm blue light, active pumping of protons out of
the neuronal cytoplasm results in hyperpolarization of the cell.
Since sensitivity to blue light via DChR or GtR3 is induced when a
viral vector inserts the respective gene into a previously normal
cell, the insertion may be genetically targeted to the products
expressed by specific cellular subtypes. For example, it might be
advantageous to cause only dopaminergic neurons, and not
cholinergic neurons to react to blue light.
[0170] As discussed above, certain embodiments of the present
invention involves the use of an optically responsive ion pump or
ion channel that is expressed in a cell. In a particular instance,
the cell is either a neural cell or a stem cell. A specific
embodiment involves in vivo animal cells expressing an ion pump.
Certain aspects of the present invention are based on the
identification and development of a proton pump, derived from
Guillardia Theta, for example, for temporally-precise optical
inhibition of neural activity. The pump allows both knockout of
single action potentials within rapid spike trains and sustained
blockade of spiking over many minutes.
[0171] According to an example embodiment of the present invention,
an optically responsive ion pump and/or channel is expressed in one
or more stem cells, progenitor cells, or progeny of stem or
progenitor cells. Optical stimulation is used to activate expressed
pumps/channels. The activation can be used to control the proton
concentration in the cells. It may also be used to control the pH
of particular subcellular organelles. This can be particularly
useful for affecting the survival, proliferation, differentiation,
de-differentiation, or lack of differentiation in the cells. Thus,
optical stimulus is implemented to provide control over the
(maturation) of stem or progenitor cells.
[0172] According to other example embodiments of the present
invention, methods for generating an inhibitory neuron-current flow
involve, in a neuron, engineering a protein that responds to light
by producing an inhibitory current to dissuade depolarization of
the neuron. In one such method, the protein is GtR3 is an exogenous
molecule in the neuron, and in another method the protein is an
inhibitory protein that uses an endogenous cofactor.
[0173] In another example embodiment, a method for controlling
action potential of a neuron involves the following step:
engineering a first light responsive protein in the neuron;
producing, in response to light, an inhibitory current in the
neuron and from the first light responsive protein; engineering a
second light responsive protein in the neuron; and producing, in
response to light, an excitation current in the neuron from the
second light responsive protein. The combination of light
responsive proteins may depend on the light sensitivity of the
protein, the reaction time of the protein, and defined action of
the protein, for example. Multiple light responsive proteins of the
same type (inhibitory vs. excitatory) may be used in the same cell
population to allow for, for example, long term blockage of action
potential or single action potential inhibition depending on the
light wavelength used.
[0174] In another method for controlling a voltage level across a
cell membrane of a cell, the method comprises: engineering a first
light responsive protein in the cell; measuring the voltage level
across the cell membrane; and producing, in response to light of a
first wavelength and using the first light responsive protein, a
current across the cell membrane that is responsive to the measured
voltage level.
[0175] Another aspect of the present invention is directed to a
system for controlling an action potential of a neuron in vivo. The
system includes a delivery device, a light source, and a control
device. The delivery device introduces a light responsive protein
to the neuron, with the light responsive protein producing an
inhibitory current. The light source generates light for
stimulating the light responsive protein, and the control device
controls the generation of light by the light source. In a
particular embodiment the light source is a blue light source and
the light responsive protein is responsive to blue light.
[0176] In more detailed embodiments, such a system is further
adapted such that the delivery device introduces the light
responsive protein by one of transfection, transduction and
microinjection, and/or such that the light source introduces light
to the neuron via one of an implantable light generator and
fiber-optics.
[0177] Another aspect of the present invention is directed to a
method for treatment of a disorder. The method targets a group of
neurons associated with the disorder; and in this group, the method
includes engineering an inhibitory proteins that use an endogenous
cofactor to respond to light by producing an inhibitory current to
dissuade depolarization of the neurons, and exposing the neurons to
light, thereby dissuading depolarization of the neurons.
[0178] In another aspect of the present invention, GtR3 is
optimized for mammalian expression. A light responsive protein is
isolated from Guillardia theta. The isolated protein has a
C-terminus and an N-terminus. An endoplasmic reticulum (ER) export
signal promoter is added to the C-terminus of the isolated protein,
creating an enhanced light responsive protein. In various
embodiments the promoter added to the isolated GtR3 varies
depending on the desired location of expression.
[0179] FIG. 15 depicts an arrangement with multiple light sources,
according to an example embodiment of the present invention. FIG.
15 shows light sources 1602 and 1604 that illuminate proteins 1610
and 1614. The proteins 1610 and 1614 are engineered within cell
1612 to control current across the cell membrane in response to
light from light sources 1602 and 1604, respectively. In one
instance, the first protein 1610 functions to dissuade action
potential firing, while the second protein 1614 functions to
encourage action potential firing. Each of proteins 1610 and 1614
are responsive to light. In a particular instance, the first
protein is responsive to light from light source 1602 having a
wavelength A and the second protein is responsive to light from
light source 1604 having a wavelength B. Thus, the light sources
can be used to control each protein independently. This can be
useful for both encouraging and dissuading action potentials in the
cell. In another instance, having both types of proteins allows for
both positive and negative control of the cell membrane voltage.
Thus, the different light sources and proteins could be used to
control the voltage or current level (e.g., clamping) of the cell
membrane.
[0180] One method of determining responsiveness involves
quantifying the responsiveness in terms of the intensity of light
required to produce a given response. In some instances, the first
or second protein can still be responsive to the alternate
wavelength of light although the responsiveness of the protein may
be less than that of the primary wavelength. Accordingly, a protein
of a first type may have some responsiveness to the wavelength
corresponding to the other type of protein while still maintaining
sufficient independence of operation. In one such instance, control
of the cell can be implemented by shifting either the wavelength of
light or the intensity of the light. For instance, the wavelength
can be shifted between A and B to induce a corresponding increase
or decrease of the membrane voltage potential. Alternatively,
multiple proteins having similar actions, but different activation
wavelength may be introduced into the same cell. The response may
vary as the wavelength is shifted, in some places the combination
of the two responses create a greater response than from an
individual protein.
[0181] According to one embodiment of the present invention, pump
1614 can optionally be implemented for purposes other than
dissuading action potential firing, such as controlling the voltage
level of cell 1612. More specifically, a sensor can be used provide
feedback to the light source 1602. For instance, this feedback
could be a measurement of the voltage or current across the cell
membrane. Thus, the light source could be configured to maintain a
constant current or voltage (e.g., clamp) across the cell.
Moreover, the amount of responsiveness can be controlled by
modifying one or more of the intensity and wavelength of the
light.
[0182] FIG. 16 shows a system for controlling electrical properties
of one or more cells in vivo, according to an example embodiment of
the present invention. Control/Interface unit 1702 enables/disables
light source 1704 to illuminate target cells 1708. A delivery
mechanism, such as fiber optic cable 1706, routes or otherwise
directs the light to target cells 1708. Fiber optic cable 1706 may
include a bundle of optical cables, each capable of carrying and
directing light independently. Thus, fiber optic cable 1706 can be
configured to deliver light having one or more wavelengths to
multiple locations. Sensor 1710 can be implemented e.g., as an
optical device such as an optical scope or as a voltmeter, to
provide feedback to control unit 1702. In a particular instance,
the feedback includes optical imaging of the target cells or of
other related cells. In another instance, the feedback could
monitor the voltage response of the target cells, including the
amount of action potential firing.
[0183] FIG. 17 shows a system for controlling electrical properties
of one or more cells in vivo, according to an example embodiment of
the present invention. Control/Interface unit 1802 enables/disables
implantable light source 1804, which in turn illuminates target
cells 1806. Light source 1804 is shown with two light source,
inhibitory current light source 1808 and excitation current light
source 1810. Light source 1808 produces light at a wavelength and
intensity that an inhibitory protein is responsive to, while light
source 1810 produces light at a wavelength and intensity that an
excitation protein is responsive to. One skilled in the art would
recognize that various configurations of light source 1810 are
possible, including a single inhibitory light source or an array of
light sources having one or more wavelengths. Control/Interface
unit 1802 communicates with light source 1804 through any suitable
communication mechanisms, such as wired communications or wireless
communications using radio-frequency signals, magnetic signals and
the like. As discussed above in connection with FIG. 16, sensor
1812 can optionally be implemented for providing feedback to
control unit 1802.
[0184] Certain embodiments of the present invention can be useful
in drug screening. The various light-sensitive proteins, serving to
regulate membrane voltage using ion switches that, when activated
(or deactivated) in response to light, function as channels or
pumps and are referred to hereafter as light-responsive ion
switches or light-activated membrane potential switches
(LAMPS).
[0185] Consistent with one example embodiment of the present
invention, a system screens for ion-channel and ion-pump affecting
compounds. The system introduces one or more drug candidates that
could either block or enhance the activity of ion-channels or
ion-pumps to cells that were made optically responsive by the
addition of a combination of the above mentioned proteins (ChR2,
DChR and NpHR among others), for the purpose of screening the drug
candidates. Light triggers optically responsive ion channels in the
cells causing a change in the voltage seen across the cell
membrane. The voltage change stimulates voltage-gated ion channels
in the cells which will then cause a change in ion concentrations
that can be read as optical outputs. These optical signals are
detected and used to determine what effect, if any, the drug
candidates have on the voltage-gated ion channels. In a more
specific embodiment a protein expressing a proton pump is
introduced into the cell.
[0186] In one instance, the system allows for different drug
candidates to be screened without necessitating extensive setup
between screenings. For example, an assay may be performed using
optics both to stimulate the optically responsive cells and to
detect the effectiveness of the drug. The use of optics instead of
manual contacts, e.g., using a whole-cell patch clamp, can be
particularly useful in increasing the throughput of the assay
screening process. For instance, the time between screenings can be
reduced by minimizing or eliminating physical manipulations
otherwise necessary to stimulate or detect ion flow in the target
cells. The cells can also be prepared prior to the screening
process because the test equipment need only be optically coupled
to the prepared cells. In another instance, throughput may be
increased by screening a number of different drugs simultaneously
using, for example, an array of photo detectors and a corresponding
array of modified cells exposed to different drugs.
[0187] A cell line based approach is not limited to a particular
ion channel. For example, cell lines can be created for
voltage-gated sodium (e.g., Na.sub.v1.1 through Na.sub.v1.9),
potassium (e.g., K.sub.v such as hERG, TASK1, Shaker, or KvLQT1),
or chloride conducting channels/pumps (e.g., members of the CLC
family of chloride channels). The methods of introducing such genes
into the cell line are known in the art and may include, for
example liposomal transfection, or viral gene transfer. For further
information in this regard, reference may be made to one or more of
the following references: [0188] Warren Pear, Transient
Transfection Methods for Preparation of High-Titer Retroviral
Supernatants, Supplement 68, Current Protocols in Molecular
Biology, 9.11.1-9.11.18, John Wiley & Sons, Inc. (1996). [0189]
R. E. Kingston, C. A. Chen, H. Okayama, and J. K. Rose,
Transfection of DNA into Eukarotic Cells. Supplement 63, Current
Protocols in Molecular Biology, 9.1.1-9.1.11, John Wiley &
Sons, Inc. (1996). [0190] R. Mortensen, J. D. Chesnut, J. P.
Hoeffler, and R. E. Kingston, Selection of Transfected Mammalian
Cells, Supplement 62, Current Protocols in Molecular Biology,
9.5.1-09.5.19, John Wiley & Sons, Inc. (1997). [0191] H.
Potter, Transfection by Electroporation, Supplement 62, Current
Protocols in Molecular Biology, 9.3.1-9.3.6, John Wiley & Sons,
Inc. (1996). [0192] T. Gulick, Transfection using DEAE-Dextran,
Supplement 40, Current Protocols in Molecular Biology,
9.2.1-9.2.10, John Wiley & Sons, Inc. (1997). [0193] R. E.
Kingston, C. A. Chen, H. Okayama, Transfection and Expression of
Cloned DNA, Supplement 31, Current Protocols in Immunology (CPI),
10.13.1-10.13.9, John Wiley & Sons, Inc. Each of the above
references is incorporated by reference in its entirety.
[0194] These and other transfer vectors may be generated using
various genetic engineering techniques. For instance, the transfer
vectors may be derived from a provirus clone of a retrovirus, such
as an immunodeficiency virus (e.g., HIV-1 or HIV-2, or SIV). For
further details on the use of 293T cells and transfection thereof,
reference can be made to U.S. Pat. No. 6,790,657 (entitled,
Lentivirus Vector System, to Arya), which is fully incorporated
herein by reference.
[0195] In one embodiment of the invention, optical stimulation of
the modified cells may be altered to determine specific properties
of an introduced drug candidate. For example, the intensity of the
optical stimulus may be modified to change the corresponding level
of depolarization. The level of desired depolarization can be tuned
to further characterize the effectiveness of the drug under test.
In another example, the optical stimulus may include rapid pulsing
of the light. By correlating the temporal relationship between the
optical stimulus and the resultant detected fluorescence, the drug
may be further characterized in terms of a kinetic response. Thus,
the drug may be characterized for a variety of different aspects
including, but not limited to, the steady state effect on ion
concentrations, a change in the level of depolarization necessary
to trigger the voltage gated ion channels and the effect on
repeated depolarization.
[0196] In one embodiment, the system allows for simple calibration
of the optical stimulation and/or detection. The modified cells may
be optically stimulated prior to introduction of the drug
candidate. The ion channel responsiveness is detected and recorded.
The recorded values may be used as a baseline for comparison to the
ion channel responsiveness of the same modified cells after the
introduction of the drug under test. The recorded values may also
be used to modify the optical stimulus or the sensitivity of the
optical detector. Such modifications may be applied to an
individual test sample or an array of test samples. For such an
array of test samples, each test sample may be individually
calibrated by adjusting the corresponding optical stimulus.
Similarly, each corresponding photo detector may be individually
adjusted.
[0197] FIG. 18A shows a basic block diagram of a system for
screening for ion-channel affecting drugs, according to an
embodiment of the invention. Optical control 1904 communicates with
database 1902, optical source 1906 and optical detector 1909.
Optical source 1906 provides optical stimulus to test sample 1908.
Test sample 1908 includes the drug under test, cells with optically
responsive ion channels, and a voltage/ion indicator. In one
instance, the indicator fluoresces in response to light from
optical source 1906. Optical control 1904 may also include a
reconfigurable readout, so that as different LAMPS and different
LEIAs are used, the same control system can be readily adapted to
each paradigm. Optical detector 1909 produces a signal responsive
to such florescence, and optical control 1904 receives the produced
signal. The optical control 1904 stores data obtained from the
signal in database 1902. The information stored may include factors
such as the intensity, duration and wavelength of the detected
light. In a particular instance, the stored data can be compared
against baseline data, where the baseline data corresponds to data
recorded prior to the introduction of the drug to the test sample
1908. In another instance, optical source 1906 may vary the
intensity, duration or other parameters related to the control of
optical source 1906. These and other parameters may be stored in
database 1902.
[0198] It should be apparent that optical source 1906 may be
implemented using a single light source, such as a light-emitting
diode (LED), or using several light sources. Similarly, optical
detector 1909 may use one or more detectors and database 1902 may
be implemented using any number of suitable storage devices.
[0199] FIG. 18B shows a system diagram of a large-format,
quasi-automated system for drug screening in accordance with a
specific embodiment of the invention. Control device 1901 (e.g., a
computer or control logic) controls various processes, and serves
as the central point of system input/output functions. The
environment may be maintained at an appropriate temperature,
humidity, carbon dioxide level and ambient light level within the
walls of the climate control chamber 1905, with the help of one or
more sensors 1914 (e.g., thermostat, carbon dioxide sensor and
humidity sensor), carbon dioxide and humidifier apparatus 1912, and
heater 1910. Multi-well tray 1941 contains test wells 1940 for
holding cultured cells, drugs, and other ingredients needed for
each test. Tray 1941 rests upon X-Y-Z table 1925, the movement of
which is carried out by table actuators 1920, under control of
computer 1901. Xenon lamp 1955 emits high-intensity white light
1956, which is passed through color filter 1960. In the case that
DChR is used for stimulating the cells within wells 1940, color
filter 1960 is blue, causing blue light 1961 to exit the filter,
and strike dichroic mirror 1970. Blue light 1961 then passes
upward, through microscope objective lens apparatus 1930, and
through bottom of transparent tray 1941. In this fashion, the
contents of wells 1940, with their transparent undersides, are
illuminated. When a separate wavelength of light is required to
stimulate a fluorescent light-emitting indicator of cellular
activity, a filter of the appropriate specification may be
substituted for the previous filter 160, causing light of the
proper wavelength for this latter task to be piped toward well
1940. If the cells within well 1940 have been light-sensitized, and
if the drug being tested in each of these wells does not suppress
the process, a light-emitting indicator of cellular activity
(LEIA), which has also been added to each well or expressed by the
cells via genetic modification, will emit light in accordance with
the voltage change caused by the effect of the light. This second
wavelength of light, which may be much smaller in magnitude than
the stimulation light, is collected by microscope turret 1935, and
will also be passed through dichroic mirror 1975, onto the lens of
(CCD) camera 1980.
[0200] Dichroic mirror 1970 allows for upward reflection of both
the wavelength required to stimulate the optical gating of the
membrane (e.g., blue-green for DChR), and the wavelength required
by any LEIA used (e.g., ultraviolet for FURA-2). This dichroic
mirror may be arranged to allow passage of the output spectrum of
the LEIA (e.g., blue-green for FURA-2) with minimal reflection or
absorption.
[0201] FIG. 19 is a system diagram of an automated-drug-screening
system, according to an example embodiment of the invention.
Emitter/detector units 2050 make up the emitter/detector array
2051. Emitter/detector array 2051 matches the number, size, and
layout of the wells on tray 2040. Tray holding device 2025 permits
tray swapping mechanism 2020 to rapidly move a new tray into
position once testing of a given tray has been completed. The
entire process may be automated, and under the control of device
2001. Device 2001 can be implemented using a computer, control
logic, programmable logic arrays, discreet logic and the like. The
introduction of the drug candidates under test can also be
automated using a machine that provides a reservoir for storing the
drugs and a dispensing nozzle for injecting the drugs into the
tray. In a manner similar to that shown by FIG. 18, the environment
within the walls of the climate control chamber 2005 may be
maintained at an appropriate temperature, humidity, carbon dioxide
level and ambient light level, with the help of thermostat, carbon
dioxide sensor and humidity sensor 2014, carbon dioxide and
humidifier apparatus 2012, and heater 2010. The use of multiple
stimulator/detector elements simultaneously and in parallel, can be
particularly useful for augmenting the speed of the overall
process. Low cost elements may be used to make multiple parallel
detectors (e.g., the components detailed below in description of
FIGS. 20A and 20B); the multiple parallel emitter/detector units
may also be quite economically feasible.
[0202] FIG. 20A depicts the workings of emitter/detector units,
such as those shown in FIG. 19, according to an example embodiment
of the invention. An LED stimulates light-sensitive ion channels of
cells located within a well, and a photodiode detects the response
of a LEIA. In this embodiment, device 2101 includes LED 2110, which
produces light pulses 2111, at the proper wavelength, pulse
frequency and intensity, so as to stimulate light-sensitive
transgenic cells 2105 in culture within well 2106. Due to the
presences of an LEIA (e.g., a voltage-sensitive dye or a calcium
dye), light 2116 is returned from cells 2105, and is detected by
photodiode 2115. In the case that RH 1691 being used, red light is
fluoresced and detected by photodiode 2115. In the absence of
cellular depolarization, no fluorescence is detected by photodiode
2115. Other light detecting technologies may also be used instead
of a photodiode including phototransistors, and CCD elements.
[0203] The combination of photostimulation with optical imaging
techniques of LEIAs may be useful for a number of different
reasons. For example, photostimulation may simplify the study of
excitable cells by reducing the need to use mechanical electrodes
for stimulation. Several commercially available LEIAs are suitable
for photogrammetrically indicating the activation of electrically
excitable cells. One such LEIA is calcium dye Fura-2, which may be
stimulated with violet/ultraviolet light around 340 nm, and whose
fluorescent output is detectable as blue-green light around 535 nm.
Another example is voltage sensitive dye RH 1691, which may be
stimulated with green light at about 550 nm, and whose fluorescent
output is detectable as red light at about 70 nm. Another example
is voltage sensitive dye di-4-ANEPPS, which is stimulated by blue
light at about 560 nm, and whose fluorescent output is detectable
as red light at about 640 nm.
[0204] FIG. 20B depicts the workings of another embodiment of the
emitter/detector units shown in the FIG. 19, in which multiple
effects are tested within the context of a single well. For
example, the cells 2155 in the wells 2156 may express both GtR3 and
VChR1, and hence be sensitive to both the hyperpolarizing effects
of blue light, and the depolarizing effects of amber light. Device
2151 includes LED 2160, which is used for the stimulation of the
targeted proton pump (e.g., GtR3) of light-sensitive transgenic
cells 2155. Additional LED 2175 may be used to stimulate a second
targeted ion channel or pump (e.g., VChR1). Yet another LED 2180
may be used to stimulate a voltage sensitive dye (e.g., RH1691 or
calcium dye, such as Fura-2). Each LED may be arranged to output
specific wavelengths and intensities for stimulus of respective
targeted compounds. In one instance, an LED may affect more than
one target, depending upon the specific sensitivities of each
compound used. Photodiode 2165 detects the fluorescence of a
selected voltage dye, while photodiode 2170 is sensitive to the
spectrum fluoresced by a selected calcium dye. The use of multiple
LEDs for the same cell allows for the stimulation of LEIAs at
different wavelengths. Multiple LEDs may also be used to detect
different light wavelengths emitted by the LEIA.
[0205] FIG. 21A depicts an electronic circuit mechanism for
activating the LED emitters used within the emitter/detector units,
according to an example embodiment of the invention. Control device
2201 generates a "light on signal" 2202 to transistor base 2205.
This light on signal 2202 will remain on for the duration of a
light flash desired, or alternatively may turn on and off in order
to produce rhythmic light flashes at a specified frequency. Light
on signal 2202 permits (conventional) current to flow from power
source 2210, through resister 2211, and through transistor
collector 2207 and transistor emitter 2212, to ground 2213. Current
is also thereby permitted to pass through resistor 2215, and into
LED 2220. LED 2220 emits light 2221, which falls upon well 2225. In
a particular instance, the transistor functions as transconductance
amplifier of signal 2202. In this manner, light of the appropriate
wavelength, intensity and frequency is delivered to cells within
the well 2225, so as to cause them to stimulate the particular
channel (e.g. DChR) or pump (e.g., GtR3), or other photoactive
membrane structure being used to regulate the activity of
electrically excitable cells. Various other circuits are also
possible. For example, other circuits can be used in place of
circuit 2206 to control LED 2220 including, but not limited to,
replacing the transistor with an operational amplifier, a
field-effect-transistor, a resistor divider network,
transistor-transistor logic, push-pull driver circuits and
switches.
[0206] FIG. 21B depicts an example electronic circuit mechanism for
light detection by the emitter/detector units, according to one
embodiment of the invention. Control device 2250 may (optionally,
depending upon specific implementation) provide power to photodiode
2255. Photodiode 2255 receives fluoresced (emitted) light 2256 from
the LEIA on the cells within well 2257. The received light results
in an output signal. This output passes through resistor 2260, and
is input to Schmitt triggered hex inverter 2270, which conditions
the signal, providing a clean "high" or "low value" to be input to
computer 2250.
[0207] Operation of the photodetector is shown in photovoltaic
mode, but the element may also be used in the photoconductive mode
of operation. Of course, many other light-detection devices and
methods may also be used, including phototransistors,
photothyristors, and charged-coupled device (CCD) elements, or
arrays of elements.
[0208] Alternatively, the circuit of FIG. 21B can be used without
Schmitt-triggered hex inverter 2270, permitting a continuum of
signal intensities to be transmitted directly to an analog input to
computer 2250 or to an analog-to-digital converter. Various other
signal conditioning circuits are also possible.
[0209] FIG. 22 shows a sequence of steps using the embodiment shown
in FIGS. 19, 20 and 21, in the context of projected high-throughput
process time course 2300 and in accordance with one embodiment of
the invention. In step 2305, light of the appropriate wavelength
and intensity for the targeted ion channel is flashed-in this case
for approximately three seconds. Concurrently, a LEIA stimulation
flash 2310 may optionally be triggered, depending upon the specific
voltage or calcium dye, etc. being used. This LEIA compound may
have been previously added to the well, or may be (artificially)
genetically imparted upon the cells such that the chemical is
produced/expressed by the cells. In step 2315, the light signal
produced by the LEIA is detected by the photodetector element
(e.g., photodiode). For example, RH1691, fluoresces red light at
about 70 nm.
[0210] In step 2320, the signal resulting from the impingement of
light onto the photodetector element is sent back to the computer.
This may be a binary (e.g., "high" versus "low" signal intensity),
or may be graded to reflect a continuum of activation levels. In
the case that multiple photodetectors are used to determine
energies at different wavelengths, the individual readings of these
photodetectors may be logged in parallel or in sequence for
appropriate interpretation in a later stage of the automated
process. In step 2330, the system calls for the next tray to be
placed by the automated system. The next tray is moved into
position at step 2335 and the process may be repeated until all
trays in a batch have been processed.
[0211] The amount of time allotted for light delivery may vary, and
depends on factors including the level of light-gated proton or ion
channel/pump expression, and the density and characteristics of
other proton/ionic channel characteristics of that cell population.
The amount of time allotted for light receipt may vary, and depends
upon factors including the degree of accuracy required for the
screening session. The amount of time allotted for well-plate
(tray) changing may vary, and depends upon factors including the
mechanical speed of the automated apparatus. If fast neurons are
used as the cells being tested, the cellular stimulation and LEIA
detection process may be accomplished in milliseconds.
[0212] The process above may be repeated under varying conditions.
For example, a given set of cells may be tested with no drug
present, and subsequently with one or more drugs present. The
response of electrically-excitable cells under those conditions may
be thereby documented, compared and studied. If the invention is
implemented with at least one emitter/detector for each well on a
tray and at least two concurrently operating devices, continuous
operation may be maintained for extended periods of time.
[0213] FIG. 23 illustrates an example of a layout of cell and drug
samples within the wells of a well-plate which is suitable for use
within an embodiment of the invention. In this figure, well-plate
2401 (also referred to herein as a "tray" contains wells 2405
(examples), which are organized into columns 2425, labeled with
numbers 1-12 and rows 2420, labeled with letters A-H. More
specifically, an example column and row are defined by 2410 and
2415 respectively.
[0214] As an example of a functional layout of contents introduced
into these wells, rows A-H of a single plate might be used for the
testing of two different drugs. To represent a baseline condition,
column 1 might contain optically gated cells, an endogenous or
exogenous LEIA, but no drug. Columns 2-6 might be used for five
different concentrations of Drug X, one concentration level per
column. Likewise, columns 7-11 might be use for five different
concentrations of Drug Y, one concentration per column. Column 12,
while fully usable, is left unused in this particular example.
[0215] Variables in the various wells might include the type of
cell being tested, the type of ion channel being tested for, the
type of drug placed in the cell, the concentration of the drug
placed in the well, the specific LEIA used, and the optical gating
stimulation parameters (e.g., wavelength, intensity, frequency,
duration) applied to the cells in that. well.
[0216] FIG. 24 illustrates the context in which the disclosed
invention may be employed within a larger system which facilitates
high-throughput drug screening. Well-plate 2506 contains wells
2505. These are carried forward by conveyer 2520, which may be a
device such as a conveyor belt, robotic transporter or other
delivery mechanism. Pipettes 2510 are held in array by robotic
member 2515, and serve to inject the proper number of cultured
cells and media into wells 2505. Subsequently, well-plate 2506 is
moved down conveyer 2520, where robotic member 2525, analogous to
robotic member 2515 and also containing pipettes, injects the
proper amount of a LEIA into wells 2505. Conveyer 2520 then brings
well-plate 2505 into screening chamber 2530. An emitter/detector
apparatus, such as those described in connection with FIG. 17, FIG.
18A, FIG. 18B, FIG. 19A, and FIG. 19B, is located within chamber
2530. Additionally, portions of the processes described in FIG. 20A
and FIG. 20B may occur within this chamber. Subsequently,
well-plates 2535 is moved out of screening chamber 2530 by conveyor
2540, and discarded at 2545. In an alternative embodiment, one or
more robotic devices may move pipettes 2510, screening chamber
2530, etc. to the locations of well-plate 2506, rather than
vice-versa.
[0217] Consistent with the above discussion, example screening
methods could include the collection of multiple data points
without having to switch samples. Because control over the samples
is reversible in the same sample preparation by simply turning the
activating light on and off with fast shutters, the same samples
can be reused. Further, a range of patterns of stimulation can be
provided to the same cell sample so that testing can be performed
for the effect of drugs without concern with regards to differences
across different sample preparations. By modulating the level of
excitation (e.g., by ramping the level from no light to a high or
maximum intensity), the effect of the drug across a range of
membrane potentials can be tested. This permits for the
identification of drugs that are efficacious during hyperpolarized,
natural, or depolarized membrane potentials.
[0218] The cell lines described herein may be a particularly useful
for detailed characterization of drug candidates in a
high-throughput manner Optical control is relatively fast, thereby
allowing for the testing the drug's activity under more
physiological forms of activation. For example, different
frequencies of depolarization and/or hyperpolarization may be used
to determine how a drug interacts with the channel under
physiological forms of neural activity. In some instances, the
process may be accomplished without the application of expensive
chemical dyes to the cell lines.
[0219] In conjunction with the various properties discussed herein,
the use of various embodiments of the invention may be particularly
useful for improving screening throughput by eliminating the need
for cumbersome mechanical manipulation and liquid handling. Various
embodiments may also be useful for repeatable the screening assay
using the same samples, reducing screening cost by eliminating the
need for chemically-based fluorescence reports, producing high
temporal precision and low signal artifact (due to the optical
nature of the voltage manipulation), modulating the level of
depolarization by attenuating the light intensity used for
stimulation, and ascertaining the kinetics of the drug's modulation
on the ion channel through the use of pulsed light patterns.
[0220] The existence of multiple independently controllable
excitation proteins and inhibition proteins opens the door for a
variety of applications including, but not limited to, applications
for treatment of a variety of disorders and the use of a plurality
of light responsive proteins that can be selected so as to respond
to a plurality of respective optical wavelengths. Although not
always expressly stated, inhibition can be used in combination
with, in addition to, or in place of excitation in the
applications. The family of single-component proteins has been
shown to respond to multiple wavelengths and intensities of light.
Aspects of the invention allow for further mutations and/or
searches for sequences that allow for additional optical
wavelengths and/or individually controllable protein channels.
Variations on the optical stimulus (e.g., a wavelength, intensity
or duration profile) can also be used. For instance, stimulation
profiles may exploit overlaps in the excitation wavelengths of two
different ion channel proteins to allow excitation of both proteins
at the same time. In one such instance, the proteins may have
different levels of responsibility. Thus, in a neural application,
one set of ion channels may produce spiking at a different success
percentage relative to a second set of ion channels. Similarly, the
overlaps in inhibition wavelengths of two different ion channels
(or pumps) allows for inhibition of both proteins at the same time.
Alternatively, multiple light sources may be used allowing for
stimulations of the light responsive proteins in the combination
desired, while leaving other proteins un-stimulated.
[0221] Many human applications of the present invention require
governmental approval prior to their use. For instance, human use
of gene therapy may require such approval. However, similar gene
therapies in neurons (non-proliferative cells that are
non-susceptible to neoplasms) are proceeding rapidly, with active,
FDA-approved clinical trials already underway involving viral gene
delivery to human brains. This is likely to facilitate the use of
various embodiments of the present invention for a large variety of
applications. The following is a non-exhaustive list of a few
examples of such applications and embodiments.
[0222] Addiction is associated with a variety of brain functions,
including reward and expectation. Additionally, the driving cause
of addiction may vary between individuals. According to one
embodiment, addiction, for example nicotine addiction, may be
treated with optogenetic stabilization of small areas on the
insula. Optionally, functional brain imaging, for example
cued-state PET or fMRI, may be used to locate a hyper metabolic
focus in order to determine a precise target spot for the
intervention on the insula surface.
[0223] Optogenetic excitation of the nucleus accumbens and septum
may provide reward and pleasure to a patient without need for
resorting to use of substances, and hence may hold a key to
addiction treatment. Conversely, optogenetic stabilization of the
nucleus accumbens and septum may be used to decrease drug craving
in the context of addiction. In an alternative embodiment,
optogenetic stabilization of hyper metabolic activity observed at
the genu of the anterior cingulate (BA32) can be used to decrease
drug craving. Optogenetic stabilization of cells within the arcuate
nucleus of the medial hypothalamus which contain peptide products
of pro-opiomelanocortin (POMC) and
cocaine-and-amphetamine-regulating transcript (CART) can also be
used to decrease drug addiction behavior. For further information
in this regard, reference may be made to: Naqvi N H, Rudrauf D,
Damasio H, Bechara A. "Damage to the insula disrupts addiction to
cigarette smoking." Science. 2007 Jan. 26; 315(5811):531-534, which
is fully incorporated herein by reference.
[0224] Optogenetic stimulation of neuroendocrine neurons of the
hypothalamic periventricular nucleus that secrete somatostatin can
be used to inhibit secretion of growth hormone from the anterior
pituitary, for example in acromegaly. Optogenetic stabilization of
neuroendocrine neurons that secrete somatostatin or growth hormone
can be used to increase growth and physical development. Among the
changes that accompany "normal" aging, is a sharp decline in serum
growth hormone levels after the 4.sup.th and 5.sup.th decades.
Consequently, physical deterioration associated with aging may be
lessened through optogenetic stabilization of the periventricular
nucleus.
[0225] Optogenetic stabilization of the ventromedial nucleus of the
hypothalamus, particularly the pro-opiomelanocortin (POMC) and
cocaine-and-amphetamine-regulating transcript (CART) of the arcuate
nucleus, can be used to increase appetite, and thereby treat
anorexia nervosa. Alternatively, optogenetic stimulation of the
lateral nuclei of the hypothalamus can be used to increase appetite
and eating behaviors.
[0226] Optogenetic excitation in the cholinergic cells of affected
areas including the temporal lobe, the NBM (Nucleus basalis of
Meynert) and the posterior cingulate gyrus (BA 31) provides
stimulation, and hence neurotrophic drive to deteriorating areas.
Because the affected areas are widespread within the brain, an
analogous treatment with implanted electrodes may be less feasible
than an opto-genetic approach.
[0227] Anxiety disorders are typically associated with increased
activity in the left temporal and frontal cortex and amygdala,
which trends toward normal as anxiety resolves. Accordingly, the
affected left temporal and frontal regions and amygdala may be
treated with optogenetic stabilization, so as to dampen activity in
these regions.
[0228] In normal physiology, photosensitive neural cells of the
retina, which depolarize in response to the light that they
receive, create a visual map of the received light pattern.
Optogenetic ion channels can be used to mimic this process in many
parts of the body, and the eyes are no exception. In the case of
visual impairment or blindness due to damaged retina, a
functionally new retina can be grown, which uses natural ambient
light rather than flashing light patterns from an implanted device.
The artificial retina grown may be placed in the location of the
original retina (where it can take advantage of the optic nerve
serving as a conduit back to the visual cortex). Alternatively, the
artificial retina may be placed in another location, such as the
forehead, provided that a conduit for the depolarization signals
are transmitted to cortical tissue capable of deciphering the
encoded information from the optogenetic sensor matrix. Cortical
blindness could also be treated by simulating visual pathways
downstream of the visual cortex. The stimulation would be based on
visual data produced up stream of the visual cortex or by an
artificial light sensor.
[0229] Treatment of tachycardia may be accomplished with
optogenetic stimulation to parasympathetic nervous system fibers
including CN X or Vagus Nerve. This causes a decrease in the SA
node rate, thereby decreasing the heart rate and force of
contraction. Similarly, optogenetic stabilization of sympathetic
nervous system fibers within spinal nerves T1 through T4, serves to
slow the heart. For the treatment of pathological bradycardia,
optogenetic stabilization of the Vagus nerve, or optogenetic
stimulation of sympathetic fibers in T1 through T4 will serve to
increase heart rate. Cardiac disrhythmias resulting from aberrant
electrical foci that outpace the sinoatrial node may be suppressed
by treating the aberrant electrical focus with moderate optogenetic
stabilization. This decreases the intrinsic rate of firing within
the treated tissue, and permits the sinoatrial node to regain its
role in pacing the heart's electrical system. In a similar way, any
type of cardiac arrhythmia could be treated. Degeneration of
cardiac tissue that occurs in cardiomyopathy or congestive heart
failure could also be treated using this invention; the remaining
tissue could be excited using various embodiments of the
invention.
[0230] Optogenetic excitation stimulation of brain regions
including the frontal lobe, parietal lobes and hippocampi, may
increase processing speed, improve memory, and stimulate growth and
interconnection of neurons, including spurring development of
neural progenitor cells. As an example, one such application of the
present invention is directed to optogenetic excitation stimulation
of targeted neurons in the thalamus for the purpose of bringing a
patient out of a near-vegetative (barely-conscious) state. Growth
of light-gated ion channels or pumps in the membrane of targeted
thalamus neurons is affected. These modified neurons are then
stimulated (e.g., via optics which may also gain access by the same
passageway) by directing a flash of light thereupon so as to
modulate the function of the targeted neurons and/or surrounding
cells. For further information regarding appropriate modulation
techniques (via electrode-based treatment) or further information
regarding the associated brain regions for such patients, reference
may be made to: Schiff N D, Giacino J T, Kalmar K, Victor J D,
Baker K, Gerber M, Fritz B, Eisenberg B, O'Connor J O, Kobylarz E
J, Farris S, Machado A, McCagg C, Plum F, Fins J J, Rezai A R
"Behavioral improvements with thalamic stimulation after severe
traumatic brain injury," Nature, Vol. 448, Aug. 2, 2007, pp.
600-604.
[0231] In an alternative embodiment, optogenetic excitation may be
used to treat weakened cardiac muscle in conditions such as
congestive heart failure. Electrical assistance to failing heart
muscle of CHF is generally not practical, due to the
thin-stretched, fragile state of the cardiac wall, and the
difficulty in providing an evenly distributed electrical coupling
between an electrodes and muscle. For this reason, preferred
methods to date for increasing cardiac contractility have involved
either pharmacological methods such as Beta agonists, and
mechanical approaches such as ventricular assist devices. In this
embodiment of the present invention, optogenetic excitation is
delivered to weakened heart muscle via light emitting elements on
the inner surface of a jacket surround the heart or otherwise
against the affected heart wall. Light may be diffused by means
well known in the art, to smoothly cover large areas of muscle,
prompting contraction with each light pulse.
[0232] Optogenetic stabilization in the subgenual portion of the
cingulate gyrus (Cg25), yellow light may be applied with an
implanted device. The goal would be to treat depression by
suppressing target activity in manner analogous to what is taught
by Mayberg H S et al., "Deep Brain Stimulation for
Treatment-Resistant Depression," Neuron, Vol. 45, 651-660, Mar. 3,
2005, pp. 651-660, which is fully incorporated herein by reference.
In an alternative embodiment, an optogenetic excitation stimulation
method is to increase activity in that region in a manner analogous
to what is taught by Schlaepfer et al., "Deep Brain stimulation to
Reward Circuitry Alleviates Anhedonia in Refractory Major
Depression," Neuropsychopharmacology 2007, pp. 1-10, which is fully
incorporated herein by reference.
[0233] In yet another embodiment, the left dorsolateral prefrontal
cortex (LDPFC) is targeted with an optogenetic excitation
stimulation method. Pacing the LDLPFC at 5-20 Hz serves to increase
the basal metabolic level of this structure which, via connecting
circuitry, serves to decrease activity in Cg 25, improving
depression in the process. Suppression of the right dorsolateral
prefrontal cortex (RDLPFC) is also an effective depression
treatment strategy. This may be accomplished by optogenetic
stabilization on the RDLPFC, or suppression may also be
accomplished by using optogenetic excitation stimulation, and
pulsing at a slow rate (e.g., 1 Hz or less) improving depression in
the process. Vagus nerve stimulation (VNS) may be improved using an
optogenetic approach. Use of optogenetic excitation may be used in
order to stimulate only the vagus afferents to the brain, such as
the nodose ganglion and the jugular ganglion. Efferents from the
brain would not receive stimulation by this approach, thus
eliminating some of the side-effects of VNS including discomfort in
the throat, a cough, difficulty swallowing and a hoarse voice. In
an alternative embodiment, the hippocampus may be optogenetically
excited, leading to increased dendritic and axonal sprouting, and
overall growth of the hippocampus. Other brain regions implicated
in depression that could be treated using this invention include
the amygdala, accumbens, orbitofrontal and orbitomedial cortex,
hippocampus, olfactory cortex, and dopaminergic, serotonergic, and
noradrenergic projections. Optogenetic approaches could be used to
control spread of activity through structures like the hippocampus
to control depressive symptoms.
[0234] So long as there are viable alpha and beta cell populations
in the pancreatic islets of Langerhans, the islets can be targeted
for the treatment of diabetes. For example, when serum glucose is
high (as determined manually or by closed loop glucose detection
system), optogenetic excitation may be used to cause insulin
release from the beta cells of the islets of Langerhans in the
pancreas, while optogenetic stabilization is used to prevent
glucagon release from the alpha cells of the islets of Langerhans
in the pancreas. Conversely, when blood sugars are too low (as
determined manually or by closed loop glucose detection system),
optogenetic stabilization may be used to stop beta cell secretion
of insulin, and optogenetic excitation may be used to increase
alpha-cell secretion of glucagon.
[0235] For treatment of epilepsy, quenching or blocking
epileptogenic activity is amenable to optogenetic approaches. Most
epilepsy patients have a stereotyped pattern of activity spread
resulting from an epileptogenic focus. Optogenetic stabilization
could be used to suppress the abnormal activity before it spreads
or truncated it early in its course. Alternatively, activation of
excitatory tissue via optogenetic excitation stimulation could be
delivered in a series of deliberately asynchronous patterns to
disrupt the emerging seizure activity. Another alternative involves
the activation of optogenetic excitation stimulation in GABAergic
neurons to provide a similar result. Thalamic relays may be
targeted with optogenetic stabilization triggered when an abnormal
EEG pattern is detected.
[0236] Another embodiment involves the treatment of
gastrointestinal disorders. The digestive system has its own,
semi-autonomous nervous system containing sensory neurons, motor
neurons and interneurons. These neurons control movement of the GI
tract, as well as trigger specific cells in the gut to release
acid, digestive enzymes, and hormones including gastrin,
cholecystokinin and secretin. Syndromes that include inadequate
secretion of any of these cellular products may be treated with
optogenetic stimulation of the producing cell types, or neurons
that prompt their activity. Conversely, optogenetic stabilization
may be used to treat syndromes in which excessive endocrine and
exocrine products are being created. Disorders of lowered
intestinal motility, ranging from constipation (particularly in
patients with spinal cord injury) to megacolan may be treated with
optogenetic excitation of motor neurons in the intestines.
Disorders of intestinal hypermotility, including some forms of
irritable bowel syndrome may be treated with optogenetic
stabilization of neurons that control motility. Neurogenic gastric
outlet obstructions may be treated with optogenetic stabilization
of neurons and musculature in the pyloris. An alternative approach
to hypomobility syndromes would be to provide optogenetic
excitation to stretch-sensitive neurons in the walls of the gut,
increasing the signal that the gut is full and in need of
emptying.
[0237] In this same paradigm, an approach to hypermobility
syndromes of the gut would be to provide optogenetic stabilization
to stretch receptor neurons in the lower GI, thus providing a
"false cue" that the gut was empty, and not in need of emptying. In
the case of frank fecal incontinence, gaining improved control of
the internal and external sphincters may be preferred to slowing
the motility of the entire tract. During periods of time during
which a patient needs to hold feces in, optogenetic excitation of
the internal anal sphincter will provide for retention. Providing
optogenetic stimulation to the external sphincter may be used to
provide additional continence. When the patient is required to
defecate, the internal anal sphincter, and then external anal
sphincter should be relaxed, either by pausing the optogenetic
stimulation, or by adding optogenetic stabilization.
[0238] Conductive hearing loss may be treated by the use of optical
cochlear implants. Once the cochlea has been prepared for
optogenetic stimulation, a cochlear implant that flashes light may
be used. Sensorineural hearing loss may be treated through optical
stimulation of downstream targets in the auditory pathway.
[0239] Another embodiment of the present invention is directed
toward the treatment of blood pressure disorders, such as
hypertension. Baroreceptors and chemoreceptors in regions such as
the aorta (aortic bodies and paraaortic bodies) and the carotid
arteries ("carotic bodies") participate in the regulation of blood
pressure and respiration by sending afferents via the vagus nerve
(CN X), and other pathways to the medulla and pons, particularly
the solitary tract and nucleus. Optogenetic excitation of the
carotid bodies, aortic bodies, paraortic bodies, may be used to
send a false message of "hypertension" to the solitary nucleus and
tract, causing it to report that blood pressure should be
decreased. Optogenetic excitation or stabilization directly to
appropriate parts of the brainstem may also be used to lower blood
pressure. The opposite modality causes the optogenetic approach to
serve as a pressor, raising blood pressure. A similar effect may
also be achieved via optogenetic excitation of the Vagus nerve, or
by optogenetic stabilization of sympathetic fibers within spinal
nerves T1-T4. In an alternative embodiment, hypertension may be
treated with optogenetic stabilization of the heart, resulting in
decreased cardiac output and lowered blood pressure. According to
another embodiment, optogenetic stabilization of
aldosterone-producing cells within the adrenal cortex may be used
to decrease blood pressure. In yet another alternative embodiment,
hypertension may be treated by optogenetic stabilization of
vascular smooth muscle. Activating light may be passed
transcutaneously to the peripheral vascular bed.
[0240] Another example embodiment is directed toward the treatment
of hypothalamic-pituitary-adrenal axis disorders. In the treatment
of hypothyroidism, optogenetic excitation of parvocellular
neuroendocrine, neurons in the paraventricular and anterior
hypothalamic nuclei can be used to increase secretion of
thyrotropin-releasing hormone (TRH). TRH, in turn, stimulates
anterior pituitary to secrete TSH. Conversely, hyperthyroidism may
be treated with optogenetic stabilization of the provocellular
neuroendocrine neurons. For the treatment of adrenal insufficiency,
or of Addison's disease, optogenetic excitation of parvocellular
neuroendocrine neurons in the supraoptic nucleus and
paraventricular nuclei may be used to increase the secretion of
vasopressin, which, with the help of corticotropin-releasing
hormone (CRH), stimulate anterior pituitary to secrete ACTH.
Cushing syndrome, frequently caused by excessive ACTH secretion,
may be treated with optogenetic stabilization of the parvocellular
neuroendocrine neurons of supraoptic nucleus via the same
physiological chain of effects described above. Neuroendocrine
neurons of the arcuate nucleus produce dopamine, which inhibits
secretion of prolactin from the anterior pituitary.
Hyperprolactinemia can therefore be treated via optogenetic
excitation, while hypoprolactinemia can be treated with optogenetic
stabilization of the neuroendocrine cells of the arcuate
nucleus.
[0241] In the treatment of hyperautonomic states, for example
anxiety disorders, optogenetic stabilization of the adrenal medulla
may be used to reduce norepinephrine output. Similarly, optogenetic
stimulation of the adrenal medulla may be used in persons with need
for adrenaline surges, for example those with severe asthma, or
disorders that manifest as chronic sleepiness.
[0242] Optogenetic stimulation of the adrenal cortex will cause
release of chemicals including cortisol, testosterone, and
aldosterone. Unlike the adrenal medualla, the adrenal cortex
receives its instructions from neuroendocrine hormones secreted
from the pituitary and hypothalamus, the lungs, and the kidneys.
Regardless, the adrenal cortex is amenable to optogenetic
stimulation. Optogenetic stimulation of the cortisol-producing
cells of the adrenal cortex may be used to treat Addison's disease.
Optogenetic stabilization of cortisol-producing cells of the
adrenal cortex may be used to treat Cushing's disease. Optogenetic
stimulation of testosterone-producing cells may be used to treat
disorders of sexual interest in women: Optogenetic stabilization of
those same cells may be used to decrease facial hair in women.
Optogenetic stabilization of aldosterone-producing cells within the
adrenal cortex may be used to decrease blood pressure. Optogenetic
excitation of aldosterone-producing cells within the adrenal cortex
may be used to increase blood pressure.
[0243] Optogenetic excitation stimulation of specific affected
brain regions may be used to increase processing speed, and
stimulate growth and interconnection of neurons, including spurring
the maturation of neural progenitor cells. Such uses can be
particularly useful for treatment of mental retardation.
[0244] According to another embodiment of the present invention,
various muscle diseases and injuries can be treated. Palsies
related to muscle damage, peripheral nerve damage and to dystrophic
diseases can be treated with optogenetic excitation to cause
contraction, and optogenetic stabilization to cause relaxation.
This latter relaxation via optogenetic stabilization approach can
also be used to prevent muscle wasting, maintain tone, and permit
coordinated movement as opposing muscle groups are contracted.
Likewise, frank spasticity can be treated via optogenetic
stabilization.
[0245] In areas as diverse as peripheral nerve truncation, stroke,
traumatic brain injury and spinal cord injury, there is a need to
foster the growth of new neurons, and assist with their integration
into a functional network with other neurons and with their target
tissue. Re-growth of new neuronal tracts may be encouraged via
optogenetic excitation, which serves to signal stem cells to sprout
axons and dendrites, and to integrate themselves with the network.
Use of an optogenetic technique (as opposed to electrodes) prevents
receipt of signals by intact tissue, and serves to ensure that new
target tissue grows by virtue of a communication set up with the
developing neurons, and not with an artificial signal like current
emanating from an electrode.
[0246] Obesity can be treated with optogenetic excitation to the
ventromedial nucleus of the hypothalamus, particularly the
pro-opiomelanocortin (POMC) and cocaine-and-amphetamine-regulating
transcript (CART) of the arcuate nucleus. In an alternative
embodiment, obesity can be treated via optogenetic stabilization of
the lateral nuclei of the hypothalamus. In another embodiment,
optogenetic stimulation to leptin-producing cells or to cells with
leptin receptors within the hypothalamus may be used to decrease
appetite and hence treat obesity.
[0247] Destructive lesions to the anterior capsule and analogous
DBS to that region are established means of treating severe,
intractable obsessive-compulsive disorder 48 (OCD48). Such
approaches may be emulated using optogenetic stabilization to the
anterior limb of the internal capsule, or to regions such as BA32
and Cg24 which show metabolic decrease as OCD remits.
[0248] Chronic pain can be treated using another embodiment of the
present invention. Electrical stimulation methods include local
peripheral nerve stimulation, local cranial nerve stimulation and
"sub threshold" motor cortex stimulation. Reasonable autogenic
approaches include optogenetic stabilization at local painful
sites. Attention to promoter selection would ensure that other
sensory and motor fibers would be unaffected. Selective optogenetic
excitation of interneurons at the primary motor cortex also may
provide effective pain relief. Also, optogenetic stabilization at
the sensory thalamus, (particularly medial thalamic nuclei),
periventricular grey matter, and ventral raphe nuclei, may be used
to produce pain relief. In an alternative embodiment, optogenetic
stabilization of parvalbumin-expressing cells targeting as
targeting strategy, may be used to treat pain by decreasing
Substance P production. The release of endogenous opiods may be
accomplished by using optogenetic excitation to increase activity
in the nucleus accumbens. In an alternative embodiment, when POMC
neurons of the arcuate nucleus of the medial hypothalamus are
optogenetically excited, beta endorphin are increased, providing
viable treatment approaches for depression and for chronic
pain.
[0249] Certain personality disorders, including the borderline and
antisocial types, demonstrate focal deficits in brain disorders
including "hypofrontality." Direct or indirect optogenetic
excitation of these regions is anticipated to produce improvement
of symptoms. Abnormal bursts of activity in the amygdala are also
known to precipitate sudden, unprompted flights into rage: a
symptom of borderline personality disorder, as well as other
conditions, which can benefit from optogenetic stabilization of the
amygdala. Optogenetic approaches could improve communication and
synchronization between different parts of the brain, including
amygdala, striatum, and frontal cortex, which could help in
reducing impulsiveness and improving insight.
[0250] The amygdalocentric model of post-traumatic-stress disorder
(PTSD) proposes that it is associated with hyperarousal of the
amygdala and insufficient top-down control by the medial prefrontal
cortex and the hippocampus. Accordingly, PTSD may be treated with
optogenetic stabilization of the amygdale or hippocampus.
[0251] Schizophrenia is characterized by abnormalities including
auditory hallucinations. These might be treated by suppression of
the auditory cortex using optogenetic stabilization. Hypofrontality
associated with schizophrenia might be treated with optogenetic
excitation in the affected frontal regions. Optogenetic approaches
could improve communication and synchronization between different
parts of the brain which could help in reducing misattribution of
self-generated stimuli as foreign.
[0252] Optogenetic stabilization of cells within the arcuate
nucleus of the medial hypothalamus, which contain peptide products
of pro-opiomelanocortin (POMC) and
cocaine-and-amphetamine-regulating transcript (CART), can be used
to reduce compulsive sexual behavior. Optogenetic excitation of
cells within the arcuate nucleus of the medial hypothalamus which
contain peptide products of pro-opiomelanocortin (POMC) and
cocaine-and-amphetamine-regulating transcript (CART) may be used to
increase sexual interest in the treatment of cases of disorders of
sexual desire. In the treatment of disorders of hypoactive sexual
desire testosterone production by the testes and the adrenal glands
can be increased through optogenetic excitation of the pituitary
gland. Optogenetic excitation of the nucleus accumbens can be used
for the treatment of anorgasmia.
[0253] The suprachiasmatic nucleus secretes melatonin, which serves
to regulate sleep/wake cycles. Optogenetic excitation to the
suprachiasmic nucleus can be used to increase melatonin production,
inducing sleep, and thereby treating insomnia. Orexin (hypocretin)
neurons strongly excite numerous brain nuclei in order to promote
wakefulness. Optogenetic excitation of orexin-producing cell
populations can be used to treat narcolepsy, and chronic daytime
sleepiness.
[0254] Optogenetic stimulation of the supraoptic nucleus may be
used to induce secretion of oxytocin, can be used to promote
parturition during childbirth, and can be used to treat disorders
of social attachment.
[0255] Like muscular palsies, the motor functions that have been
de-afferented by a spinal cord injury may be treated with
optogenetic excitation to cause contraction, and optogenetic
stabilization to cause relaxation. This latter relaxation via
optogenetic stabilization approach may also be used to prevent
muscle wasting, maintain tone, and permit coordinated movement as
opposing muscle groups are contracted. Likewise, frank spasticity
may be treated via optogenetic stabilization. Re-growth of new
spinal neuronal tracts may be encouraged via optogenetic
excitation, which serves to signal stem cells to sprout axons and
dendrites, and to integrate themselves with the network.
[0256] Stroke deficits include personality change, motor deficits,
sensory deficits, cognitive loss, and emotional instability. One
strategy for the treatment of stroke deficits is to provide
optogenetic stimulation to brain and body structures that have been
deafferented from excitatory connections. Similarly, optogenetic
stabilization capabilities can be imparted on brain and body
structures that have been deafferented from inhibitory
connections.
[0257] Research indicates that the underlying pathobiology in
Tourette's syndrome is a phasic dysfunction of dopamine
transmission in cortical and subcortical regions, the thalamus,
basal ganglia and frontal cortex. In order to provide therapy,
affected areas are preferably first identified using techniques
including functional brain imaging and magnetoencephalography
(MEG). Whether specifically identified or not, optogenetic
stabilization of candidate tracts may be used to suppress motor
tics. Post-implantation empirical testing of device parameters
reveals which sites of optogenetic stabilization, and which are
unnecessary to continue.
[0258] In order to treat disorders of urinary or fecal incontinence
optogenetic stabilization can be used to the sphincters, for
example via optogenetic stabilization of the bladder detrussor
smooth muscle or innervations of that muscle. When micturation is
necessary, these optogenetic processes are turned off, or
alternatively can be reversed, with optogenetic stabilization to
the (external) urinary sphincter, and optogenetic excitation of the
bladder detrussor muscle or its innervations. When a bladder has
been deafferentated, for example, when the sacral dorsal roots are
cut or destroyed by diseases of the dorsal roots such as tabes
dorsalis in humans, all reflex contractions of the bladder are
abolished, and the bladder becomes distended. Optogenetic
excitation of the muscle directly can be used to restore tone to
the detrussor, prevent kidney damage, and to assist with the
micturition process. As the bladder becomes "decentralized" and
hypersensitive to movement, and hence prone to incontinence,
optogenetic stabilization to the bladder muscle can be used to
minimize this reactivity of the organ.
[0259] In order to selectively excite/inhibit a given population of
neurons, for example those involved in the disease state of an
illness, several strategies can be used to target the optogenetic
proteins/molecules to specific populations.
[0260] For various embodiments of the present invention, genetic
targeting may be used to express various optogenetic proteins or
molecules. Such targeting involves the targeted expression of the
optogenetic proteins/molecules via genetic control elements such as
promoters (e.g., Parvalbumin, Somatostatin, Cholecystokinin, GFAP),
enhancers/silencers (e.g., Cytomaglovirus Immediate Early
Enhancer), and other transcriptional or translational regulatory
elements (e.g., Woodchuck Hepatitis Virus Post-transcriptional
Regulatory Element). Permutations of the
promoter+enhancer+regulatory element combination can be used to
restrict the expression of optogenetic probes to
genetically-defined populations.
[0261] Various embodiments of the present invention may be
implemented using spatial/anatomical targeting. Such targeting
takes advantage of the fact that projection patterns of neurons,
virus or other reagents carrying genetic information (DNA plasmids,
fragments, etc), can be focally delivered to an area where a given
population of neurons project to. The genetic material will then be
transported back to the bodies of the neurons to mediate expression
of the optogenetic probes. Alternatively, if it is desired to label
cells in a focal region, viruses or genetic material may be focally
delivered to the interested region to mediate localized
expression.
[0262] Various gene delivery systems are useful in implementing one
or more embodiments of the present invention. One such delivery
system is Adeno-Associated Virus (AAV). AAV can be used to deliver
a promoter+optogenetic probe cassette to a specific region of
interest. The choice of promoter will drive expression in a
specific population of neurons. For example, using the CaMKIIa
promoter will drive excitatory neuron specific expression of
optogenetic probes. AAV will mediate long-term expression of the
optogenetic probe for at least one year or more. To achieve more
specificity, AAV may be pseudotyped with specific serotypes 1, 2,
3, 4, 5, 6, 7, and 8, with each having different trophism for
different cell types. For instance, serotype 2 and 5 is known to
have good neuron-specific trophism.
[0263] Another gene delivery mechanism is the use of a retrovirus.
HIV or other lentivirus-based retroviral vectors may be used to
deliver a promoter+optogenetic probe cassette to a specific region
of interest. Retroviruses may also be pseudo-typed with the Rabies
virus envelope glycoprotein to achieve retrograde transport for
labeling cells based on their axonal projection patterns.
Retroviruses integrate into the host cell's genome, therefore are
capable of mediating permanent expression of the optogenetic
probes. Non-lentivirus based retroviral vectors can be used to
selectively label dividing cells.
[0264] Gutless Adenovirus and Herpes Simplex Virus (HSV) are two
DNA-based viruses that can be used to deliver promoter+optogenetic
probe cassette into specific regions of the brain as well. HSV and
Adenovirus have much larger packaging capacities and therefore can
accommodate much larger promoter elements and can also be used to
deliver multiple optogenetic probes or other therapeutic genes
along with optogenetic probes.
[0265] Focal Electroporation can also be used to transiently
transfect neurons. DNA plasmids or fragments can be focally
delivered into a specific region of the brain. By applying mild
electrical current, surrounding local cells will receive the DNA
material and expression of the optogenetic probes.
[0266] In another instance, lipofection can be used by mixing
genetic material with lipid reagents and then subsequently injected
into the brain to mediate transfection of the local cells.
[0267] Various embodiments involve the use of various control
elements. In addition to genetic control elements, other control
elements (particularly promoters and enhancers whose activities are
sensitive to chemical, magnetic stimulation or infrared radiation)
can be used to mediate temporally-controlled expression of the
optogenetic probes. For example, a promoter whose transcriptional
activity is subject to infrared radiation allows one to use focused
radiation to fine tune the expression of optogenetic probes in a
focal region at only the desired time.
[0268] Parkinson's Disease can be treated by expressing optogenetic
stabilization in the glutamatergic neurons in either the
subthalamic nucleus (STN) or the globus pallidus interna (GPi)
using an excitatory-specific promoter such as CaMKII.alpha., and
apply optogenetic stabilization. Unlike electrical modulation in
which all cell-types are affected, only glutamatergic STN neurons
would be suppressed.
[0269] Aspects of the present invention are directed towards
testing a model of a neural circuit or disease. The model can
define output response of the circuit as a function of input
signals. The output response can be assessed using a number of
different measurable characteristics. For instance, characteristics
can include an electrical response of downstream neurons and/or
behavioral response of a patient. To test the model, optogenetic
probes are expressed at an input position for the model. The
optogenetic probes are stimulated and the output characteristics
are monitored and compared to an output predicted by the model.
[0270] In certain implementations, the use of optogenetic probes
allows for fine tuning of models defined using electrical probes.
As electrical probes provide only limited ability to direct the
stimulus and thus are not well suited for stimulus of certain areas
without also directly stimulating nearby areas. Optogenetic probes
disclosed herein provide a mechanism for more precise selection of
the stimulus location. For instance, the stimulus from the
optogenetic probes can be directed to very specific types of
circuits/cells, such as afferent fibers. The following description
provides an example implementation consistent with such an
embodiment and is meant to show the feasibility and wide-ranging
applicability for aspects of present invention.
[0271] According to one embodiment of the present invention, the
invention may be used in animal models of DBS, for example in
Parkinsonian rats, to identify the target cell types responsible
for therapeutic effects (an area of intense debate and immense
clinical importance). This knowledge alone may lead to the
development of improved pharmacological and surgical strategies for
treating human disease.
[0272] One such application involves long-term potentiation (LTP)
and/or long-term depression (LTD) between two neural groups. By
targeting the expression of VChR1 and ChR2 to different neural
populations and stimulating each with a different frequency of
light, LTP or LTD can be accomplished between the two groups. Each
group can be individually controlled using the respective
wavelength of light. This can be particularly useful for
applications in which the spatial arrangement of the two groups
presents issues with individual control using the same wavelength
of light. Thus, the light delivery device(s) are less susceptible
to exciting the wrong neural group and can be less reliant upon
precise spatial location of the optical stimulus.
[0273] The delivery of the proteins to cells in vivo can be
accomplished using a number of different deliver devices, methods
and systems. On such delivery device is an implantable device that
delivers a nucleotide sequence for modifying cells in vivo, such as
a viral-vector. The implantable device can also include a light
delivery mechanism. The light delivery can be accomplished using,
for example, light-emitting diodes (LEDs), fiber optics and/or
Lasers.
[0274] Another embodiment of the present invention involves the use
of VChR1 in affecting stem cell fate including survival/death,
differentiation and replication. The modulation of electrical
properties has been shown to control stem cell fate. Various
techniques can be used to provide stimulus patterns that modify
stem cell fate. A specific example is consistent with the
techniques explained in Deisseroth, K. et al.
"Excitation-neurogenesis coupling in adult neural stem/progenitor
cells," Neuron 42, pp. 535-552 (2004), which is fully incorporated
herein by reference.
[0275] Another embodiment of the present invention is directed to
the use of DChR and/or GtR3 to assess the efficacy of treatments.
This can include, but is not limited to, drug screening, treatment
regimens or modeling of treatments/disorders. In a specific
embodiment, DChR is used as the primary optically responsive
protein in such assessments. In alternate embodiments, DChR is used
with other types of optically responsive proteins (e.g., VCHR1,
GtR3, ChR2 and/or NpHR) that respond to different wavelengths.
[0276] Also provided herein are methods of identifying
transsynaptic connection between neuronal cells in an animal or a
tissue, comprising: a) administering a first viral vector encoding
a Cre recombinase fused to a transcellular tracer protein to
neuronal cells in region A of the animal or tissue; b)
administering a second viral vector encoding a light-activated
protein to neuronal cells in region B of the animal or tissue,
wherein the expression of the light-activated protein depends on
the presence of the Cre recombinase; and c) identifying neuronal
cells expressing the light-activated protein in region B, wherein
the expression of the light-activated protein in the neuronal cells
indicating that these cells are in transsynaptic connection with
the cells in region A.
[0277] Also provided herein are methods of generating optical
control of targeted neuronal cells in an animal or tissue,
comprising: a) administering a first viral vector expressing a Cre
recombinase fused to a transcellular tracer protein to region A of
the animal or tissue; b) administering a second viral vector
encoding a light-activated protein to region B of the animal or
tissue, wherein the expression of the light-activated protein
depends on the presence of the Cre recombinase, and wherein the
neuronal cells in region A and in region B are in transsynaptic
connected; and c) controlling action potential of a neuronal cell
in region B with light that activates the protein.
[0278] Also provided herein are methods of controlling action
potential of a neuron in an animal, comprising activating a
light-activated protein in the neuron with light to generate action
potential change, wherein expression of the light-activated protein
in the neuron is generated by a) administering a first viral vector
expressing a Cre recombinase fused to a transcellular tracer
protein to region A of the animal, b) administering a second viral
vector encoding a light-activated protein to region B of the animal
which contains the neuron, wherein the expression of the
light-activated protein depends on the presence of the Cre
recombinase, wherein the neurons in region A and region B are in
transsynaptic connection.
[0279] In some embodiments, the viral vector is a viral vector
selected from the group consisting of AAV, HSV, and lentivirus. In
some embodiments, the transcellular tracer protein is wheat germ
agglutinin (WGA) or tetanus toxin-fragment C (TTC).
[0280] It is to be understood that one, some, or all of the
properties of the various embodiments described herein may be
combined to form other embodiments of the present invention. These
and other aspects of the invention will become apparent to one of
skill in the art.
[0281] It is understood that aspect and variations of the invention
described herein include "consisting" and/or "consisting
essentially of aspects and variations.
[0282] As used herein and in the appended claims, the singular
forms "a," "an," and "the" include plural reference unless the
context clearly indicates otherwise. For example, reference to an
"animal cell" is a reference to from one to many cells.
[0283] An "isolated" polynucleotide is one which has been
identified and separated and/or recovered from a component of its
natural environment.
[0284] Reference to "about" a value or parameter herein includes
(and describes) variations that are directed to that value or
parameter per se. For example, description referring to "about X"
includes description of "X". The term "about" has its normal
meaning of approximately. In some embodiments, "about" means
.+-.10% or .+-.5%.
TABLE-US-00003 TABLE 3 Sequence for GtR3 >GtR3
ATGGACTACGGAGGAGCACTGTCTGCTGTGGGCCGTGAATTACTCTTTGTGACCAATCCAGTCGTTGTA
AATGGGAGCGTCCTGGTGCCGGAGGATCAATGCTACTGCGCCGGTTGGATTGAAAGCAGAGGCACGA
ATGGGGCCTCATCCTTCGGCAAGGCCCTACTGGAGTTTGTCTTCATCGTCTTCGCGTGTATCACATTACT
GTTGGGAATTAACGCTGCGAAATCAAAGGCTGCATCTAGGGTGCTGTTTCCCGCTACTTTCGTCACTGG
AATCGCAAGTATCGCATATTTTTCCATGGCAAGCGGCGGCGGGTGGGTGATTGCCCCTGACTGTCGGC
AGCTCTTTGTGGCCCGCTATCTGGACTGGCTCATTACTACACCACTTCTACTCATAGATTTGGGTCTGGT
TGCAGGGGTCAGTCGGTGGGATATAATGGCCCTCTGCCTGTCTGATGTCCTGATGATTGCTACGGGTG
CTTTCGGGAGCCTGACAGTGGGTAACGTGAAGTGGGTGTGGTGGTTCTTTGGAATGTGTTGGTTTCTT
CACATAATCTTCGCGCTTGGGAAAAGTTGGGCAGAAGCAGCCAAGGCCAAGGGCGGCGACTCTGCTTC
TGTGTACTCCAAAATCGCCGGCATCACCGTGATTACATGGTTCTGTTATCCCGTGGTATGGGTCTTCGCT
GAGGGCTTCGGAAACTTTTCCGTAACCTTCGAAGTTCTCATCTATGGAGTGTTGGATGTTATTTCAAAG
GCCGTTTTTGGCCTTATACTGATGTCAGGGGCCGCCACCGGATACGAGTCCATT Translation
Map GtR3 1
ATGGACTACGGAGGAGCACTGTCTGCTGTGGGCCGTGAATTACTCTTTGTGACCAATCCA 1 M D
Y G G A L S A V G R E L L F V T N P 61
GTCGTTGTAAATGGGAGCGTCCTGGTGCCGGAGGATCAATGCTACTGCGCCGGTTGGATT 21 V V
V N G S V L V P E D Q C Y C A G W I 121
GAAAGCAGAGGCACGAATGGGGCCTCATCCTICGGCAAGGCCCTACTGGAGTTTGTCTTC 41 E S
R G T N G A S S F G K A L L E F V F 181
ATCGTCTTCGCGTGTATCACATTACTGTTGGGAATTAACGCTGCGAAATCAAAGGCTGCA 61 I V
F A C I T L L L G I N A A K S K A A 241
TCTAGGGIGCTGTTTCCCGCTACTTTCGTCACTGGAATCGCAAGTATCGCATATTTTTCC 81 S R
V L F P A T F V T G I A S I A Y F S 301
ATGGCAAGCGGCGGCGGGTGGGTGATTGCCCCTGACTGTCGGCAGCTCTTTGTGGCCCGC 101 M
A S G G G W V I A P D C R Q L F V A R 361
TATCTGGACTGGCTCATTACTACACCACTTCTACTCATAGATTTGGGTCTGGTTGCAGGG 121 Y
L D W L I T T P L L L I D L G L V A G 421
GTCAGTCGGTGGGATATAATGGCCCTCTGCCTGTCTGATGTCCTGATGATTGCTACGGGT 141 V
S R W D I M A L C L S D V L M I A T G 481
GCTTTCGGGAGCCTGACAGTGGGTAACGTGAAGTGGGTGTGGTGGTTCTTTGGAATGTGT 161 A
F G S L T V G N V K W V W W F F G M C 541
TGGTTTCTTCACATAATCTTCGCGCTTGGGAAAAGTTGGGCAGAAGCAGCCAAGGCCAAG 181 W
F L H I I F A L G K S W A E A A K A K 601
GGCGGCGACTCTGCTTCTGTGTACTCCAAAATCGCCGGCATCACCGTGATTACATGGTTC 201 G
G D S A S V Y S K I A G I T V I T W F 661
TGTTATCCCGTGGTATGGGTCTTCGCTGAGGGCTTCGGAAACTTTTCCGTAACCTTCGAA 221 C
Y P V V W V F A E G F G N F S V T F E 721
GTTCTCATCTATGGAGTGTTGGATGTTATTTCAAAGGCCGTTTTTGGCCTTATACTGATG 241 V
L I Y G V L D V I S K A V F G L I L M 781
TCAGGGGCCGCCACCGGATACGAGTCCATT 261 S G A A T G Y E S I Restriction
Sites Name Seq. Locations Aat1 AGGCCT none Acc1 GTMKAC none AfIII
CTTAAG none AgeI ACCGGT none AlwI GGATC 92 AlwNI CAGNNNCTG none
ApaI GGGCCC none ApaLI GTGCAC none AscI GGCGCGCC none AseI ATTAAT
none AvaI CYCGRG none AvaIl GGWCC none AvrIl CCTAGG none BamHI
GGATCC none BbsI GAAGAC 174(c), 183(c), 678(c) BbvI GCAGC 341, 585,
219(c), 234(c) BcII TGATCA none BgII GCCNNNNNGGC none BglII AGATCT
none BlpI GCTNAGC none BsaI GGTCTC none BsmAI GTCTC none BsmBI
CGTCTC none BstEII GGTNACC none BstXI CCANNNNNNTGG none ClaI ATCGAT
none DraIII CACNNNGTG none EagI CGGCCG none EarI CTCTTC none EcoRI
GAATTC none EcoRV GATATC none FokI GGATG 740, 145(c) FseI GGCCGGCC
none HindIII AAGCTT none KasI GGCGCC none KpnI GGTACC none MluI
ACGCGT none NarI GGCGCC none NcoI CCATGG 298 NdeI CATATG none NheI
GCTAGC none NotI GCGGCCGC none NsiI ATGCAT none PacI TTAATTAA none
PciI ACATGT none PmeI GTTTAAAC none PstI CTGCAG none PvuI CGATCG
none PvuII CAGCTG none SacI GAGCTC none SacII CCGCGG none SalI
GTCGAC none SapI GCTCTTC none Sfil GGCCNNNNNGGCC none SgrAI
CRCCGGYG none SmaI CCCGGG none SpeI ACTAGT none SphI GCATGC none
SspI AATATT none StuI AGGCCT none SwaI ATTTAAAT none TilI CTCGAG
none XbaI TCTAGA none XhoI CTCGAG none XmaI CCCGGG none XmnI
GAANNNNTTC 697 AvaIII atgcat none AfeI AGCGCT none AvrII CCTAGG
none BspEI TCCGGA none BsrGI TGTACA none
TABLE-US-00004 TABLE 4 Sequence for DChR >DChR
ATGCGTAGAAGGGAGTCTCAGCTCGCATACCTTTGCCTGTTCGTTTTGATCGCTGGCTGGGCCCCACGT
CTGACTGAAAGCGCCCCTGATCTAGCCGAGCGGCGGCCTCCCTCCGAGCGAAACACCCCTTACGCCAAT
ATTAAAAAGGTGCCCAATATAACTGAACCCAACGCCAATGTGCAACTTGATGGGTGGGCTCTGTACCA
GGATTTTTACTACCTGGCTGGTTCAGATAAGGAATGGGTCGTTGGCCCTAGCGACCAGTGTTACTGCCG
AGCATGGTCTAAATCACACGGCACCGACAGAGAGGGCGAGGCGGCTGTGGTGTGGGCGTACATCGTA
TTCGCCATTTGTATCGTACAACTGGTTTATTTCATGTTTGCCGCTTGGAAGGCAACGGTCGGATGGGAG
GAAGTCTACGTGAACATCATTGAGCTGGTGCACAITGCCCTGGTGATTTGGGTCGAGTTCGATAAACCC
GCCATGCTCTACCTTAACGACGGTCAGATGGTTCCATGGTTGCGCTATAGTGCATGGCTCCTTTCCTGCC
CAGTCATCCTAATTCACCTGAGCAACTTAACAGGGCTAAAGGGGGACTATAGTAAGAGAACCATGGGG
CTTTTGGTCTCTGACATCGGAACCATAGTGTTTGGTACAAGCGCCGCACTCGCTCCGCCAAACCATGTC
AAAGTCATCTTATTTACAATTGGGTTGCTGTATGGACTCTTCATTTTTTCACGGCAGCGAAGGTATATA
TTGAGGCCTACCACACCGTTCCAAAAGGCCAATGTAGAAACCTCGTGAGGGCTATGGCCTGGACTTATT
TCGTAAGTTGGGCGATGTTCCCCATCCTGTTTATCCTGGGAAGAGAGGGTTTTGGCCATATTACATATTT
TGGCTCATCCATCGGACACTTCATACTGGAGATATTTTCAAAAAATCTGTGGAGTCTACTGGGCCACGG
ATTACGGTATCGCATAAGGCAGCATATCATCATTCATGGCAATTTGACAAAGAAGAATAAGATTAATAT
CGCAGGGGACAACGTCGAAGTGGAAGAGTACGTGGATTCTAACGACAAGGACAGCGACGTT
>DChR
ATGCGTAGAAGGGAGTCTCAGCTCGCATACCTTTGCCTGTTCGTITTGATCGCTGGCTGGGCCCCACGT
CTGACTGAAAGCGCCCCTGATCTAGCCGAGCGGCGGCCTCCCTCCGAGCGAAACACCCCTTACGCCAAT
ATTAAAAAGGTGCCCAATATAACTGAACCCAACGCCAATGTGCAACTTGATGGGTGGGCTCTGTACCA
GGATTTTTACTACCTGGCTGGTTCAGATAAGGAATGGGTCGTTGGCCCTAGCGACCAGTGTTACTGCCG
AGCATGGTCTAAATCACACGGCACCGACAGAGAGGGCGAGGCGGCTGTGGTGTGGGCGTACATCGTA
TTCGCCATTTGTATCGTACAACTGGTTTATTTCATGTTTGCCGCTTGGAAGGCAACGGTCGGATGGGAG
GAAGTCTACGTGAACATCATTGAGCTGGTGCACATTGCCCTGGTGATTTGGGTCGAGTTCGATAAACCC
GCCATGCTCTACCTTAACGACGGTCAGATGGTTCCATGGTTGCGCTATAGTGCATGGCTCCTTTCCTGCC
CAGTCATCCTAATTCACCTGAGCAACTTAACAGGGCTAAAGGGGGACTATAGTAAGAGAACCATGGGG
CTTTTGGTCTCTGACATCGGAACCATAGTGTTTGGTACAAGCGCCGCACTCGCTCCGCCAAACCATGTC
AAAGTCATCTTATTTACAATTGGGTTGCTGTATGGACTCTTCACTTTTTTCACGGCAGCGAAGGTATATA
TTGAGGCCTACCACACCGTTCCAAAAGGCCAATGTAGAAACCTCGTGAGGGCTATGGCCTGGACTTATT
TCGTAAGTTGGGCGATGTTCCCCATCCTGTTTATCCTGGGAAGAGAGGGTTTTGGCCATATTACATATTT
TGGCTCATCCATCGGACACTTCATACTGGAGATATTTTCAAAAAATCTGTGGAGTCTACTGGGCCACGG
ATTACGGTATCGCATAAGGCAGCATATCATCATTCATGGCAATTTGACAAAGAAGAATAAGATTAATAT
CGCAGGGGACAACGTCGAAGTGGAAGAGTACGTGGATTCTAACGACAAGGACAGCGACGTT
Translation Map DChR 1
ATGCGTAGAAGGGAGTCTCAGCTCGCATACCTTTGCCTGTTCGTTTTGATCGCTGGCTGG 1 M R
R R E S Q L A Y L C L F V L I A G W 61
GCCCCACGTCTGACTGAAAGCGCCCCTGATCTAGCCGAGCGGCGGCCTCCCTCCGAGCGA 21 A P
R L T E S A P D L A E R R P P S E R 121
AACACCCCTTACGCCAATATTAAAAAGGTGCCCAATATAACTGAACCCAACGCCAATGTG 41 N T
P Y A N I K K V P N I T E P N A N V 181
CAACTTGATGGGTGGGCTCTGTACCAGGATTTTTACTACCTGGCTGGTTCAGATAAGGAA 61 Q L
D G W A L Y Q D F Y Y L A G S D K E 241
TGGGTCGTTGGCCCTAGCGACCAGTGTTACTGCCGAGCATGGTCTAAATCACACGGCACC 81 W V
V G P S D Q C Y C R A W S K S H G T 301
GACAGAGAGGGCGAGGCGGCTGTGGTGTGGGCGTACATCGTATTCGCCATTTGTATCGTA 101 D
R E G E A A V V W A Y I V F A I C I V 361
CAACTGGTTTATTTCATGTTTGCCGCTTGGAAGGCAACGGTCGGATGGGAGGAAGTCTAC 121 Q
L V Y F M F A A W K A T V G W E E V Y 421
GTGAACATCATTGAGCTGGTGCACATTGCCCTGGTGATTTGGGTCGAGTTCGATAAACCC 141 V
N I I E L V H I A L V I W V E F D K P 481
GCCATGCTCTACCTTAACGACGGTCAGATGGTTCCATGGTTGCGCTATAGTGCATGGCTC 161 A
M L Y L N D G Q M V P W L R Y S A W L 541
CTTTCCTGCCCAGTCATCCTAATTCACCTGAGCAACTTAACAGGGCTAAAGGGGGACTAT 181 L
S C P V I L I H L S N L T G L K G D Y 601
AGTAAGAGAACCATGGGGCTTTTGGTCTCTGACATCGGAACCATAGTGTTTGGTACAAGC 201 S
K R T M G L L V S D I G T I V F G T S 661
GCCGCACTCGCTCCGCCAAACCATGTCAAAGTCATCTTATTTACAATTGGGTTGCTGTAT 221 A
A L A P P N H V K V I L F T I G L L Y 721
GGACTCTTCACTTTTTTCACGGCAGCGAAGGTATATATTGAGGCCTACCACACCGTTCCA 241 G
L F T F F T A A K V Y I E A Y H T V P 781
AAAGGCCAATGTAGAAACCTCGTGAGGGCTATGGCCTGGACTTATTTCGTAAGTTGGGCG 261 K
G Q C R N L V R A M A W T Y F V S W A 841
ATGTTCCCCATCCTGTTTATCCTGGGAAGAGAGGGTTTTGGCCATATTACATATTTTGGC 281 M
F P I L F I L G R E G F G H I T Y F G 901
TCATCCATCGGACACTTCATACTGGAGATATTTTCAAAAAATCTGTGGAGTCTACTGGGC 301 S
S I G H F I L E I F S K N L W S L L G 961
CACGGATTACGGTATCGCATAAGGCAGCATATCATCATTCATGGCAATTTGACAAAGAAG 321 H
G L R Y R I R Q H I I I H G N L T K K 1021
AATAAGATTAATATCGCAGGGGACAACGTCGAAGTGGAAGAGTACGTGGATTCTAACGAC 341 N
K I N I A G D N V E V E E Y V D S N D 1081 AAGGACAGCGACGTT 361 K D
S D V Restriction Sites Name Seq. Locations AatI AGGCCT 760 AccI
GTMKAC 414, 949 AflII CTTAAG none AgeI ACCGGT none AlwI GGATC none
AlwNI CAGNNNCTG none ApaI GGGCCC 58 ApaLI GTGCAC 438 AscI GGCGCGCC
none AseI ATTAAT 1026 AvaI CYCGRG none AvaII GGWCC none AvrII
CCTAGG none BamHI GGATCC none BbsI GAAGAC none BbvI GCAGC 741, 983
bclI TGATCA none BglI GCCNNNNNGGC none BglII AGATCT none BlpI
GCTNAGC none BsaI GGTCTC 623 BsmAI GTCTC 14, 624 BsnnBI CGTCTC none
BstEII GGTNACC none BstXI CCANNNNNNTGG none ClaI ATCGAT none DraIII
CACNNNGTG none EagI CGGCCG none EarI CTCTTC 723, 865(c), 1056(c)
EcoRI GAATTC none EcoRV GATATC none FokI GGATG 402, 554(c), 848(c),
901(c) Fsel GGCCGGCC none HindIII AAGCTT none KasI GGCGCC none KpnI
GGTACC none MluI ACGCGT none NarI GGCGCC none NcoI CCATGG 513,610
NdeI CATATG none NheI GCTAGC none NotI GCGGCCGC none NsiI ATGCAT
none PacI TTAATTAA none PciI ACATGT none PmeI GTTTAAAC none PstI
CTGCAG none PvuI CGATCG none PvuII CAGCTG none SacI GAGCTC none
SacII CCGCGG none SalI GTCGAC none SapI GCTCTTC none SfiI
GGCCNNNNNGGCC none SgrAI CRCCGGYG none SmaI CCCGGG none SpeI ACTAGT
none SphI GCATGC none SspI AATATT 135 StuI AGGCCT 760 SwaI ATTTAAAT
none TliI CTCGAG none XbaI TCTAGA none XhoI CTCGAG none XmaI CCCGGG
none XmnI GAANNNNTTC none AvalII atgcat none AfeI AGCGCT none AvrII
CCTAGG none BspEI TCCGGA none BsrGI TGTACA none
[0285] Provided herein is an animal cell including, but not limited
to, neural cells, cell lines and muscle cells, the animal cell
comprising: an integrated exogenous molecule which expresses a
proton pump responsive to blue light, the exogenous molecule
derived from Guillardia theta.
[0286] Also provided herein is a method comprising: modifying a
light responsive protein derived from Guillardia theta to add an
endoplasmic reticulum (ER) export signal at the C-Terminus of the
light responsive protein.
[0287] Also provided herein is a system for controlling an action
potential of a neuron in vivo, the system comprising: a delivery
device that introduces a protein to the neuron, the protein being
responsive to blue light, wherein the produces an inhibitory
current a blue light source that generates light for stimulation of
the blue light responsive protein; and a control device that
controls the generation of light by the light source.
[0288] Also provided herein are systems, methods, arrangements, or
kits directed toward: optical stimulation of a cell expressing a
GtR3 proton pump.
[0289] Also provided herein are systems, methods, arrangements, or
kits directed toward control of subcellular processes using GtR3
and/or DChR.
[0290] Also provided herein are systems, methods, arrangements, or
kits directed toward the use of GtR3 and DChR in different cell
populations of a common cellular network.
[0291] Also provided herein are systems, methods, arrangements, or
kits directed toward DChR.
[0292] Also provided herein is a protein consistent with any of the
sequences described herein (e.g., sequences shown in Table 1).
[0293] Also provided herein are systems, methods, arrangements, or
kits directed toward combinations of DChR or GtR3 with other
light-responsive opsin types, which can be based on reaction
profiles thereof.
[0294] Also provided herein are systems, methods, arrangements, or
kits directed toward combinations of three or more light-responsive
opsin types.
[0295] Also provided herein are methods for providing tiered-levels
of activity using multiple opsin types in same cell but reactive to
different light.
[0296] Also provided herein are methods for providing tiered-levels
of activity using multiple opsin types in same cell to provide
increase frequency of channel function through alternating
stimulation of each opsin type.
[0297] Also provided herein are systems, methods, arrangements, or
kits directed toward muscle control.
[0298] Also provided herein are systems, methods, arrangements, or
kits directed toward combination control of several different cell
groups, each group having a different combination of opsins so that
each groups be controlled independently of at least one other
group.
[0299] Also provided herein is a system comprising a feedback loop
for control of a cell (or cell population) with the cell(s) having
multiple light-responsive proteins types expressed therein.
[0300] Also provided herein are therapeutic applications including,
but not limited to, treatment of Parkinson's disease.
[0301] Also provided herein are systems, methods, arrangements, or
kits directed toward implantation in retinal cells/retraining brain
to respond to intensity of multiple wavelengths.
[0302] Also provided herein are systems, methods, arrangements, or
kits directed toward drug testing.
[0303] Also provided herein are systems, methods, arrangements, or
kits directed toward the use of GtR3 and/or DChR with transgenic
animals.
[0304] Also provided herein are systems, methods, arrangements, or
kits directed toward control of pH levels in cells including, but
not limited to, control over pH levels in an organelle, which can
be implemented, without limitation, to encourage or inhibit
functions thereof or to kill or maim the cell.
EXAMPLES
[0305] According to certain embodiments, subcellular and
transcellular trafficking strategies now permit (1) optical
regulation at the far-red/infrared border and extension of
optogenetic control across the entire visible spectrum; (2)
increased potency of optical inhibition without increased light
power requirement (nanoampere-scale chloride-mediated photocurrents
that maintain the light sensitivity and reversible, step-like
kinetic stability of earlier tools); and (3) generalizable
strategies for targeting cells based not only on genetic identity,
but also on morphology and tissue topology, to allow versatile
targeting when promoters are not known or in genetically
intractable organisms. These results illustrate the use of
cell-biological principles to enable expansion of the versatile
fast optogenetic technologies suitable for intact-systems biology
and behavior.
[0306] Specific aspects of the present disclosure are directed to
applications of molecular trafficking strategies, to derive a panel
of tools that both quantitatively and qualitatively enhance the
power of optogenetics and open distinct avenues of investigation.
In particular, tools are developed that allow targeting of cells
solely by virtue of their topological relationships within tissue
and that extend the reach of optical control to the infrared
border, with effector function enhanced beyond the other known
tools and covering the entire visible spectrum.
[0307] According to the present disclosure, examination of
eNpHR2.0-expressing hippocampal neurons revealed the absence of
globular ER accumulations with persistent intracellular labeling
and poor membrane localization, suggesting that additional
modifications subsequent to the ER export step are important.
Examination of primary-sequence differences between two forms of an
inward rectifier potassium channel with differential membrane
localization (Kir2.1 and Kir2.4) revealed differences not only in
C-terminal ER export motifs but also in N-terminal Golgi export
signals and in C-terminal trafficking signals (Hofherr et al.,
2005). Surprisingly, provision of the Golgi export signal did not
significantly affect surface expression, but that addition of the
trafficking signal from Kir2.1 either between eNpHR and the EYFP
fusion, or at the C terminus of the fusion protein, dramatically
reduced intracellular labeling and increased apparent surface
membrane expression and also improved labeling of cellular
processes. Indeed, high-resolution confocal imaging revealed marked
localization in processes, with identifiable labeled membranes
spanning intracellular regions apparently devoid of the opsin-EYFP
fusion protein, in a pattern never previously observed with NpHR or
its derivatives.
[0308] We examined photocurrents, using whole-cell patch clamp
recordings to quantify bona fide functional plasma membrane
localization of halorhodopsin pump molecules. Photocurrents were
indeed profoundly increased (to a level .about.20-fold larger than
the initially described NpHR currents; mean.+-.standard error of
the mean [SEM], photocurrent 747.2.+-.93.9 pA in lentivirally
transduced hippocampal pyramidal neurons under the human synapsin I
promoter; n=10). FIG. 25D shows representative traces in the left
portion of the figure, and summary plots in the right portion of
the figure. The representative traces and summary plots of FIG. 25D
shows the average photocurrent levels in cells expressing eNPHR3.0
(747.2.+-.93.9 pA), shown in black, and eNpHR2.0, shown in gray,
(214.1.+-.24.7 pA; unpaired t test p, 0.0005; n=10). Membrane input
resistance was similar for all neurons patched (eNpHR:
193.1.+-.36.6 M.OMEGA.; eNpHR3.0: 151.6.+-.28.5 M.OMEGA.; unpaired
t test p=0.37). At action spectrum peak described below,
nanoampere-scale mean outward currents were readily observed with
3.5 mW/mm.sup.2 yellow light, an order of magnitude lower intensity
than required by proton pumps to attain this level of photocurrent
(maintaining low light intensities becomes an important issue only
for in vivo experiments, wherein safe control of significant tissue
volumes is paramount) (Aravanis et al., 2007; Adamantidis et al.,
2007; Chow et al., 2010). FIG. 25E shows representative voltage
traces, in the left portion of the figure, and summary plots, in
the right portion, of eNpHR3.0 (black) and eNpHR2.0 (gray). In
virally transduced neurons, light-induced hyperpolarizations by
>100 mV were routinely achievable, at the same modest light
power levels, as shown in FIG. 25E (mean hyperpolarization in cells
expressing eNpHR3.0: 101.0.+-.24.7 mV, n=10; and eNpHr2.0:
57.2.+-.6.8 mV, unpaired t test p, 0.0005, n=10). Membrane
potential changes of this new magnitude represent a functionally
distinct advance in optogenetic inhibition, and we accordingly
designate this third-generation NpHR as eNpHR3.0 (the Natronomonas
halorhodopsin was named NpHR in 2005 [Sato et al., 2005], and the
first trafficking-enhanced version developed by Gradinaru et al.
[2008] is now referred to as eNpHR2.0). As expected from prior work
(Zhang et al., 2007a) showing that NpHR photocurrents were
step-like and exhibited little inactivation over more than 10 min
of continuous illumination (indeed, NpHR was selected for this
reason, as described in Zhang et al. [2007a]), the eNpHR3.0
photocurrents were also step-like, resistant to inactivation, and
highly stable over multiple light pulses and long (behaviorally
relevant) timescales (Zhang et al., 2007a).
[0309] FIG. 30A shows stability and recovery for eNpHR3.0 over a
short time scale. The representative traces in the left portion of
FIG. 30A show photocurrents in cells expressing eNpHR3.0 when
exposed to pairs of 10 second long yellow light pulses separated in
time by, from the top to bottom of FIG. 30A: 2.5 seconds, 5
seconds, 10 seconds, and 20 seconds. The upper right portion of
FIG. 30A shows the summary plot for pulses 20 second apart
displaying normalized average photocurrent levels in cells
expressing eNpHR3.0 (P1=first pulse peak, 1.00, S1=first pulse
steady state, 0.74.+-.0.01; P2=second pulse peak, 0.86.+-.0.02;
n=11). The lower right portion of FIG. 30A shows the summary plot
for pulses 20 seconds apart displaying approximately 50% peak
recovery (P2-S1)/(P1-S1). After 20 seconds, the peak recovers to
(45.2.+-.6.6)%. FIG. 30B shows the timecourse of NpHR3.0 normalized
photocurrents for long-term continuous light exposure (n=11;
various plotted are mean.+-.SEM). FIG. 30C shows the outward
current of eNpHR3.0 stability over 10 minutes (light deliver of 593
nm is indicated by the solid bar; output power density: 2.5
mW/mm.sup.2).
[0310] To address whether the robust improved expression is
preserved in the mammalian brain in vivo, we injected lentiviral
vectors delivering the novel opsin gene under control of the
CaMKII.alpha. promoter to the CA1 region of the hippocampal
formation in adult mice and examined distribution of the expressed
EYFP fusion. As in cultured cells, strong expression was observed
not only in dendrites but also in axons in vivo with both eNpHR3.0
and eNpHR3.1 (a shorter version of eNpHR3.0 with equivalent
functionality but the N-terminal signal peptide removed). A major
in vivo opportunity for systems neurobiology is controlling not
just a projection from region A to region B, but a cell type itself
that has (among its connections) a projection from A to B. This
fundamentally distinct result requires multiplexing of optical
control with other targeting methods. Such control would be of
great value in systems neurobiology; for example, cortical
excitatory pyramidal neurons form a genetically and anatomically
defined class of cell, but within this class are cells that each
project to multiple different areas of the brain (e.g., thalamus,
spinal cord, striatum, and other cortical areas) and therefore have
fundamentally distinct roles (Lein et al., 2007; Yoshimura et al.,
2005). It is unlikely that genetic tools will advance far enough to
separate all of these different cell classes, pointing to the need
to inhibit or excite cells defined by connection topology (FIG.
26B). One way to achieve this goal is to capitalize on
transcellular trafficking: to introduce into the local cell-body
location a Cre-dependent virus conditionally expressing the
microbial opsin gene of choice (e.g., Tsai et al., 2009), and
rather than additionally employing a Cre-drive mouse line, to
instead introduce into a distant target structure (chosen to define
the cells of interest by anatomical connectivity) a virus
expressing Cre recombinase fused to a transcellular tracer protein,
e.g., wheat germ agglutinin (WGA) (FIG. 26B) or tetanus
toxin-fragment C (TTC) (Kissa et al., 2002; Maskos et al., 2002;
Perreault et al., 2006; Sano et al., 2007; Sugita and Shiba, 2005).
Cre recombinase in the fusion protein would be transported by
presumed endosomal trafficking mechanisms along with the tracer to
the local cell-body location if anatomically connected and activate
opsin expression in the subset of local cells defined by this
connectivity (FIG. 26B) (Gradinaru et al., 2007, 2009; Petreanu et
al., 2007, 2009). Note that this approach does not require any
specific promoter fragment or genetic definition of target cells (a
clear advantage for use in less-genetically tractable species such
as rats and primates); but, if needed, such additional genetic
refinements can be readily added (for example, both the WGA-Cre-
and the Cre-dependent opsin could be delivered under control of
cell type-specific promoters where available), creating a versatile
means for addressing cells defined at the intersection of
connectivity, location, and genetics.
[0311] This concept was first validated in the rat by devising a
strategy to selectively introduce eNpHR3.0 into those primary motor
cortex (M1) microcircuits that are involved in cortico-cortical
connections with primary sensory cortex (S1) (Colechio and Alloway,
2009). To do this, we injected the previously described
Cre-dependent AAV, now conditionally expressing eNpHR3.0 into motor
cortex, and injected a novel WGA-Cre-expressing AAV
(AAV2-EF1.alpha.-mCherry-IRES-WGA-Cre) remotely into primary
somatosensory cortex. Robust eNpHR3.0-EYFP expression was indeed
observed in a distributed subset of the motor cortex neurons at 5
weeks after injection, despite the remoteness of the Cre
recombinase AAV injection; in control animals without Cre
recombinase, no expression is observed from these Cre-dependent
AAVs (Tsai et al., 2009; Sohal et al., 2009). FIG. 26C shows the
construct design for the WGA-Cre and Cre dependent AAV vectors,
wherein the WGA and Cre genes are both optimized with mammalian
codons. Consistent with the anticipated mode of trans-synaptic or
transcellular transport of Cre, no mCherry-positive cell bodies
were observed in motor cortex, and no EYFP-positive cell bodies
were observed in S1 sensory cortex. Cre can be trans-synaptically
delivered from transduced cells to activate distant gene expression
only in synaptically connected neurons that have received the
Cre-dependent virus, and not in others. The expected EYFP-eNpHR3.0
axon terminals arising from M1 were present in S1. Simultaneous
optrode stimulation/recording (Gradinaru et al., 2007) was
conducted to validate functionality of eNpHR3.0 under the WGA
system; indeed, robust inhibition was readily observed in M1, as
expected from the intense fluorescence of the XFP-opsin fusion
protein. These data indicate that neurons involved in
cortico-cortical connections can indeed be addressed and targeted
not simply as a projection, but as a cell type defined by
connectivity.
[0312] To independently validate this targeting technology in a
distinct circuit and with a different opsin, we next targeted
hippocampal formation dentate gyrus neurons involved in
interhemispheric projections. Within the dentate hilus, the only
known monosynaptic contralateral projection arises from the hilar
mossy cells, which terminate on granule cells of the contralateral
dentate, in dendrites of the molecular layer (Freund and Buzsaki,
1996; Ratzliff et al., 2004). The WGA-Cre AAV was unilaterally
injected into one dentate gyrus, while the Cre-dependent AAV was
injected into the contralateral dentate gyms of the same animal.
Strikingly, opsin expression was observed only in hilar cells of
the contralateral side. Indeed, in this case and at this time
point, accumulation of Cre was retrograde and monosynaptic to the
contralateral hilar cells, as no EYFP labeling was observed in the
contralateral granule cell layer; moreover, pointing to lack of
direct transduction of axon terminals with this AAV serotype, no
mCherry was observed in the contralateral dentate. The only
EYFP-expressing circuit elements in the ipsilateral dentate,
affording precise opportunities for optical control, were axonal
fibers observed to terminate in the molecular layer of the granule
cell layer, precisely as expected for fibers arising from the
contralateral dentate hilus. Indeed, in vivo optrode recordings
confirmed the functionality of WGA/Creactivated ChR2 in driving
light-triggered spikes both at the opsin-expressing cell bodies and
in neurons downstream to the axonal projections of ChR2-expressing
cells, in the contralateral hemisphere; in line with previous
optogenetic studies (Zhang et al., 2007a, 2007b), 470 nm light
pulses at 30 Hz (5 ms pulse width) delivered through the optical
fiber reliably drove neuronal firing in vivo.
[0313] The utility of these targeting strategies for engineered
opsins within intact tissue raised the question of whether
additional advantages might accrue with regard to volume of tissue
modulatable in vivo. While membrane trafficking modifications alone
will not shift the action spectrum, the capability to control
neurons in the far red is a long-sought goal of optogenetics, as
this will allow use of light that penetrates much more deeply into
scattering biological tissues (as with the far-red utility recently
demonstrated for fluorescent proteins) (Shu et al., 2009), and
therefore will allow recruitment of larger volumes (Aravanis et
al., 2007; Adamantidis et al., 2007; Gradinaru et al., 2009). The
massive photocurrents observed for eNpHR3.0 (.about.20.times. those
initially reported for NpHR, which itself is capable of blocking
spiking in response to 589 nm amber light), suggested optogenetic
control with far-red light might be achieved. We therefore explored
optical control in the far red with the trafficking-enhanced
eNpHR3.0.
[0314] Even in response to true-red (630 nm) light of only 3.5
mW/mm.sup.2, we observed potent .about.250 pA outward photocurrents
in virally transduced cells--still more than 6-fold larger than the
first observed NpHR currents with yellow light (FIG. 27A), and
maintaining the characteristic step-like, stable kinetics typical
of NpHR (eNpHR3.0-expressing and eNpHR2.0 expressing neurons:
eNpHR3.0: 239.4.+-.28.7 pA; eNpHR2.0: 42.7.+-.4.5 pA; unpaired t
test p=0.00004; n=10) (Zhang et al., 2007a). Moreover, we found
that these photocurrents evoked by red light could be used to
trigger large (>40 mV) hyperpolarizations in hippocampal
pyramidal neurons (FIG. 27B) (eNpHR3.0-expressing and eNpHR2.0
expressing neurons: eNpHR3.0: 43.3.+-.6.1 mV; eNpHR2.0: 15.6.+-.3.2
mV; unpaired t test p=0.00116; n=10). We therefore explored even
further red-shifted light. We continued to observe robust
photocurrents in the deep red with 660 nm light and at the
red/infrared border with 680 nm light (FIG. 27C). At 680 nm, the
photocurrents (.about.75 pA) were still larger than peak (yellow
light) eNpHR2.0 currents previously reported at 7 mW/mm.sup.2
Importantly, at all of the red and far-red wavelengths tested,
eNpHR3.0 photocurrents readily blocked action potentials induced by
current injection (FIG. 27D) with 7 mW/mm.sup.2 or less, validating
the extension of optogenetic control channels to far-red light. The
outward photocurrents evoked by different wavelengths of red and
far-red/infrared border illumination are: 239.4.+-.28.7 pA (n=10)
at 630 nm; 120.5.+-.16.7 pA (n=4) at 660 nm; and 76.3.+-.8.1 pA
(n=4) at 680 nm.
[0315] One important feature of NpHR is its spectral compatibility
with ChR2: the two opsins have largely separable action spectra and
operate with similar light power density requirements, allowing
bidirectional control of optical activity (Zhang et al., 2007a) in
vitro or in vivo despite a small region of spectral overlap. To
test whether eNpHR3.0 had become too potent, given the spectral
overlap, to use in combination with ChR2 in the same cell, we
created a bicistronic vector containing eNpHR3.0; analogous
2A-based combination vectors (Ryan and Drew, 1994) have been
employed with earlier tools, and channelrhodopsin currents with
this method have ranged from 150 to 240 pA and halorhodopsin
currents from 11 to 40 pA (Tang et al., 2009, Han et al., 2009b).
We transfected the eNpHR3.0-2A-ChR2 construct (abbreviated eNPAC)
into hippocampal pyramidal neurons. With these experiments,
trafficking of both opsin gene products to cellular processes was
observed. To verify that independent excitation and inhibition was
still possible despite the increased currents from eNpHR3.0, we
mapped out the steady-state photocurrent action spectrum in detail
for eNPAC and for ChR2(H134R) (Gradinaru et al., 2007) and eNpHR3.0
alone. FIG. 27F, shows the activation spectrums for eNPAC, the left
portion of FIG. 27F, and for ChR2 (H124R) and eNpHR3.0, on the
right portion of FIG. 27F. In the right portion of FIG. 27F, the
activation spectrum of ChR2 is shown in dark gray, and the
activation spectrum of eNpHR3.0 is shown in light gray. Maximal
eNPAC steady-state excitatory and inhibitory currents were both
approximately 60% of that observed when each opsin was expressed
individually, yielding maximal photocurrents of >550 pA in each
direction (FIGS. 27F-G); the modestly overlapping action spectra
may provide a feature, in that potent shunting inhibition combined
with hyperpolarizing inhibition is likely possible with this
combination approach. More specifically, maximum eNPAC steady-state
excitation was 567.+-.49 pA at 427 nm (n=9), 62% of the value for
ChR2(H134R) alone (916.+-.185 pA, n=5). Similarly, maximum eNPAC
inhibition was 679.+-.109 pA at 590 nm (n=9), 61% of the value for
eNpHR3.0 alone (1110.+-.333 pA; n=4). Output power density for peak
current values was 3.5-5 mW/mm.sup.2 (3.5 mW/mm.sup.2 at 590 nm).
Validation in vivo will require demonstration that the specific P2A
method (or other linker approach) is functional in a particular
circuit or cell type (yet to be determined); however, these data in
cultured hippocampal neurons demonstrate that potent bidirectional
photocurrents of >500 pA each can be achieved within a single
cell, without incapacitating interference of the
trafficking-enhanced opsin.
[0316] The known wide action spectrum of the microbial opsins poses
challenges with regard to achieving multiple independent channels
of control; interestingly, eNpHR3.0 becomes not only a potent
far-red optical control tool, but also the most potent known blue
light-driven opsin-based inhibitor (>400 pA at 472 nm). Indeed,
the membrane trafficking strategies delineated here may form a
generalizable strategy for adapting diverse microbial opsins with
unique properties for optogenetic control purposes. In a final
series of experiments, we explored whether these and other enhanced
membrane trafficking principles could enable the addition of
genetically and functionally distinct components to the optogenetic
toolbox.
[0317] While a very large number of microbial opsins genes exist in
nature, we and others have thus far found none that outperform
eNpHR3.0 (as described herein) with regard to photocurrent size,
light requirements, or kinetics (Zhang et al., 2007a; Han and
Boyden, 2007; Chow et al., 2010). It is important to continue to
expand the optogenetic toolbox, but we have found that most
microbial opsins traffic poorly in mammalian cells. However,
application of the trafficking principles for microbial opsin
engineering outlined here may enable optogenetics to continue the
genomics progress over the past few years (Zhang et al., 2008),
capitalizing on the immense natural diversity of microbial opsins
(Zhang et al., 2008; Chow et al., 2010). We sought to test the
adaptability of the membrane trafficking principle with the
best-characterized microbial opsin, bacteriorhodopsin (BR)
(Stoeckenius and Bogomolni, 1982), from H. salinarum, a green
light-activated regulator of transmembrane ion conductance (Marti
et al., 1991).
[0318] We found that expressed in unmodified form, prominent
intracellular accumulations were observed, similar to those seen
when the Natronomonas halorhodopsin is expressed at high levels,
and no photocurrents were observed. However, addition of the
trafficking signal (TS, as employed for eNpHR3.0) between BR and
EYFP substantially improved membrane and process localization, with
smaller persistent ER-like accumulations that were eliminated with
further C-terminal addition of the ER export signal FCYENEV. The
resulting construct (eBR, doubly engineered for optimal membrane
trafficking) was well tolerated in cultured neurons, with marked
membrane localization and process targeting. Validation of
functional plasma membrane targeting revealed that eBR could
typically deliver .about.50 pA of outward photocurrent and
.about.10 mV hyperpolarizations that sufficed to block spiking in
hippocampal pyramidal neurons when exposed to the optimal
wavelength light of 560 nm, thereby providing another channel for
optogenetic control and illustrating the potential
generalizeability of the microbial opsin membrane trafficking
approach. More specifically, as seen in FIG. 28B, five hundred
sixty nanometer light induced outward photocurrents of 46.4.+-.7.2
pA in eBR cells (mean.+-.SEM is plotted, n=12). The membrane input
resistance was similar for all neurons patched (131.6.+-.19.5
m.OMEGA.). The light power density at sample was 7 mW/mm.sup.2. As
seen in FIG. 28C, the light induced hyperpolarizations were
10.8.+-.1.0 mV (mean.+-.SEM plotted, n=12).
[0319] We also continued genomic strategies similar to those that
allowed our identification of the red-shifted excitatory opsin
VChR1 from Volvox carteri (Zhang et al., 2008); indeed, a number of
microbes have been reported to display light sensitivities from
violet to near infrared. We accordingly continued our broad genomic
mining approach in environmental sequencing databases,
plant/microbial expressed sequence tag (EST) libraries, and
whole-genome shotgun (WGS) sequencing repositories to search for
new rhodopsins with channel or pump properties and novel light
sensitivities (Zhang et al., 2008). Using the primary amino acid
sequences for ChRs, HRs, and BRs as the template sequence, we
continued the search among evolutionarily distant species (Zhang et
al., 2008; Chow et al., 2010). Among other candidate sequences from
diverse hosts (Cryptomonas, Guillardia, Mesostigma, Dunaliella,
Gloeobacter, etc.), one of these from Guillardia theta was
different from the previously reported GtR1 and GtR2 (Sineshchekov
et al., 2005) and showed high amino acid homology to ChR2. We
designated this new protein as G. theta rhodopsin-3 (GtR3),
optimized the codon bias of GtR3 for mammalian expression, and
delivered the GtR3-EYFP fusion gene to hippocampal pyramidal
neurons. In an emerging theme, GtR3 showed intracellular
accumulations and no photocurrents. Provision of the TS signal
between GtR3 and EYFP only mildly reduced accumulations, but,
together with addition of the ER export signal FCYENEV to the C
terminus, accumulations were abolished and increased surface and
process localization observed.
[0320] The resulting modified GtR3 hyperpolarizes hippocampal
neurons in response to 472 nm blue light, albeit with smaller
currents than eBR, and could inhibit spiking as well. We also
achieved blue inhibition of spiking with an opsin (AR) from
Acetabularia acetabulum (Tsunoda et al., 2006; Chow et al., 2010)
engineered for improved trafficking; AR generates little current
alone but was initially aggregate free and required only addition
of the TS signal between AR and EYFP for functional membrane
localization and spike inhibition. Sample current clamp and voltage
clamp traces and summary data show GtR3 function under 472 nm light
(18.5 mW/mm.sup.2) are shown in the left and right portions,
respectively, of FIG. 31C. A light induced outward photocurrent
summary is shown in the left bar graph of FIG. 31C, and the
corresponding hyperpolarization summary for a blue light peak is
shown in the right bar graph. Corresponding photocurrents and
hyperpolarization were: 0.5.+-.0.4 pA and 0.12.+-.0.09 mV for
yellow light (589 nm; 7.5 mW/mm.sup.2); 20.0.+-.6.7 pA and
5.6.+-.1.2 mV for blue light (472 nm; 18.5 mW/mm.sup.2); 1.7.+-.0.9
pA and 0.6.+-.0.3 mV for purple light (406 nm; 3 mW/mm.sup.2)
(mean.+-.SEM plotted; n=10; input resistance was similar for all
neurons: 113.5.+-.24.2 m.OMEGA.).
[0321] While these and other published microbial opsin-derived
inhibitors are not yet as potent as eNpHR3.0 (and for this reason
we continue with eNpHR3.0 for optogenetic applications), the
improved functionality achieved here by membrane trafficking
modifications point to the potential versatility of this approach
in unlocking the full potential of ecological diversity, and to the
individualized strategies that will be indicated for different
microbial opsin genes. FIG. 29A shows general subcellular targeting
strategies for adapting microbial opsin genes to metazoan
intact-systems biology. FIG. 29B shows refinement of targeting at
the tissue and subcellular levels (subcellular opsin targeting
methods have been previously described, see Gradinaru et al. [2007]
and Lewis et al., [2009]; tissue/transcellular opsin targeting
methods are described herein).
[0322] Optogenetic approaches previously have found substantial
utility in the control of biological processes and behavior in
freely moving mammals (Adamantidis et al., 2007; Airan et al.,
2009; Gradinaru et al., 2009; Petreanu et al., 2007, 2009; Sohal et
al., 2009; Tsai et al., 2009) and other animals (Douglass et al.,
2008; Hwang et al., 2007; Lerchner et al., 2007; Zhang et al.,
2007a), with the high temporal precision that is important for
intact-systems biology. We have found that engineering specific
membrane-trafficking capabilities for microbial proteins is an
important step in generating diverse optogenetic technologies for
intact-systems biology. Not all trafficking strategies will be
suitable for all microbial opsins, with different motifs required
for opsins that encounter trafficking difficulty at different
stages; therefore, careful subcellular analysis with rational
selection of proper modifications together constitute a directed
and principled strategy that may be applicable to all opsins of
nonmammalian origin, thereby enabling systematic generation of
novel optogenetic tools from genomic resources.
[0323] We have previously observed that inhibition with NpHR and
NpHR2.0, while useful for many applications (Gradinaru et al.,
2009; Sohal et al., 2009; Tonnesen et al., 2009; Arrenberg et al.,
2009), can in some cases be overcome by very strong excitation
(Sohal et al., 2009). Hyperpolarizations by greater than 100 mV
with eNpHR3.0 provide a substantial step forward in the potency of
optical inhibition. The inhibition now provided with eNpHR3.0, more
than 20-fold stronger than the initial NpHR, remains tunable with
light intensity or duty-cycle adjustments, as with any of the
optogenetic tools. At the action spectrum peak, nanoampere-scale
mean outward currents readily resulted with only 3.5 mW/mm.sup.2
yellow light (10-fold less light power than required for
approaching similar currents with previously described proton
pumps). At the same time, eNpHR3.0 preserved the step-like
kinetics, fast recovery, and resistance to inactivation over long
timescales of NpHR (Zhang et al., 2007a).
[0324] eNpHR3.0 is particularly well suited for in vivo
applications, as the most red-shifted and potent optogenetic
inhibitor to date, but further strategies to enhance potency of
this and other tools will no doubt emerge, and membrane trafficking
work as described here may enable even more potent inhibitors in
the future. When employing eNpHR3.0, inhibition can be readily
dialed down if needed by using weaker promoters, shorter expression
times, or reduced light levels, while maintaining access to new
wavelengths .about.100 nm red-shifted from previous reports (680 nm
versus 589 nm) to enable operating at the infrared border with
deeper-penetrating and safer photons. Of course, not only the opsin
gene and light source selected, but also the strategy for circuit
element targeting, may determine effectiveness; for example,
optogenetic work on Parkinsonian models (Gradinaru et al., 2009)
showed that therapeutically effective deep brain stimulation (DBS)
in the subthalamic nucleus (STN) is likely initiated by action on
afferent axons (which in turn then modulate both downstream and
upstream networks). While direct fiber-optic-based inhibition of
local cell bodies in the STN did not show behavioral effects
comparable to those observed with direct modulation of afferent
axons, these results do not mean that inhibition of the STN is not
important (indeed, optogenetic axonal modulation in the STN results
in inhibition of STN spiking, as noted by Gradinaru et al. [2009]).
Rather, these results informed the long-standing clinical
significant questions surrounding the mechanism and target of DBS
by showing that axonal modulation constitutes the likely
therapeutic mechanism and a highly efficient means for a point
source such as a DBS electrode (or optical fiber) to control a
structure or network in diseased neural circuitry (Gradinaru et
al., 2009). In addition to these circuit element targeting
considerations, the light intensity and wavelength, promoter
choice, virus titer, virus tropism, time of opsin expression,
target cell biophysics, and local patterns of endogenous activity
and modulation will all affect optogenetic inhibition efficacy and
should be carefully considered for each experimental system (Cardin
et al., 2010).
[0325] To enable control of cell types on the basis of connectivity
properties, we leveraged transcellular delivery of a Cre
recombinase. First, in rat, we selectively targeted those M1
neurons that are involved in cortico-cortical connections with S1,
and second, we targeted hippocampal formation dentate gyms neurons
involved in interhemispheric projections; in both cases, cells were
targeted defined only by connectivity, without use of cell
type-specific promoter fragments or transgenic animals. In each
system, this approach must be validated for directionality (antero-
or retrograde) and extent of Cre transport, which may depend on
cell-specific endosomal dynamics and experimental timepoint; this
strategy may also work only with viruses rather than mouse
transgenesis, allowing Cre access to episomal DNA. This approach is
best served by vectors that do not directly transduce axon
terminals, which may not be the case for all AAV serotypes (as we
and others have in some circuits observed [Paterna et al., 2004]).
Any direct transduction of axon terminals may be detected or ruled
out with appropriate XFP markers, and direct transduction of axon
terminals in some cases may be desirable and can be achieved with
HSVs, some AAV serotypes, and pseudotyped lentiviruses; however,
such an approach (unlike the present strategy) does not allow
selection of the cell type postsynaptic to the transduced terminals
and is not as efficient with certain AAVs that are the vector of
choice for many applications due to high titer, tissue penetration,
safety, and tolerability.
[0326] The cell-process targeting enabled by membrane trafficking
modification allows for control of cells that are defined
topologically--that is, by the essential character of their
connections within tissue. At present, it is not guaranteed that
transport is synaptic or monosynaptic (as in the hippocampal
circuit experiments, such properties will need to be validated in
each system); therefore, the term "topological targeting" rather
than synaptic targeting is here used to underscore the deformation
independence of the fundamental character of the connection--an
axonal connection can take any path from A to B, and as long as the
connection is present, the topological targeting strategy remains
valid. This property is important in genetically less-tractable
organisms, but also of substantial value even in animals such as
mice, where genetic targeting tools are in many cases inadequate.
Of course, genetic targeting strategies may be multiplexed with
topological targeting; for example, expression from the
Cre-dependent vector and the Cre-fusion vector may each be governed
by specific genetic targeting sequences if available. Moreover, the
availability of multiple channels of optical control opens the door
to combinatorial topological targeting strategies.
[0327] Like ChR2, NpHR, and VChR1, we note that most microbial
opsins can benefit from substantial protein engineering to achieve
new kinds of functionality. Indeed, we and others have previously
demonstrated molecular strategies for eliciting from microbial
opsins increased light sensitivity (Berndt et al., 2009), increased
photocurrent magnitude (Gradinaru et al., 2007, 2008; Zhao et al.,
2008), faster kinetics (Gunaydin et al., 2010; Lin et al., 2009),
and bistable switching behavior (Berndt et al., 2009). Other
possibilities such as shifted action spectrum (Zhang et al., 2008;
Gunaydin et al., 2010), increased two-photon responsivity, and
altered ion permeability (e.g., for Ca2+) may also be achieved in
the future. While ion conductance-regulating opsins have been the
most versatile for ready translation (employing a common electrical
language), biochemical control with light in defined cell types is
also possible (but with a different set of approaches, given that
microbial signal transduction employs principles distinct from
metazoan signaling) Indeed, optogenetic control of well-defined
biochemical signaling pathways was recently achieved both in
cultured cells and in freely moving mammals, using the optoXR
method for optical control of specified G protein-coupled receptor
signaling (Airan et al., 2009). A photoactivatable adenylyl cyclase
has been studied from Euglena, although with high dark activity
that limits in vivo application (Schroder-Lang et al., 2007), and
subsequent work on light-sensitive PAS or LOV domains (Levskaya et
al., 2009; Wu et al., 2009) may open up new ways to control
protein-protein association if these approaches can be made to
operate in living animals.
[0328] We have found that in the nervous system, optogenetic tools
can be applied to probe the neural circuit underpinnings of
information transmission, oscillations, locomotion, awakening, and
reward, as well as to probe the operation of neural circuits
important in a number of brain diseases including Parkinson's
disease and epilepsy (Adamantidis et al., 2007; Airan et al., 2009;
Cardin et al., 2009; Gradinaru et al., 2009; Sohal et al., 2009;
Tonnesen et al., 2009; Tsai et al., 2009). Moreover, results thus
far point to substantial versatility of the optogenetic approach
across animal species (Adamantidis et al., 2007; Airan et al.,
2009; Aravanis et al., 2007; Arenkiel et al., 2007; Bi et al.,
2006; Boyden et al., 2005; Chow et al., 2010; Douglass et al.,
2008; Gradinaru et al., 2008, 2009; Hagglund et al., 2010; Han et
al., 2009a; Huber et al., 2008; Hwang et al., 2007; Ishizuka et
al., 2006; Li et al., 2005; Nagel et al., 2003, 2005; Petreanu et
al., 2007, 2009; Tsai et al., 2009; Wang et al., 2007; Zhang et
al., 2006, 2007a; Zhang and Oertner, 2007; Zhao et al., 2008).
Together with fiberoptic (Adamantidis et al., 2007; Aravanis et
al., 2007) and integrated fiberoptic-electrode "optrode" assemblies
(Gradinaru et al., 2007), even cells located deep within large,
dense organs can be readily accessed and interrogated in freely
moving mammals. The additional resources defined here arise from
the application of molecular, cellular, and genomic strategies to
enable expansion of the capabilities of optical control, and, as
this toolbox rapidly grows, optogenetics may come to play an
increasingly potent and versatile role in intact-systems biology
for the fast control of defined cells within functioning
tissues.
[0329] Experimental Procedures
[0330] Constructs
[0331] All NpHR variants were produced by PCR amplification of the
NpHR-EYFP construct previously published (Zhang et al., 2007b). All
opsins described here have been optimized for mammalian expression
by changing each gene's codon usage to conform to human codon usage
distribution. Updated maps and vectors are available and freely
distributed from the Deisseroth laboratory (affiliated with
Stanford University, Stanford, Calif.) and described at 2010
Scientific American, "Method of the Year," December 2010
(http://www.optogenetics.org/), the contents of which are hereby
incorporated by reference in their entirety.
[0332] The Amino Acid Sequence of GtR3 Without the Signal Peptide
Sequence
TABLE-US-00005 (SEQ ID NO: 1) A S S F G K A L L E F V F I V F A C I
T L L L G I N A A K S K A A S R V L F P A T F V T G I A S I A Y F S
M A S G G G W V I A P D C R Q L F V A R Y L D W L I T T P L L L I D
L G L V A G V S R W D I M A L C L S D V L M I A T G A F G S L T V G
N V K W V W W F F G M C W F L H I I F A L G K S W A E A A K A K G G
D S A S V Y S K I A G I T V I T W F C Y P V V W V F A E G F G N F S
V T F E V L I Y G V L D V I S K A V F G L I L M S G A A T G Y E S
I
[0333] The Amino Acid Sequence of GtR3 With the Signal Peptide
Sequence from ChR2
TABLE-US-00006 (SEQ ID NO: 5) M D Y G G A L S A V G R E L L F V I N
P V V V N G S V L V P E D Q C Y C A G W I E S R G T N G A S S F G K
A L L E F V F I V F A C I T L L L G I N A A K S K A A S R V L F P A
T F V T G I A S T A Y F S M A S G G G W V I A P D C R Q L F V A R Y
L D W L I T T P L L L I D L G L V A G V S R W D I M A L C L S D V L
M I A T G A F G S L T V G N V K W V W W F F G M C W F L H I I F A L
G K S W A E A A K A K G G D S A S V Y S K I A G I T V I T W F C Y P
V V W V F A E G F G N F S V T F E V L I Y G V L D V I S K A V F G L
I L M S G A A T G Y E S I
[0334] The Amino Acid Sequence of DChR
TABLE-US-00007 (SEQ ID NO: 2) M R R R E S Q L A Y L C L F V L I A G
W A P R L T E S A P D L A E R R P P S E R N T P Y A N I K K V P N I
T E P N A N V Q L D G W A L Y Q D F Y Y L A G S D K E W V V G P S D
Q C Y C R A W S K S H G T D R E G E A A V V W A Y I V F A I C I V Q
L V Y F M F A A W K A T V G W E E V Y V N I I E L V H I A L V I W V
E F D K P A M L Y L N D G Q M V P W L R Y S A W L L S C P V I L I H
L S N L T G L K G D Y S K R T M G L L V S D I G T I V F G T S A A L
A P P N H V K V I L F T I G L L Y G L F T F F T A A K V Y I E A Y H
T V P K G Q C R N L V R A M A W T Y F V S W A M F P I L F I L G R E
G F G H I T Y F G S S I G H F I L E I F S K N L W S L L G H G L R Y
R I R Q H I I I H G N L T K K N K I N I A G D N V E V E E Y V D S N
D K D S D V
[0335] The Amino Acid Sequence of NpHR
TABLE-US-00008 (SEQ ID NO: 3) D P R A K L I A V S T I L V P V V S I
A S Y T G L A S G L T I S V L E M P A G H F A E G S S V M L G G E E
V D G V V T M W G R Y L T W A L S T P M I L L A L G L L A G S N A T
K L F T A I T F D I A M C V T G L A A A L T T S S H L M R W F W Y A
I S C A C F L V V L Y I L L V E W A Q D A K A A G T A D M F N T L K
L L T V V M W L G Y P I V W A L G V E G I A V L P V G V T S W G Y S
F L D I V A K Y I F A F L L L N Y L T S N E S V V S G S I L D V P S
A S G T P A D D
[0336] The Amino Acid Sequence of BR
TABLE-US-00009 (SEQ ID NO: 4) M L E L L P T A V E G V S Q A Q I T G
R P E W I W L A L G T A L M G L G T L Y F L V K G M G V S D P D A K
K F Y A I T T L V P A I A F T M Y L S M L L G Y G L T M V P F G G E
Q N P I Y W A R Y A D W L F T T P L L L L D L A L L V D A D Q G T I
L A L V G A D G I M I G T G L V G A L T K V Y S Y R F V W W A I S T
A A M L Y I L Y V L F F G F T S K A E S M R P E V A S T F K V L R N
V T V V L W S A Y P V V W L I G S E G A G I V P L N I E T L L F M V
L D V S A K V G F G L I L L R S R A I F G E A E A P E P S A G D G A
A A T S D
[0337] Hippocampal Cultures
[0338] Primary cultured hippocampal neurons were prepared from PO
Spague-Dawley rat pups. The CA1 and CA3 regions were isolated,
digested with 0.4 mg/ml papain (Worthington, Lakewood, N.J.), and
plated onto glass coverslips precoated with 1:30 Matrigel (Beckton
Dickinson Labware, Bedford, Mass.) at a density of 65,000/cm.sup.2.
Hippocampal cultures grown on coverslips were transfected or
transduced at 4 days in vitro (DIV) with titer-matched viruses for
all constructs (final dilution 10.sup.4 infectious units (i.u.)/ml
in neuronal growth medium). Whole-cell patch clamp recordings were
performed as previously described (Zhang et al., 2007b). Primary
hippocampal cultures were infected at 4 DIV with titer-matched
virus (final dilution 104 i.u./ml in neuronal growth medium). At 14
DIV, cultures were fixed for 30 min with ice-cold 4%
parafoinialdehyde and then permeabilized for 30 min with 0.4%
saponin in 2% normal donkey serum (NDS). Primary antibody
incubations were performed overnight at 4.degree. C.;
Cy3-conjugated secondary antibodies (Jackson Laboratories, West
Grove, Pa.) were applied in 2% NDS for 1 hr at room temperature.
Images were obtained on a Leica confocal microscope with a
63.times./1.4 NA oil objective.
[0339] Stereotactic Injection Into the Rodent Brain and Optrode
Recordings
[0340] Adult mice and Long-Evans rats were housed according to the
approved protocols at Stanford. All surgeries were performed under
aseptic conditions. The animals were anesthetized with
intraperitoneal injections of a ketamine (80 mg/kg)/xylazine (15-20
mg/kg) cocktail (Sigma). The virus was delivered via a 10 .mu.l
syringe and a thin 34 gauge metal needle; the injection volume and
flow rate (1 .mu.l at 0.1 .mu.l/min) were controlled with an
injection pump from World Precision Instruments (Sarasota, Fla.).
For validation of opsin functionality, simultaneous optical
stimulation and electrical recording in living rodents was
conducted as described previously (Gradinaru et al., 2007) with an
optrode composed of an extracellular tungsten electrode (1
M.OMEGA., .about.125 .mu.m) attached to an optical fiber
(.about.200 .mu.m) with the tip of the electrode deeper (.about.0.4
mm) than the tip of the fiber to ensure illumination of the
recorded neurons. The optical fiber was coupled to a 473 nm (for
ChR2) or 560 nm (for eNpHR3.0) laser diode (10 mW fiber output)
from CrystaLaser. Optrode recordings were conducted in rodents
anesthetized with 1.5% isoflurane, and the optrode was placed
through small craniotomies created above target regions. pClamp 10
and a Digidata 1322A board were used to both collect data and
generate light pulses through the fiber. The recorded signal was
band-pass filtered at 300 Hz low/5 kHz high (1800 Microelectrode AC
Amplifier).
[0341] Tissue Slice Preparation
[0342] For preparation of brain slices, mice or rats were
sacrificed 4 to 5 weeks after viral injection. Rodents were
perfused with 20 ml ice-cold PBS, followed by 20 ml 4%
paraformaldehyde. The brains were then fixed overnight in 4%
paraformaldehyde and transferred to 30% sucrose solution for 2
days. Brains were frozen and coronal slices (40 .mu.m) were
prepared with a Leica SM2000R cryostat and preserved in 4.degree.
C. in cryoprotectant (25% glycerol and 30% ethylene glycol in PBS).
Slices (DAPI stain 1:50,000) were mounted with PVA-DABCO on
microscope slides, and single confocal optical sections (e.g.,
through dorsal CA1 region, .about.1-2.5 mm posterior to bregma or
the dorsal subiculum, 2.7-3 mm posterior to bregma) were acquired
using a 10.times. air and 40.times./1.4 NA oil objectives on a
Leica confocal microscope.
[0343] Extended Experimental Procedures
[0344] Opsin Sources
[0345] All opsins described here have been optimized for mammalian
expression by changing each gene's codon usage to conform to human
codon usage distribution
(http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=9606).
The GenBank accession code for the original AR, BR, and GtR3
sequences are DQ074124, M11720, and EG722553.
[0346] DNA Constructs
[0347] All NpHR variants were produced by PCR amplification of the
NpHR-EYFP construct previously published (Zhang et al., 2007b) and
cloned in-frame into the AgeI and EcoRI restriction sites of a
lentivirus carrying the CaMKII.alpha. or Synapsin-1 promoters
according to standard molecular biology protocols. A similar
strategy was used for BR and AR. GtR3 was identified through
genomic searches. All opsins described here have been optimized for
mammalian expression by changing each gene's codon usage to conform
to human codon usage distribution
(http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=9606),
and the optimized sequence was custom synthesized (DNA2.0, Inc.,
Menlo Park, Calif.). The GenBank accession codes for the original
AR, BR, and GtR3 sequences are DQ074124, M11720, and EG722553.
pAAV-EF1a-mCherry-IRES-WGA-Cre vector was constructed using
standard molecular biology protocols. Codons for the WGA and Cre
genes were optimized for expression in mammalian cells. The genes
were synthesized by DNA2.0 (Menlo Park, Calif.). Cre was fused
in-frame to the C-term of WGA, which in turn was fused to IRES. The
mCherry-IRES-WGA-Cre bicistronic expression cassette was designed
using the EMCV IRES sequence. The pAAV-EF1a plasmid backbone is the
same as described previously (Sohal et al., 2009; Tsai et al.,
2009). pAAV-hSyn-eNpHR3.0-EFYP-P2A-ChR2H134R-mCherry was
constructed with a 120-mer primer
(5'caagttctgctacgagaacgaggtgggctccggagccacgaacttctctctgttaaagcaagcagg
agacgtggaagaaaaccccggtcccatggactatggcggcgctttgtctgccg 3') that
contained the p2A region with the ER export sequence at the 5' end
and 20 bases of the start of hChR2 at the 3' end. First, the
ChR2(H134R)-mCherry fragment was amplified using the 120-mer as the
forward primer and 5'-atatcgaattctcattacttgtacagctcgt-3' as the
reverse primer. Second, this amplified product was used as a
reverse primer along with the forward primer
5'-ccggatccccgggtaccggtaggccaccatgacagagaccctgcct-3' to fuse eNpHR
3.0-EYFP to ChR2 (H134R)-mCherry with the p2A region interposed.
The 3.4 Kb fragment was then purified and cloned into the BamHI and
EcoRI sites of the pAAV-hSyn vector. All constructs were fully
sequenced for accuracy of cloning; updated maps are available
online at http://www.optogenetics.org, the contents of which are
hereby incorporated by reference in their entirety.
[0348] Lentivirus Preparation and Titering
[0349] Lentiviruses for cultured neuron infection and for in vivo
injection were produced as previously described (Zhang et al.,
2007b). Viral titering was performed in HEK293 cells that were
grown in 24-well plates and inoculated with 5-fold serial dilutions
in the presence of polybrene (8 .mu.g/ml). After 4 days, cultures
were resuspended in PBS and sorted for EYFP fluorescence on a
FACScan flow cytometer (collecting 20,000 events per sample)
followed by analysis using FlowJo software (Ashland, Oreg.). The
titer of the virus was determined as follows: [(% of infected
cells).times.(total number of cells in well).times.(dilution
factor)]/(volume of inoculum added to cells)=infectious units/ml.
The titer of viruses for culture infection was 10.sup.5 i.u./ml.
The titer of concentrated virus for in vivo injection was 10.sup.10
i.u./ml.
[0350] Hippocampal Cultures
[0351] Primary cultured hippocampal neurons were prepared from P0
Spague-Dawley rat pups. The CA1 and CA3 regions were isolated,
digested with 0.4 mg/mL papain (Worthington, Lakewood, N.J.), and
plated onto glass coverslips precoated with 1:30 Matrigel (Beckton
Dickinson Labware, Bedford, Mass.) at a density of 65,000/cm.sup.2.
Cultures were maintained in a 5% CO.sub.2 humid incubator with
Neurobasal-A medium (Invitrogen Carlsbad, Calif.) containing 1.25%
FBS (Hyclone, Logan, Utah), 4% B-27 supplement (GIBCO, Grand
Island, N.Y.), 2 mM Glutamax (GIBCO), and FUDR (2 mg/ml, Sigma, St.
Louis, Mo.).
[0352] Calcium Phosphate Transfection
[0353] 6-10 div hippocampal neurons were grown at 65,000 cells/well
in a 24-well plate. DNA/CaC CI.sub.2 mix for each well: 1.5-3 .mu.g
DNA (QIAGEN endotoxin-free preparation)+1.875 .mu.l 2M CaC CI.sub.2
(final Ca.sup.2+ concentration 250 mM) in 15 .mu.l total H.sub.2O.
To DNA/CaCl.sub.2 was added 15 .mu.l of 2.times. HEPES-buffered
saline (pH 7.05), and the final volume was mixed well by pipetting.
After 20 min at RT, the 30 .mu.l DNA/CaCI2.sub.2/HBS mixture was
dropped into each well (from which the growth medium had been
temporarily removed and replaced with 400 .mu.l warm MEM) and
transfection allowed to proceed at 37 C for 45-60 min. Each well
was then washed with 3.times.1 mL warm MEM and the growth medium
replaced. Opsin expression was generally observed within 20-24
hr.
[0354] Electrophysiology
[0355] Hippocampal cultures grown on coverslips were transduced at
4 div with titer-matched viruses for all constructs (final dilution
10.sup.4 i.u./ml in neuronal growth medium) and allowed to express
for one week. Whole-cell patch clamp recordings were performed as
previously described (intracellular solution: 129 mM K-gluconate,
10 mM HEPES, 10 mM KCI, 4 mM MgATP, 0.3 mM Na.sub.3GTP, titrated to
pH 7.2; extracellular Tyrode: 125 mM NaCl, 2 mM KCl, 3 mM CaCl2, 1
mM MgCl.sub.2, 30 mM glucose, and 25 mM HEPES, titrated to pH 7.3).
For voltage clamp recordings cells were held at -70 mV. Light in
the visible range was delivered from a 300 W DG-4 lamp (Sutter
Instruments, Novato, Calif.) through filters of different
wavelength selectivity (Semrock, Rochester, N.Y.) and a Leica
40.times./0.8 NA water objective. Filters, except for power
spectra, (given here as wavelength in nm/bandwidth in nm/output
power in mW/mm.sup.2) were: 406/15/3; 472/30/18.5; 560/14/7;
589/15/7.5; 593/40/15.5; 630/20/3.5. Far-red and near-infrared
light delivery: light (7 mW/mm2) for 660 nm inhibition was
delivered using a light emitting diode and a 40.times./0.8 NA water
objective. Light (7 mW/mm.sup.2) for 680 nm inhibition was
delivered using the X-Cite 120 W halogen light source through a
680.+-.13 nm filter and a 40.times./0.8 NA water objective. Light
delivery for eNPAC, ChR2(H134R), and eNpHR3.0 power spectra was
delivered from a 300 W DG-4 lamp fitted with a Lambda 10-3 filter
wheel (Sutter Instruments) with a 10-position wheel for 25-mm
filters of different wavelengths and a 40.times./0.8 NA water
objective. Filters (given here as wavelength in nm/bandwidth in
nm/output power in mW/mm.sup.2) were: 387/10/3.5; 406/15/3.5;
427/10/4.0; 445/20/4.0; 470/22/4.0; 494/20/4.5; 520/15/4.5;
542/27/5.0; 560/20/5.0; 590/20/3.5; 630/20/3.5. For FIGS. 1, 3A-3D,
and 4 and Figure S2 (see, Table 5 below), confocal images and
whole-cell patch clamp data are from cultured hippocampal neurons
either transfected (confocal data) or transduced (patch data) with
lentiviral NpHR, BR, GtR3 and AR-based constructs, and allowed to
express for one week. Expression was driven by the human Synapsin I
promoter and visualized by fusion to EYFP.
[0356] Table 5 shows additional trafficking-enhanced tools for blue
inhibition, and a new opsin sequence: G. theta rhodopsin-3 or
GtR3.
TABLE-US-00010 TABLE 5 ##STR00001## ##STR00002## ##STR00003##
##STR00004## ##STR00005## New opsin sequence: G. theta rhodopsin-3
or GtR3. The EST sequence included all seven transmembrane helices;
the 5' amino acid sequence was provided from ChR2 (transmembrane
motifs: bars; conserved residues: highlighted; truncation site for
peptide: *; signal peptide provided from ChR2: gray.
[0357] Immunohistochemistry
[0358] Primary hippocampal cultures were infected at 4 div with
titer matched virus (final dilution 10.sup.4 i.u./ml in neuronal
growth medium). At 14 div cultures were fixed for 30 min with
ice-cold 4% paraformaldehyde and then permeabilized for 30 min with
0.4% saponin in 2% normal donkey serum (NDS). Primary antibody
incubations were performed overnight at 4.degree. C. using a
monoclonal marker of endoplasmic reticulum recognizing endogenous
ER-resident proteins containing the KDEL retention signal (KDEL
1:200, Abcam, Cambridge, Mass.). Cy3-conjugated secondary
antibodies (Jackson Laboratories, West Grove, Pa.) were applied in
2% NDS for 1 hr at room temperature. Images were obtained on a
Leica confocal microscope using a 63.times./1.4 NA oil
objective.
[0359] Stereotactic Injection Into the Rodent Brain
[0360] Adult mice and Long-Evans rats were housed according to the
approved protocols at Stanford. All surgeries were performed under
aseptic conditions. The animals were anesthetized with
intraperitoneal injections of a ketamine (80 mg/kg)/xylazine (15-20
mg/kg) cocktail (Sigma). The head was placed in a stereotactic
apparatus (Kopf Instruments, Tujunga, Calif.; Olympus
stereomicroscope). Ophthalmic ointment was applied to prevent eye
drying. A midline scalp incision was made and a small craniotomy
was performed using a drill mounted on the stereotactic apparatus
(Fine Science Tools, Foster City, Calif.). The virus was delivered
using a 10 .mu.l syringe and a thin 34 gauge metal needle; the
injection volume and flow rate (1 .mu.l at 0.1 CI.sub.2l/min) was
controlled with an injection pump from World Precision Instruments
(Sarasota, Fla.). After injection the needle was left in place for
5 additional minutes and then slowly withdrawn. The skin was glued
back with Vetbond tissue adhesive. The animal was kept on a heating
pad until it recovered from anesthesia. Buprenorphine (0.03 mg/kg)
was given subcutaneously following the surgical procedure to
minimize discomfort. For the experiment in FIG. 2A, to cover a
large area in dorsal CA1, 1 .mu.l of concentrated lentivirus
(10.sup.10 i.u./ml) carrying eNpHR3.1 (a shorter form of eNpHR3.0
with the N-terminal signal peptide, the first 17 amino acids of
original NpHR, removed) under the CaMKII.alpha. promoter was
microinjected into 2 sites in each hippocampus (site one:
anteroposterior -1.5 mm from bregma; lateral, .+-.1 mm; ventral,
1.5 mm; site two: AP, -2.5 mm from bregma; lateral, .+-.2 mm;
ventral, 1.5 mm) For FIGS. 2D and 2E, two different
adeno-associated viruses (AAVs) (virus titer 2.times.10.sup.12
g.c./mL), were stereotactically injected during the same surgery
with an injection speed of 0.15 ul/min. High-titer
(2.times.10.sup.12 g.c./mL) AAV was produced by the UNC VectorCore.
For FIG. 2D, double-floxed cre-dependent AAVS carrying
eNpHR3.0-EYFP (AAV5-Ef1a-DIO-eNpHR3.0-EYFP) was injected into M1,
and AAV2-Ef1.alpha.-mCherry-IRESWGA-Cre was injected into S1 of
adult Long-Evans rats. 1 .mu.l of virus was delivered at five
different sites defined by the following coordinates: M1 injection
I: AP, +1 mm from bregma; lateral, 1.5 mm; ventral, 2 mm; M1
injection II: AP, +2 mm; lateral, 1.5 mm; ventral, 2 mm; S1
injection I: AP, -0.3 mm; lateral, 3.4 mm; ventral, 2 mm; S1
injection II: AP, -1.3 mm; lateral, 3 mm; ventral, 2 mm; S1
injection III: AP, -2.12 mm; lateral, 3 mm; ventral, 2 mm. For FIG.
2E, 1 .mu.l of virus was injected bilaterally into the dentate gyms
(DG) of adult BL6 mice. AAV8-EF1a-DIO-ChR2-EYFP was injected in the
right DG and of AAV2-EF1a-mCherry-IRES-WGA-Cre was injected in the
left DG with the following coordinates: AP, -2.1 from bregma;
lateral, .+-.1.05 mm; ventral, 2.1 mm.
[0361] In Vivo Optrode Recordings
[0362] To validate opsin functionality in the WGA-Cre system
simultaneous optical stimulation and electrical recording in living
rodents was conducted as described previously (Gradinaru et al.,
2007) using an optrode composed of an extracellular tungsten
electrode (1 M.OMEGA., .about.125 .mu.m) attached to an optical
fiber (.about.200 .mu.m) with the tip of the electrode deeper
(.about.0.4 mm) than the tip of the fiber to ensure illumination of
the recorded neurons. The optical fiber was coupled to a 473 nm
(for ChR2) or 560 nm (for eNpHR3.0) laser diode (10 mW fiber
output) from CrystaLaser. Optrode recordings were conducted in
rodents anesthetized with 1.5% isoflurane and the optrode was
placed through small craniotomies created above target regions.
pClamp 10 and a Digidata 1322A board were used to both collect data
and generate light pulses through the fiber. The recorded signal
was band pass filtered at 300 Hz low/5 kHz high (1800
Microelectrode AC Amplifier). For precise placement of the
fiber/electrode pair, stereotactic instrumentation was used.
[0363] Tissue Slice Preparation
[0364] For preparation of brain slices, mice or rats were
sacrificed 4 to 5 weeks after viral injection. Rodents were
perfused with 20 ml of ice-cold PBS, followed by 20 ml of 4%
paraformaldehyde. The brains were then fixed overnight in 4%
paraformaldehyde, and transferred to 30% sucrose solution for 2
days. Brains were frozen and coronal slices (40 .mu.m) were
prepared using a Leica SM2000R cryostat, and preserved in 4.degree.
C. in cryoprotectant (25% glycerol, 30% ethylene glycol, in PBS).
Slices (DAPI stain 1:50,000) were mounted with PVA-DABCO on
microscope slides, and single confocal optical sections (e.g.,
through dorsal CA1 region, .about.1-2.5 mm posterior to bregma or
the dorsal subiculum, 2.7-3mm posterior to bregma) were acquired
using a 10.times. air and 40.times./1.4 NA oil objectives on a
Leica confocal microscope.
[0365] For further details and discussion of the above-noted
embodiments, reference can be made to "Molecular and Cellular
Approaches for Diversifying and Extending Optogenetics" by Viviana
Gradinaru et al., Cell 141, 154-165, Apr. 2, 2010, which is fully
incorporated herein by reference.
REFERENCES
[0366] Adamantidis, A. R., Zhang, F., Aravanis, A. M., Deisseroth,
K., and de Lecea, L. (2007). Neural substrates of awakening probed
with optogenetic control of hypocretin neurons. Nature 450,
420-424.
[0367] Airan, R. D., Thompson, K. R., Fenno, L. E., Bernstein, H.,
and Deisseroth, K. (2009). Temporally precise in vivo control of
intracellular signalling. Nature 458, 1025-1029.
[0368] Aravanis, A. M., Wang, L. P., Zhang, F., Meltzer, L. A.,
Mogri, M. Z., Schneider, M. B., and Deisseroth, K. (2007). An
optical neural interface: in vivo control of rodent motor cortex
with integrated fiberoptic and optogenetic technology. J. Neural
Eng. 4, S143-S156.
[0369] Arenkiel, B. R., Peca, J., Davison, I. G., Feliciano, C.,
Deisseroth, K., Augustine, G. J., Ehlers, M. D., and Feng, G.
(2007). In vivo light-induced activation of neural circuitry in
transgenic mice expressing channelrhodopsin-2. Neuron 54,
205-218.
[0370] Arrenberg, A. B., Del Bene, F., and Baier, H. (2009).
Optical control of zebrafish behavior with halorhodopsin. Proc.
Natl. Acad. Sci. USA 106, 17968-17973.
[0371] Berndt, A., Yizhar, O., Gunaydin, L. A., Hegemann, P., and
Deisseroth, K. (2009). Bi-stable neural state switches. Nat.
Neurosci. 12, 229-234. Bi, G. Q., and Poo, M. M. (1998). Synaptic
modifications in cultured hippocampal neurons: dependence on spike
timing, synaptic strength, and postsynaptic cell type. J. Neurosci.
18, 10464-10472.
[0372] Bi, A., Cui, J., Ma, Y. P., Olshevskaya, E., Pu, M.,
Dizhoor, A. M., and Pan, Z. H. (2006). Ectopic expression of a
microbial-type rhodopsin restores visual responses in mice with
photoreceptor degeneration. Neuron 50, 23-33.
[0373] Boyden, E. S., Zhang, F., Bamberg, E., Nagel, G., and
Deisseroth, K. (2005). Millisecond-timescale, genetically targeted
optical control of neural activity. Nat. Neurosci. 8,
1263-1268.
[0374] Cardin, J. A., Carlen, M., Meletis, K., Knoblich, U., Zhang,
F., Deisseroth, K., Tsai, L. H., and Moore, C. I. (2009). Driving
fast-spiking cells induces gamma rhythm and controls sensory
responses. Nature 459, 663-667.
[0375] Cardin, J. A., Carlen, M., Meletis, K., Knoblich, U., Zhang,
F., Deisseroth, K., Tsai, L. H., and Moore, C. I. (2010). Targeted
optogenetic stimulation and recording of neurons in vivo using
cell-type-specific expression of Channelrhodopsin-2. Nat. Protoc.
5, 247-254.
[0376] Chow, B. Y., Han, X., Dobry, A. S., Qian, X., Chuong, A. S.,
Li, M., Henninger, M. A., Belfort, G. M., Lin, Y., Monahan, P. E.,
and Boyden, E. S. (2010) High-performance genetically targetable
optical neural silencing by lightdriven proton pumps. Nature 463,
98-102.
[0377] Colechio, E. M., and Alloway, K. D. (2009). Differential
topography of the bilateral cortical projections to the whisker and
forepaw regions in rat motor cortex. Brain Struct. Funct. 213,
423-439.
[0378] Deisseroth, K., Feng, G., Majewska, A. K., Miesenbo{umlaut
over ( )}ck, G., Ting, A., and Schnitzer, M. J. (2006).
Next-generation optical technologies for illuminating genetically
targeted brain circuits. J. Neurosci. 26, 10380-10386.
[0379] Douglass, A. D., Kraves, S., Deisseroth, K., Schier, A. F.,
and Engert, F. (2008). Escape behavior elicited by single,
channelrhodopsin-2-evoked spikes in zebrafish somatosensory
neurons. Curr. Biol. 18, 1133-1137.
[0380] Fleischmann, A., Shykind, B. M., Sosulski, D. L., Franks, K.
M., Glinka, M. E., Mei, D. F., Sun, Y., Kirkland, J., Mendelsohn,
M., Albers, M. W., and Axel, R. (2008). Mice with a "monoclonal
nose": perturbations in an olfactory map impair odor
discrimination. Neuron 60, 1068-1081.
[0381] Freund, T. F., and Buzsaki, G. (1996). Interneurons of the
hippocampus. Hippocampus 6, 347-470.
[0382] Gradinaru, V., Thompson, K. R., Zhang, F., Mogri, M., Kay,
K., Schneider, M. B., and Deisseroth, K. (2007). Targeting and
readout strategies for fast optical neural control in vitro and in
vivo. J. Neurosci. 27, 14231-14238.
[0383] Gradinaru, V., Thompson, K. R., and Deisseroth, K. (2008).
eNpHR: a Natronomonas halorhodopsin enhanced for optogenetic
applications. Brain Cell Biol. 36, 129-139.
[0384] Gradinaru, V., Mogri, M., Thompson, K. R., Henderson, J. M.,
and Deisseroth, K. (2009). Optical deconstruction of parkinsonian
neural circuitry. Science 324, 354-359.
[0385] Gunaydin, L. A., Yizhar, O., Berndt, A., Sohal, V. S.,
Deisseroth, K., and Hegemann, P. (2010). Ultrafast optogenetic
control. Nat. Neurosci. 13, 387-392.
[0386] Hagglund, M., Borgius, L., Dougherty, K. J., and Kiehn, O.
(2010). Activation of groups of excitatory neurons in the mammalian
spinal cord or hindbrain evokes locomotion. Nat. Neurosci. 13,
246-252.
[0387] Han, X., and Boyden, E. S. (2007). Multiple-color optical
activation, silencing, and desynchronization of neural activity,
with single-spike temporal resolution. PLoS ONE 2, e299.
[0388] Han, X., Qian, X., Bernstein, J. G., Zhou, H. H., Franzesi,
G. T., Stern, P., Bronson, R. T., Graybiel, A. M., Desimone, R.,
and Boyden, E. S. (2009a). Millisecond-timescale optical control of
neural dynamics in the nonhuman primate brain. Neuron 62,
191-198.
[0389] Han, X., Qian, X., Stern, P., Chuong, A. S., and Boyden, E.
S. (2009b). Informational lesions: optical perturbation of spike
timing and neural synchrony via microbial opsin gene fusions. Front
Mol Neurosci 2, 12.
[0390] Hofherr, A., Fakler, B., and Klocker, N. (2005). Selective
Golgi export of Kir2.1 controls the stoichiometry of functional
Kir2.x channel heteromers. J. Cell Sci. 118, 1935-1943.
[0391] Huber, D., Petreanu, L., Ghitani, N., Ranade, S., Hromadka,
T., Mainen, Z., and Svoboda, K. (2008). Sparse optical
microstimulation in barrel cortex drives learned behaviour in
freely moving mice. Nature 451, 61-64.
[0392] Hwang, R. Y., Zhong, L., Xu, Y., Johnson, T., Zhang, F.,
Deisseroth, K., and Tracey, W. D. (2007). Nociceptive neurons
protect Drosophila larvae from parasitoid wasps. Curr. Biol. 17,
2105-2116.
[0393] Ishizuka, T., Kakuda, M., Araki, R., and Yawo, H. (2006).
Kinetic evaluation of photosensitivity in genetically engineered
neurons expressing green algae light-gated channels. Neurosci. Res.
54, 85-94.
[0394] Kalaidzidis, I. V., Kalaidzidis, Y. L., and Kaulen, A. D.
(1998). Flash-induced voltage changes in halorhodopsin from
Natronobacterium pharaonis. FEBS Lett. 427, 59-63.
[0395] Kissa, K., Mordelet, E., Soudais, C., Kremer, E. J.,
Demeneix, B. A., Brulet, P., and Coen, L. (2002). In vivo neuronal
tracing with GFP-TTC gene delivery. Mol. Cell. Neurosci. 20,
627-637.
[0396] Lanyi, J. K., and Oesterhelt, D. (1982). Identification of
the retinal-binding protein in halorhodopsin. J. Biol. Chem. 257,
2674-2677.
[0397] Lein, E. S., Hawrylycz, M. J., Ao, N., Ayres, M., Bensinger,
A., Bernard, A., Boe, A. F., Boguski, M. S., Brockway, K. S.,
Byrnes, E. J., et al. (2007). Genome-wide atlas of gene expression
in the adult mouse brain. Nature 445, 168-176.
[0398] Lerchner, W., Xiao, C., Nashmi, R., Slimko, E. M., van
Trigt, L., Lester, H. A., and Anderson, D. J. (2007). Reversible
silencing of neuronal excitability in behaving mice by a
genetically targeted, ivermectin-gated Cl-- channel. Neuron 54,
35-49.
[0399] Levskaya, A., Weiner, O. D., Lim, W. A., and Voigt, C. A.
(2009). Spatiotemporal control of cell signalling using a
light-switchable protein interaction. Nature 461, 997-1001.
[0400] Lewis, T. L., Jr., Mao, T., Svoboda, K., and Arnold, D. B.
(2009). Myosindependent targeting of transmembrane proteins to
neuronal dendrites. Nat. Neurosci. 12, 568-576.
[0401] Li, X., Gutierrez, D. V., Hanson, M. G., Han, J., Mark, M.
D., Chiel, H., Hegemann, P., Landmesser, L. T., and Herlitze, S.
(2005). Fast noninvasive activation and inhibition of neural and
network activity by vertebrate rhodopsin and green algae
channelrhodopsin. Proc. Natl. Acad. Sci. USA 102, 17816-17821.
[0402] Lin, J. Y., Lin, M. Z., Steinbach, P., and Tsien, R. Y.
(2009). Characterization of engineered channelrhodopsin variants
with improved properties and kinetics. Biophys. J. 96,
1803-1814.
[0403] Lozier, R. H., Bogomolni, R. A., and Stoeckenius, W. (1975).
Bacteriorhodopsin: a light-driven proton pump in Halobacterium
Halobium. Biophys. J. 15, 955-962.
[0404] Marti, T., Otto, H., Mogi, T., Rosselet, S. J., Heyn, M. P.,
and Khorana, H. G. (1991). Bacteriorhodopsin mutants containing
single substitutions of serine or threonine residues are all active
in proton translocation. J. Biol. Chem. 266, 6919-6927.
[0405] Maskos, U., Kissa, K., St Cloment, C., and Brulet, P.
(2002). Retrograde trans-synaptic transfer of green fluorescent
protein allows the genetic mapping of neuronal circuits in
transgenic mice. Proc. Natl. Acad. Sci. USA 99, 10120-10125.
[0406] Nagel, G., Szellas, T., Huhn, W., Kateriya, S., Adeishvili,
N., Berthold, P., Ollig, D., Hegemann, P., and Bamberg, E. (2003).
Channelrhodopsin-2, a directly light-gated cation-selective
membrane channel. Proc. Natl. Acad. Sci. USA 100, 13940-13945.
[0407] Paterna, J. C., Feldon, J., and Bueler, H. (2004).
Transduction profiles of recombinant adeno-associated virus vectors
derived from serotypes 2 and 5 in the nigrostriatal system of rats.
J. Virol. 78, 6808-6817.
[0408] Perreault, M. C., Bernier, A. P., Renaud, J. S., Roux, S.,
and Glover, J. C. (2006). C fragment of tetanus toxin hybrid
proteins evaluated for muscle-specific transsynaptic mapping of
spinal motor circuitry in the newborn mouse. Neuroscience 141,
803-816.
[0409] Petreanu, L., Huber, D., Sobczyk, A., and Svoboda, K.
(2007). Channelrhodopsin-2-assisted circuit mapping of long-range
callosal projections. Nat. Neurosci. 10, 663-668.
[0410] Petreanu, L., Mao, T., Sternson, S. M., and Svoboda, K.
(2009). The subcellular organization of neocortical excitatory
connections. Nature 457, 1142-1145.
[0411] Ratzliff, A. H., Howard, A. L., Santhakumar, V., Osapay, I.,
and Soltesz, I. (2004). Rapid deletion of mossy cells does not
result in a hyperexcitable dentate gyrus: implications for
epileptogenesis. J. Neurosci. 24, 2259-2269.
[0412] Ryan, M. D., and Drew, J. (1994). Foot-and-mouth disease
virus 2A oligopeptide mediated cleavage of an artificial
polyprotein. EMBO J. 13,928-933.
[0413] Sano, H., Nagai, Y., and Yokoi, M. (2007). Inducible
expression of retrograde transynaptic genetic tracer in mice.
Genesis 45,123-128.
[0414] Sato, M., Kubo, M., Aizawa, T., Kamo, N., Kikukawa, T.,
Nitta, K., and Demura, M. (2005). Role of putative anion-binding
sites in cytoplasmic and extracellular channels of Natronomonas
pharaonis halorhodopsin. Biochemistry 44,4775-4784.
[0415] Schroder-Lang, S., Schwarzel, M., Seifert, R., Strunker, T.,
Kateriya, S., Looser, J., Watanabe, M., Kaupp, U. B., Hegemann, P.,
and Nagel, G. (2007). Fast manipulation of cellular cAMP level by
light in vivo. Nat. Methods 4,39-42.
[0416] Shu, X., Royant, A., Lin, M. Z., Aguilera, T. A., Lev-Ram,
V., Steinbach, P. A., and Tsien, R. Y. (2009). Mammalian expression
of infrared fluorescent proteins engineered from a bacterial
phytochrome. Science 324,804-807.
[0417] Silberberg, G., Wu, C., and Markram, H. (2004). Synaptic
dynamics control the timing of neuronal excitation in the activated
neocortical microcircuit. J. Physiol. 556, 19-27. Simon, S. M., and
Blobel, G. (1993). Mechanisms of translocation of proteins across
membranes. Subcell. Biochem. 21,1-15.
[0418] Sineshchekov, O. A., Govorunova, E. G., Jung, K. H., Zauner,
S., Maier, U. G., and Spudich, J. L. (2005). Rhodopsin-mediated
photoreception in cryptophyte flagellates. Biophys. J.
89,4310-4319.
[0419] Sohal, V. S., Zhang, F., Yizhar, O., and Deisseroth, K.
(2009). Parvalbumin neurons and gamma rhythms enhance cortical
circuit performance. Nature 459,698-702.
[0420] Stoeckenius, W., and Bogomolni, R. A. (1982).
Bacteriorhodopsin and related pigments of halobacteria. Annu. Rev.
Biochem. 51,587-616.
[0421] Sugita, M., and Shiba, Y. (2005). Genetic tracing shows
segregation of taste neuronal circuitries for bitter and sweet.
Science 309,781-785.
[0422] Tang, W., Ehrlich, I., Wolff, S. B., Michalski, A. M.,
Wolfl, S., Hasan, M. T., Luthi, A., and Sprengel, R. (2009).
Faithful expression of multiple proteins via 2A-peptide
self-processing: a versatile and reliable method for manipulating
brain circuits. J. Neurosci. 29, 8621-8629.
[0423] Tengholm, A., and Gylfe, E. (2009). Oscillatory control of
insulin secretion. Mol. Cell. Endocrinol. 297, 58-72.
[0424] Tonnesen, J., Sorensen, A. T., Deisseroth, K., Lundberg, C.,
and Kokaia, M. (2009). Optogenetic control of epileptiform
activity. Proc. Natl. Acad. Sci. USA 106, 12162-12167.
[0425] Tsai, H. C., Zhang, F., Adamantidis, A., Stuber, G. D.,
Bonci, A., de Lecea, L., and Deisseroth, K. (2009). Phasic firing
in dopaminergic neurons is sufficient for behavioral conditioning.
Science 324, 1080-1084.
[0426] Tsunoda, S. P., Ewers, D., Gazzarrini, S., Moroni, A.,
Gradmann, D., and Hegemann, P. (2006). H+-pumping rhodopsin from
the marine alga Acetabularia. Biophys. J. 91, 1471-1479.
[0427] Wang, H., Peca, J., Matsuzaki, M., Matsuzaki, K., Noguchi,
J., Qiu, L., Wang, D., Zhang, F., Boyden, E., Deisseroth, K., et
al. (2007). High-speed mapping of synaptic connectivity using
photostimulation in Channelrhodopsin-2 transgenic mice. Proc. Natl.
Acad. Sci. USA 104, 8143-8148.
[0428] Wu, Y.I., Frey, D., Lungu, O. I., Jaehrig, A., Schlichting,
I., Kuhlman, B., and Hahn, K. M. (2009). A genetically encoded
photoactivatable Rac controls the motility of living cells. Nature
461, 104-108.
[0429] Yooseph, S., Sutton, G., Rusch, D. B., Halpern, A. L.,
Williamson, S. J., Remington, K., Eisen, J. A., Heidelberg, K. B.,
Manning, G., Li, W., et al. (2007). The Sorcerer II Global Ocean
Sampling expedition: expanding the universe of protein families.
PLoS Biol. 5, e16.
[0430] Yoshimura, Y., Dantzker, J. L., and Callaway, E. M. (2005).
Excitatory cortica neurons form fine-scale functional networks.
Nature 433, 868-873.
[0431] Zhang, Y. P., and Oertner, T. G. (2007). Optical induction
of synaptic plasticity using a light-sensitive channel. Nat.
Methods 4, 139-141.
[0432] Zhang, F., Wang, L. P., Boyden, E. S., and Deisseroth, K.
(2006). Channelrhodopsin-2 and optical control of excitable cells.
Nat. Methods 3, 785-792.
[0433] Zhang, F., Wang, L. P., Brauner, M., Liewald, J. F., Kay,
K., Watzke, N., Wood, P. G., Bamberg, E., Nagel, G., Gottschalk,
A., and Deisseroth, K. (2007a). Multimodal fast optical
interrogation of neural circuitry. Nature 446, 633-639.
[0434] Zhang, F., Aravanis, A. M., Adamantidis, A., de Lecea, L.,
and Deisseroth, K. (2007b). Circuit-breakers: optical technologies
for probing neural signals and systems. Nat. Rev. Neurosci. 8,
577-581.
[0435] Zhang, F., Prigge, M., Beyriere, F., Tsunoda, S. P., Mattis,
J., Yizhar, O., Hegemann, P., and Deisseroth, K. (2008).
Red-shifted optogenetic excitation: a tool for fast neural control
derived from Volvox carteri. Nat. Neurosci. 11, 631-633.
[0436] Zhao, S., Cunha, C., Zhang, F., Liu, Q., Gloss, B.,
Deisseroth, K., Augustine, G. J., and Feng, G. (2008). Improved
expression of halorhodopsin for light-induced silencing of neuronal
activity. Brain Cell Biol. 36, 141-154.
[0437] All references, publications, and patent applications
disclosed herein are hereby incorporated by reference in their
entirety.
[0438] The various embodiments described above are provided by way
of illustration only and should not be construed to limit the
invention. Based on the above discussion and illustrations, those
skilled in the art will readily recognize that various
modifications and changes may be made to the present invention
without strictly following the exemplary embodiments and
applications illustrated and described herein. For instance, such
changes may include the use of digital logic or microprocessors to
control the emitted light. Such modifications and changes do not
depart from the true spirit and scope of the present invention,
which is set forth in the following claims. As discussed above,
specific applications and background details relative to the
present invention are discussed above, in the description below and
throughout the references cited herein. The embodiments in the
Appendices may be implemented in connection with one or more of the
above-described embodiments and implementations, as well as with
those shown in the figures and described below. Reference may be
made to the Appendices (A, B and C) which were filed in the
underlying provisional application and incorporated herein by
reference.
Sequence CWU 1
1
71223PRTArtificial SequenceDerived from Guillardia theta 1Ala Ser
Ser Phe Gly Lys Ala Leu Leu Glu Phe Val Phe Ile Val Phe 1 5 10 15
Ala Cys Ile Thr Leu Leu Leu Gly Ile Asn Ala Ala Lys Ser Lys Ala 20
25 30 Ala Ser Arg Val Leu Phe Pro Ala Thr Phe Val Thr Gly Ile Ala
Ser 35 40 45 Ile Ala Tyr Phe Ser Met Ala Ser Gly Gly Gly Trp Val
Ile Ala Pro 50 55 60 Asp Cys Arg Gln Leu Phe Val Ala Arg Tyr Leu
Asp Trp Leu Ile Thr 65 70 75 80 Thr Pro Leu Leu Leu Ile Asp Leu Gly
Leu Val Ala Gly Val Ser Arg 85 90 95 Trp Asp Ile Met Ala Leu Cys
Leu Ser Asp Val Leu Met Ile Ala Thr 100 105 110 Gly Ala Phe Gly Ser
Leu Thr Val Gly Asn Val Lys Trp Val Trp Trp 115 120 125 Phe Phe Gly
Met Cys Trp Phe Leu His Ile Ile Phe Ala Leu Gly Lys 130 135 140 Ser
Trp Ala Glu Ala Ala Lys Ala Lys Gly Gly Asp Ser Ala Ser Val 145 150
155 160 Tyr Ser Lys Ile Ala Gly Ile Thr Val Ile Thr Trp Phe Cys Tyr
Pro 165 170 175 Val Val Trp Val Phe Ala Glu Gly Phe Gly Asn Phe Ser
Val Thr Phe 180 185 190 Glu Val Leu Ile Tyr Gly Val Leu Asp Val Ile
Ser Lys Ala Val Phe 195 200 205 Gly Leu Ile Leu Met Ser Gly Ala Ala
Thr Gly Tyr Glu Ser Ile 210 215 220 2365PRTArtificial
SequenceDerived from Dunaliella salina 2Met Arg Arg Arg Glu Ser Gln
Leu Ala Tyr Leu Cys Leu Phe Val Leu 1 5 10 15 Ile Ala Gly Trp Ala
Pro Arg Leu Thr Glu Ser Ala Pro Asp Leu Ala 20 25 30 Glu Arg Arg
Pro Pro Ser Glu Arg Asn Thr Pro Tyr Ala Asn Ile Lys 35 40 45 Lys
Val Pro Asn Ile Thr Glu Pro Asn Ala Asn Val Gln Leu Asp Gly 50 55
60 Trp Ala Leu Tyr Gln Asp Phe Tyr Tyr Leu Ala Gly Ser Asp Lys Glu
65 70 75 80 Trp Val Val Gly Pro Ser Asp Gln Cys Tyr Cys Arg Ala Trp
Ser Lys 85 90 95 Ser His Gly Thr Asp Arg Glu Gly Glu Ala Ala Val
Val Trp Ala Tyr 100 105 110 Ile Val Phe Ala Ile Cys Ile Val Gln Leu
Val Tyr Phe Met Phe Ala 115 120 125 Ala Trp Lys Ala Thr Val Gly Trp
Glu Glu Val Tyr Val Asn Ile Ile 130 135 140 Glu Leu Val His Ile Ala
Leu Val Ile Trp Val Glu Phe Asp Lys Pro 145 150 155 160 Ala Met Leu
Tyr Leu Asn Asp Gly Gln Met Val Pro Trp Leu Arg Tyr 165 170 175 Ser
Ala Trp Leu Leu Ser Cys Pro Val Ile Leu Ile His Leu Ser Asn 180 185
190 Leu Thr Gly Leu Lys Gly Asp Tyr Ser Lys Arg Thr Met Gly Leu Leu
195 200 205 Val Ser Asp Ile Gly Thr Ile Val Phe Gly Thr Ser Ala Ala
Leu Ala 210 215 220 Pro Pro Asn His Val Lys Val Ile Leu Phe Thr Ile
Gly Leu Leu Tyr 225 230 235 240 Gly Leu Phe Thr Phe Phe Thr Ala Ala
Lys Val Tyr Ile Glu Ala Tyr 245 250 255 His Thr Val Pro Lys Gly Gln
Cys Arg Asn Leu Val Arg Ala Met Ala 260 265 270 Trp Thr Tyr Phe Val
Ser Trp Ala Met Phe Pro Ile Leu Phe Ile Leu 275 280 285 Gly Arg Glu
Gly Phe Gly His Ile Thr Tyr Phe Gly Ser Ser Ile Gly 290 295 300 His
Phe Ile Leu Glu Ile Phe Ser Lys Asn Leu Trp Ser Leu Leu Gly 305 310
315 320 His Gly Leu Arg Tyr Arg Ile Arg Gln His Ile Ile Ile His Gly
Asn 325 330 335 Leu Thr Lys Lys Asn Lys Ile Asn Ile Ala Gly Asp Asn
Val Glu Val 340 345 350 Glu Glu Tyr Val Asp Ser Asn Asp Lys Asp Ser
Asp Val 355 360 365 3291PRTArtificial SequenceDerived from
Natronomonas pharaonis 3Met Thr Glu Thr Leu Pro Pro Val Thr Glu Ser
Ala Val Ala Leu Gln 1 5 10 15 Ala Glu Val Thr Gln Arg Glu Leu Phe
Glu Phe Val Leu Asn Asp Pro 20 25 30 Leu Leu Ala Ser Ser Leu Tyr
Ile Asn Ile Ala Leu Ala Gly Leu Ser 35 40 45 Ile Leu Leu Phe Val
Phe Met Thr Arg Gly Leu Asp Asp Pro Arg Ala 50 55 60 Lys Leu Ile
Ala Val Ser Thr Ile Leu Val Pro Val Val Ser Ile Ala 65 70 75 80 Ser
Tyr Thr Gly Leu Ala Ser Gly Leu Thr Ile Ser Val Leu Glu Met 85 90
95 Pro Ala Gly His Phe Ala Glu Gly Ser Ser Val Met Leu Gly Gly Glu
100 105 110 Glu Val Asp Gly Val Val Thr Met Trp Gly Arg Tyr Leu Thr
Trp Ala 115 120 125 Leu Ser Thr Pro Met Ile Leu Leu Ala Leu Gly Leu
Leu Ala Gly Ser 130 135 140 Asn Ala Thr Lys Leu Phe Thr Ala Ile Thr
Phe Asp Ile Ala Met Cys 145 150 155 160 Val Thr Gly Leu Ala Ala Ala
Leu Thr Thr Ser Ser His Leu Met Arg 165 170 175 Trp Phe Trp Tyr Ala
Ile Ser Cys Ala Cys Phe Leu Val Val Leu Tyr 180 185 190 Ile Leu Leu
Val Glu Trp Ala Gln Asp Ala Lys Ala Ala Gly Thr Ala 195 200 205 Asp
Met Phe Asn Thr Leu Lys Leu Leu Thr Val Val Met Trp Leu Gly 210 215
220 Tyr Pro Ile Val Trp Ala Leu Gly Val Glu Gly Ile Ala Val Leu Pro
225 230 235 240 Val Gly Val Thr Ser Trp Gly Tyr Ser Phe Leu Asp Ile
Val Ala Lys 245 250 255 Tyr Ile Phe Ala Phe Leu Leu Leu Asn Tyr Leu
Thr Ser Asn Glu Ser 260 265 270 Val Val Ser Gly Ser Ile Leu Asp Val
Pro Ser Ala Ser Gly Thr Pro 275 280 285 Ala Asp Asp 290
4262PRTArtificial Sequencelight-driven proton pump 4Met Leu Glu Leu
Leu Pro Thr Ala Val Glu Gly Val Ser Gln Ala Gln 1 5 10 15 Ile Thr
Gly Arg Pro Glu Trp Ile Trp Leu Ala Leu Gly Thr Ala Leu 20 25 30
Met Gly Leu Gly Thr Leu Tyr Phe Leu Val Lys Gly Met Gly Val Ser 35
40 45 Asp Pro Asp Ala Lys Lys Phe Tyr Ala Ile Thr Thr Leu Val Pro
Ala 50 55 60 Ile Ala Phe Thr Met Tyr Leu Ser Met Leu Leu Gly Tyr
Gly Leu Thr 65 70 75 80 Met Val Pro Phe Gly Gly Glu Gln Asn Pro Ile
Tyr Trp Ala Arg Tyr 85 90 95 Ala Asp Trp Leu Phe Thr Thr Pro Leu
Leu Leu Leu Asp Leu Ala Leu 100 105 110 Leu Val Asp Ala Asp Gln Gly
Thr Ile Leu Ala Leu Val Gly Ala Asp 115 120 125 Gly Ile Met Ile Gly
Thr Gly Leu Val Gly Ala Leu Thr Lys Val Tyr 130 135 140 Ser Tyr Arg
Phe Val Trp Trp Ala Ile Ser Thr Ala Ala Met Leu Tyr 145 150 155 160
Ile Leu Tyr Val Leu Phe Phe Gly Phe Thr Ser Lys Ala Glu Ser Met 165
170 175 Arg Pro Glu Val Ala Ser Thr Phe Lys Val Leu Arg Asn Val Thr
Val 180 185 190 Val Leu Trp Ser Ala Tyr Pro Val Val Trp Leu Ile Gly
Ser Glu Gly 195 200 205 Ala Gly Ile Val Pro Leu Asn Ile Glu Thr Leu
Leu Phe Met Val Leu 210 215 220 Asp Val Ser Ala Lys Val Gly Phe Gly
Leu Ile Leu Leu Arg Ser Arg 225 230 235 240 Ala Ile Phe Gly Glu Ala
Glu Ala Pro Glu Pro Ser Ala Gly Asp Gly 245 250 255 Ala Ala Ala Thr
Ser Asp 260 5270PRTArtificial SequenceGtR3 with signal; derived
from Guillardia theta 5Met Asp Tyr Gly Gly Ala Leu Ser Ala Val Gly
Arg Glu Leu Leu Phe 1 5 10 15 Val Thr Asn Pro Val Val Val Asn Gly
Ser Val Leu Val Pro Glu Asp 20 25 30 Gln Cys Tyr Cys Ala Gly Trp
Ile Glu Ser Arg Gly Thr Asn Gly Ala 35 40 45 Ser Ser Phe Gly Lys
Ala Leu Leu Glu Phe Val Phe Ile Val Phe Ala 50 55 60 Cys Ile Thr
Leu Leu Leu Gly Ile Asn Ala Ala Lys Ser Lys Ala Ala 65 70 75 80 Ser
Arg Val Leu Phe Pro Ala Thr Phe Val Thr Gly Ile Ala Ser Ile 85 90
95 Ala Tyr Phe Ser Met Ala Ser Gly Gly Gly Trp Val Ile Ala Pro Asp
100 105 110 Cys Arg Gln Leu Phe Val Ala Arg Tyr Leu Asp Trp Leu Ile
Thr Thr 115 120 125 Pro Leu Leu Leu Ile Asp Leu Gly Leu Val Ala Gly
Val Ser Arg Trp 130 135 140 Asp Ile Met Ala Leu Cys Leu Ser Asp Val
Leu Met Ile Ala Thr Gly 145 150 155 160 Ala Phe Gly Ser Leu Thr Val
Gly Asn Val Lys Trp Val Trp Trp Phe 165 170 175 Phe Gly Met Cys Trp
Phe Leu His Ile Ile Phe Ala Leu Gly Lys Ser 180 185 190 Trp Ala Glu
Ala Ala Lys Ala Lys Gly Gly Asp Ser Ala Ser Val Tyr 195 200 205 Ser
Lys Ile Ala Gly Ile Thr Val Ile Thr Trp Phe Cys Tyr Pro Val 210 215
220 Val Trp Val Phe Ala Glu Gly Phe Gly Asn Phe Ser Val Thr Phe Glu
225 230 235 240 Val Leu Ile Tyr Gly Val Leu Asp Val Ile Ser Lys Ala
Val Phe Gly 245 250 255 Leu Ile Leu Met Ser Gly Ala Ala Thr Gly Tyr
Glu Ser Ile 260 265 270 6810DNAArtificial SequenceDerived from
Guillardia theta 6atggactacg gaggagcact gtctgctgtg ggccgtgaat
tactctttgt gaccaatcca 60gtcgttgtaa atgggagcgt cctggtgccg gaggatcaat
gctactgcgc cggttggatt 120gaaagcagag gcacgaatgg ggcctcatcc
ttcggcaagg ccctactgga gtttgtcttc 180atcgtcttcg cgtgtatcac
attactgttg ggaattaacg ctgcgaaatc aaaggctgca 240tctagggtgc
tgtttcccgc tactttcgtc actggaatcg caagtatcgc atatttttcc
300atggcaagcg gcggcgggtg ggtgattgcc cctgactgtc ggcagctctt
tgtggcccgc 360tatctggact ggctcattac tacaccactt ctactcatag
atttgggtct ggttgcaggg 420gtcagtcggt gggatataat ggccctctgc
ctgtctgatg tcctgatgat tgctacgggt 480gctttcggga gcctgacagt
gggtaacgtg aagtgggtgt ggtggttctt tggaatgtgt 540tggtttcttc
acataatctt cgcgcttggg aaaagttggg cagaagcagc caaggccaag
600ggcggcgact ctgcttctgt gtactccaaa atcgccggca tcaccgtgat
tacatggttc 660tgttatcccg tggtatgggt cttcgctgag ggcttcggaa
acttttccgt aaccttcgaa 720gttctcatct atggagtgtt ggatgttatt
tcaaaggccg tttttggcct tatactgatg 780tcaggggccg ccaccggata
cgagtccatt 81071095DNAArtificial SequenceDerived from Dunaliella
salina 7atgcgtagaa gggagtctca gctcgcatac ctttgcctgt tcgttttgat
cgctggctgg 60gccccacgtc tgactgaaag cgcccctgat ctagccgagc ggcggcctcc
ctccgagcga 120aacacccctt acgccaatat taaaaaggtg cccaatataa
ctgaacccaa cgccaatgtg 180caacttgatg ggtgggctct gtaccaggat
ttttactacc tggctggttc agataaggaa 240tgggtcgttg gccctagcga
ccagtgttac tgccgagcat ggtctaaatc acacggcacc 300gacagagagg
gcgaggcggc tgtggtgtgg gcgtacatcg tattcgccat ttgtatcgta
360caactggttt atttcatgtt tgccgcttgg aaggcaacgg tcggatggga
ggaagtctac 420gtgaacatca ttgagctggt gcacattgcc ctggtgattt
gggtcgagtt cgataaaccc 480gccatgctct accttaacga cggtcagatg
gttccatggt tgcgctatag tgcatggctc 540ctttcctgcc cagtcatcct
aattcacctg agcaacttaa cagggctaaa gggggactat 600agtaagagaa
ccatggggct tttggtctct gacatcggaa ccatagtgtt tggtacaagc
660gccgcactcg ctccgccaaa ccatgtcaaa gtcatcttat ttacaattgg
gttgctgtat 720ggactcttca cttttttcac ggcagcgaag gtatatattg
aggcctacca caccgttcca 780aaaggccaat gtagaaacct cgtgagggct
atggcctgga cttatttcgt aagttgggcg 840atgttcccca tcctgtttat
cctgggaaga gagggttttg gccatattac atattttggc 900tcatccatcg
gacacttcat actggagata ttttcaaaaa atctgtggag tctactgggc
960cacggattac ggtatcgcat aaggcagcat atcatcattc atggcaattt
gacaaagaag 1020aataagatta atatcgcagg ggacaacgtc gaagtggaag
agtacgtgga ttctaacgac 1080aaggacagcg acgtt 1095
* * * * *
References