U.S. patent application number 15/470576 was filed with the patent office on 2017-07-13 for methods for identification of sites for igg conjugation.
This patent application is currently assigned to Novartis AG. The applicant listed for this patent is Massachusetts Institute of Technology, Novartis AG. Invention is credited to Naresh CHENNAMSETTY, Bernhard HELK, Veysel KAYSER, Bernhardt TROUT, Vladimir VOYNOV.
Application Number | 20170198007 15/470576 |
Document ID | / |
Family ID | 42562878 |
Filed Date | 2017-07-13 |
United States Patent
Application |
20170198007 |
Kind Code |
A1 |
CHENNAMSETTY; Naresh ; et
al. |
July 13, 2017 |
METHODS FOR IDENTIFICATION OF SITES FOR IGG CONJUGATION
Abstract
The present disclosure relates to immunoglobulins and
immunoglobulin conjugates with reduced oligomerization and
efficient labeling and compositions, methods of generating such
immunoglobulins and immunoglobulin conjugates and methods of using
such immunoglobulin conjugates particularly in the treatment and
prevention of disease.
Inventors: |
CHENNAMSETTY; Naresh;
(Cambridge, MA) ; HELK; Bernhard; (Basel, CH)
; KAYSER; Veysel; (Cambridge, MA) ; TROUT;
Bernhardt; (Cambridge, MA) ; VOYNOV; Vladimir;
(Cambridge, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Novartis AG
Massachusetts Institute of Technology |
Basel
Cambridge |
MA |
CH
US |
|
|
Assignee: |
Novartis AG
Basel
MA
Massachusetts Institute of Technology
Cambridge
|
Family ID: |
42562878 |
Appl. No.: |
15/470576 |
Filed: |
March 27, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14449975 |
Aug 1, 2014 |
9629925 |
|
|
15470576 |
|
|
|
|
13375466 |
Feb 27, 2012 |
8834885 |
|
|
PCT/US2010/037517 |
Jun 4, 2010 |
|
|
|
14449975 |
|
|
|
|
61184084 |
Jun 4, 2009 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 1/16 20180101; C07K
2317/524 20130101; A61K 49/0058 20130101; A61P 3/14 20180101; C07K
2317/567 20130101; A61K 51/1093 20130101; A61P 9/10 20180101; A61P
1/02 20180101; A61P 7/00 20180101; A61P 17/00 20180101; A61P 9/04
20180101; A61P 27/02 20180101; A61P 43/00 20180101; A61P 19/02
20180101; A61P 29/00 20180101; A61P 27/06 20180101; C07K 2317/522
20130101; A61P 25/28 20180101; A61P 35/00 20180101; A61P 1/04
20180101; A61P 3/06 20180101; A61P 37/02 20180101; A61P 19/10
20180101; C07K 16/00 20130101; C07K 2317/56 20130101; A61K 47/6817
20170801; A61P 3/02 20180101; A61P 5/38 20180101; G01N 33/582
20130101; A61P 31/12 20180101; A61K 47/6835 20170801; A61P 19/08
20180101; A61P 25/00 20180101; A61P 31/04 20180101; A61P 31/18
20180101; A61P 35/04 20180101; A61P 35/02 20180101; A61P 37/06
20180101; A61P 3/10 20180101; A61K 47/6803 20170801; C07K 1/13
20130101; A61P 15/00 20180101; A61P 17/06 20180101; A61P 17/10
20180101; C07K 2317/526 20130101 |
International
Class: |
C07K 1/13 20060101
C07K001/13; G01N 33/58 20060101 G01N033/58; C07K 16/00 20060101
C07K016/00; A61K 51/10 20060101 A61K051/10; A61K 49/00 20060101
A61K049/00 |
Claims
1. (canceled)
2: An immunoglobulin conjugate, comprising A) an immunoglobulin
having a mutation at a residue selected from the group consisting
of 25(V.sub.H), 125(C.sub.H1), 248(C.sub.H2), 254(C.sub.H2),
286(C.sub.H2), and 326(C.sub.H2), wherein the residue numbering for
the immunoglobulin is according to Kabat numbering, wherein the
mutation is a substitution with a cysteine residue, and B) an atom
or molecule, wherein the atom or molecule is conjugated to the
cysteine residue.
3: The immunoglobulin conjugate of claim 2, further comprising a
linker molecule having at least two reactive sites, wherein a first
reactive site is bound to the cysteine residue of the
immunoglobulin and a second reactive site is bound to the atom or
molecule.
4: The immunoglobulin conjugate of claim 3, wherein the linker
molecule is selected from the group consisting of a hydrazone, a
peptide, a chelating agent, and a maleimide.
5: The immunoglobulin conjugate of claim 3, wherein the linker
molecule forms a disulfide linkage with the cysteine residue.
6: The immunoglobulin conjugate of claim 2, wherein the atom or
molecule is selected from the group consisting of a radionuclide, a
chemotherapeutic agent, a microbial toxin, a plant toxin, a
polymer, a carbohydrate, a cytokine, a fluorescent label, a
luminescent label, an enzyme-substrate label, an enzyme, a peptide,
a peptidomimetic, a nucleotide, an siRNA, a microRNA, an RNA
mimetic, and an aptamer.
7: The immunoglobulin conjugate of claim 2, wherein the atom or
molecule is selected from the group consisting of .sup.90Y,
.sup.131I, .sup.67Cu, .sup.177Lu, .sup.213Bi, .sup.211At, a
calicheamicin, a duocarmycin, a maytanisoid, an auristatin, an
anthracyclin, Pseudomonas exotoxin A, Diphtheria toxin, ricin,
polyethylene glycol, hydroxyethyl starch, and a mannosyl
residue.
8: A modified or isolated immunoglobulin comprising a mutation at a
residue selected from the group consisting of 25(V.sub.H),
125(C.sub.H1), 248(C.sub.H2), 254(C.sub.H2), 286(C.sub.H2), and
326(C.sub.H2), wherein the residue numbering for the immunoglobulin
is according to Kabat numbering, wherein the mutation is a
substitution with a cysteine residue.
9: An isolated or recombinant polynucleotide encoding the
immunoglobulin of claim 8.
10: A vector comprising the polynucleotide of claim 9 operably
linked to an inducible promoter.
11: A host cell comprising the vector of claim 10.
12: A method of producing an immunoglobulin, comprising: (a)
providing a culture medium comprising the host cell of claim 11;
and (b) placing the culture medium in conditions under which the
immunoglobulin is expressed.
13: A method of producing an immunoglobulin conjugate, comprising:
(a) providing the immunoglobulin of claim 8; (b) reducing the one
or more substituted cysteine residues with a reducing agent to form
reduced cysteine residues; and (c) incubating the immunoglobulin
with an atom or molecule, wherein the atom or molecule is reactive
with the reduced cysteine residues, to form an immunoglobulin
conjugate.
14: A method for reducing the cross-linking between surface-exposed
cysteines of an immunoglobulin in a highly concentrated
pharmaceutical formulation of immunoglobulin conjugates,
comprising: (a) providing an immunoglobulin; (b) substituting a
residue selected from the group consisting of 25(V.sub.H),
125(C.sub.H1), 248(C.sub.H2), 254(C.sub.H2), 286(C.sub.H2), and
326(C.sub.H2) with a cysteine residue, wherein the residue
numbering for the immunoglobulin is according to Kabat numbering,
(c) reducing the one or more substituted cysteine residues with a
reducing agent to form reduced cysteine residues; (d) incubating
the immunoglobulin with an atom or molecule, wherein the molecule
is reactive with the reduced cysteine residues, to form an
immunoglobulin conjugate; and (e) generating a highly concentrated,
liquid formulation of the immunoglobulin conjugate wherein the
immunoglobulin conjugate concentration is at least 20 mg/ml, at
least 30 mg/ml, at least 40 mg/ml, at least 50 mg/ml, at least 75
mg/ml, at least 100 mg/ml, at least 125 mg/ml, or at least 150
mg/ml.
15: The method of claim 14, wherein the immunoglobulin conjugate
comprises an antigen binding activity and the activity is at least
eighty percent, at least ninety percent, at least one hundred
percent, at least one hundred ten percent, at least one hundred
twenty percent, or at least one hundred thirty percent of the
antigen binding activity of the unmutated immunoglobulin.
16: A pharmaceutical composition comprising the immunoglobulin
conjugate of claim 2 and a pharmaceutically acceptable excipient,
wherein at least eighty percent, at least eighty-five percent, at
least ninety percent, at least ninety-five percent, at least
ninety-six percent, at least ninety-seven percent, at least
ninety-eight percent, or at least ninety-nine percent of the
immunoglobulin conjugate is non-oligomerized monomer.
17: The pharmaceutical composition of claim 16, wherein the
immunoglobulin conjugate is at a concentration of at least 10
mg/ml, at least 20 mg/ml, at least 30 mg/ml, at least 40 mg/ml, at
least 50 mg/ml, at least 75 mg/ml, at least 100 mg/ml, at least 125
mg/ml, or at least 150 mg/ml.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a Divisional of U.S. patent application
Ser. No. 14/449,975, filed Aug. 1, 2014; which is a Divisional of
U.S. patent application Ser. No. 13/375,466, claiming an
international filing date of Jun. 4, 2010, now issued as U.S. Pat.
No. 8,834,885; which is a U.S. National Phase of International
Patent Application No. PCT/US2010/037517, filed Jun. 4, 2010; which
claims the benefit of U.S. Provisional Patent Application No.
61/184,084, filed Jun. 4, 2009; all of which are hereby
incorporated by reference in the present disclosure in their
entirety.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0002] The content of the following submission on ASCII text file
is incorporated herein by reference in its entirety: a computer
readable form (CRF) of the Sequence Listing (file name:
619672000211SEQLIST.TXT, date recorded: Jan. 27, 2017, size: 15
KB).
FIELD OF THE INVENTION
[0003] The present disclosure relates to improved immunoglobulins
and immunoglobulin conjugates.
BACKGROUND
[0004] Monoclonal antibodies are of great laboratory and
therapeutic use. Antibody derivatives with engineered site-specific
fluorescence or binding properties have been developed and used for
many years. More recently, antibodies have been also developed as
therapeutic agents, currently presenting the fastest growing class
of pharmaceuticals [1]. Antibodies are multidomain proteins of two
light and two heavy chains held together by disulfide bonds. The
variable regions specify binding to a particular antigen, and part
of the constant regions is responsible for effector functions via
binding to Fc receptors on the surface of immune cells. Because of
their potential in the cure of various diseases, antibodies
currently constitute the most rapidly growing class of human
therapeutics (Carter. Nature Reviews Immunology. 2006, 6(5), 343).
Since 2001, their market has been growing at an average yearly
growth rate of 35%, the highest rate among all categories of
biotech drugs (S. Aggarwal. Nature. BioTech. 2007, 25 (10)
1097).
[0005] Engineering of antibody conjugates has further increased the
versatility of antibody applications. In many laboratory
techniques, enzymes or fluorescent probes are conjugated to
antibodies to carry out an assay function, for example quantitation
of antigen abundance. In cases of targeted therapy, toxic small
molecules are attached to antibodies that specifically bind
biomarkers on diseased cells [2-4]. Various approaches to antibody
conjugation have been pursued, for example attachment to surface
lysines [5], to Fc carbohydrates [6], or to partially reduced
interchain disulfides [7].
[0006] Antibody conjugation to engineered surface cysteine remains
a very attractive option because most antibodies do not have
cysteines other than the ones consumed in intra- and inter-chain
disulfide bonds. Small molecules can be attached at the specific
site of cysteine substitution via a thiol reactive chemistry such
as maleimides [8-14]. Engineering in the C.sub.H1 and C.sub.H3
domains has been favored to avoid interference with antigen binding
of the variable regions and effector function of C.sub.H2.
Different criteria for successful antibody conjugation via
engineered cysteines have been considered. For example, the
antibody domain in which to carry out mutation, the exposure of the
mutated site, the amino acid to be substituted are several of the
variables to take into account. A high throughput screening
approach to identifying sites suitable for cysteine engineering and
conjugation has been developed [15]. Two of the most common
problems associated with antibody cysteine variants are
oligomerization and poor labeling. Yet, there is no universal tool
for predicting whether an antibody cysteine variant will be stable
and efficiently conjugated. Furthermore, cysteine variants
currently exist only for the C.sub.L, C.sub.H1 and C.sub.H3 domains
[8, 9, 11, 12, 15].
[0007] Thus, there is a need for additional immunoglobulin cysteine
variants that can be used in the generation of stable
immunoglobulin conjugates.
SUMMARY
[0008] Described herein are improved immunoglobulins and
immunoglobulin conjugates which exhibit reduced cross-linking that
meet this need.
[0009] Thus one aspect includes an immunoglobulin conjugate
comprising an immunoglobulin having at least one mutation at a
residue selected from the group consisting of 7(V.sub.H),
20(V.sub.L), 22(V.sub.L), 25(V.sub.H), 125(C.sub.H1),
248(C.sub.H2), 254(C.sub.H2), 286(C.sub.H2), 298(C.sub.H2), and
326(C.sub.H2), wherein the at least one mutation is a substitution
with a cysteine residue, and an atom or molecule, wherein the atom
or molecule is conjugated to the cysteine residue. In certain
embodiments, the at least one mutation is at a residue selected
from the group consisting of 7(V.sub.H), 20(V.sub.L), 22(V.sub.L)
and 125(C.sub.H1). In certain embodiments, the at least one
mutation is at a residue selected from the group consisting of
248(C.sub.H2) and 326(C.sub.H2). In certain embodiments, the at
least one mutation is at a residue selected from the group
consisting of 25(V.sub.H) and 286(C.sub.H2). In certain
embodiments, the at least one mutation is at residue selected from
the group consisting of 254(C.sub.H2) and 298(V.sub.H). In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin is selected from the group comprising IgG1,
IgG2, IgG3, and IgG4. In certain embodiments that may be combined
with the preceding embodiments, the immunoglobulin comprises an
IgG1. In certain embodiments that may be combined with the
preceding embodiments, the immunoglobulin conjugate comprises a
human C.sub.H1 domain. In certain embodiments that may be combined
with the preceding embodiments, the immunoglobulin conjugate
comprises a human C.sub.H2 domain. In certain embodiments that may
be combined with the preceding embodiments, the immunoglobulin
conjugate comprises a human C.sub.H3 domain. In certain embodiments
that may be combined with the preceding embodiments, the
immunoglobulin conjugate comprises a human C.sub.L domain. In
certain embodiments that may be combined with the preceding
embodiments, the immunoglobulin conjugate comprises a human V.sub.H
domain. In certain embodiments that may be combined with the
preceding embodiments, the immunoglobulin conjugate comprises a
human V.sub.L domain. In certain embodiments that may be combined
with the preceding embodiments, the immunoglobulin conjugate
further comprises a linker molecule having at least two reactive
sites, wherein a first reactive site is bound to the cysteine
residue of the immunoglobulin and a second reactive site is bound
to the atom or molecule. In certain embodiments that may be
combined with the preceding embodiments having a linker molecule,
the linker molecule is selected from the group consisting of a
hydrazone, a disulfide, a peptide, a chelating agent, and a
maleimide. In certain embodiments that may be combined with the
preceding embodiments, the atom or molecule is selected from the
group consisting of a radionuclide, a chemotherapeutic agent, a
microbial toxin, a plant toxin, a polymer, a carbohydrate, a
cytokine, a fluorescent label, a luminescent label, an
enzyme-substrate label, an enzyme, a peptide, a peptidomimetic, a
nucleotide, an siRNA, a microRNA, an RNA mimetic, and an aptamer.
In certain embodiments that may be combined with the preceding
embodiments, the atom or molecule is selected from the group
consisting of .sup.90Y, .sup.131I, .sup.67Cu, .sup.177Lu,
.sup.213Bi, .sup.211At, a calicheamicin, a duocarmycin, a
maytanisoid, an auristatin, an anthracyclin, Pseudomonas exotoxin
A, Diphtheria toxin, ricin, polyethylene glycol, hydroxyethyl
starch, and a mannosyl residue. In certain embodiments that may be
combined with the preceding embodiments, the atom or molecule
reduces the immunogenicity of the unmutated immunoglobulin. In
certain embodiments that may be combined with the preceding
embodiments, the atom or molecule increases the immunogenicity of
the unmutated immunoglobulin. In certain embodiments that may be
combined with the preceding embodiments, the immunoglobulin
conjugate further comprises an antigen binding activity and the
activity is at least eighty percent, at least ninety percent, at
least one hundred percent, at least one hundred ten percent, at
least one hundred twenty percent, or at least one hundred thirty
percent of the antigen binding activity of the unmutated
immunoglobulin.
[0010] Another aspect includes a modified or isolated
immunoglobulin comprising at least one mutation at a residue
selected from the group consisting of 7(V.sub.H), 20(V.sub.L),
22(V.sub.L), 25(V.sub.H), 125(C.sub.H1), 248(C.sub.H2),
254(C.sub.H2), 286(C.sub.H2), and 326(C.sub.H2), wherein the at
least one mutation is a substitution with a cysteine residue. In
certain embodiments, the at least one mutation is at a residue
selected from the group consisting of 7(V.sub.H), 20(V.sub.L),
22(V.sub.L) and 125(C.sub.H1). In certain embodiments, the at least
one mutation is at a residue selected from the group consisting of
248(C.sub.H2) and 326(C.sub.H2). In certain embodiments, the at
least one mutation is at a residue selected from the group
consisting of 25(V.sub.H) and 286(C.sub.H2). In certain
embodiments, the at least one mutation is at residue 254(C.sub.H2).
In certain embodiments that may be combined with the preceding
embodiments, the immunoglobulin is selected from the group
comprising IgG1, IgG2, IgG3, and IgG4. In certain embodiments that
may be combined with the preceding embodiments, the immunoglobulin
comprises an IgG1. In certain embodiments that may be combined with
the preceding embodiments, the modified or isolated immunoglobulin
comprises a human C.sub.H1 domain. In certain embodiments that may
be combined with the preceding embodiments, the modified or
isolated immunoglobulin comprises a human C.sub.H2 domain. In
certain embodiments that may be combined with the preceding
embodiments, the modified or isolated immunoglobulin comprises a
human C.sub.H3 domain. In certain embodiments that may be combined
with the preceding embodiments, the modified or isolated
immunoglobulin comprises a human C.sub.L domain. In certain
embodiments that may be combined with the preceding embodiments,
the modified or isolated immunoglobulin comprises a human V.sub.H
domain. In certain embodiments that may be combined with the
preceding embodiments, the modified or isolated immunoglobulin
comprises a human V.sub.L domain. In certain embodiments that may
be combined with the preceding embodiments, the immunoglobulin
further comprises an antigen binding activity and the activity is
at least eighty percent, at least ninety percent, at least one
hundred percent, at least one hundred ten percent, at least one
hundred twenty percent, or at least one hundred thirty percent of
the antigen binding activity of the unmutated immunoglobulin.
[0011] Another aspect includes isolated or recombinant
polynucleotides that encode the immunoglobulins of the preceding
modified immunoglobulin aspect and any and all combinations of the
preceding embodiments. In certain embodiments, the polynucleotide
is in a vector. In certain embodiments, the vector is an expression
vector. In certain embodiments that may be combined with the
preceding embodiments, an inducible promoter is operably linked to
the polynucleotide. Another aspect includes host cells with the
vector of either of the preceding embodiments. In certain
embodiments, the host cells are capable of expressing the
immunoglobulin encoded by the polynucleotide.
[0012] Another aspect includes methods of producing an
immunoglobulin comprising providing a culture medium comprising the
host cell of the preceding aspect and placing the culture medium in
conditions under which the immunoglobulin is expressed. In certain
embodiments, the methods include an additional step of isolating
the immunoglobulin expressed.
[0013] Another aspect includes methods of producing an
immunoglobulin conjugate comprising providing the immunoglobulin of
the preceding modified immunoglobulin aspect and any and all
combinations of the preceding embodiments, reducing the one or more
substituted cysteine residues with a reducing agent to form reduced
cysteine residues, and incubating the immunoglobulin with an atom
or molecule, wherein the atom or molecule is reactive with the
reduced cysteine residues, to form an immunoglobulin conjugate.
[0014] Another aspect includes methods for reducing the
cross-linking between surface-exposed cysteines of an
immunoglobulin in a highly concentrated pharmaceutical formulation
of immunoglobulin conjugates comprising providing an
immunoglobulin, substituting a residue selected from the group
consisting of 7(V.sub.H), 20(V.sub.L), 22(V.sub.L), and
125(C.sub.H1) with a cysteine residue, reducing the one or more
substituted cysteine residues with a reducing agent to form reduced
cysteine residues, incubating the immunoglobulin with an atom or
molecule, wherein the molecule is reactive with the reduced
cysteine residues, to form an immunoglobulin conjugate, and
generating a highly concentrated, liquid formulation of the
immunoglobulin conjugate wherein the immunoglobulin conjugate
concentration is at least 20 mg/ml, at least 30 mg/ml, at least 40
mg/ml, at least 50 mg/ml, at least 75 mg/ml, at least 100 mg/ml, at
least 125 mg/ml, or at least 150 mg/ml. In certain embodiments, the
immunoglobulin is selected from the group comprising IgG1, IgG2,
IgG3, and IgG4. In certain embodiments, the immunoglobulin
comprises an IgG1. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin comprises a human
C.sub.H1 domain. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin comprises a human
C.sub.H2 domain. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin comprises a human
C.sub.H3 domain. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin comprises a human
C.sub.L domain. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin comprises a human
V.sub.H domain. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin comprises a human
V.sub.L domain. In certain embodiments that may be combined with
the preceding embodiments, the immunoglobulin conjugate comprises
an antigen binding activity and the activity is at least eighty
percent, at least ninety percent, at least one hundred percent, at
least one hundred ten percent, at least one hundred twenty percent,
or at least one hundred thirty percent of the antigen binding
activity of the unmutated immunoglobulin.
[0015] Another aspect includes uses of the preceding immunoglobulin
conjugate aspect and any and all combinations of the preceding
embodiments in the preparation of a medicament comprising a highly
concentrated liquid formulation wherein the immunoglobulin
conjugate is at least 20 mg/ml, at least 30 mg/ml, at least 40
mg/ml, at least 50 mg/ml, at least 75 mg/ml, at least 100 mg/ml, at
least 125 mg/ml, or at least 150 mg/ml. In certain embodiments, the
use of the medicament is for the treatment of autoimmune diseases,
immunological diseases, infectious diseases, inflammatory diseases,
neurological diseases, and oncological and neoplastic diseases
including cancer. In certain embodiments, the use of the medicament
is for the treatment of congestive heart failure (CHF), vasculitis,
rosacea, acne, eczema, myocarditis and other conditions of the
myocardium, systemic lupus erythematosus, diabetes,
spondylopathies, synovial fibroblasts, and bone marrow stroma; bone
loss; Paget's disease, osteoclastoma; breast cancer; disuse
osteopenia; malnutrition, periodontal disease, Gaucher's disease,
Langerhans' cell histiocytosis, spinal cord injury, acute septic
arthritis, osteomalacia, Cushing's syndrome, monoostotic fibrous
dysplasia, polyostotic fibrous dysplasia, periodontal
reconstruction, and bone fractures; sarcoidosis; osteolytic bone
cancers, breast cancer, lung cancer, kidney cancer and rectal
cancer; bone metastasis, bone pain management, and humoral
malignant hypercalcemia, ankylosing spondylitisa and other
spondyloarthropathies; transplantation rejection, viral infections,
hematologic neoplasias and neoplastic-like conditions for example,
Hodgkin's lymphoma; non-Hodgkin's lymphomas (Burkitt's lymphoma,
small lymphocytic lymphoma/chronic lymphocytic leukemia, mycosis
fungoides, mantle cell lymphoma, follicular lymphoma, diffuse large
B-cell lymphoma, marginal zone lymphoma, hairy cell leukemia and
lymphoplamacytic leukemia), tumors of lymphocyte precursor cells,
including B-cell acute lymphoblastic leukemia/lymphoma, and T-cell
acute lymphoblastic leukemia/lymphoma, thymoma, tumors of the
mature T and NK cells, including peripheral T-cell leukemias, adult
T-cell leukemia/T-cell lymphomas and large granular lymphocytic
leukemia, Langerhans cell histocytosis, myeloid neoplasias such as
acute myelogenous leukemias, including AML with maturation, AML
without differentiation, acute promyelocytic leukemia, acute
myelomonocytic leukemia, and acute monocytic leukemias,
myelodysplastic syndromes, and chronic myeloproliferative
disorders, including chronic myelogenous leukemia, tumors of the
central nervous system, e.g., brain tumors (glioma, neuroblastoma,
astrocytoma, medulloblastoma, ependymoma, and retinoblastoma),
solid tumors (nasopharyngeal cancer, basal cell carcinoma,
pancreatic cancer, cancer of the bile duct, Kaposi's sarcoma,
testicular cancer, uterine, vaginal or cervical cancers, ovarian
cancer, primary liver cancer or endometrial cancer, and tumors of
the vascular system (angiosarcoma and hemangiopericytoma),
osteoporosis, hepatitis, HIV, AIDS, spondylarthritis, rheumatoid
arthritis, inflammatory bowel diseases (IBD), sepsis and septic
shock, Crohn's Disease, psoriasis, schleraderma, graft versus host
disease (GVHD), allogenic islet graft rejection, hematologic
malignancies, such as multiple myeloma (MM), myelodysplastic
syndrome (MDS) and acute myelogenous leukemia (AML), inflammation
associated with tumors, peripheral nerve injury or demyelinating
diseases. In certain embodiments, the use of the medicament is for
the treatment of plaque psoriasis, ulcerative colitis,
non-Hodgkin's lymphoma, breast cancer, colorectal cancer, juvenile
idiopathic arthritis, macular degeneration, respiratory syncytial
virus, Crohn's disease, rheumatoid arthritis, psoriatic arthritis,
ankylosing spondylitis, osteoporosis, treatment-induced bone loss,
bone metastases, multiple myeloma, Alzheimer's disease, glaucoma,
and multiple sclerosis. In certain embodiments that may be combined
with the preceding embodiments, the medicament further comprises a
pharmaceutically acceptable excipient. In certain embodiments that
may be combined with the preceding embodiments, the formulation
comprises at least eighty percent, at least eighty-five percent, at
least ninety percent, at least ninety-five percent, at least
ninety-six percent, at least ninety-seven percent, at least
ninety-eight percent, or at least ninety-nine percent of the
immunoglobulin conjugate is non-oligomerized monomer. In certain
embodiments, the percentage of monomers is measured by non-reducing
SDS-PAGE analysis.
[0016] Another aspect includes uses of the preceding immunoglobulin
conjugate aspect and any and all combinations of the preceding
embodiments as a non-oligomerizing pharmaceutical active
ingredient.
[0017] Another aspect includes uses of the preceding immunoglobulin
conjugate aspect and any and all combinations of the preceding
embodiments as a diagnostic tool.
[0018] Another aspect includes uses of the preceding immunoglobulin
conjugate aspect and any and all combinations of the preceding
embodiments as a standard for high molecular weight proteins.
Another aspect includes uses of an immunoglobulin conjugate as a
standard for high molecular weight proteins, wherein the
immunoglobulin conjugate comprises an immunoglobulin having at
least one mutation at residue 440(C.sub.H3), wherein the at least
one mutation is a substitution with a cysteine residue, and an atom
or molecule, wherein the atom or molecule is conjugated to the
cysteine residue.
[0019] Another aspect includes pharmaceutical compositions that
include an immunoglobulin conjugate of the preceding immunoglobulin
conjugate aspect and any and all combinations of the preceding
embodiments and a pharmaceutically acceptable excipient. In certain
embodiments, the immunoglobulin conjugate is at a concentration of
at least 10 mg/ml, at least 20 mg/ml, at least 30 mg/ml, at least
40 mg/ml, at least 50 mg/ml, at least 75 mg/ml, at least 100 mg/ml,
at least 125 mg/ml, or at least 150 mg/ml. In certain embodiments
that may be combined with the preceding embodiments, at least
eighty percent, at least eighty-five percent, at least ninety
percent, at least ninety-five percent, at least ninety-six percent,
at least ninety-seven percent, at least ninety-eight percent, or at
least ninety-nine percent of the immunoglobulin conjugate is
non-oligomerized monomer.
[0020] Another aspect includes methods for selecting a residue of
an immunoglobulin for mutation to cysteine comprising calculating
the Spatial-Aggregation-Propensity of a first amino acid residue on
the surface of the immunoglobulin, calculating the
Spatial-Aggregation-Propensities of a plurality of residues of the
immunoglobulin within immediate proximity of the first residue, and
selecting the first amino acid residue for mutation to cysteine if
the Spatial-Aggregation-Propensity of the first amino acid residue
is equal to or in between the values of 0 and -0.11 and if the
plurality of residues have Spatial-Aggregation-Propensities of less
than 0. In certain embodiments, the plurality of residues is within
15 .ANG. of the first residue. In certain embodiments, the
plurality of residues is within 10 .ANG. of the first residue. In
certain embodiments, the plurality of residues is within 7.5 .ANG.
of the first residue. In certain embodiments, the plurality of
residues is within 5 .ANG. of the first residue. In certain
embodiments that may be combined with the preceding embodiments,
calculating the Spatial-Aggregation-Propensity of a residue
comprises calculating the Spatial-Aggregation-Propensity for a
spherical region with a radius centered on an atom in the residue.
In certain embodiments, the radius of the spherical region is at
least 5 .ANG..
[0021] Another aspect includes modified or isolated immunoglobulins
comprising at least one mutation of a surface-exposed residue to
cysteine, wherein the Spatial-Aggregation-Propensity of the residue
is equal to or in between the values of 0 and -0.11 and wherein the
Spatial-Aggregation-Propensities of a plurality of residues of the
immunoglobulin within immediate proximity of the first residue have
Spatial-Aggregation-Propensities of less than 0. In certain
embodiments, the plurality of residues is within 15 .ANG. of the
first residue. In certain embodiments, the plurality of residues is
within 10 .ANG. of the first residue. In certain embodiments, the
plurality of residues is within 7.5 .ANG. of the first residue. In
certain embodiments, the plurality of residues is within 5 .ANG. of
the first residue. In certain embodiments that may be combined with
the preceding embodiments, the Spatial-Aggregation-Propensity is
calculated for a spherical region with a radius centered on an atom
in the residue. In certain embodiments, the radius is at least 5
.ANG..
[0022] Another aspect includes methods of selecting a residue of an
immunoglobulin for mutation to cysteine comprising choosing a
plurality of amino acid residues of the immunoglobulin, wherein the
plurality of residues are exposed on the surface of the
immunoglobulin, mutating one residue of the plurality of residues
to a cysteine residue, conjugating the cysteine residue to an atom
or molecule to form an immunoglobulin conjugate, testing the
immunoglobulin conjugate for cross-linking propensity and assigning
the immunoglobulin conjugate a cross-linking propensity value, and
selecting the residue for mutation to cysteine if the cross-linking
propensity value is I or II. In certain embodiments, the method
further comprises assigning the immunoglobulin conjugate a
cross-linking propensity value of II if less than 5% of the
immunoglobulin conjugate forms dimers and none of the
immunoglobulin conjugate forms trimers wherein dimer and trimer
formation is measured by comparative non-reducing and reducing
SDS-PAGE. In certain embodiments, the method further comprises
assigning the immunoglobulin conjugate a cross-linking propensity
value of I if less than 1% of the immunoglobulin conjugate forms
dimers wherein dimer formation is measured by comparative
non-reducing and reducing SDS-PAGE.
[0023] Additional aspects and embodiments of the invention may be
found throughout the specification.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0024] The present disclosure relates to improved immunoglobulins
and immunoglobulin conjugates which exhibit reduced cross-linking.
In certain embodiments, the immunoglobulins of the disclosure are
modified at specific residues by substitution with cysteine. The
disclosure provides modified immunoglobulins and immunoglobulin
conjugates, methods of making such immunoglobulins and
immunoglobulin conjugates, multivalent or multispecific molecules
comprising such immunoglobulins and pharmaceutical compositions
containing the immunoglobulins, immunoglobulin conjugates or
bispecific molecules of the disclosure.
Definitions
[0025] The term "antibody" or "immunoglobulin" as referred to
herein includes whole antibodies and any antigen binding fragment
(i. e., "antigen-binding portion") or single chains thereof. A
naturally occurring "antibody" is a glycoprotein comprising at
least two heavy (H) chains and two light (L) chains inter-connected
by disulfide bonds. Each heavy chain is comprised of a heavy chain
variable region (abbreviated herein as V.sub.H) and a heavy chain
constant region. The heavy chain constant region is comprised of
three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain is
comprised of a light chain variable region (abbreviated herein as
V.sub.L) and a light chain constant region. The light chain
constant region is comprised of one domain, C.sub.L. The V.sub.H
and V.sub.L regions can be further subdivided into regions of
hypervariability, termed complementarity determining regions (CDR),
interspersed with regions that are more conserved, termed framework
regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs
and four FRs arranged from amino-terminus to carboxy-terminus in
the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The
variable regions of the heavy and light chains contain a binding
domain that interacts with an antigen. The constant regions of the
antibodies may mediate the binding of the immunoglobulin to host
tissues or factors, including various cells of the immune system
(e.g., effector cells) and the first component (Clq) of the
classical complement system.
[0026] The terms "antibody conjugate" or "immunoglobulin conjugate"
as referred to herein include any immunoglobulin, antigen binding
fragment, or single chains thereof chemically or biologically
linked to an atom or molecule. Atoms or molecules may include, for
example, a cytotoxin, radioactive agent, anti-tumor drug, or
therapeutic agent. The antibody conjugate retains the
immunoreactivity of the immunoglobulin or antigen binding fragment,
i.e., the immunoglobulin or antigen binding fragment of the
antibody conjugate has at least seventy percent, at least
seventy-five percent, at least eighty percent, at least eighty-five
percent, at least ninety percent, at least ninety-five percent, at
least at least one hundred percent, at least one hundred ten
percent, at least one hundred twenty percent, or at least one
hundred thirty percent of the antigen binding activity of the
immunoglobulin prior to conjugation with the atom or molecule.
[0027] The term "antigen-binding portion" of an antibody (or simply
"antigen portion"), as used herein, refers to full length or one or
more fragments of an antibody that retain the ability to
specifically bind to an antigen and at least a portion of the
constant region of the heavy or light chain. It has been shown that
the antigen-binding function of an antibody can be performed by
fragments of a full-length antibody. Examples of binding fragments
encompassed within the term "antigen-binding portion" of an
antibody include a Fab fragment, a monovalent fragment consisting
of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; a F(ab)2
fragment, a bivalent fragment comprising two Fab fragments linked
by a disulfide bridge at the hinge region; a Fd fragment consisting
of the V.sub.H and C.sub.H1 domains; and a Fv fragment consisting
of the V.sub.L and V.sub.H domains of a single arm of an
antibody.
[0028] Furthermore, although the two domains of the Fv fragment,
V.sub.L and V.sub.H, are coded for by separate genes, they can be
joined, using recombinant methods, by a synthetic linker that
enables them to be made as a single protein chain in which the
V.sub.L and V.sub.H regions pair to form monovalent molecules
(known as single chain Fv (scFv); see e.g., Bird et al., 1988
Science 242:423-426; and Huston et al., 1988 Proc. Natl. Acad. Sci.
85:5879-5883). Such single chain antibodies are also intended to be
encompassed within the term "antigen-binding region" of an
antibody. These antibody fragments are obtained using conventional
techniques known to those of skill in the art, and the fragments
are screened for utility in the same manner as are intact
antibodies.
[0029] An "isolated" antibody or immunoglobulin, as used herein,
refers to an antibody or immunoglobulin that is substantially free
of other components in which such antibodies or immunoglobulin are
naturally found. Moreover, an isolated antibody or immunoglobulin
may be substantially free of other cellular material and/or
chemicals.
[0030] The terms "monoclonal antibody" or "monoclonal antibody
composition" as used herein refer to a preparation of antibody
molecules of single molecular composition. A monoclonal antibody
composition typically displays a single binding specificity and
affinity for a particular epitope.
[0031] The term "human antibody", as used herein, is intended to
include antibodies having variable regions in which both the
framework and CDR regions are derived from sequences of human
origin. Furthermore, if the antibody contains a constant region,
the constant region also is derived from such human sequences,
e.g., human germline sequences, or mutated versions of human
germline sequences or antibody containing consensus framework
sequences derived from human framework sequences analysis as
described in Knappik, et al. (2000. J Mol Biol 296, 57-86).
[0032] The human antibodies of the disclosure may include amino
acid residues not encoded by human sequences (e.g., mutations
introduced by random or site-specific mutagenesis in vitro or by
somatic mutation in vivo). However, the term "human antibody", as
used herein, is not intended to include antibodies in which CDR
sequences derived from the germline of another mammalian species,
such as a mouse, have been grafted onto human framework
sequences.
[0033] The term "human domain", as used herein, is intended to
include immunoglobulin constant region domains derived from
sequences of human origin, e.g., human germline sequences, or
mutated versions of human germline sequences or antibody containing
consensus framework sequences derived from human framework
sequences analysis as described in Knappik, et al. (2000. J Mol
Biol 296, 57-86).
[0034] The term "recombinant human antibody", as used herein,
includes all human antibodies that are prepared, expressed, created
or isolated by recombinant means, such as antibodies isolated from
an animal (e.g., a mouse) that is transgenic or transchromosomal
for human immunoglobulin genes or a hybridoma prepared therefrom,
antibodies isolated from a host cell transformed to express the
human antibody, e.g., from a transfectoma, antibodies isolated from
a recombinant, combinatorial human antibody library, and antibodies
prepared, expressed, created or isolated by any other means that
involve splicing of all or a portion of a human immunoglobulin
gene, sequences to other DNA sequences. Such recombinant human
antibodies have variable regions in which the framework and CDR
regions are derived from human germline immunoglobulin sequences.
In certain embodiments, however, such recombinant human antibodies
can be subjected to in vitro mutagenesis (or, when an animal
transgenic for human Ig sequences is used, in vivo somatic
mutagenesis) and thus the amino acid sequences of the V.sub.H and
V.sub.L regions of the recombinant antibodies are sequences that,
while derived from and related to human germline V.sub.H and
V.sub.L sequences, may not naturally exist within the human
antibody germline repertoire in vivo.
[0035] A "chimeric antibody" is an antibody molecule in which (a)
the constant region, or a portion thereof, is altered, replaced or
exchanged so that the antigen binding site (variable region) is
linked to a constant region of a different or altered class,
effector function and/or species, or an entirely different molecule
which confers new properties to the chimeric antibody, e.g., an
enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the
variable region, or a portion thereof, is altered, replaced or
exchanged with a variable region having a different or altered
antigen specificity. For example, a mouse antibody can be modified
by replacing its constant region with the constant region from a
human immunoglobulin comprising a modification as disclosed herein.
Due to the replacement with a human constant region, the chimeric
antibody can retain its specificity while having reduced
antigenicity in human and reduced aggregation overall as compared
to the original mouse antibody or a chimeric antibody without the
modification as disclosed herein.
[0036] A "humanized" antibody is an antibody that retains the
reactivity of a non-human antibody while being less immunogenic in
humans. This can be achieved, for instance, by retaining the
non-human CDR regions and replacing the remaining parts of the
antibody with their human counterparts (i.e., the constant region
as well as the framework portions of the variable region). See,
e.g., Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855,
1984; Morrison and Oi, Adv. Immunol., 44:65-92, 1988; Verhoeyen et
al., Science, 239:1534-1536, 1988; Padlan, Molec. Immun.,
28:489-498, 1991; and Padlan, Molec. Immun., 31:169-217, 1994.
Other examples of human engineering technology include, but are not
limited to Xoma technology disclosed in U.S. Pat. No.
5,766,886.
[0037] The term "linker", "linker Unit", or "link" as used herein
refers to a chemical moiety comprising a covalent bond or a chain
of atoms that covalently attaches an antibody to a drug moiety or
other molecule. Linkers include a divalent radical such as an
alkyldiyl, an arylene, a heteroarylene, moieties such as:
--(CR.sub.2).sub.nO(CR.sub.2).sub.n--, repeating units of alkyloxy
(e.g. polyethylenoxy, PEG, polymethyleneoxy) and alkylamino (e.g.
polyethyleneamino, polyetheramine (Jeffamine.TM.))); and diacid
ester and amides including succinate, succinamide, diglycolate,
malonate, and caproamide.
[0038] The term "label" as used herein refers to any moiety which
can be covalently attached to an antibody and that functions to:
(i) provide a detectable signal; (ii) interact with a second label
to modify the detectable signal provided by the first or second
label, e.g. FRET (fluorescence resonance energy transfer); (iii)
stabilize interactions or increase affinity of binding, with
antigen or ligand; (iv) affect mobility, e.g. electrophoretic
mobility, or cell-permeability, by charge, hydrophobicity, shape,
or other physical parameters, or (v) provide a capture moiety, to
modulate ligand affinity, antibody/antigen binding, or ionic
complexation.
[0039] The term "Humaneering" as used herein refers to a method for
converting non-human antibodies into engineered human antibodies
(See e.g., KaloBios' Humaneering.TM. technology).
[0040] As used herein, "isotype" refers to any antibody class
(e.g., IgM, IgE, IgG such as IgG1 or IgG2) that is provided by the
heavy chain constant region genes that have the aggregation prone
motifs disclosed herein (and therefore are amenable to the
modifications disclosed herein that reduce aggregation).
[0041] As used herein, the term "affinity" refers to the strength
of interaction between antibody and antigen at single antigenic
sites. Within each antigenic site, the variable region of the
antibody "arm" interacts through weak non-covalent forces with
antigen at numerous sites; the more interactions, the stronger the
affinity. The modifications disclosed herein preferably do not
reduce the affinity of the immunoglobulin or antibodies disclosed
herein or the affinity is reduced less than thirty percent, less
than twenty percent, less than ten percent, or less than five
percent. As used herein, when determining whether the modifications
disclosed herein reduce affinity the comparison is made between the
immunoglobulin or antibody with the modification and the same
immunoglobulin lacking the modification but including any unrelated
mutations.
[0042] As used herein, the term "subject" includes any human or
nonhuman animal.
[0043] The term "nonhuman animal" includes all vertebrates, e.g.,
mammals and non-mammals, such as nonhuman primates, sheep, dogs,
cats, horses, cows, chickens, amphibians, reptiles, etc.
[0044] The term "chemotherapeutic agent" as used herein refers to a
chemical compound useful in the treatment of cancer. Examples of
chemotherapeutic agents include Erlotinib (TARCEVA.TM.,
Genentech/OSI Pharm.), Bortezomib (VELCADE.TM., Millenium Pharm.),
Fulvestrant (FASLODEX.TM., Astrazeneca), Sutent (SU11248, Pfizer),
Letrozole (FEMARA.TM., Novartis), Imatinib mesylate (GLEEVEC.TM.,
Novartis), PTK787/ZK 222584 (Novartis), Oxaliplatin (ELOXATIN.TM.,
Sanofi), 5-FU (5-fluorouracil), Leucovorin, Rapamycin (Sirolimus,
RAPAMUNE.TM., Wyeth), Lapatinib (GSK572016, GlaxoSmithKline),
Lonafarnib (SCH 66336), Sorafenib (BAY43-9006, Bayer Labs.), and
Gefitinib (IRESSA.TM., Astrazeneca), AG1478, AG1571 (SU 5271;
Sugen), alkylating agents such as thiotepa and CYTOXAN.TM.
cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan
and piposulfan; aziridines such as benzodopa, carboquone,
meturedopa, and uredopa; ethylenimines and methylamelamines
including altretamine, triethylenemelamine,
triethylenephosphoramide, triethylenethiophosphoramide and
trimethylomelamine; acetogenins (especially bullatacin and
bullatacinone); a camptothecin (including the synthetic analogue
topotecan); bryostatin; callystatin; CC-1065 (including its
adozelesin, carzelesin and bizelesin synthetic analogues);
cryptophycins (particularly cryptophycin 1 and cryptophycin 8);
dolastatin; duocarmycin (including the synthetic analogues, KW-2189
and CB 1-TM1); eleutherobin; pancratistatin; a sarcodictyin;
spongistatin; nitrogen mustards such as chlorambucil,
chlornaphazine, cholophosphamide, estramustine, ifosfamide,
mechlorethamine, mechlorethamine oxide hydrochloride, melphalan,
novembichin, phenesterine, prednimustine, trofosfamide, uracil
mustard; nitrosureas such as carmustine, chlorozotocin,
fotemustine, lomustine, nimustine, and ranimnustine; antibiotics
such as the enediyne antibiotics (e.g., calicheamicin, especially
calicheamicin gamma1I and calicheamicin omegall (Angew Chem Intl.
Ed. Engl. (1994) 33:183-186); dynemicin, including dynemicin A;
bisphosphonates, such as clodronate; an esperamicin; as well as
neocarzinostatin chromophore and related chromoprotein enediyne
antibiotic chromophores), aclacinomysins, actinomycin, anthramycin,
azaserine, bleomycins, cactinomycin, carabicin, carminomycin,
carzinophilin, chromomycinis, dactinomycin, daunorubicin,
detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN.TM. doxorubicin
(including morpholino-doxorubicin, cyanomorpholino-doxorubicin,
2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin,
esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin
C, mycophenolic acid, nogalamycin, olivomycins, peplomycin,
potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin,
streptozocin, tubercidin, ubenimex, zinostatin, zorubicin;
anti-metabolites such as methotrexate and 5-fluorouracil (5-FU);
folic acid analogues such as denopterin, methotrexate, pteropterin,
trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine,
thiamiprine, thioguanine; pyrimidine analogs such as ancitabine,
azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine,
doxifluridine, enocitabine, floxuridine; androgens such as
calusterone, dromostanolone propionate, epitiostanol, mepitiostane,
testolactone; anti-adrenals such as aminoglutethimide, mitotane,
trilostane; folic acid replenisher such as frolinic acid;
aceglatone; aldophosphamide glycoside; aminolevulinic acid;
eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate;
defofamine; demecolcine; diaziquone; elformithine; elliptinium
acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea;
lentinan; lonidainine; maytansinoids such as maytansine and
ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine;
pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic
acid; 2-ethylhydrazide; procarbazine; PSK.TM. polysaccharide
complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin;
sizofuran; spirogermanium; tenuazonic acid; triaziquone;
2,2',2''-trichlorotriethylamine; trichothecenes (especially T-2
toxin, verracurin A, roridin A and anguidine); urethan; vindesine;
dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa;
taxoids, e.g., TAXOL.TM. paclitaxel (Bristol-Myers Squibb Oncology,
Princeton, N.J.), ABRAXANE.TM. Cremophor-free, albumin-engineered
nanoparticle formulation of paclitaxel (American Pharmaceutical
Partners, Schaumberg, Ill.), and TAXOTERE.TM. doxetaxel
(Rhone-Poulenc Rorer, Antony, France); chloranbucil; GEMZAR.TM.
gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum
analogs such as cisplatin and carboplatin; vinblastine; platinum;
etoposide (VP-16); ifosfamide; mitoxantrone; vincristine;
NAVELBINE.TM. vinorelbine; novantrone; teniposide; edatrexate;
daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase
inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such
as retinoic acid; capecitabine; and pharmaceutically acceptable
salts, acids or derivatives of any of the above.
[0045] Also included in this definition of "chemotherapeutic agent"
are: (i) anti-hormonal agents that act to regulate or inhibit
hormone action on tumors such as anti-estrogens and selective
estrogen receptor modulators (SERMs), including, for example,
tamoxifen (including NOLVADEX.TM. tamoxifen), raloxifene,
droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018,
onapristone, and FARESTON toremifene; (ii) aromatase inhibitors
that inhibit the enzyme aromatase, which regulates estrogen
production in the adrenal glands, such as, for example,
4(5)-imidazoles, aminoglutethimide, MEGASE.TM. megestrol acetate,
AROMASIN.TM. exemestane, formestanie, fadrozole, RIVISOR.TM.
vorozole, FEMARA.TM. letrozole, and ARIMIDEX.TM. anastrozole; (iii)
anti-androgens such as flutamide, nilutamide, bicalutamide,
leuprolide, and goserelin; as well as troxacitabine (a
1,3-dioxolane nucleoside cytosine analog); (iv) aromatase
inhibitors; (v) protein kinase inhibitors; (vi) lipid kinase
inhibitors; (vii) antisense oligonucleotides, particularly those
which inhibit expression of genes in signaling pathways implicated
in aberrant cell proliferation, such as, for example, PKC-alpha,
Ralf and H-Ras; (viii) ribozymes such as a VEGF expression
inhibitor (e.g., ANGIOZYME.TM. ribozyme) and a HER2 expression
inhibitor; (ix) vaccines such as gene therapy vaccines, for
example, ALLOVECTIN.TM. vaccine, LEUVECTIN.TM. vaccine, and
VAXID.TM. vaccine; PROLEUKIN.TM. rIL-2; LURTOTECAN.TM.
topoisomerase 1 inhibitor; ABARELIX.TM. rmRH; (x) anti-angiogenic
agents such as bevacizumab (AVASTIN.TM., Genentech); and (xi)
pharmaceutically acceptable salts, acids or derivatives of any of
the above.
[0046] As used herein, the term "cytokine" is a generic term for
proteins released by one cell population which act on another cell
as intercellular mediators. Examples of such cytokines are
lymphokines, monokines, and traditional polypeptide hormones.
Included among the cytokines are growth hormone such as human
growth hormone, N-methionyl human growth hormone, and bovine growth
hormone; parathyroid hormone; thyroxine; insulin; proinsulin;
relaxin; prorelaxin; glycoprotein hormones such as follicle
stimulating hormone (FSH), thyroid stimulating hormone (TSH), and
luteinizing hormone (LH); hepatic growth factor; fibroblast growth
factor; prolactin; placental lactogen; tumor necrosis
factor-.alpha. and -.beta.; mullerian-inhibiting substance; mouse
gonadotropin-associated peptide; inhibin; activin; vascular
endothelial growth factor; integrin; thrombopoietin (TPO); nerve
growth factors such as NGF-.beta.; platelet-growth factor;
transforming growth factors (TGFs) such as TGF-.alpha. and
TGF-.beta.; insulin-like growth factor-I and -II; erythropoietin
(EPO); osteoinductive factors; interferons such as
interferon-.alpha., -.beta., and -.gamma.; colony stimulating
factors (CSFs) such as macrophage-CSF (M-CSF);
granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF);
interleukins (ILs) such as IL-1, IL-1 .alpha., IL-2, IL-3, IL-4,
IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; a tumor necrosis
factor such as TNF-.alpha. or TNF-.beta.; and other polypeptide
factors including LIF and kit ligand (KL). As used herein, the term
cytokine includes proteins from natural sources or from recombinant
cell culture and biologically active equivalents of the native
sequence cytokines.
[0047] As used herein, the term, "optimized" means that a
nucleotide sequence has been altered to encode an amino acid
sequence using codons that are preferred in the production cell or
organism, generally a eukaryotic cell, for example, a cell of
Pichia, a Chinese Hamster Ovary cell (CHO) or a human cell. The
optimized nucleotide sequence is engineered to retain completely or
as much as possible the amino acid sequence originally encoded by
the starting nucleotide sequence, which is also known as the
"parental" sequence. Optimized expression of these sequences in
other eukaryotic cells is also envisioned herein. The amino acid
sequences encoded by optimized nucleotide sequences are also
referred to as optimized.
[0048] As used herein, the term "antigen binding activity" refers
to the specificity of binding of an immunoglobulin or
immunoglobulin conjugate to its target antigen. For example,
antigen binding activity may be measured by cell-based bioassays
(e.g. reporter gene assays), ELISA, surface plasmon resonance
(Biacore), or any other techniques known to one skilled in the
art.
[0049] As used herein, the term "cross-linking propensity" (CLP)
refers to the propensity of a modified immunoglobulin or
immunoglobulin conjugate containing a mutation that is a
substitution with cysteine to cross-link between different
immunoglobulins at the substituted cysteine residue. For example,
CLP can be determined by the level of oligomerization as measured
by non-reducing SDS-PAGE, size-exclusion chromatography, static or
dynamic laser light scattering with size-exclusion chromatography,
or any other techniques known to one skilled in the art. Class I
comprises variants that are monomeric and remain stable after
labeling. Variants of class II contain a small percent of dimers
before and after labeling. Class III variants have a more
pronounced propensity to oligomerize including formation of some
trimers. Class IV variants have even higher propensity to
oligomerize as evidenced by the presence of aggregates larger than
trimer, especially after labeling. Class V includes variants of
high oligomerization propensity similarly to variant of Class IV
with additional structural abnormalities such as fragmentation or
coloration of purified concentrated sample.
[0050] The term "epitope" means a protein determinant capable of
specific binding to an antibody. Epitopes usually consist of
chemically active surface groupings of molecules such as amino
acids or sugar side chains and usually have specific three
dimensional structural characteristics, as well as specific charge
characteristics. Conformational and nonconformational epitopes are
distinguished in that the binding to the former but not the latter
is lost in the presence of denaturing solvents.
[0051] The term "conservatively modified variant" applies to both
amino acid and nucleic acid sequences. With respect to particular
nucleic acid sequences, conservatively modified variants refers to
those nucleic acids which encode identical or essentially identical
amino acid sequences, or where the nucleic acid does not encode an
amino acid sequence, to essentially identical sequences. Because of
the degeneracy of the genetic code, a large number of functionally
identical nucleic acids encode any given protein. For instance, the
codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
Thus, at every position where an alanine is specified by a codon,
the codon can be altered to any of the corresponding codons
described without altering the encoded polypeptide. Such nucleic
acid variations are "silent variations," which are one species of
conservatively modified variations. Every nucleic acid sequence
herein which encodes a polypeptide also describes every possible
silent variation of the nucleic acid. One of skill will recognize
that each codon in a nucleic acid (except AUG, which is ordinarily
the only codon for methionine, and TGG, which is ordinarily the
only codon for tryptophan) can be modified to yield a functionally
identical molecule. Accordingly, each silent variation of a nucleic
acid that encodes a polypeptide is implicit in each described
sequence.
[0052] For polypeptide sequences, "conservatively modified
variants" include individual substitutions, deletions or additions
to a polypeptide sequence which result in the substitution of an
amino acid with a chemically similar amino acid. Conservative
substitution tables providing functionally similar amino acids are
well known in the art. Such conservatively modified variants are in
addition to and do not exclude polymorphic variants, interspecies
homologs, and alleles of the disclosure. The following eight groups
contain amino acids that are conservative substitutions for one
another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D),
Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine
(R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M),
Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7)
Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M)
(see, e.g., Creighton, Proteins (1984)).
[0053] The terms "identical" or percent "identity," in the context
of two or more nucleic acids or polypeptide sequences, refer to two
or more sequences or subsequences that are the same. Two sequences
are "substantially identical" if two sequences have a specified
percentage of amino acid residues or nucleotides that are the same
(i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%,
or 99% identity over a specified region, or, when not specified,
over the entire sequence), when compared and aligned for maximum
correspondence over a comparison window, or designated region as
measured using one of the following sequence comparison algorithms
or by manual alignment and visual inspection. Optionally, the
identity exists over a region that is at least about 50 nucleotides
(or 10 amino acids) in length, or more preferably over a region
that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or
more amino acids) in length.
[0054] For sequence comparison, typically one sequence acts as a
reference sequence, to which test sequences are compared. When
using a sequence comparison algorithm, test and reference sequences
are entered into a computer, subsequence coordinates are
designated, if necessary, and sequence algorithm program parameters
are designated. Default program parameters can be used, or
alternative parameters can be designated. The sequence comparison
algorithm then calculates the percent sequence identities for the
test sequences relative to the reference sequence, based on the
program parameters. When comparing two sequences for identity, it
is not necessary that the sequences be contiguous, but any gap
would carry with it a penalty that would reduce the overall percent
identity. For blastn, the default parameters are Gap opening
penalty=5 and Gap extension penalty=2. For blastp, the default
parameters are Gap opening penalty=11 and Gap extension
penalty=1.
[0055] A "comparison window", as used herein, includes reference to
a segment of any one of the number of contiguous positions
including, but not limited to from 20 to 600, usually about 50 to
about 200, more usually about 100 to about 150 in which a sequence
may be compared to a reference sequence of the same number of
contiguous positions after the two sequences are optimally aligned.
Methods of alignment of sequences for comparison are well known in
the art. Optimal alignment of sequences for comparison can be
conducted, e.g., by the local homology algorithm of Smith and
Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment
algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443, 1970, by
the search for similarity method of Pearson and Lipman, Proc.
Nat'l. Acad. Sci. USA 85:2444, 1988, by computerized
implementations of these algorithms (GAP, BESTFIT, FASTA, and
TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group, 575 Science Dr., Madison, Wis.), or by manual
alignment and visual inspection (see, e.g., Brent et al., Current
Protocols in Molecular Biology, John Wiley & Sons, Inc.
(ringbou ed., 2003)).
[0056] Two examples of algorithms that are suitable for determining
percent sequence identity and sequence similarity are the BLAST and
BLAST 2.0 algorithms, which are described in Altschul et al., Nuc.
Acids Res. 25:3389-3402, 1977; and Altschul et al., J. Mol. Biol.
215:403-410, 1990, respectively. Software for performing BLAST
analyses is publicly available through the National Center for
Biotechnology Information. This algorithm involves first
identifying high scoring sequence pairs (HSPs) by identifying short
words of length W in the query sequence, which either match or
satisfy some positive-valued threshold score T when aligned with a
word of the same length in a database sequence. T is referred to as
the neighborhood word score threshold (Altschul et al., supra).
These initial neighborhood word hits act as seeds for initiating
searches to find longer HSPs containing them. The word hits are
extended in both directions along each sequence for as far as the
cumulative alignment score can be increased. Cumulative scores are
calculated using, for nucleotide sequences, the parameters M
(reward score for a pair of matching residues; always >0) and N
(penalty score for mismatching residues; always <0). For amino
acid sequences, a scoring matrix is used to calculate the
cumulative score. Extension of the word hits in each direction are
halted when: the cumulative alignment score falls off by the
quantity X from its maximum achieved value; the cumulative score
goes to zero or below, due to the accumulation of one or more
negative-scoring residue alignments; or the end of either sequence
is reached. The BLAST algorithm parameters W, T, and X determine
the sensitivity and speed of the alignment. The BLASTN program (for
nucleotide sequences) uses as defaults a wordlength (W) of 11, an
expectation (E) or 10, M=5, N=-4 and a comparison of both strands.
For amino acid sequences, the BLASTP program uses as defaults a
wordlength of 3, and expectation (E) of 10, and the BLOSUM62
scoring matrix (see Henikoff and Henikoff, Proc. Natl. Acad. Sci.
USA 89:10915, 1989) alignments (B) of 50, expectation (E) of 10,
M=5, N=-4, and a comparison of both strands.
[0057] The BLAST algorithm also performs a statistical analysis of
the similarity between two sequences (see, e.g., Karlin and
Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787, 1993). One
measure of similarity provided by the BLAST algorithm is the
smallest sum probability (P(N)), which provides an indication of
the probability by which a match between two nucleotide or amino
acid sequences would occur by chance. For example, a nucleic acid
is considered similar to a reference sequence if the smallest sum
probability in a comparison of the test nucleic acid to the
reference nucleic acid is less than about 0.2, more preferably less
than about 0.01, and most preferably less than about 0.001.
[0058] Other than percentage of sequence identity noted above,
another indication that two nucleic acid sequences or polypeptides
are substantially identical is that the polypeptide encoded by the
first nucleic acid is immunologically cross reactive with the
antibodies raised against the polypeptide encoded by the second
nucleic acid, as described below. Thus, a polypeptide is typically
substantially identical to a second polypeptide, for example, where
the two peptides differ only by conservative substitutions. Another
indication that two nucleic acid sequences are substantially
identical is that the two molecules or their complements hybridize
to each other under stringent conditions, as described below. Yet
another indication that two nucleic acid sequences are
substantially identical is that the same primers can be used to
amplify the sequence.
[0059] The term "operably linked" refers to a functional
relationship between two or more polynucleotide (e.g., DNA)
segments. Typically, it refers to the functional relationship of a
transcriptional regulatory sequence to a transcribed sequence. For
example, a promoter or enhancer sequence is operably linked to a
coding sequence if it stimulates or modulates the transcription of
the coding sequence in an appropriate host cell or other expression
system. Generally, promoter transcriptional regulatory sequences
that are operably linked to a transcribed sequence are physically
contiguous to the transcribed sequence, i.e., they are cis-acting.
However, some transcriptional regulatory sequences, such as
enhancers, need not be physically contiguous or located in close
proximity to the coding sequences whose transcription they
enhance.
[0060] The term "vector" is intended to refer to a polynucleotide
molecule capable of transporting another polynucleotide to which it
has been linked. One type of vector is a "plasmid", which refers to
a circular double stranded DNA loop into which additional DNA
segments may be ligated. Another type of vector is a viral vector,
wherein additional DNA segments may be ligated into the viral
genome. Certain vectors are capable of autonomous replication in a
host cell into which they are introduced (e.g., bacterial vectors
having a bacterial origin of replication and episomal mammalian
vectors). Other vectors (e.g., non-episomal mammalian vectors) can
be integrated into the genome of a host cell upon introduction into
the host cell, and thereby are replicated along with the host
genome. Moreover, certain vectors are capable of directing the
expression of genes to which they are operatively linked. Such
vectors are referred to herein as "recombinant expression vectors"
(or simply, "expression vectors"). In general, expression vectors
of utility in recombinant DNA techniques are often in the form of
plasmids. In the present specification, "plasmid" and "vector" may
be used interchangeably as the plasmid is the most commonly used
form of vector. However, the disclosure is intended to include such
other forms of expression vectors, such as viral vectors (e.g.,
replication defective retroviruses, adenoviruses and
adeno-associated viruses), which serve equivalent functions.
[0061] The term "recombinant host cell" (or simply "host cell")
refers to a cell into which a recombinant expression vector has
been introduced. It should be understood that such terms are
intended to refer not only to the particular subject cell but to
the progeny of such a cell. Because certain modifications may occur
in succeeding generations due to either mutation or environmental
influences, such progeny may not, in fact, be identical to the
parent cell, but are still included within the scope of the term
"host cell" as used herein.
[0062] The term "target antigen" refers to the antigen against
which the parent immunoglobulin was raised or otherwise generated
(e.g., by phage display).
[0063] The term "unmutated immunoglobulin" refers to the
immunoglobulin which does not comprise the at least one mutation
that is a substitution with a cysteine residue. As used herein, the
unmutated immunoglobulin may be a hypothetical construct for the
purposes of comparison of the oligomerization propensity or the
conjugation efficiency of the immunoglobulin with and without the
mutation. By way of example, a murine antibody that includes
humanizing mutations as well as mutations to cysteine for the
purpose of conjugation is not the unmutated immunoglobulin. The
unmutated immunoglobulin would be the antibody with the humanizing
mutations, but without the mutations to cysteine. Where a mutation
is intended to serve more than one purpose including providing
sites for conjugation, the unmutated immunoglobulin does not
include such mutation.
[0064] The term "aggregation motif" refers to a set of residues
grouped together based upon the following process. First, residues
having an SAP (5 .ANG. radius) of greater than 0.15 are identified.
Then all residues within 5 .ANG. of each residue having an SAP (5
.ANG. radius) of greater than 0.15 are identified. A motif is then
the residue with an SAP (5 .ANG. radius) of greater than 0.15 and
all residues with an SAP (5 .ANG. radius) of greater than 0.0
within 5 .ANG. of the residue with an SAP (5 .ANG. radius) of
greater than 0.15. Any such motifs having at least one residue in
common are merged into a larger motif reiteratively until there are
no remaining motifs which have a residue in common. These remaining
motifs or sets of residues constitute aggregation motifs.
[0065] Where immunoglobulin residues are referred to by number
herein, the residue number refers to the Kabat number of the
corresponding residue in the IgG1 molecule when the immunoglobulin
sequence of interest is aligned to the human IgG1 immunoglobulin.
By way of reference, the human IgG1, IgG2, IgG3 and IgG4 constant
domains are aligned:
TABLE-US-00001 C.sub.H1 domain ..A.. loop ....B.... loop..C...
C'loop..D. 120 130 140 150 160 170 | | | | | | IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF IgG2
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF IgG4
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF IgG3
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF .. loop
...E..... loop. ...F... loop ..G....join 180 190 200 210 220 | | |
| | IgG1 PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC IgG2
PAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCC IgG4
PAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG IgG3
PAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEPKTP (IgG1 = SEQ ID
NO: 1; IgG2 = SEQ ID NO: 2; IgG4 = SEQ ID NO: 3; IgG3 = SEQ ID NO:
4) Hinge upper middle lower 230 | IgG1 -DKTHT ----------------
CPPCP APELLGG (SEQ ID NO: 5) IgG2 -VE--- ---------------- CPPCP
AP-PVAG (SEQ ID NO: 6) IgG4 -PP--- ---------------- CPSCP APEFLGG
(SEQ ID NO: 7) IgG3 LGTTHT CPRCPEPK******** CPRCP APELLGG (SEQ ID
NO: 8) C.sub.H2 domain ..A.. loop ....B.... loop ..C.. C'loop ...D
240 250 260 270 280 290 | | | | | | IgG1
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP IgG2
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKP IgG4
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP IgG3
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKP ... loop
....E... .loop. ...F.....loop ..G... joinC3 300 310 320 330 340 | |
| | | IgG1 REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE
IgG2 REEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPRE IgG4
REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPRE IgG3
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPRE (IgG1 = SEQ
ID NO: 9; IgG2 = SEQ ID NO: 10; IgG4 = SEQ ID NO: 11; IgG3 = SEQ ID
NO: 12) C.sub.H3 domain ..A.. loop ....B.... loop
..C...C'loop..D.... 350 360 370 380 390 400 | | | | | | IgG1
PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS IgG2
PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDS IgG4
PQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS IgG3
PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYKTTPPVLDS loop
....E... .loop. ...F... loop ....G.... 410 420 430 440 | | | | IgG1
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK IgG2
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK IgG4
DGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK IgG3
DGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHFTQKSLSLSPGK (IgG1 = SEQ ID NO:
13; IgG2 = SEQ ID NO: 14; IgG4 = SEQ ID NO: 15; IgG3 = SEQ ID NO:
16) C.sub.L domain 11 12 13 14 15
0123456789012345678901234567890123456789 constant .cndot.
KAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWK constant .cndot.
VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK 16 17 18 19
0123456789012345678901234567890123456789 constant .cndot.
ADSSPVKAGVETTTPSKQS-NNKYAASSYLSLTPEQWKSH constant .cndot.
VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH 20 21
01234567890123456789012345 constant .cndot.
RSYSCQVTHEG--STVEKTVAPTECS (SEQ ID NO: 17) constant .cndot.
KVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 18)
[0066] Alignments of the V.sub.H and V.sub.L domains can be found
in Ewert, Honegger, and Pluchthun, Methods 34 (2004) 184-199.
[0067] Immunoglobulin Conjugates of the Invention
[0068] The invention herein relates to immunoglobulin conjugates
including immunoglobulins having at least one mutation of a residue
of the surface of the immunoglobulin wherein the mutation is a
substitution with a cysteine residue. The substituted cysteine
residue is conjugated to an atom or molecule, which may be, by way
of example, a cytotoxic agent (e.g. a toxin such as doxorubicin or
pertussis toxin), a fluorophore such as a fluorescent dye like
fluorescein or rhodamine, a chelating agent for an imaging or
radiotherapeutic metal, a peptidyl or non-peptidyl label or
detection tag, or a clearance-modifying agent such as various
isomers of polyethylene glycol, a peptide that binds to a third
component, or another carbohydrate or lipophilic agent. In further
embodiments, the molecule may be an enzyme, a peptide, a
peptidomimetic, a nucleotide such as an RNA molecule, including
siRNA, microRNA, and RNA mimetics, or aptamers.
[0069] Labeled Immunoglobulin Conjugates
[0070] In certain embodiments, modified immunoglobulins of the
invention may be conjugated with any label moiety which can be
covalently attached to the immunoglobulin through a reactive
cysteine thiol group (Singh et al (2002) Anal. Biochem. 304:147-15;
Harlow E. and Lane, D. (1999) Using Antibodies: A Laboratory
Manual, Cold Springs Harbor Laboratory Press, Cold Spring Harbor,
N.Y.; Lundblad R. L. (1991) Chemical Reagents for Protein
Modification, 2nd ed. CRC Press, Boca Raton, Fla.). The attached
label may function, for example, to: (i) provide a detectable
signal; (ii) interact with a second label to modify the detectable
signal provided by the first or second label, e.g. to give FRET
(fluorescence resonance energy transfer); (iii) stabilize
interactions or increase affinity of binding, with antigen or
ligand; (iv) affect mobility, e.g. electrophoretic mobility or
cell-permeability, by charge, hydrophobicity, shape, or other
physical parameters, or (v) provide a capture moiety, to modulate
ligand affinity, antibody/antigen binding, or ionic
complexation.
[0071] Labeled immunoglobulin conjugates may be useful in
diagnostic assays, e.g., for detecting expression of an antigen of
interest in specific cells, tissues, or serum. For diagnostic
applications, the immunoglobulin will typically be labeled with a
detectable moiety. Numerous labels are available which can be
generally grouped into the following exemplary categories:
[0072] (a) Radioisotopes (radionuclides), such as .sup.3H,
.sup.11C, .sup.14C, .sup.18F, .sup.32P, .sup.35S, .sup.64Cu,
.sup.68Ga, .sup.86Y, .sup.99Tc, .sup.111In, .sup.123I, .sup.124I,
.sup.125I, .sup.131I, .sup.133Xe, .sup.177Lu, .sup.211At, or
.sup.213Bi. Radioisotope labeled immunoglobulins are useful in
receptor targeted imaging experiments. The immunoglobulin can be
labeled with ligand reagents that bind, chelate or otherwise
complex a radioisotope metal where the reagent is reactive with the
engineered cysteine thiol of the immunoglobulin, using the
techniques described in Current Protocols in Immunology, Volumes 1
and 2, Coligen et al, Ed. Wiley-Interscience, New York, N.Y., Pubs.
(1991). Chelating ligands which may complex a metal ion include
DOTA, DOTP, DOTMA, DTPA and TETA (Macrocyclics, Dallas, Tex.).
Radionuclides can be targeted via complexation with the
antibody-drug conjugates of the invention (Wu et al (2005) Nature
Biotechnology 23(9):1137-1146).
[0073] Metal-chelate complexes suitable as immunoglobulin labels
for imaging experiments are disclosed: U.S. Pat. Nos. 5,342,606;
5,428,155; 5,316,757; 5,480,990; 5,462,725; 5,428,139; 5,385,893;
5,739,294; 5,750,660; 5,834,456; Hnatowich et al (1983) J. Immunol.
Methods 65:147-157; Meares et al (1984) Anal. Biochem. 142:68-78;
Mirzadeh et al (1990) Bioconjugate Chem. 1:59-65; Meares et al
(1990) J. Cancer 1990, Suppl. 10:21-26; Izard et al (1992)
Bioconjugate Chem. 3:346-350; Nikula et al (1995) Nucl. Med. Biol.
22:387-90; Camera et al (1993) Nucl. Med. Biol. 20:955-62; Kukis et
al (1998) J. Nucl. Med. 39:2105-2110; Verel et al (2003) J. Nucl.
Med. 44:1663-1670; Camera et al (1994) J. Nucl. Med. 21:640-646;
Ruegg et al (1990) Cancer Res. 50:4221-4226; Verel et al (2003) J.
Nucl. Med. 44:1663-1670; Lee et al (2001) Cancer Res. 61:4474-4482;
Mitchell, et al (2003) J. Nucl. Med. 44:1105-1112; Kobayashi et al
(1999) Bioconjugate Chem. 10:103-111; Miederer et al (2004) J.
Nucl. Med. 45:129-137; DeNardo et al (1998) Clinical Cancer
Research 4:2483-90; Blend et al (2003) Cancer Biotherapy &
Radiopharmaceuticals 18:355-363; Nikula et al (1999) J. Nucl. Med.
40:166-76; Kobayashi et al (1998) J. Nucl. Med. 39:829-36;
Mardirossian et al (1993) Nucl. Med. Biol. 20:65-74; Roselli et al
(1999) Cancer Biotherapy & Radiopharmaceuticals, 14:209-20.
[0074] (b) Fluorescent labels such as rare earth chelates (europium
chelates), fluorescein types including FITC, 5-carboxyfluorescein,
6-carboxy fluorescein; rhodamine types including TAMRA; dansyl;
Lissamine; cyanines; phycoerythrins; Texas Red; and analogs
thereof. The fluorescent labels can be conjugated to
immunoglobulins using the techniques disclosed in Current Protocols
in Immunology, supra, for example. Fluorescent dyes and fluorescent
label reagents include those which are commercially available from
Invitrogen/Molecular Probes (Eugene, Oreg.) and Pierce
Biotechnology, Inc. (Rockford, Ill.).
[0075] c) Various enzyme-substrate labels are available or
disclosed (U.S. Pat. No. 4,275,149). The enzyme generally catalyzes
a chemical alteration of a chromogenic substrate that can be
measured using various techniques. For example, the enzyme may
catalyze a color change in a substrate, which can be measured
spectrophotometrically. Alternatively, the enzyme may alter the
fluorescence or chemiluminescence of the substrate. Techniques for
quantifying a change in fluorescence are described above. The
chemiluminescent substrate becomes electronically excited by a
chemical reaction and may then emit light which can be measured
(using a chemiluminometer, for example) or donates energy to a
fluorescent acceptor. Examples of enzymatic labels include
luciferases (e.g., firefly luciferase and bacterial luciferase;
U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones,
malate dehydrogenase, urease, peroxidase such as horseradish
peroxidase (HRP), alkaline phosphatase (AP), .beta.-galactosidase,
glucoamylase, lysozyme, saccharide oxidases (e.g., glucose oxidase,
galactose oxidase, and glucose-6-phosphate dehydrogenase),
heterocyclic oxidases (such as uricase and xanthine oxidase),
lactoperoxidase, microperoxidase, and the like. Techniques for
conjugating enzymes to antibodies are described in O'Sullivan et al
(1981) "Methods for the Preparation of Enzyme-Antibody Conjugates
for use in Enzyme Immunoassay", in Methods in Enzym. (ed J. Langone
& H. Van Vunakis), Academic Press, New York, 73:147-166.
[0076] Examples of enzyme-substrate combinations include, for
example: (i) Horseradish peroxidase (HRP) with hydrogen peroxidase
as a substrate, wherein the hydrogen peroxidase oxidizes a dye
precursor (e.g., orthophenylene diamine (OPD) or
3,3',5,5'-tetramethylbenzidine hydrochloride (TMB)); (ii) alkaline
phosphatase (AP) with para-nitrophenyl phosphate as chromogenic
substrate; and (iii) .beta.-D-galactosidase (.beta.-D-Gal) with a
chromogenic substrate (e.g., p-nitrophenyl-.beta.-D-galactosidase)
or fluorogenic substrate
4-methylumbelliferyl-.beta.-D-galactosidase. Numerous other
enzyme-substrate combinations are available to those skilled in the
art. For a general review, see U.S. Pat. Nos. 4,275,149 and
4,318,980.
[0077] A label may be indirectly conjugated with modified
immunoglobulins of the invention. For example, the immunoglobulin
can be conjugated with biotin and any of the three broad categories
of labels mentioned above can be conjugated with avidin or
streptavidin, or vice versa. Biotin binds selectively to
streptavidin and thus, the label can be conjugated with the
immunoglobulin in this indirect manner. Alternatively, to achieve
indirect conjugation of the label with the immunoglobulin variant,
the immunoglobulin variant is conjugated with a small hapten (e.g.,
digoxin) and one of the different types of labels mentioned above
is conjugated with an anti-hapten polypeptide variant (e.g.,
anti-digoxin antibody). Thus, indirect conjugation of the label
with the immunoglobulin variant can be achieved (Hermanson, G.
(1996) in Bioconjugate Techniques Academic Press, San Diego).
[0078] The modified immunoglobulins and immunoglobulin conjugates
of the present invention may be employed in any known assay method,
such as ELISA, competitive binding assays, direct and indirect
sandwich assays, and immunoprecipitation assays (Zola, (1987)
Monoclonal Antibodies: A Manual of Techniques, pp. 147-158, CRC
Press, Inc.).
[0079] A detection label may be useful for localizing, visualizing,
and quantitating a binding or recognition event. The labeled
immunoglobulin conjugates of the invention can detect cell-surface
receptors. Another use for detectably labeled immunoglobulin
conjugates is a method of bead-based immunocapture comprising
conjugating a bead with a fluorescent labeled antibody and
detecting a fluorescence signal upon binding of a ligand. Similar
binding detection methodologies utilize the surface plasmon
resonance (SPR) effect to measure and detect antibody-antigen
interactions.
[0080] Detection labels such as fluorescent dyes and
chemiluminescent dyes (Briggs et al (1997) "Synthesis of
Functionalised Fluorescent Dyes and Their Coupling to Amines and
Amino Acids," J. Chem. Soc., Perkin-Trans. 1:1051-1058) provide a
detectable signal and are generally applicable for labeling
immunoglobulins, preferably with the following properties: (i) the
labeled immunoglobulin should produce a very high signal with low
background so that small quantities of immunoglobulins can be
sensitively detected in both cell-free and cell-based assays; and
(ii) the labeled antibody should be photostable so that the
fluorescent signal may be observed, monitored and recorded without
significant photo bleaching. For applications involving cell
surface binding of labeled antibody to membranes or cell surfaces,
especially live cells, the labels preferably (iii) have good
water-solubility to achieve effective conjugate concentration and
detection sensitivity and (iv) are non-toxic to living cells so as
not to disrupt the normal metabolic processes of the cells or cause
premature cell death.
[0081] Direct quantification of cellular fluorescence intensity and
enumeration of fluorescently labeled events, e.g. cell surface
binding of peptide-dye conjugates may be conducted on an system
(FMAT.TM. 8100 HTS System, Applied Biosystems, Foster City, Calif.)
that automates mix-and-read, non-radioactive assays with live cells
or beads (Miraglia, "Homogeneous cell- and bead-based assays for
high throughput screening using fluorometric microvolume assay
technology", (1999) J. of Biomolecular Screening 4:193-204). Uses
of labeled immunoglobulins also include cell surface receptor
binding assays, immunocapture assays, fluorescence linked
immunosorbent assays (FLISA), caspase-cleavage (Zheng, "Caspase-3
controls both cytoplasmic and nuclear events associated with
Fas-mediated apoptosis in vivo", (1998) Proc. Natl. Acad. Sci. USA
95:618-23; U.S. Pat. No. 6,372,907), apoptosis (Vermes, "A novel
assay for apoptosis. Flow cytometric detection of
phosphatidylserine expression on early apoptotic cells using
fluorescein labeled Annexin V" (1995) J. Immunol. Methods
184:39-51) and cytotoxicity assays. Fluorometric microvolume assay
technology can be used to identify the up or down regulation by a
molecule that is targeted to the cell surface (Swartzman, "A
homogeneous and multiplexed immunoassay for high-throughput
screening using fluorometric microvolume assay technology", (1999)
Anal. Biochem. 271:143-51).
[0082] Labeled immunoglobulin conjugates of the invention are
useful as imaging biomarkers and probes by the various methods and
techniques of biomedical and molecular imaging such as: (i) MRI
(magnetic resonance imaging); (ii) MicroCT (computerized
tomography); (iii) SPECT (single photon emission computed
tomography); (iv) PET (positron emission tomography) Chen et al
(2004) Bioconjugate Chem. 15:41-49; (v) bioluminescence; (vi)
fluorescence; and (vii) ultrasound. Immunoscintigraphy is an
imaging procedure in which antibodies labeled with radioactive
substances are administered to an animal or human patient and a
picture is taken of sites in the body where the antibody localizes
(U.S. Pat. No. 6,528,624). Imaging biomarkers may be objectively
measured and evaluated as an indicator of normal biological
processes, pathogenic processes, or pharmacological responses to a
therapeutic intervention. Biomarkers may be of several types: Type
0 are natural history markers of a disease and correlate
longitudinally with known clinical indices, e.g. MRI assessment of
synovial inflammation in rheumatoid arthritis; Type I markers
capture the effect of an intervention in accordance with a
mechanism-of-action, even though the mechanism may not be
associated with clinical outcome; Type II markers function as
surrogate endpoints where the change in, or signal from, the
biomarker predicts a clinical benefit to "validate" the targeted
response, such as measured bone erosion in rheumatoid arthritis by
CT. Imaging biomarkers thus can provide pharmacodynamic (PD)
therapeutic information about: (i) expression of a target protein,
(ii) binding of a therapeutic to the target protein, i.e.
selectivity, and (iii) clearance and half-life pharmacokinetic
data. Advantages of in vivo imaging biomarkers relative to
lab-based biomarkers include: non-invasive treatment, quantifiable,
whole body assessment, repetitive dosing and assessment, i.e.
multiple time points, and potentially transferable effects from
preclinical (small animal) to clinical (human) results. For some
applications, bioimaging supplants or minimizes the number of
animal experiments in preclinical studies.
[0083] Radionuclide imaging labels include radionuclides such as
.sup.3H, .sup.11C, .sup.14C, .sup.18F, .sup.32P, .sup.35S,
.sup.64Cu, .sup.68Ga, .sup.86Y, .sup.99Tc, .sup.111In, .sup.123I,
.sup.124I, .sup.125I, .sup.131I, .sup.133Xe, .sup.177Lu,
.sup.211At, or .sup.213Bi. The radionuclide metal ion can be
complexed with a chelating linker such as DOTA. Linker reagents
such as DOTA-maleimide (4-maleimidobutyramidobenzyl-DOTA) can be
prepared by the reaction of aminobenzyl-DOTA with
4-maleimidobutyric acid (Fluka) activated with
isopropylchloroformate (Aldrich), following the procedure of
Axworthy et al (2000) Proc. Natl. Acad. Sci. USA 97(4):1802-1807).
DOTA-maleimide reagents react with the free cysteine amino acids of
the modified immunoglobulins and provide a metal complexing ligand
on the antibody (Lewis et al (1998) Bioconj. Chem. 9:72-86).
Chelating linker labelling reagents such as DOTA-NHS
(1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid mono
(N-hydroxysuccinimide ester) are commercially available
(Macrocyclics, Dallas, Tex.). Receptor target imaging with
radionuclide labeled antibodies can provide a marker of pathway
activation by detection and quantitation of progressive
accumulation of antibodies in tumor tissue (Albert et al (1998)
Bioorg. Med. Chem. Lett. 8:1207-1210). The conjugated radio-metals
may remain intracellular following lysosomal degradation.
[0084] Peptide labelling methods are well known. See Haugland,
2003, Molecular Probes Handbook of Fluorescent Probes and Research
Chemicals, Molecular Probes, Inc.; Brinkley, 1992, Bioconjugate
Chem. 3:2; Garman, (1997) Non-Radioactive Labelling: A Practical
Approach, Academic Press, London; Means (1990) Bioconjugate Chem.
1:2; Glazer et al (1975) Chemical Modification of Proteins.
Laboratory Techniques in Biochemistry and Molecular Biology (T. S.
Work and E. Work, Eds.) American Elsevier Publishing Co., New York;
Lundblad, R. L. and Noyes, C. M. (1984) Chemical Reagents for
Protein Modification, Vols. I and II, CRC Press, New York;
Pfleiderer, G. (1985) "Chemical Modification of Proteins", Modern
Methods in Protein Chemistry, H. Tschesche, Ed., Walter DeGryter,
Berlin and New York; and Wong (1991) Chemistry of Protein
Conjugation and Cross-linking, CRC Press, Boca Raton, Fla.); De
Leon-Rodriguez et al (2004) Chem. Eur. J. 10:1149-1155; Lewis et al
(2001) Bioconjugate Chem. 12:320-324; Li et al (2002) Bioconjugate
Chem. 13:110-115; Mier et al (2005) Bioconjugate Chem.
16:240-237.
[0085] Peptides and proteins labeled with two moieties, a
fluorescent reporter and quencher in sufficient proximity undergo
fluorescence resonance energy transfer (FRET). Reporter groups are
typically fluorescent dyes that are excited by light at a certain
wavelength and transfer energy to an acceptor, or quencher, group,
with the appropriate Stokes shift for emission at maximal
brightness. Fluorescent dyes include molecules with extended
aromaticity, such as fluorescein and rhodamine, and their
derivatives. The fluorescent reporter may be partially or
significantly quenched by the quencher moiety in an intact peptide.
Upon cleavage of the peptide by a peptidase or protease, a
detectable increase in fluorescence may be measured (Knight, C.
(1995) "Fluorimetric Assays of Proteolytic Enzymes", Methods in
Enzymology, Academic Press, 248:18-34).
[0086] The labeled antibodies of the invention may also be used as
an affinity purification agent. In this process, the labeled
antibody is immobilized on a solid phase such a Sephadex resin or
filter paper, using methods well known in the art. The immobilized
antibody is contacted with a sample containing the antigen to be
purified, and thereafter the support is washed with a suitable
solvent that will remove substantially all the material in the
sample except the antigen to be purified, which is bound to the
immobilized polypeptide variant. Finally, the support is washed
with another suitable solvent, such as glycine buffer, pH 5.0, that
will release the antigen from the polypeptide variant.
[0087] Labelling reagents typically bear reactive functionality
which may react (i) directly with a cysteine thiol of a modified
immunoglobulin to form the labeled antibody, (ii) with a linker
reagent to form a linker-label intermediate, or (iii) with a linker
antibody to form the labeled antibody. Reactive functionality of
labelling reagents include: maleimide, haloacetyl, iodoacetamide
succinimidyl ester (e.g. NHS, N-hydroxysuccinimide),
isothiocyanate, sulfonyl chloride, 2,6-dichlorotriazinyl,
pentafluorophenyl ester, and phosphoramidite, although other
functional groups can also be used.
[0088] An exemplary reactive functional group is
N-hydroxysuccinimidyl ester (NHS) of a carboxyl group substituent
of a detectable label, e.g. biotin or a fluorescent dye. The NHS
ester of the label may be preformed, isolated, purified, and/or
characterized, or it may be formed in situ and reacted with a
nucleophilic group of an antibody. Typically, the carboxyl form of
the label is activated by reacting with some combination of a
carbodiimide reagent, e.g. dicyclohexylcarbodiimide,
diisopropylcarbodiimide, or a uronium reagent, e.g. TSTU
(O--(N-Succinimidyl)-N,N,N',N'-tetramethyluronium
tetrafluoroborate, HBTU
(O-benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
hexafluorophosphate), or HATU
(O-(7-azabenzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
hexafluorophosphate), an activator, such as 1-hydroxybenzotriazole
(HOBt), and N-hydroxysuccinimide to give the NHS ester of the
label. In some cases, the label and the antibody may be coupled by
in situ activation of the label and reaction with the antibody to
form the label-antibody conjugate in one step. Other activating and
coupling reagents include TBTU
(2-(1H-benzotriazo-1-yl)-1-1,3,3-tetramethyluronium
hexafluorophosphate), TFFH(N,N',N'',N'''-tetramethyluronium
2-fluoro-hexafluorophosphate), PyBOP
(benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium
hexafluorophosphate, EEDQ
(2-ethoxy-1-ethoxycarbonyl-1,2-dihydro-quinoline), DCC
(dicyclohexylcarbodiimide); DIPCDI (diisopropylcarbodiimide), MSNT
(1-(mesitylene-2-sulfonyl)-3-nitro-1H-1,2,4-triazole, and aryl
sulfonyl halides, e.g. triisopropylbenzenesulfonyl chloride.
[0089] It is accordingly an object of the present invention to
provide uses of the immunoglobulin conjugates as discussed in
paragraph [0007] and any and all combinations of their embodiments
as a diagnostic tool.
[0090] It is accordingly an object of the present invention to
provide uses of the immunoglobulin conjugates as discussed in
paragraph [0007] and any and all combinations of their embodiments
as a standard for high molecular weight proteins.
[0091] Immunoglobulin Polymer Conjugates
[0092] In further embodiments, the present invention also
contemplates immunoglobulin conjugates, in which an immunoglobulin
is linked with a polymer. Typically, the polymer is water soluble
so that an immunoglobulin component does not precipitate in an
aqueous environment, such as a physiological environment. An
example of a suitable polymer is one that has been modified to have
a single reactive group, such as an active ester for acylation, or
an aldehyde for alkylation. In this way, the degree of
polymerization can be controlled. An example of a reactive aldehyde
is polyethylene glycol propionaldehyde, or mono-(C.sub.1-C.sub.10)
alkoxy, or aryloxy derivatives thereof (see, for example, Harris,
et al., U.S. Pat. No. 5,252,714). The polymer may be branched or
unbranched. Moreover, a mixture of polymers can be used to produce
conjugates with antibody components.
[0093] Suitable water-soluble polymers include, without limitation,
polyethylene glycol (PEG), monomethoxy-PEG,
mono-(C.sub.1-C.sub.10)alkoxy-PEG, aryloxy-PEG, poly-(N-vinyl
pyrrolidone)PEG, tresyl monomethoxy PEG, PEG propionaldehyde,
bis-succinimidyl carbonate PEG, propylene glycol homopolymers, a
polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated
polyols (e.g., glycerol), polyvinyl alcohol, dextran, cellulose, or
other carbohydrate-based polymers. Suitable PEG may have a
molecular weight from about 600 to about 60,000, including, for
example, 5,000, 12,000, 20,000 and 25,000. A conjugate can also
comprise a mixture of such water-soluble polymers.
[0094] As an illustration, a polyalkyl oxide moiety can be attached
to the N-terminus of an immunoglobulin component. PEG is one
suitable polyalkyl oxide. For example, an immunoglobulin can be
modified with PEG, a process known as "PEGylation." PEGylation of
an immunoglobulin can be carried out by any of the PEGylation
reactions known in the art (see, for example, EP 0 154 316, Delgado
et al., Critical Reviews in Therapeutic Drug Carrier Systems 9:249
(1992), Duncan and Spreafico, Clin. Pharmacokinet. 27:290 (1994),
and Francis et al., Int J Hematol 68:1 (1998)). For example,
PEGylation can be performed by an acylation reaction or by an
alkylation reaction with a reactive polyethylene glycol molecule.
In an alternative approach, immunoglobulin conjugates are formed by
condensing activated PEG, in which a terminal hydroxy or amino
group of PEG has been replaced by an activated linker (see, for
example, Karasiewicz et al., U.S. Pat. No. 5,382,657).
[0095] PEGylation by acylation typically requires reacting an
active ester derivative of PEG with an immunoglobulin. An example
of an activated PEG ester is PEG esterified to
N-hydroxysuccinimide. As used herein, the term "acylation" includes
the following types of linkages between an immunoglobulin and a
water soluble polymer: amide, carbamate, urethane, and the like.
Methods for preparing PEGylated anti-BCMA-TACI immunoglobulins by
acylation will typically comprise the steps of (a) reacting an
immunoglobulin with PEG (such as a reactive ester of an aldehyde
derivative of PEG) under conditions whereby one or more PEG groups
attach to the immunoglobulin, and (b) obtaining the reaction
product(s). Generally, the optimal reaction conditions for
acylation reactions will be determined based upon known parameters
and desired results. For example, the larger the ratio of
PEG:antibody component, the greater the percentage of polyPEGylated
antibody component product.
[0096] The product of PEGylation by acylation is typically a
polyPEGylated immunoglobulin product, wherein the lysine
.epsilon.-amino groups are PEGylated via an acyl linking group. An
example of a connecting linkage is an amide. Typically, the
resulting immunoglobulin component will be at least 95% mono-, di-,
or tri-pegylated, although some species with higher degrees of
PEGylation may be formed depending upon the reaction conditions.
PEGylated species can be separated from unconjugated immunoglobulin
components using standard purification methods, such as dialysis,
ultrafiltration, ion exchange chromatography, affinity
chromatography, and the like.
[0097] PEGylation by alkylation generally involves reacting a
terminal aldehyde derivative of PEG with an immunoglobulin
component in the presence of a reducing agent. PEG groups can be
attached to the polypeptide via a --CH.sub.2--NH group.
[0098] Derivatization via reductive alkylation to produce a
monoPEGylated product takes advantage of the differential
reactivity of different types of primary amino groups available for
derivatization. Typically, the reaction is performed at a pH that
allows one to take advantage of the pKa differences between the
.epsilon.-amino groups of the lysine residues and the .alpha.-amino
group of the N-terminal residue of the protein. By such selective
derivatization, attachment of a water-soluble polymer that contains
a reactive group such as an aldehyde, to a protein is controlled.
The conjugation with the polymer occurs predominantly at the
N-terminus of the protein without significant modification of other
reactive groups such as the lysine side chain amino groups.
[0099] Reductive alkylation to produce a substantially homogenous
population of monopolymer antibody component conjugate molecule can
comprise the steps of: (a) reacting an antibody component with a
reactive PEG under reductive alkylation conditions at a pH suitable
to permit selective modification of the .alpha.-amino group at the
amino terminus of the antibody component, and (b) obtaining the
reaction product(s). The reducing agent used for reductive
alkylation should be stable in aqueous solution and preferably be
able to reduce only the Schiff base formed in the initial process
of reductive alkylation. Preferred reducing agents include sodium
borohydride, sodium cyanoborohydride, dimethylamine borane,
trimethylamine borane, and pyridine borane.
[0100] For a substantially homogenous population of monopolymer
immunoglobulin conjugates, the reductive alkylation reaction
conditions are those which permit the selective attachment of the
water soluble polymer moiety to the N-terminus of the
immunoglobulin. Such reaction conditions generally provide for pKa
differences between the lysine amino groups and the .alpha.-amino
group at the N-terminus. The pH also affects the ratio of polymer
to protein to be used. In general, if the pH is lower, a larger
excess of polymer to protein will be desired because the less
reactive the N-terminal .alpha.-group, the more polymer is needed
to achieve optimal conditions. If the pH is higher, the polymer:
antibody component need not be as large because more reactive
groups are available. Typically, the pH will fall within the range
of 3 to 9, or 3 to 6.
[0101] General methods for producing conjugates comprising a
polypeptide and water-soluble polymer moieties are known in the
art. See, for example, Karasiewicz et al., U.S. Pat. No. 5,382,657,
Greenwald et al., U.S. Pat. No. 5,738,846, Nieforth et al., Clin.
Pharmacol. Ther. 59:636 (1996), Monkarsh et al., Anal Biochem.
247:434 (1997)).
[0102] Immunoglobulin Drug Conjugates
[0103] In further embodiments, the present invention includes
immunoglobulin conjugates in which an immunoglobulin is conjugated
to a drug or cytotoxic moiety. The drug moiety of the
immunoglobulin drug conjugates may, for example, include any
compound, moiety or group which has a cytotoxic or cytostatic
effect. Drug moieties include, without limitation: (i)
chemotherapeutic agents, which may function as microtubulin
inhibitors, mitosis inhibitors, topoisomerase inhibitors, or DNA
intercalators; (ii) protein toxins, which may function
enzymatically; and (iii) radioisotopes.
[0104] Exemplary drug moieties include, but are not limited to, a
maytansinoid, an auristatin, a dolastatin, a trichothecene, CC1065,
a calicheamicin and other enediyne antibiotics, a taxane, an
anthracycline, and stereoisomers, isosteres, analogs or derivatives
thereof.
[0105] Maytansine compounds suitable for use as maytansinoid drug
moieties are well known in the art, and can be isolated from
natural sources according to known methods, produced using genetic
engineering techniques (see Yu et al (2002) PROC. NAT. ACAD. SCI.
(USA) 99:7968-7973), or maytansinol and maytansinol analogues
prepared synthetically according to known methods.
[0106] Exemplary maytansinoid drug moieties include those having a
modified aromatic ring, such as: C-19-dechloro (U.S. Pat. No.
4,256,746) (prepared by lithium aluminum hydride reduction of
ansamytocin P2); C-20-hydroxy (or C-20-demethyl)+/-C-19-dechloro
(U.S. Pat. Nos. 4,361,650 and 4,307,016) (prepared by demethylation
using Streptomyces or Actinomyces or dechlorination using LAH); and
C-20-demethoxy, C-20-acyloxy (--OCOR), +/-dechloro (U.S. Pat. No.
4,294,757) (prepared by acylation using acyl chlorides) and those
having modifications at other positions.
[0107] Exemplary maytansinoid drug moieties also include those
having modifications such as: C-9-SH (U.S. Pat. No. 4,424,219)
(prepared by the reaction of maytansinol with H.sub.2S or
P.sub.2S.sub.5); C-14-alkoxymethyl(demethoxy/CH.sub.2 OR) (U.S.
Pat. No. 4,331,598); C-14-hydroxymethyl or acyloxymethyl
(CH.sub.2OH or CH.sub.2OAc) (U.S. Pat. No. 4,450,254) (prepared
from Nocardia); C--I 5-hydroxy/acyloxy (U.S. Pat. No. 4,364,866)
(prepared by the conversion of maytansinol by Streptomyces);
C-15-methoxy (U.S. Pat. Nos. 4,313,946 and 4,315,929) (isolated
from Trewia nudlflora); C-18-N-demethyl (U.S. Pat. Nos. 4,362,663
and 4,322,348) (prepared by the demethylation of maytansinol by
Streptomyces); and 4,5-deoxy (U.S. Pat. No. 4,371,533) (prepared by
the titanium trichloride/LAH reduction of maytansinol). Many
positions on maytansine compounds are known to be useful as the
linkage position, depending upon the type of link. For example, for
forming an ester linkage, the C-3 position having a hydroxyl group,
the C-14 position modified with hydroxymethyl, the C-15 position
modified with a hydroxyl group and the C-20 position having a
hydroxyl group are all suitable.
[0108] Maytansine compounds inhibit cell proliferation by
inhibiting the formation of microtubules during mitosis through
inhibition of polymerization of the microtubulin protein, tubulin
(Remillard et al (1975) Science 189:1002-1005). Maytansine and
maytansinoids are highly cytotoxic but their clinical use in cancer
therapy has been greatly limited by their severe systemic
side-effects primarily attributed to their poor selectivity for
tumors. Clinical trials with maytansine had been discontinued due
to serious adverse effects on the central nervous system and
gastrointestinal system (Issel et al (1978) Can. Treatment. Rev.
5:199-207).
[0109] Maytansinoid drug moieties are attractive drug moieties in
immunoglobulin drug conjugates because they are: (i) relatively
accessible to prepare by fermentation or chemical modification,
derivatization of fermentation products, (ii) amenable to
derivatization with functional groups suitable for conjugation
through the non-disulfide linkers to antibodies, (iii) stable in
plasma, and (iv) effective against a variety of tumor cell lines
(US 2005/0169933; WO 2005/037992; U.S. Pat. No. 5,208,020).
[0110] As with other drug moieties, all stereoisomers of the
maytansinoid drug moiety are contemplated for the compounds of the
invention.
[0111] The drug moiety of the immunoglobulin drug conjugates also
include dolastatins and their peptidic analogs and derivatives, the
auristatins (U.S. Pat. Nos. 5,635,483; 5,780,588). Dolastatins and
auristatins have been shown to interfere with microtubule dynamics,
GTP hydrolysis, and nuclear and cellular division (Woyke et al
(2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have
anticancer (U.S. Pat. No. 5,663,149) and antifungal activity
(Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965).
Various forms of a dolastatin or auristatin drug moiety may be
covalently attached to an antibody through the N (amino) terminus
or the C (carboxyl) terminus of the peptidic drug moiety (WO
02/088172; Doronina et al (2003) Nature Biotechnology
21(7):778-784; Francisco et al (2003) Blood 102(4):1458-1465).
[0112] Exemplary auristatin embodiments include the N-terminus
linked monomethylauristatin drug moieties DE and DF, disclosed in:
WO 2005/081711; Senter et al, Proceedings of the American
Association for Cancer Research, Volume 45, Abstract Number 623,
presented Mar. 28, 2004, the disclosure of each which are expressly
incorporated by reference in their entirety.
[0113] Typically, peptide-based drug moieties can be prepared by
forming a peptide bond between two or more amino acids and/or
peptide fragments. Such peptide bonds can be prepared, for example,
according to the liquid phase synthesis method (see E. Schroder and
K. Luibke, "The Peptides", volume 1, pp 76-136, 1965, Academic
Press) that is well known in the field of peptide chemistry.
[0114] The drug moiety includes calicheamicin, and analogs and
derivatives thereof. The calicheamicin family of antibiotics are
capable of producing double-stranded DNA breaks at sub-picomolar
concentrations. For the preparation of conjugates of the
calicheamicin family, see U.S. Pat. Nos. 5,712,374; 5,714,586;
5,739,116; 5,767,285; 5,770,701, 5,770,710; 5,773,001; 5,877,296.
Structural analogues of calicheamicin which may be used include,
but are not limited to, .gamma..sub.1.sup.I, .alpha..sub.2.sup.I,
.alpha..sub.3.sup.I, N-acetyl-.gamma..sub.1.sup.I, PSAG and
.theta..sup.I.sub.1 (Hinman et al Cancer Research 53:3336-3342
(1993), Lode et al Cancer Research 58:2925-2928 (1998).
[0115] Protein toxins include, for example, diphtheria A chain,
nonbinding active fragments of diphtheria toxin, exotoxin A chain
(from Pseudomonas aeruginosa), ricin A chain (Vitetta et al (1987)
Science, 238:1098), abrin A chain, modeccin A chain, alpha-sarcin,
Aleurites fordii proteins, dianthin proteins, Phytolaca americana
proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor,
curcin, crotin, sapaonaria officinalis inhibitor, gelonin,
mitogellin, restrictocin, phenomycin, enomycin, and the
tricothecenes (WO 93/21232).
[0116] Therapeutic radioisotopes include, for example, .sup.32P,
.sup.33P, .sup.90Y, .sup.125I, .sup.131I, .sup.131In, .sup.153Sm,
.sup.186Re, .sup.188Re, .sup.211At, .sup.212Bi, .sup.212Pb, and
radioactive isotopes of Lu.
[0117] The radioisotope or other labels may be incorporated in the
conjugate in known ways (Fraker et al (1978) Biochem. Biophys. Res.
Commun. 80: 49-57; "Monoclonal Antibodies in Immunoscintigraphy"
Chatal, CRC Press 1989). Carbon-14-labeled
1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
(MX-DTPA) is an exemplary chelating agent for conjugation of a
radionuclide to the antibody (WO 94/11026).
[0118] Linkers
[0119] In certain embodiments of the present invention, the
immunoglobulin conjugate includes a linker molecule having at least
two reactive sites. One reactive site is bound to the substituted
cysteine residue of the immunoglobulin, and the other reactive site
is bound to an atom or molecule. A "linker" is a bifunctional or
multifunctional moiety which can be used to link one or more drug
moieties and an immunoglobulin unit to form immunoglobulin
conjugates. Immunoglobulin conjugates can be conveniently prepared
using a linker having reactive functionality for binding to the
drug or other molecule and to the immunoglobulin. A cysteine thiol
of a modified immunoglobulin with a substitution to cysteine can
form a bond with a functional group of a linker reagent, a drug
moiety or drug-linker intermediate.
[0120] In one aspect, a linker has a reactive site which has an
electrophilic group that is reactive to a nucleophilic cysteine
present on an antibody. The cysteine thiol of the antibody is
reactive with an electrophilic group on a linker and forms a
covalent bond to a linker. Useful electrophilic groups include, but
are not limited to, maleimide and haloacetamide groups.
[0121] Modified immunoglobulins of the invention react with linker
reagents or drug-linker intermediates, with electrophilic
functional groups such as maleimide or .alpha.-halo carbonyl,
according to the conjugation method at page 766 of Klussman, et al
(2004), Bioconjugate Chemistry 15(4):765-773.
[0122] The linker may comprise amino acid residues. The amino acid
unit, when present, links the immunoglobulin to the drug moiety of
the immunoglobulin drug conjugates of the invention.
[0123] The amino acid linker may be, for example, a dipeptide,
tripeptide, tetrapeptide, pentapeptide, hexapeptide, heptapeptide,
octapeptide, nonapeptide, decapeptide, undecapeptide or
dodecapeptide unit. Amino acid residues which comprise the amino
acid unit include those occurring naturally, as well as minor amino
acids and non-naturally occurring amino acid analogs, such as
citrulline.
[0124] The Amino Acid unit can be enzymatically cleaved by one or
more enzymes, including a tumor-associated protease, to liberate
the drug moiety.
[0125] In another embodiment, the linker may be a dendritic type
linker for covalent attachment of more than one drug moiety through
a branching, multifunctional linker moiety to an antibody (Sun et
al (2002) Bioorganic & Medicinal Chemistry Letters
12:2213-2215; Sun et al (2003) Bioorganic & Medicinal Chemistry
11:1761-1768). Dendritic linkers can increase the molar ratio of
drug to antibody, i.e. loading, which is related to the potency of
the immunoglobulin drug conjugate. Thus, where a modified
immunoglobulin bears only one reactive cysteine thiol group, a
multitude of drug moieties may be attached through a dendritic
linker.
[0126] In another embodiment, the linker may be substituted with
groups which modulated solubility or reactivity. For example, a
charged substituent such as sulfonate (--SO.sub.3.sup.-) or
ammonium, may increase water solubility of the reagent and
facilitate the coupling reaction of the linker reagent with the
immunoglobulin or the drug moiety, or facilitate the coupling
reaction of the immunoglobulin-linker intermediate with the drug
moiety, or the drug-linker intermediate with the immunoglobulin,
depending on the synthetic route employed to prepare the
immunoglobulin conjugate.
[0127] The compounds of the invention expressly contemplate, but
are not limited to, immunoglobulin conjugates prepared with linker
reagents: BMPEO, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP,
SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS,
sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB
(succinimidyl-(4-vinylsulfone)benzoate), and including
bis-maleimide reagents: DTME, BMB, BMDB, BMH, BMOE, BM(PEO).sub.3,
and BM(PEO).sub.4, which are commercially available from Pierce
Biotechnology, Inc., Customer Service Department, P.O. Box 117,
Rockford, Ill. 61105 U.S.A, U.S.A 1-800-874-3723, International
+815-968-0747. See pages 467-498, 2003-2004 Applications Handbook
and Catalog. Bis-maleimide reagents allow the attachment of the
thiol group of a cysteine to a thiol-containing drug moiety, label,
or linker intermediate, in a sequential or concurrent fashion.
Other functional groups besides maleimide, which are reactive with
a thiol group of a cysteine, drug moiety, label, or linker
intermediate include, without limitation, iodoacetamide,
bromoacetamide, vinyl pyridine, disulfide, pyridyl disulfide,
isocyanate, and isothiocyanate.
[0128] It is accordingly an object of the present invention to
provide immunoglobulin conjugates comprising an immunoglobulin
having at least one mutation at a residue selected from the group
consisting of 7(V.sub.H), 20(V.sub.L), 22(V.sub.L), 25(V.sub.H),
125(C.sub.H1), 248(C.sub.H2), 254(C.sub.H2), 286(C.sub.H2),
298(C.sub.H2), and 326(C.sub.H2), wherein the at least one mutation
is a substitution with a cysteine residue, and an atom or molecule,
wherein the atom or molecule is conjugated to the cysteine residue.
In certain embodiments, the at least one mutation is at a residue
selected from the group consisting of 7(V.sub.H), 20(V.sub.L),
22(V.sub.L) and 125(C.sub.H1). In certain embodiments, the at least
one mutation is at a residue selected from the group consisting of
248(C.sub.H2) and 326(C.sub.H2). In certain embodiments, the at
least one mutation is at a residue selected from the group
consisting of 25(V.sub.H) and 286(C.sub.H2). In certain
embodiments, the at least one mutation is at residue selected from
the group consisting of 254(C.sub.H2) and 298(V.sub.H). In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin is selected from the group comprising IgG1,
IgG2, IgG3, and IgG4. In certain embodiments that may be combined
with the preceding embodiments, the immunoglobulin comprises an
IgG1. In certain embodiments that may be combined with the
preceding embodiments, the immunoglobulin conjugate comprises a
human C.sub.H1 domain. In certain embodiments that may be combined
with the preceding embodiments, the immunoglobulin conjugate
comprises a human C.sub.H2 domain. In certain embodiments that may
be combined with the preceding embodiments, the immunoglobulin
conjugate comprises a human C.sub.H3 domain. In certain embodiments
that may be combined with the preceding embodiments, the
immunoglobulin conjugate comprises a human C.sub.L domain. In
certain embodiments that may be combined with the preceding
embodiments, the immunoglobulin conjugate comprises a human V.sub.H
domain. In certain embodiments that may be combined with the
preceding embodiments, the immunoglobulin conjugate comprises a
human V.sub.L domain. In certain embodiments that may be combined
with the preceding embodiments, the immunoglobulin conjugate
further comprises a linker molecule having at least two reactive
sites, wherein a first reactive site is bound to the cysteine
residue of the immunoglobulin and a second reactive site is bound
to the atom or molecule. In certain embodiments that may be
combined with the preceding embodiments having a linker molecule,
the linker molecule is selected from the group consisting of a
hydrazone, a disulfide, a peptide, a chelating agent, and a
maleimide. In certain embodiments that may be combined with the
preceding embodiments, the atom or molecule is selected from the
group consisting of a radionuclide, a chemotherapeutic agent, a
microbial toxin, a plant toxin, a polymer, a carbohydrate, a
cytokine, a fluorescent label, a luminescent label, an
enzyme-substrate label, an enzyme, a peptide, a peptidomimetic, a
nucleotide, an siRNA, a microRNA, an RNA mimetic, and an aptamer.
In certain embodiments that may be combined with the preceding
embodiments, the atom or molecule is selected from the group
consisting of .sup.90Y, .sup.131I, .sup.67Cu, .sup.177Lu,
.sup.213Bi, .sup.211At, a calicheamicin, a duocarmycin, a
maytanisoid, an auristatin, an anthracyclin, Pseudomonas exotoxin
A, Diphtheria toxin, ricin, polyethylene glycol, hydroxyethyl
starch, and a mannosyl residue. In certain embodiments that may be
combined with the preceding embodiments, the atom or molecule
reduces the immunogenicity of the unmutated immunoglobulin. In
certain embodiments that may be combined with the preceding
embodiments, the atom or molecule increases the immunogenicity of
the unmutated immunoglobulin. In certain embodiments that may be
combined with the preceding embodiments, the immunoglobulin
conjugate further comprises an antigen binding activity and the
activity is at least eighty percent, at least ninety percent, at
least one hundred percent, at least one hundred ten percent, at
least one hundred twenty percent, or at least one hundred thirty
percent of the antigen binding activity of the unmutated
immunoglobulin.
[0129] It is accordingly an object of the present invention to
provide modified or isolated immunoglobulins comprising at least
one mutation at a residue selected from the group consisting of
7(V.sub.H), 20(V.sub.L), 22(V.sub.L), 25(V.sub.H), 125(C.sub.H1),
248(C.sub.H2), 254(C.sub.H2), 286(C.sub.H2), and 326(C.sub.H2),
wherein the at least one mutation is a substitution with a cysteine
residue. In certain embodiments the at least one mutation is at a
residue selected from the group consisting of 7(V.sub.H),
20(V.sub.L), 22(V.sub.L) and 125(C.sub.H1). In certain embodiments
the at least one mutation is at a residue selected from the group
consisting of 248(C.sub.H2) and 326(C.sub.H2). In certain
embodiments the at least one mutation is at a residue selected from
the group consisting of 25(V.sub.H) and 286(C.sub.H2). In certain
embodiments the at least one mutation is at residue 254(C.sub.H2).
In certain embodiments that may be combined with the preceding
embodiments, the immunoglobulin is selected from the group
comprising IgG1, IgG2, IgG3, and IgG4. In certain embodiments that
may be combined with the preceding embodiments, the immunoglobulin
comprises an IgG1. In certain embodiments that may be combined with
the preceding embodiments, the modified or isolated immunoglobulin
comprises a human C.sub.H1 domain. In certain embodiments that may
be combined with the preceding embodiments, the modified or
isolated immunoglobulin comprises a human C.sub.H2 domain. In
certain embodiments that may be combined with the preceding
embodiments, the modified or isolated immunoglobulin comprises a
human C.sub.H3 domain. In certain embodiments that may be combined
with the preceding embodiments, the modified or isolated
immunoglobulin comprises a human C.sub.L domain. In certain
embodiments that may be combined with the preceding embodiments,
the modified or isolated immunoglobulin comprises a human V.sub.H
domain. In certain embodiments that may be combined with the
preceding embodiments, the modified or isolated immunoglobulin
comprises a human V.sub.L domain. In certain embodiments that may
be combined with the preceding embodiments, the immunoglobulin
further comprises an antigen binding activity and the activity is
at least eighty percent, at least ninety percent, at least one
hundred percent, at least one hundred ten percent, at least one
hundred twenty percent, or at least one hundred thirty percent of
the antigen binding activity of the unmutated immunoglobulin.
[0130] Preparation of Immunoglobulin Drug Conjugates
[0131] In one aspect, the present invention includes methods of
producing immunoglobulin conjugates. The immunoglobulin drug
conjugate may be prepared by several routes, employing organic
chemistry reactions, conditions, and reagents known to those
skilled in the art, including: (1) reaction of a cysteine group of
a modified immunoglobulin with a linker reagent, to form an
immunoglobulin-linker intermediate, via a covalent bond, followed
by reaction with an activated drug moiety; and (2) reaction of a
nucleophilic group of a drug moiety with a linker reagent, to form
a drug-linker intermediate, via a covalent bond, followed by
reaction with a cysteine group of a modified immunoglobulin.
Conjugation methods (1) and (2) may be employed with a variety of
modified immunoglobulins, drug moieties, and linkers to prepare the
immunoglobulin drug conjugates of the invention.
[0132] Antibody cysteine thiol groups are nucleophilic and capable
of reacting to form covalent bonds with electrophilic groups on
linker reagents and drug-linker intermediates including: (i) active
esters such as NHS esters, HOBt esters, haloformates, and acid
halides; (ii) alkyl and benzyl halides, such as haloacetamides;
(iii) aldehydes, ketones, carboxyl, and maleimide groups; and (iv)
disulfides, including pyridyl disulfides, via sulfide exchange.
Nucleophilic groups on a drug moiety include, but are not limited
to: amine, thiol, hydroxyl, hydrazide, oxime, hydrazine,
thiosemicarbazone, hydrazine carboxylate, and arylhydrazide groups
capable of reacting to form covalent bonds with electrophilic
groups on linker moieties and linker reagents.
[0133] Maytansine may, for example, be converted to May-SSCH.sub.3,
which can be reduced to the free thiol, May-SH, and reacted with a
modified antibody (Chari et al (1992) Cancer Research 52:127-131)
to generate a maytansinoid-antibody immunoconjugate with a
disulfide linker. Antibody-maytansinoid conjugates with disulfide
linkers have been reported (WO 04/016801; U.S. Pat. No. 6,884,874;
US 2004/039176 A1; WO 03/068144; US 2004/001838 A1; U.S. Pat. Nos.
6,441,163, 5,208,020, 5,416,064; WO 01/024763). The disulfide
linker SPP is constructed with linker reagent N-succinimidyl
4-(2-pyridylthio)pentanoate.
[0134] Under certain conditions, the modified immunoglobulins may
be made reactive for conjugation with linker reagents by treatment
with a reducing agent such as DTT (Cleland's reagent,
dithiothreitol) or TCEP (tris(2-carboxyethyl)phosphine
hydrochloride; Getz et al (1999) Anal. Biochem. Vol 273:73-80;
Soltec Ventures, Beverly, Mass.) or other reducing agents known to
one of skill in the art.
[0135] It is accordingly an object of the present invention to
provide methods of producing immunoglobulin conjugates by providing
modified or isolated immunoglobulins as discussed in paragraphs
[0008] or [0019] and any and all combinations of their embodiments,
reducing the one or more substituted cysteine residues with a
reducing agent to form reduced cysteine residues, and incubating
the immunoglobulin with an atom or molecule, wherein the atom or
molecule is reactive with the reduced cysteine residues, to form an
immunoglobulin conjugate.
[0136] Spatial-Aggregation-Propensity
[0137] In one aspect, the invention herein relates to methods for
selecting residues on a protein surface to mutate to cysteine and
for reducing cross-linking of a modified immunoglobulin or
immunoglobulin conjugate. The invention may be applied to generate
immunoglobulins and immunoglobulin conjugates with reduced
propensity for cross-linking, i.e., the immunoglobulin or
immunoglobulin conjugate in concentrated solution remains primarily
in monomeric form rather than higher order aggregated multimers.
The methods herein represent an advancement in the ability of
computational methods to evaluate the propensity of a protein to
cross-link. In particular, the methods are based, at least in part,
on the calculation of the SAA (Solvent Accessible Area), which is
known in the art for characterizing the surface of a protein. SAA
gives the surface area of each amino acid or protein structure that
is in contact with the solvent. SAA may be typically calculated by
computing the locus of the center of a probe sphere as it rolls
over the protein surface, i.e., the surface of a protein structural
model. The probe sphere has the same radius as that of a water
molecule, R=1.4 .ANG.. Alternative methods of calculating SAA,
described below, are known in the art and are compatible with the
methods described herein. Although SAA is quite useful to
characterize the protein surface, it was not found to be adequate
to characterize the hydrophobic patches on the protein surface that
are potentially aggregation prone because of the following
shortcomings, [0138] 1. SAA doesn't distinguish between hydrophobic
and hydrophilic regions [0139] 2. SAA is not directly proportional
to a residue's hydrophobicity (for example, MET has more surface
area than LEU but is less hydrophobic) [0140] 3. SAA doesn't
indicate whether several hydrophobic residues are close-by and thus
could enhance the hydrophobicity of a certain region. These
residues could be close-by either in primary sequence or in the
tertiary structure even though they are far in primary sequence.
Either way, they could enhance the hydrophobicity of a certain
patch on the antibody surface.
[0141] One measure which is described herein, the Effective-SAA, is
generated by calculating the hydrophobicity of the fraction of the
amino acid which is exposed according to the formula below:
Effective - SAA = SAA SAA fully exposed .times. Residue
hydrophobicity ##EQU00001##
[0142] A further embodiment of the Effective-SAA further comprises
summing the Effective-SAA over at least two, at least three, at
least four, at least five or at least six, (e.g., two, three, four,
five, six, etc.) amino acid residues which are adjacent in the
primary protein sequence. Although the Effective-SAA represents an
improvement over the basic SAA, it nevertheless lacks the ability
to fully account for the structure of the folded protein and for
the fact that amino acids which are not adjacent in the protein
sequence may be in proximity to one another in the folded
secondary, tertiary, or quaternary structure of a protein. Such
protein folds may form aggregation prone regions which do not
appear in the primary structure alone, or which may only be
detected by more robustly analyzing the folded protein
structure.
[0143] The present invention provides a new, more advanced measure,
called the Spatial-Aggregation-Propensity, which will highlight the
effective hydrophobicity of a certain patch or region on the
protein surface. The Spatial-Aggregation-Propensity is calculated
for defined spatial regions on or near the atoms of a protein
structural model.
[0144] In this context, a "defined spatial region" is a
three-dimensional space or volume chosen to capture a local
physical structure and/or chemical environment on or near the
protein structure. In a particularly preferred embodiment the
Spatial-Aggregation-Propensity is calculated for spherical regions
with radius R centered on atoms in a protein (e.g., atoms in a
protein structural model). The Spatial-Aggregation-Propensity may
also be calculated for spherical regions with radius R centered on
chemical bonds, or positioned in space near the structural model.
Accordingly, in another embodiment the SAP may be calculated for a
defined spatial region centered near an atom, e.g., centered on a
point in space which is between 1-10 .ANG., 1-5 .ANG., or 1-2 .ANG.
from the center of a particular atom or chemical bond.
[0145] In certain embodiments, the chosen radius R is between 1
.ANG. and 50 .ANG.. In particular embodiments the chosen radius is
at least 1 .ANG., at least 3 .ANG., at least 4 .ANG., at least 5
.ANG., at least 6 .ANG., at least 7 .ANG., at least 8 .ANG., at
least 9 .ANG., at least 10 .ANG., at least 11 .ANG., at least 12
.ANG., at least 15 .ANG., at least 20 .ANG., at least 25 .ANG., or
at least 30 .ANG.. In certain embodiments, the chosen radius is
between 5 .ANG. and 15 .ANG., between 5 .ANG. and 12 .ANG., or
between 5 .ANG. and 10 .ANG.. In specific embodiments the chosen
radius is 5 .ANG. or 10 .ANG..
[0146] In other embodiments, the region for which the
Spatial-Aggregation-Propensity is calculated is not spherical. The
possible shape of the region may further comprise a cube, a
cylinder, a cone, an elliptical spheroid, a pyramid, a hemisphere,
or any other shape which may be used to enclose a portion of space.
In such embodiments, the size of the region may be chosen using
measures other than radius, e.g., the distance from the center of
the shape to a face or vertex.
[0147] In a certain embodiment, the SAP may be used to select
residues in a protein, particularly an antibody or immunoglobulin,
which may be substituted with cysteine without increasing the
protein's propensity to cross-link. The present invention is
expected to streamline the process of identifying residues that can
be substituted with cysteine without increasing the propensity for
cross-linking.
[0148] Thus, in general terms, a method for calculating the
Spatial-Aggregation-Propensity for a particular atom in a protein
comprises (a) identifying one or more atoms in a structural model
representing the protein, wherein the one or more atoms are within
a defined spatial region centered on or near the particular atom;
(b) calculating, for each of the one or more atoms in the defined
spatial region, a ratio of the solvent accessible area (SAA) of the
atoms to the SAA of atoms in an identical residue which is fully
exposed; (c) multiplying each ratio by the atom hydrophobicity of
the one or more atoms; and (d) summing the products of step (c);
whereby the sum is the SAP for the particular atom.
[0149] In a related embodiment, the SAP may be calculated according
to a different method comprising (a) identifying one or more amino
acid residues in a structural model representing the protein,
wherein the one or more amino acid residues have at least one atom
within a defined spatial region centered on or near the particular
atom; (b) calculating, for each of the identified one or more amino
acid residues, a ratio of the solvent accessible area (SAA) of
atoms in the amino acid to the SAA of atoms in an identical residue
which is fully exposed; (c) multiplying each ratio by the
hydrophobicity of the one or more amino acid residues as determined
by an amino acid hydrophobicity scale; and (d) summing the products
of step (c); whereby the sum is the SAP for the particular atom. In
preferred embodiments, the structural model is processed prior to
step (a) by allowing the structural model to interact with solvent
in a molecular dynamics simulation. When an amino acid is
identified as having at least one atom within the defined spatial
region, the at least one atom may be required to be exclusively an
atom in an amino acid side chain. Alternatively it may be an atom
required to be a main chain atom.
[0150] In other embodiments, this method may further comprise
optionally conducting a molecular dynamics simulation prior to step
(a) and repeating steps (a)-(d), each time conducting a further
molecular dynamics simulation at a plurality of time steps, thereby
producing multiple sums as in step (d), and calculating the average
of the sums; whereby the calculated average is the SAP for the
particular atom.
[0151] One of skill in the art will appreciate that an embodiment
of the present invention which employs the average of values
calculated over a molecular dynamics simulation will be more
computationally intensive. Such an embodiment will also, in some
cases, provide a more precise or highly resolved map of the
Spatial-Aggregation-Propensity. However, experiments discussed
herein have shown that the method is still highly accurate when the
molecular dynamics averaging is not employed. In one preferred
embodiment, Spatial-Aggregation-Propensity values may be calculated
for all protein structures in a database, e.g., the Protein Data
Bank (PDB), thereby swiftly identifying hydrophobic residues and
patches on all known protein structures. This method allows rapid
screening of large sets of proteins to identify potential
aggregation prone regions and/or protein interaction sites.
[0152] In a preferred application, the
Spatial-Aggregation-Propensity is described
[0153] by the following formula:
SAP.sub.atom=.SIGMA..sub.Simulation Average(.SIGMA..sub.atoms
within R of atom((SAA-R/SAA-fe)*atom-hb)
[0154] wherein: [0155] 1) SAA-R is SAA of side chain atoms within
radius R which is computed at each simulation snapshot. SAA is
preferably calculated in the simulation model by computing the
locus of the center of a probe sphere as it rolls over the protein
surface. The probe sphere has the same radius as that of a water
molecule, R=1.4 A. One of skill in the art will appreciate that
other methods of computing the SAA would be compatible with the
methods described here to calculate SAP. For example, the SAA may
be calculated on only amino acid side chain atoms. The SAA may also
be calculated on only amino acid main chain atoms (i.e., those
atoms of the peptide backbone and associated hydrogens).
Alternatively, the SAA may be calculated on only amino acid main
chain atoms with the exclusion of associated hydrogens; [0156] 2)
SAA-fe is SAA of side chain of fully exposed residue (say for amino
acid `X`) which is obtained, in a preferred embodiment, by
calculating the SAA of side chains of the middle residue in the
fully extended conformation of tripeptide `Ala-X-Ala`; and [0157]
3) atom-hb is Atom Hydrophobicity which is obtained as described
above using the hydrophobicity scale of Black and Mould (Black and
Mould, Anal. Biochem. 1991, 193, 72-82). The scale is normalized
such that Glycine has a hydrophobicity of zero. Therefore, amino
acids that are more hydrophobic than Glycine are positive and less
hydrophobic than Glycine are negative on the hydrophobic scale.
[0158] A residue which is "fully exposed" is a residue, X, in the
fully extended conformation of the tripeptide Ala-X-Ala. One of
skill in the art will appreciate that this arrangement is designed
such that a calculation of SAA on such a residue, X, will yield the
maximum solvent accessible area available. Accordingly, it is
contemplated that other residues besides alanine may be used in the
calculation without wholly disrupting or altering the results.
[0159] As described above, the methods of the present invention may
be applied to any protein structural model including an X-ray
structure using the same formula as above.
[0160] Similarly, if the X-ray structure is not available, the same
Spatial-Aggregation-Propensity parameter can be applied to the
structure generated through homology modeling, and the SAP
parameter may be calculated using the same formula as above.
[0161] In certain embodiments the Spatial-Aggregation-Propensity is
calculated for all atoms in a protein structural model. In some
embodiments, the atomistic Spatial-Aggregation-Propensity values
may be averaged over each individual protein residue, or over small
groups of residues.
[0162] Uses of the SAP Methodology
[0163] In one aspect, the present invention may be used as
described above to identify hydrophobic amino acid residues,
regions or patches in a protein. Without wanting to be held to
specific threshold values, atoms or amino acid residues having a
Spatial-Aggregation-Propensity >0 are considered to be
hydrophobic, or to be in an aggregation prone region. Depending on
the type of protein, the particular structure, and the solvent in
which it exists, it may be desirable to identify atoms or residues
using a cutoff which is slightly below zero, e.g., by choosing
atoms or residues which have a Spatial-Aggregation-Propensity of
greater than -0.1, -0.15, -0.2, etc. Alternatively, it may be
desirable to employ a more stringent cutoff, e.g., 0, 0.05, 0.1,
0.15, 0.2, etc., in order to choose the strongest hydrophobic
atoms, residues, or patches. In addition, as the algorithm gives
higher numbers to residues at the center of a patch, residues
within 3 A, 4 A, 5 A, 7.5 A, or 10 A of the residue meeting the
cutoff can also be selected for mutation to less hydrophobic
residues to reduce aggregation. In another embodiment, it may be
advantageous simply to select atoms or residues having
Spatial-Aggregation-Propensity which is larger than atoms or
residues which are nearby either sequentially (i.e., along the
protein sequence) or, in a preferred embodiment, spatially (i.e.,
in the three-dimensional structure). One preferred method for
selecting atoms or residues in a hydrophobic patch is to map the
calculated Spatial-Aggregation-Propensity values, e.g., using a
color coding or numerical coding, onto the protein structural model
from which they were derived, thus visualizing differences in the
Spatial-Aggregation-Propensity across the protein surface and hence
allowing easy selection of hydrophobic patches or residues. In a
particularly preferred embodiment, the calculations for
Spatial-Aggregation-Propensity are carried out separately using two
values chosen for the radius, one of higher resolution, e.g., 5 A,
and one of lower resolution, e.g., 10 A. In such an embodiment
larger or broader hydrophobic patches may be seen on the protein
structure with the lower resolution map. Once hydrophobic patches
of interest are selected on the low resolution map, those patches
may be viewed in greater detail in the higher resolution map which
may, in some embodiments, allow one of skill in the art to more
easily or more accurately choose residues to mutate or modify. For
example, when viewing a hydrophobic patch in the higher resolution
map, it may be desirable to select for mutation the residue which
has the highest SAP score or is the most hydrophobic (e.g., the
most hydrophobic residue in the patch according to the scale of
Black and Mould, Anal. Biochem. 1991, 193, 72-82).
[0164] In a specific embodiment a method to identify an aggregation
prone region on a protein comprises (a) mapping onto the structural
model the SAP as calculated according to any of the methods
described herein for atoms in the protein; and (b) identifying a
region within in the protein having a plurality of atoms having a
SAP >0; wherein the aggregation prone region comprises the amino
acids comprising said plurality of atoms. In such an embodiment the
SAP may be calculated for all the atoms in a protein or a portion
of the atoms. It is contemplated that one may only calculate the
SAP for particular residues or groups of residues which are of
interest.
[0165] In a similar embodiment, it may be informative to plot the
SAP scores of the atoms (or the SAP score as averaged over amino
acid residues). Such a plot showing the SAP score along the atoms
or residues of a protein allows the easy identification of peaks,
which may indicate candidates for replacement. In a particularly
preferred embodiment the SAP scores along the atoms or residues in
the protein are plotted in a graph and the Area Under the Curve
(AUC) is calculated for peaks in the graph. In such an embodiment,
peaks with a larger AUC represent larger or more hydrophobic
aggregation prone regions. In particular embodiments it will be
desirable to select for replacement one or more residues which are
identified as existing in a peak, or, more preferably, in a peak
with a large AUC.
[0166] In particular embodiments the present invention may be used
to select a residue of an immunoglobulin for mutation to cysteine.
As used herein, the SAP value of a first amino acid residue on the
surface of an immunoglobulin is calculated. If the SAP value is
equal to or in between the values of 0 and -0.11, the first residue
is selected for mutation to cysteine. In a further embodiment, the
SAP values of a plurality of residues of the immunoglobulin within
immediate proximity of the first residue are calculated. If the
plurality of residues has SAP values of less than 0, the first
residue is selected for mutation to cysteine.
[0167] Immunoglobulin variants may be made by any method known in
the art including site directed mutagenesis and other recombinant
DNA technology, e.g., see U.S. Pat. Nos. 5,284,760; 5,556,747;
5,789,166; 6,878,531, 5,932,419; and, 6391548.
[0168] In particular embodiments the present invention may be used
to make an immunoglobulin variant which can be conjugated to an
atom or molecule by replacing at least one amino acid residue
exposed on the surface of the immunoglobulin identified by any of
the methods described herein with a natural amino acid residue, a
modified amino acid residue, an unusual amino acid residue, an
unnatural amino acid residue, or an amino acid analog or derivative
which can be used for conjugating the immunoglobulin to an atom or
molecule. In preferred embodiments, the amino acid residue exposed
on the surface of the immunoglobulin is replaced with cysteine. In
other embodiments, the amino acid residue is replaced with lysine,
aspartate, or pyrorlysine.
[0169] The synthesis of unnatural amino acids is known to those of
skill in the art, and is further described, e.g., in U.S. Patent
Publication No. 2003-0082575. In general, any method known in the
art to synthesize or incorporate unnatural, modified, or unusual
amino acids into proteins may be employed including, but not
limited to those methods described or referenced in the
publications Liao J. Biotechnol Prog. 2007 January-February;
23(1):28-31; Rajesh, and Iqbal. Curr Pharm Biotechnol. 2006 August;
7(4):247-59; Cardillo et al. Mini Rev Med Chem. 2006 March;
6(3):293-304; Wang et al. Annu Rev Biophys Biomol Struct. 2006;
35:225-49; Chakraborty et al., Glycoconj J. 2005 March;
22(3):83-93. As a further example, the Ambrx ReCODE.TM. technology
may be employed to develop and incorporate unnatural amino acids,
or unusual amino acids into proteins as indicated by the methods
described herein.
[0170] Immunoglobulin variants and immunoglobulin conjugates
according to the invention can exhibit enhanced or improved
stability as determined, for example, by non-reducing SDS-PAGE.
[0171] It is accordingly an object of the present invention to
provide isolated or recombinant polynucleotides that encode
modified immunoglobulins as discussed in paragraphs [0008] and
[0019] and any and all combinations of their embodiments. In
certain embodiments, the polynucleotide is in a vector. In certain
embodiments, the vector is an expression vector. In certain
embodiments that may be combined with the preceding embodiments, an
inducible promoter is operably linked to the polynucleotide.
Another aspect includes host cells with the vector of either of the
preceding embodiments. In certain embodiments, the host cells are
capable of expressing the immunoglobulin encoded by the
polynucleotide.
[0172] It is accordingly an object of the present invention to
provide methods of producing an immunoglobulin with a reduced
propensity for cross-linking comprising providing a culture medium
comprising the host cell of the preceding paragraph and placing the
culture medium in conditions under which the immunoglobulin is
expressed. In certain embodiments, the methods include an
additional step of isolating the immunoglobulin expressed.
[0173] It is accordingly an object of the present invention to
provide methods for selecting a residue of an immunoglobulin for
mutation to cysteine comprising calculating the
Spatial-Aggregation-Propensity of a first amino acid residue on the
surface of the immunoglobulin, calculating the
Spatial-Aggregation-Propensities of a plurality of residues of the
immunoglobulin within immediate proximity of the first residue, and
selecting the first amino acid residue for mutation to cysteine if
the Spatial-Aggregation-Propensity of the first amino acid residue
is equal to or in between the values of 0 and -0.11 and if the
plurality of residues have Spatial-Aggregation-Propensities of less
than 0. In certain embodiments, the plurality of residues is within
15 .ANG. of the first residue. In certain embodiments, the
plurality of residues is within 10 .ANG. of the first residue. In
certain embodiments, the plurality of residues is within 7.5 .ANG.
of the first residue. In certain embodiments, the plurality of
residues is within 5 .ANG. of the first residue. In certain
embodiments that may be combined with the preceding embodiments,
calculating the Spatial-Aggregation-Propensity of a residue
comprises calculating the Spatial-Aggregation-Propensity for a
spherical region with a radius centered on an atom in the residue.
In certain embodiments, the radius of the spherical region is at
least 5 .ANG..
[0174] In some embodiments, the invention further relates to
computer code for determining SAP according to the methods of the
invention. In other embodiments, the invention relates to a
computer, a supercomputer, or cluster of computers dedicated to
performing the methods of the invention. In yet another aspect, the
invention provides a web-based, server based, or internet based
service for selecting residues of a protein to mutate to cysteine,
the service comprising accepting data about a protein (e.g., a
protein structural model) from a user (e.g., over the internet) or
retrieving such data from a database such that the service provider
can generate, retrieve, or access a static structure of the
protein, optionally including molecular dynamics modeling of the
protein to provide a dynamic structure of the protein, determining
SAP for atoms or residues of the protein based on the static or
dynamic structure so generated, and returning the SAP data, for
example, as a structural model mapped with said SAP data by the
service provider, to a user. In some embodiments, the user is a
person. In other embodiments the user is a computer system or
automated computer algorithm.
[0175] In some embodiments the present invention proves an SAP
calculation system comprising: a web server for providing a web
service for calculating SAP to a user terminal through the
Internet; a database for storing general information on the
calculation method, amino acid hydrophobicity, etc., and a
calculation server for performing the SAP calculation based on
information in the database and information provided or transmitted
through the internet by the user.
[0176] In some embodiments, the web server and the calculation
server are the same computer system. In some embodiments the
computer system is a supercomputer, a cluster computer, or a single
workstation or server. In a related embodiment the web server of
the SAP calculation system further comprises a controller for
controlling the entire operation, a network connection unit for
connection to the Internet, and a web service unit for providing a
web service for calculating SAP to the user terminal connected
through the Internet.
[0177] In addition, embodiments of the present invention further
relate to computer storage products with a computer readable medium
that contain program code for performing various
computer-implemented operations, e.g., calculating the SAP for a
structural model, calculating SAA, calculating effective-SAA,
manipulating structural models, implementing molecular dynamics
simulations, organizing and storing relevant data, or performing
other operations described herein. The computer-readable medium is
any data storage device that can store data which can thereafter be
read by a computer system. Examples of computer-readable media
include, but are not limited to hard disks, floppy disks, flash
drives, optical discs (e.g., CDs, DVDs, HD-DVDs, Blu-Ray discs,
etc.) and specially configured hardware devices such as application
specific integrated circuits (ASICs) or programmable logic devices
(PLDs). The computer-readable medium can also be distributed as a
data signal embodied in a carrier wave over a network of coupled
computer systems so that the computer readable code is stored and
executed in a distributed fashion. It will be appreciated by those
skilled in the art that the above described hardware and software
elements are of standard design and construction. The computer,
internet, server, and service related embodiments described above
may further apply to the SAA and the effective-SAA as well as
SAP.
[0178] Pharmaceutical Compositions Containing Immunoglobulins and
Immunoglobulin Conjugates
[0179] In another aspect, the present invention provides a
composition, e.g., a pharmaceutical composition, containing one or
more immunoglobulin conjugates produced by the methods of the
invention, formulated together with a pharmaceutically acceptable
carrier. Pharmaceutical compositions of the invention also can be
administered in combination therapy, i.e., combined with other
agents. For example, the combination therapy can include an
immunoglobulin conjugate of the present invention combined with at
least one other anti-cancer agent.
[0180] As used herein, "pharmaceutically acceptable carrier"
includes any and all solvents, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents, and the like that are physiologically compatible.
Preferably, the carrier is suitable for intravenous, intramuscular,
subcutaneous, parenteral, spinal or epidermal administration (e.g.,
by injection or infusion). Depending on the route of
administration, the active compound, i.e., the immunoglobulin or
variant thereof of the invention, may be coated in a material to
protect the compound from the action of acids and other natural
conditions that may inactivate the compound.
[0181] The pharmaceutical compositions of the invention may include
one or more pharmaceutically acceptable salts. A "pharmaceutically
acceptable salt" refers to a salt that retains the desired
biological activity of the parent compound and does not impart any
undesired toxicological effects (see e.g., Berge, S. M., et al.
(1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid
addition salts and base addition salts. Acid addition salts include
those derived from nontoxic inorganic acids, such as hydrochloric,
nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous
and the like, as well as from nontoxic organic acids such as
aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic
acids, hydroxy alkanoic acids, aromatic acids, aliphatic and
aromatic sulfonic acids and the like. Base addition salts include
those derived from alkaline earth metals, such as sodium,
potassium, magnesium, calcium and the like, as well as from
nontoxic organic amines, such as N,N'-dibenzylethylenediamine,
N-methylglucamine, chloroprocaine, choline, diethanolamine,
ethylenediamine, procaine and the like.
[0182] A pharmaceutical composition of the invention also may
include a pharmaceutically acceptable anti-oxidant. Examples of
pharmaceutically acceptable antioxidants include: (1) water soluble
antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium
bisulfate, sodium metabisulfite, sodium sulfite and the like; (2)
oil-soluble antioxidants, such as ascorbyl palmitate, butylated
hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin,
propyl gallate, alpha-tocopherol, and the like; and (3) metal
chelating agents, such as citric acid, ethylenediamine tetraacetic
acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the
like.
[0183] Examples of suitable aqueous and nonaqueous carriers that
may be employed in the pharmaceutical compositions of the invention
include water, ethanol, polyols (such as glycerol, propylene
glycol, polyethylene glycol, and the like), and suitable mixtures
thereof, vegetable oils, such as olive oil, and injectable organic
esters, such as ethyl oleate. Proper fluidity can be maintained,
for example, by the use of coating materials, such as lecithin, by
the maintenance of the required particle size in the case of
dispersions, and by the use of surfactants.
[0184] These compositions may also contain adjuvants such as
preservatives, wetting agents, emulsifying agents and dispersing
agents. Prevention of presence of microorganisms may be ensured
both by sterilization procedures, and by the inclusion of various
antibacterial and antifungal agents, for example, paraben,
chlorobutanol, phenol sorbic acid, and the like. It may also be
desirable to include isotonic agents, such as sugars, sodium
chloride, and the like into the compositions. In addition,
prolonged absorption of the injectable pharmaceutical form may be
brought about by the inclusion of agents which delay absorption
such as aluminum monostearate and gelatin.
[0185] Pharmaceutically acceptable carriers include sterile aqueous
solutions or dispersions and sterile powders for the extemporaneous
preparation of sterile injectable solutions or dispersion. The use
of such media and agents for pharmaceutically active substances is
known in the art. Except insofar as any conventional media or agent
is incompatible with the active compound, use thereof in the
pharmaceutical compositions of the invention is contemplated.
Supplementary active compounds can also be incorporated into the
compositions.
[0186] Exemplary formulations comprise at least one immunoglobulin
conjugate of the invention and can comprise lower concentrations of
stabilizing agents which can, in addition to the methods disclosed
herein, be used to prevent or diminish cross-linking of an
immunoglobulin. Accordingly, conventional methods used to prevent
cross-linking may be employed in the development of pharmaceutical
compositions containing immunoglobulin conjugates produced by the
methods of the present invention. For example, a variety of
stabilizing or disaggregating compounds may be included in
pharmaceutical compositions of the invention depending on their
intended use and their biological toxicity. Such stabilizing
compounds may include, for example, cyclodextrin and its
derivatives (U.S. Pat. No. 5,730,969), alkylglycoside compositions
(U.S. patent application Ser. No. 11/474,049), the use of chaperone
molecules (e.g., LEA (Goyal et al., Biochem J. 2005, 388(Pt 1):
151-7; the methods of U.S. Pat. No. 5,688,651), betaine compounds
(Xiao, Burn, Tolbert, Bioconjug Chem. 2008 May 23), surfactants
(e.g., Pluronic F127, Pluronic F68, polysorbate 20 (TWEEN 20.TM.)
(Wei et al. International Journal of Pharmaceutics. 2007,
338(1-2):125-132)), and the methods described in U.S. Pat. Nos.
5,696,090, 5,688,651, and 6,420,122.
[0187] In addition, proteins, and in particular antibodies, are
stabilized in formulations using combinations of different classes
of excipients, e.g., (1) disaccarides (e.g. Saccharose, Trehalose)
or polyols (e.g. Sorbitol, Mannitol) act as stabilizers by
preferential exclusion and are also able to act as cryoprotectants
during lyophilization, (2) surfactants (e.g. Polysorbat 80,
Polysorbat 20) act by minimizing interactions of proteins on
interfaces like liquid/ice, liquid/material-surface and/or
liquid/air interfaces and (3) buffers (e.g. phosphate-, citrate-,
histidine) help to control and maintain formulation pH.
Accordingly, such disaccharides polyols, surfactants and buffers
may be used in addition to the methods of the present invention to
further stabilize immunoglobulins and prevent their
aggregation.
[0188] Therapeutic compositions typically must be sterile and
stable under the conditions of manufacture and storage. The
composition can be formulated as a solution, microemulsion,
liposome, or other ordered structure suitable to high drug
concentration. The carrier can be a solvent or dispersion medium
containing, for example, water, ethanol, polyol (for example,
glycerol, propylene glycol, and liquid polyethylene glycol, and the
like), and suitable mixtures thereof. The proper fluidity can be
maintained, for example, by the use of a coating such as lecithin,
by the maintenance of the required particle size in the case of
dispersion and by the use of surfactants. In many cases, it will be
preferable to include isotonic agents, for example, sugars,
polyalcohols such as mannitol, sorbitol, or sodium chloride in the
composition. Prolonged absorption of the injectable compositions
can be brought about by including in the composition an agent that
delays absorption, for example, monostearate salts and gelatin.
[0189] Sterile injectable solutions can be prepared by
incorporating the active compound in the required amount in an
appropriate solvent with one or a combination of ingredients
enumerated above, as required, followed by sterilization
microfiltration. Generally, dispersions are prepared by
incorporating the active compound into a sterile vehicle that
contains a basic dispersion medium and the required other
ingredients from those enumerated above. In the case of sterile
powders for the preparation of sterile injectable solutions, the
preferred methods of preparation are vacuum drying and
freeze-drying (lyophilization) that yield a powder of the active
ingredient plus any additional desired ingredient from a previously
sterile-filtered solution thereof.
[0190] The amount of active ingredient which can be combined with a
carrier material to produce a single dosage form will vary
depending upon the subject being treated, and the particular mode
of administration. The amount of active ingredient which can be
combined with a carrier material to produce a single dosage form
will generally be that amount of the composition which produces a
therapeutic effect. Generally, out of one hundred percent, this
amount will range from about 0.01 percent to about ninety-nine
percent of active ingredient, preferably from about 0.1 percent to
about 70 percent, most preferably from about 1 percent to about 30
percent of active ingredient in combination with a pharmaceutically
acceptable carrier.
[0191] It is accordingly an object of the present invention to
provide methods for reducing the cross-linking between
surface-exposed cysteines of an immunoglobulin in a highly
concentrated pharmaceutical formulation of immunoglobulin
conjugates comprising providing an immunoglobulin, substituting a
residue selected from the group consisting of 7(V.sub.H),
20(V.sub.L), 22(V.sub.L), and 125(C.sub.H1) with a cysteine
residue, reducing the one or more substituted cysteine residues
with a reducing agent to form reduced cysteine residues, incubating
the immunoglobulin with an atom or molecule, wherein the molecule
is reactive with the reduced cysteine residues, to form an
immunoglobulin conjugate, and generating a highly concentrated,
liquid formulation of the immunoglobulin conjugate wherein the
immunoglobulin conjugate concentration is at least 20 mg/ml, at
least 30 mg/ml, at least 40 mg/ml, at least 50 mg/ml, at least 75
mg/ml, at least 100 mg/ml, at least 125 mg/ml, or at least 150
mg/ml. In certain embodiments, the immunoglobulin is selected from
the group comprising IgG1, IgG2, IgG3, and IgG4. In certain
embodiments, the immunoglobulin comprises an IgG1. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin comprises a human C.sub.H1 domain. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin comprises a human C.sub.H2 domain. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin comprises a human C.sub.H3 domain. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin comprises a human C.sub.L domain. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin comprises a human V.sub.H domain. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin comprises a human V.sub.L domain. In certain
embodiments that may be combined with the preceding embodiments,
the immunoglobulin conjugate comprises an antigen binding activity
and the activity is at least eighty percent, at least ninety
percent, at least one hundred percent, at least one hundred ten
percent, at least one hundred twenty percent, or at least one
hundred thirty percent of the antigen binding activity of the
unmutated immunoglobulin.
[0192] It is accordingly an object of the present invention to
provide modified immunoglobulin formulations that can be made up of
immunoglobulin conjugates as discussed in paragraph [0007] and any
and all combinations of their embodiments at a concentration of at
least 10 mg/ml, at least 20 mg/ml, at least 30 mg/ml, at least 40
mg/ml, at least 50 mg/ml, at least 75 mg/ml, at least 100 mg/ml, at
least 125 mg/ml, or at least 150 mg/ml. In certain embodiments, the
immunoglobulin conjugate is at a concentration of greater than the
concentration at which an immunoglobulin conjugate known to have a
high propensity for oligomerization forms oligomers in a
concentrated, liquid solution under the same conditions. In certain
embodiments that may be combined with the preceding embodiments, at
least eighty percent, at least eighty-five percent, at least ninety
percent, at least ninety-five percent, at least ninety-six percent,
at least ninety-seven percent, at least ninety-eight percent, or at
least ninety-nine percent of the immunoglobulin conjugate is
non-oligomerized monomer. In certain embodiments that may be
combined with any of the preceding embodiments, the formulation
includes a pharmaceutically acceptable excipient. In certain
embodiments that may be combined with any of the preceding
embodiments, the immunoglobulin formulation comprises at least
eighty percent, at least eighty-five percent, at least ninety
percent, at least ninety-five percent, at least ninety-six percent,
at least ninety-seven percent, at least ninety-eight percent, or at
least ninety-nine percent of immunoglobulin conjugate that is
non-oligomerized monomer.
[0193] It is accordingly an object of the present invention to
provide uses of the immunoglobulin conjugates as discussed in
paragraph [0007] and any and all combinations of their embodiments
as a non-oligomerizing pharmaceutical active ingredient.
[0194] It is accordingly an object of the present invention to
provide pharmaceutical compositions that include an immunoglobulin
conjugate as discussed in paragraph [0007] and any and all
combinations of their embodiments and a pharmaceutically acceptable
excipient. In certain embodiments, the immunoglobulin is at a
concentration of at least 10 mg/ml, at least 20 mg/ml, at least 30
mg/ml, at least 40 mg/ml, at least 50 mg/ml, at least 75 mg/ml, at
least 100 mg/ml, at least 125 mg/ml, or at least 150 mg/ml. In
certain embodiments, the immunoglobulin conjugate is at a
concentration of greater than the concentration at which an
immunoglobulin conjugate known to have a high propensity for
oligomerization forms oligomers in a concentrated, liquid solution
under the same conditions. In certain embodiments that may be
combined with the preceding embodiments, at least eighty percent,
at least eighty-five percent, at least ninety percent, at least
ninety-five percent, at least ninety-six percent, at least
ninety-seven percent, at least ninety-eight percent, or at least
ninety-nine percent of the immunoglobulin conjugate is
non-oligomerizing monomer. In certain embodiments that may be
combined with any of the preceding embodiments, the immunoglobulin
formulation comprises at least eighty percent, at least eighty-five
percent, at least ninety percent, at least ninety-five percent, at
least ninety-six percent, at least ninety-seven percent, at least
ninety-eight percent, or at least ninety-nine percent of
immunoglobulin conjugate that is non-oligomerized monomer. In
certain embodiments that may be combined with preceding
embodiments, the oligomerization is measured by non-reducing
SDS-PAGE.
[0195] Dosage regimens are adjusted to provide the optimum desired
response (e.g., a therapeutic response). For example, a single
bolus may be administered, several divided doses may be
administered over time or the dose may be proportionally reduced or
increased as indicated by the exigencies of the therapeutic
situation. It is especially advantageous to formulate parenteral
compositions in dosage unit form for ease of administration and
uniformity of dosage. Dosage unit form as used herein refers to
physically discrete units suited as unitary dosages for the
subjects to be treated; each unit contains a predetermined quantity
of active compound calculated to produce the desired therapeutic
effect in association with the required pharmaceutical carrier. The
specification for the dosage unit forms of the invention are
dictated by and directly dependent on (a) the unique
characteristics of the active compound and the particular
therapeutic effect to be achieved, and (b) the limitations inherent
in the art of compounding such an active compound for the treatment
of sensitivity in individuals.
[0196] For administration of the immunoglobulin conjugate, the
dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01
to 5 mg/kg, of the host body weight. For example dosages can be 0.3
mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5
mg/kg body weight or 10 mg/kg body weight or within the range of
1-10 mg/kg. An exemplary treatment regime entails administration
once per week, once every two weeks, once every three weeks, once
every four weeks, once a month, once every 3 months or once every
three to 6 months. Preferred dosage regimens for an immunoglobulin
conjugate of the invention include 1 mg/kg body weight or 3 mg/kg
body weight via intravenous administration, with the antibody being
given using one of the following dosing schedules: (i) every four
weeks for six dosages, then every three months; (ii) every three
weeks; (iii) 3 mg/kg body weight once followed by 1 mg/kg body
weight every three weeks.
[0197] Alternatively an immunoglobulin conjugate of the invention
can be administered as a sustained release formulation, in which
case less frequent administration is required. Dosage and frequency
vary depending on the half-life of the administered substance in
the patient. In general, human antibodies show the longest half
life, followed by humanized antibodies, chimeric antibodies, and
nonhuman antibodies. The dosage and frequency of administration can
vary depending on whether the treatment is prophylactic or
therapeutic. In prophylactic applications, a relatively low dosage
is administered at relatively infrequent intervals over a long
period of time. Some patients continue to receive treatment for the
rest of their lives. In therapeutic applications, a relatively high
dosage at relatively short intervals is sometimes required until
progression of the disease is reduced or terminated, and preferably
until the patient shows partial or complete amelioration of
symptoms of disease. Thereafter, the patient can be administered a
prophylactic regime.
[0198] Actual dosage levels of the active ingredients in the
pharmaceutical compositions of the present invention may be varied
so as to obtain an amount of the active ingredient which is
effective to achieve the desired therapeutic response for a
particular patient, composition, and mode of administration,
without being toxic to the patient. The selected dosage level will
depend upon a variety of pharmacokinetic factors including the
activity of the particular compositions of the present invention
employed, or the ester, salt or amide thereof, the route of
administration, the time of administration, the rate of excretion
of the particular compound being employed, the duration of the
treatment, other drugs, compounds and/or materials used in
combination with the particular compositions employed, the age,
sex, weight, condition, general health and prior medical history of
the patient being treated, and like factors well known in the
medical arts.
[0199] A "therapeutically effective dosage" of immunoglobulin
conjugate of the invention preferably results in a decrease in
severity of disease symptoms, an increase in frequency and duration
of disease symptom-free periods, or a prevention of impairment or
disability due to the disease affliction. For example, for the
treatment of tumors, a "therapeutically effective dosage"
preferably inhibits cell growth or tumor growth by at least about
20%, more preferably by at least about 40%, even more preferably by
at least about 60%, and still more preferably by at least about 80%
relative to untreated subjects. The ability of a compound to
inhibit tumor growth can be evaluated in an animal model system
predictive of efficacy in human tumors. Alternatively, this
property of a composition can be evaluated by examining the ability
of the compound to inhibit, such inhibition in vitro by assays
known to the skilled practitioner. A therapeutically effective
amount of a therapeutic compound can decrease tumor size, or
otherwise ameliorate symptoms in a subject. One of ordinary skill
in the art would be able to determine such amounts based on such
factors as the subject's size, the severity of the subject's
symptoms, and the particular composition or route of administration
selected.
[0200] A composition of the present invention can be administered
via one or more routes of administration using one or more of a
variety of methods known in the art. As will be appreciated by the
skilled artisan, the route and/or mode of administration will vary
depending upon the desired results. Preferred routes of
administration for binding moieties of the invention include
intravenous, intramuscular, intradermal, intraperitoneal,
subcutaneous, spinal or other parenteral routes of administration,
for example by injection or infusion. The phrase "parenteral
administration" as used herein means modes of administration other
than enteral and topical administration, usually by injection, and
includes, without limitation, intravenous, intramuscular,
intraarterial, intrathecal, intracapsular, intraorbital,
intracardiac, intradermal, intraperitoneal, transtracheal,
subcutaneous, subcuticular, intraarticular, subcapsular,
subarachnoid, intraspinal, epidural and intrasternal injection and
infusion.
[0201] Alternatively, an immunoglobulin conjugate of the invention
can be administered via a nonparenteral route, such as a topical,
epidermal or mucosal route of administration, for example,
intranasally, orally, vaginally, rectally, sublingually or
topically.
[0202] The active compounds can be prepared with carriers that will
protect the compound against rapid release, such as a controlled
release formulation, including implants, transdermal patches, and
microencapsulated delivery systems. Biodegradable, biocompatible
polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Many methods for the preparation of such
formulations are patented or generally known to those skilled in
the art. See, e.g., Sustained and Controlled Release Drug Delivery
Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York,
1978.
[0203] Therapeutic compositions can be administered with medical
devices known in the art. For example, in a preferred embodiment, a
therapeutic composition of the invention can be administered with a
needleless hypodermic injection device, such as the devices
disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335;
5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of
well-known implants and modules useful in the present invention
include: U.S. Pat. No. 4,487,603, which discloses an implantable
micro-infusion pump for dispensing medication at a controlled rate;
U.S. Pat. No. 4,486,194, which discloses a therapeutic device for
administering medicants through the skin; U.S. Pat. No. 4,447,233,
which discloses a medication infusion pump for delivering
medication at a precise infusion rate; U.S. Pat. No. 4,447,224,
which discloses a variable flow implantable infusion apparatus for
continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses
an osmotic drug delivery system having multi-chamber compartments;
and U.S. Pat. No. 4,475,196, which discloses an osmotic drug
delivery system.
[0204] It is accordingly an object of the present invention to
provide uses of the immunoglobulin conjugates as discussed in
paragraph [0007] and any and all combinations of their embodiments
in the preparation of a medicament comprising a highly concentrated
liquid formulation wherein the immunoglobulin conjugate
concentration is at least 20 mg/ml, at least 30 mg/ml, at least 40
mg/ml, at least 50 mg/ml, at least 75 mg/ml, at least 100 mg/ml, at
least 125 mg/ml, or at least 150 mg/ml. In certain embodiments, the
use of the medicament is for the treatment of autoimmune diseases,
immunological diseases, infectious diseases, inflammatory diseases,
neurological diseases, and oncological and neoplastic diseases
including cancer. In certain embodiments, the use of the medicament
is for the treatment of congestive heart failure (CHF), vasculitis,
rosacea, acne, eczema, myocarditis and other conditions of the
myocardium, systemic lupus erythematosus, diabetes,
spondylopathies, synovial fibroblasts, and bone marrow stroma; bone
loss; Paget's disease, osteoclastoma; breast cancer; disuse
osteopenia; malnutrition, periodontal disease, Gaucher's disease,
Langerhans' cell histiocytosis, spinal cord injury, acute septic
arthritis, osteomalacia, Cushing's syndrome, monoostotic fibrous
dysplasia, polyostotic fibrous dysplasia, periodontal
reconstruction, and bone fractures; sarcoidosis; osteolytic bone
cancers, breast cancer, lung cancer, kidney cancer and rectal
cancer; bone metastasis, bone pain management, and humoral
malignant hypercalcemia, ankylosing spondylitisa and other
spondyloarthropathies; transplantation rejection, viral infections,
hematologic neoplasias and neoplastic-like conditions for example,
Hodgkin's lymphoma; non-Hodgkin's lymphomas (Burkitt's lymphoma,
small lymphocytic lymphoma/chronic lymphocytic leukemia, mycosis
fungoides, mantle cell lymphoma, follicular lymphoma, diffuse large
B-cell lymphoma, marginal zone lymphoma, hairy cell leukemia and
lymphoplamacytic leukemia), tumors of lymphocyte precursor cells,
including B-cell acute lymphoblastic leukemia/lymphoma, and T-cell
acute lymphoblastic leukemia/lymphoma, thymoma, tumors of the
mature T and NK cells, including peripheral T-cell leukemias, adult
T-cell leukemia/T-cell lymphomas and large granular lymphocytic
leukemia, Langerhans cell histocytosis, myeloid neoplasias such as
acute myelogenous leukemias, including AML with maturation, AML
without differentiation, acute promyelocytic leukemia, acute
myelomonocytic leukemia, and acute monocytic leukemias,
myelodysplastic syndromes, and chronic myeloproliferative
disorders, including chronic myelogenous leukemia, tumors of the
central nervous system, e.g., brain tumors (glioma, neuroblastoma,
astrocytoma, medulloblastoma, ependymoma, and retinoblastoma),
solid tumors (nasopharyngeal cancer, basal cell carcinoma,
pancreatic cancer, cancer of the bile duct, Kaposi's sarcoma,
testicular cancer, uterine, vaginal or cervical cancers, ovarian
cancer, primary liver cancer or endometrial cancer, and tumors of
the vascular system (angiosarcoma and hemangiopericytoma),
osteoporosis, hepatitis, HIV, AIDS, spondylarthritis, rheumatoid
arthritis, inflammatory bowel diseases (IBD), sepsis and septic
shock, Crohn's Disease, psoriasis, schleraderma, graft versus host
disease (GVHD), allogenic islet graft rejection, hematologic
malignancies, such as multiple myeloma (MM), myelodysplastic
syndrome (MDS) and acute myelogenous leukemia (AML), inflammation
associated with tumors, peripheral nerve injury or demyelinating
diseases. In certain embodiments, the use of the medicament is for
the treatment of plaque psoriasis, ulcerative colitis,
non-Hodgkin's lymphoma, breast cancer, colorectal cancer, juvenile
idiopathic arthritis, macular degeneration, respiratory syncytial
virus, Crohn's disease, rheumatoid arthritis, psoriatic arthritis,
ankylosing spondylitis, osteoporosis, treatment-induced bone loss,
bone metastases, multiple myeloma, Alzheimer's disease, glaucoma,
and multiple sclerosis. In certain embodiments that may be combined
with any of the preceding embodiments, the use of the medicament
further comprises a pharmaceutically acceptable excipient. In
certain embodiments that may be combined with any of the preceding
embodiments, the immunoglobulin conjugate in the medicament shows
at least at least eighty percent, at least eighty-five percent, at
least ninety percent, at least ninety-five percent, at least
ninety-six percent, at least ninety-seven percent, at least
ninety-eight percent, or at least ninety-nine percent
non-oligomerized monomer. In certain embodiments, the
oligomerization is measured by non-reducing SDS-PAGE.
EXAMPLES
[0205] The Examples described herein refer to particular,
non-limiting embodiments of the invention.
Example 1: Design, Expression, and Conjugation of Antibody Cysteine
Variants
[0206] A set of IgG1 cysteine variants was designed such that each
immunoglobulin fold domain is represented (Table 1). Variants 1-13
were designed from the X-ray structure of antibody-1. Variant 14
was selected from the structure of another IgG1, antibody-2, built
by homology modeling with respect to antibody-1. All sites were
exposed on the antibody surface. Polar residues, such as serine and
threonine and arginine, or charged residues, such as lysine, were
substituted with cysteine. The light and heavy chain genes were
subcloned in vector gWIZ (Genlantis) and engineered for protein
expression by transient transfection of mammalian cells. Antibody
variants were either de novo synthesized (GeneArt) or generated by
site-directed mutagenic PCR and confirmed by sequencing. Antibody
wild type and variants were expressed at 10-100 mg levels by
transient transfection of Freestyle HEK 293 cells (Invitrogen) with
polyethyleneimine (Polysciences) as the transfection reagent. Cell
culture supernatant was collected 7-10 days post-transfection.
Antibodies were purified on a protein A column (GE Healthcare),
eluted with 50 mM citrate buffer, pH 3.5, and buffer exchange in
100 mM Tris pH 7.0 buffer for fluorescence labeling.
[0207] Following expression and purification of antibody variants,
the engineered surface cysteines were mostly oxidized. For example
both Variant 4 and 6 had less than 0.3 free thiol per antibody
molecule as opposed to the anticipated 2.0 for the antibodies with
engineered surface cysteines. We compared the effect of a mild
reducing agent, TCEP (Tris[2-carboxyethyl] phosphine hydrochloride)
and a stronger reducing agent, DTT (dithiothreitol) on a variant
from class I and a variant from class IV. Initially, the
non-oligomerizing Variant 4 showed 0.13 free thiol per antibody,
and the highly oligomerizing Variant 6 had 0.25 free thiol per
antibody. Aliquots of wild type, variant 4, and variant 6 were
treated in five different conditions: 1) no reducing agent, 2)
TCEP, 10.times., 1 hour, 3) TCEP, 20.times., 1 hour, 4) DTT,
5.times., 15 minutes, and 5) DTT, 10.times., 15 minutes. After
removal of the reducing agent the samples were resolved on
non-reducing PAGE and were quantified for free thiol. A comparison
of the results for wild type and variants indicated that the TCEP
treatment was sufficient to reduce cysteines in non-oligomerized
form (Variant 4) with little effect on WT. However, cysteines from
oligomers (Variant 6) were reduced only after a harsher treatment.
Treatment with DTT even at low levels leads to antibody
fragmentation for WT and both variants. The sites where the surface
cysteines were introduced had a profound effect on the ability to
decap the engineered cysteines for conjugation.
[0208] Different methods were attempted for the specific reduction
of the engineered surface thiols before labeling. TCEP and DTT were
two of the reagent used, and levels of free thiol were quantified
using Ellman's reagent (Invitrogen). We found L-cysteine to work
best in our site-specific labeling experiments, so the following
two-step protocol was used. First, the variants were incubated with
100-200 fold excess of L-cysteine for 4 hrs at 37.degree. C.,
followed by buffer exchange into 50 mM Tris/EDTA. Second, the
samples were incubated with 5-10 fold excess of ALEXA FLUOR.RTM.
488 maleimide dye (Invitrogen) for 1 hr at room temperature or with
10 fold excess of Pyrene maleimide dye (Invitrogen) for 12 hrs at
room temperature. After removal of free dye, and buffer exchange to
50 mM phosphate buffer pH 7.0, the efficiency of protein labeling
was calculated as mole of dye per mole of protein according to
manufacturer's protocols (Invitrogen).
Example 2: Characterization of the Engineered Antibody Cysteine
Variants
[0209] Unlabeled and labeled antibody samples were analyzed by
SDS-PAGE. Gels of 7.5%, 10%, and 12% were used for non-reducing
analysis. Gels of 12% were used for reducing analysis of heated
samples with DTT. Usually, samples of 5-10 .mu.g were loaded per
lane. Fluorescent images were taken under UV light before staining
with Coomassie Blue. Antibody digestion was carried out by GluC
(1:20 wt enzyme per wt antibody, at 25.degree. C. for 12-24 hrs)
and pronase (1:20 wt enzyme per wt antibody, at 37.degree. C. for 1
hr).
[0210] Non-reducing gels show monomers as well as the presence of
dimers, trimers, and in some cases even higher oligomers. Reducing
gels show the exclusive labeling of the light or heavy chain
depending on where the surface cysteine was engineered. Labeled and
unlabeled variants 1-6 were also analyzed for antigen binding
specificity. The variants retain activity within 80% and 130% of
wild type with some loss of activity upon labeling. Unlabeled
variant 1 retained approximately 110% of wild-type activity,
whereas labeled variant 1 retained approximately 80%. Unlabeled
variant 2 retained approximately 105% activity of wild-type,
whereas labeled variant 2 retained slightly less than 100%
activity. Unlabeled and labeled variant 3 both retained
approximately 110% of wild-type activity. Unlabeled variant 4
retained approximately 125% of wild-type activity, whereas labeled
variant 4 retained approximately 95% of activity. Unlabeled variant
5 retained approximately 120% of wild-type activity, whereas
labeled variant 6 retained approximately 100% of activity. Finally,
unlabeled variant 6 retained approximately 115% of wild-type
activity, whereas labeled variant 6 retained approximately 90% of
activity. Similarly to its unlabeled counterpart, labeled variant 6
showed high oligomerization propensity.
[0211] Most variants were labeled near the optimal efficiency of
2.0 moles dye per mole antibody (two identical cysteines per
antibody molecule). Higher than 2.0 labeling efficiency is
non-desirable since that would suggest partial disruptions and
labeling of intrachain disulfides. Variants with high
oligomerization propensity such as Variant 6, Variant 11 and
Variant 5 did not label as efficiently. Even among the other
variants, labeling conditions such as time of reaction and dye to
protein ratio had to be optimized on an individual basis because
not all engineered cysteines were equally amenable to conjugation.
Variants 1-14 were specifically labeled at the chain that carries
the engineered cysteine. Proteolytic treatment of the variants with
pronase yielded different fluorescence patterns for most variants,
but similar patterns for variants with neighboring substitutions,
such as Variant 3 and 12. Thus, most variants were efficiently and
specifically labeled.
[0212] Five classes of cross-linking propensity were distinguished
for this set of cysteine variants (Table 1). Class I comprises
variants that were monomeric and remain stable after labeling.
Variants of class II contained a small percent of dimers before and
after labeling. Class III variants had a more pronounced propensity
to oligomerize including formation of some trimers. Class IV
variants had an even higher propensity to oligomerize as evidenced
by the presence of aggregates larger than trimer, especially after
labeling. Class V included variants of high oligomerization
propensity similarly to variant of Class IV with additional
structural abnormalities such as fragmentation or coloration of
purified concentrated sample.
Example 3: Application of the Engineered Antibody Cysteine
Variants
[0213] Cysteine variants with low cross-linking propensity
(Variants 1-4, 7, 10, 12-14) were labeled with high specificity and
efficiency and little oligomerization. Labeling with maleimide dyes
is only one example of site-specific conjugation on these antibody
variants. Molecules with many other functionalities such as binding
specificity or toxicity can be equally attached. Thus, this set of
variants expands on the repertoire of antibody variants to serve
for payload vehicles in targeted therapy or for in vitro and in
vivo fluorescence analysis.
[0214] To illustrate the fluorescence application of one of the
variants, we analyzed the emission pattern of variants conjugated
with the fluorophore pyrene. When two pyrene molecules are close
together there is a characteristic increase of emission at 465 nm
known as excimer fluorescence. We labeled Variants 4 and 7 with
pyrene maleimide and monitored emission spectra. While Variant 4
showed basal level emission at 465 nm, Variant 7 showed strong
excimer fluorescence. Considering the position of the engineered
cysteine in C.sub.H1 for Variant 7, on the inner side of the Fab
domains, the observed result correlates with the known scissoring
effect of the Fab's with respect to Fc. Thus, this variant can be
used in the analysis of antibody domain dynamics.
[0215] The high oligomerization propensity of Variant 6 suggested
another utility of antibody cysteine variants that was explored in
greater detail. Labeled variant 6 was subjected to gel filtration
chromatography in order to separate monomer from oligomers, and
protein-containing fractions were resolved on a 7.5% non-reducing
SDS-PAGE gel and analyzed before and after staining with Coomasssie
Blue. The gel filtration analysis on variant 6 indicated a
competition between labeling and crosslinking: the higher the MW of
the species, the lower the labeling efficiency (indicated by the
level of fluorescence). The highest MW species had a labeling
efficiency of 0.5, while the monomeric species had a labeling
efficiency of 1.0, with the original labeled sample of labeling
efficiency 0.8. An antibody variant with multiple oligomers,
Variant 6 presents an excellent control for antibody
oligomerization and a suitable standard for high molecular weight
proteins, with the additional functionality that it can be
site-specifically labeled.
Example 4: Correlation Between Cross-Linking Propensity (CLP) and
Spatial-Aggregation Propensity (SAP) of the Cysteine Variants
[0216] Cross-linking propensity (CLP) and spatial aggregation
propensity (SAP) were compared for the cysteine variants where
specific amino acids are substituted with cysteine. Each variant
was assigned CLP based on non-reducing SDS-PAGE analysis. SAP
values for the mutated residues are from computational results with
radius of 5 .ANG.. We overlaid the engineered cysteine variants on
the SAP-coded antibody-1 structure.
[0217] The following correlations were observed. All amino acids
substituted with cysteines are of negative SAP-value in the range
from -0.27 to 0.00. This is consistent with the choice of polar or
charged amino acids for substitution. All variants of CLP class I
have SAP between 0.00 and -0.11 (Variants 3, 4, 7, 10, 12), and all
variants of CLP class II have SAP between -0.12 and -0.23 (Variants
1, 2, 13). However, there are variants with SAP in those ranges
with high CLP (Variants 8, 9 and 11 for example). The highly
cross-linking variants Variant 8 and 11 neighbor high-SAP sites.
Variant 5 with CLP III is adjacent to high-SAP sites in C.sub.H2,
while Variant 2 of CLP II is not. However, there is no such
correlation between Variant 6 and Variant 10 in C.sub.H3, and
between Variant 9 and 14 in V.sub.H.
[0218] An additional observation was made of Variant 14. Variant 14
fails to express if there is a region of high SAP nearby, whereas
it expresses when this high SAP region is replaced by a region of
low SAP. A 100-fold higher yield of Variant 14 in the stabilized
antibody-2 (35.6 mg/L culture) was observed compared to that of
Variant 14 in the native antibody-2 background (0.34 mg/L). The
relative yield of Variant 14 in the different backgrounds indicated
a structural problem when a cysteine is introduced on the surface
of a protein near a region of high SAP value. The problem was
resolved when two hydrophobic amino acids in the hydrophobic patch
neighboring the engineered cysteine were substituted with
lysines.
[0219] In summary, correlations exist between stability of cysteine
variants and SAP: 1) cysteine variants with low cross-linking
propensity have slightly negative SAP (0.00 to -0.11), 2) cysteine
variants with more negative SAP (-0.12 to -0.23) are more prone to
cross-linking, and 3) cysteine variants in immediate proximity to
patches of high-SAP are more likely to cross-link or have
structural abnormalities. Conclusions 1 and 2 are consistent with
the previously defined notion that fully exposed residues may be
more susceptible to cross-linking [9].
Example 5--Conclusion
[0220] We designed a set of human IgG1 cysteine variants that are
broadly distributed on the antibody molecule with at least one
variant per immunoglobulin fold domain. Most of these variants are
stable, and can be conjugated efficiently and specifically without
significant loss of antigen binding activity. Thus, the stable
antibody variants add to the repertoire of variants for
site-specific conjugation of payload molecules. If fluorophores are
attached to the engineered cysteines, the dynamics of particular
domains can be analyzed. The highly oligomerizing variants are
beneficial as well, as the numerous multimers provide a convenient
standard for antibody aggregates and for high molecular weight
proteins in general.
[0221] A correlation between the cross-linking propensity of the
antibody cysteine variants described here and the SAP method
demonstrate that the SAP methodology may be used to screen for
conjugation sites with reduced cross-linking. The SAP technology is
computer-based, so it reduces the time and experimental work in
variants design. CLP/SAP comparison showed that substitution of
partially and not fully exposed amino acids yields the most stable
variants. Moreover, the comparison showed that neighboring
hydrophobic patches should be avoided.
[0222] The engineered human IgG1 surface cysteine variants
described here provide new sites for site-specific conjugation of
therapeutic antibodies and methods for identifying further
variants. The variants with little crosslinking propensity have the
greatest utility in developing antibodies for targeted therapy. The
cysteine variants disclosed herein include new sites in previously
represented domains (C.sub.L, C.sub.H1, C.sub.H3) as well as in
previously unrepresented domains (V.sub.L, V.sub.H, C.sub.H2).
[0223] Moreover, the labeled variants can be used as a set of
site-specific fluorescent antibody markers for in vitro and in vivo
laboratory research. The fluorescently labeled products can be
commercialized via biotechnology companies (such as Thermo
Scientific Pierce, GE Healthcare, and Invitrogen) providing the
research community with antibody and other protein reagents.
[0224] The highly cross-linking variant 6 is a useful protein-gel
or other chromatography technique standard. It can be marketed by
companies (for example Invitrogen, Bio-Rad, and Pierce) providing
protein reagents.
[0225] The correlation between CLP and SAP further suggested a
commercial application of our previously described SAP technology.
Consideration of SAP can improve the design of stable antibody
cysteine variants for site-specific conjugation.
TABLE-US-00002 TABLE 1 Variant Domain Residue CLP SAP 1 CH2 K248 II
-0.12 2 CH2 K326 II -0.19 3 VL T22 I -0.07 4 CL T197 I -0.03 5 CH2
N286 III -0.27 6 CH3 S440 IV -0.09 7 CH1 S125 I -0.06 8 CH2 S298 V
-0.19 9 VH S25 III -0.07 10 CH3 S442 I 0.00 11 CH2 S254 V -0.06 12
VL T20 I -0.04 13 CH3 S415 II -0.23 14 VH S7 I -0.11
REFERENCES
[0226] 1. Carter, P. J., Potent antibody therapeutics by design.
Nat Rev Immunol, 2006. 6(5): p. 343-57. [0227] 2. Polakis, P.,
Arming antibodies for cancer therapy. Curr Opin Pharmacol, 2005.
5(4): p. 382-7. [0228] 3. Kaminski, M. S., et al.,
Radioimmunotherapy of B-cell lymphoma with [131I]anti-B1
(anti-CD20) antibody. N Engl J Med, 1993. 329(7): p. 459-65. [0229]
4. King, D. J., et al., Preparation and preclinical evaluation of
humanised A33 immunoconjugates for radioimmunotherapy. Br J Cancer,
1995. 72(6): p. 1364-72. [0230] 5. Khaw, B. A., et al., Myocardial
infarct imaging of antibodies to canine cardiac myosin with
indium-111-diethylenetriamine pentaacetic acid. Science, 1980.
209(4453): p. 295-7. [0231] 6. Rodwell, J. D., et al.,
Site-specific covalent modification of monoclonal antibodies: in
vitro and in vivo evaluations. Proc Natl Acad Sci USA, 1986. 83(8):
p. 2632-6. [0232] 7. Sun, M. M., et al., Reduction-alkylation
strategies for the modification of specific monoclonal antibody
disulfides. Bioconjug Chem, 2005. 16(5): p. 1282-90. [0233] 8.
Junutula, J. R., et al., Site-specific conjugation of a cytotoxic
drug to an antibody improves the therapeutic index. Nat Biotechnol,
2008. 26(8): p. 925-32. [0234] 9. Lyons, A., et al., Site-specific
attachment to recombinant antibodies via introduced surface
cysteine residues. Protein Eng, 1990. 3(8): p. 703-8. [0235] 10.
Shopes, B., A genetically engineered human IgG mutant with enhanced
cytolytic activity. J Immunol, 1992. 148(9): p. 2918-22. [0236] 11.
Shopes, B., A genetically engineered human IgG with limited
flexibility fully initiates cytolysis via complement. Mol Immunol,
1993. 30(6): p. 603-9. [0237] 12. Stimmel, J. B., et al.,
Site-specific conjugation on serine right-arrow cysteine variant
monoclonal antibodies. J Biol Chem, 2000. 275(39): p. 30445-50.
[0238] 13. Zheng, Y., et al., Conformations of IgE bound to its
receptor Fc epsilon RI and in solution. Biochemistry, 1991. 30(38):
p. 9125-32. [0239] 14. Zheng, Y., et al., Dynamic conformations
compared for IgE and IgG1 in solution and bound to receptors.
Biochemistry, 1992. 31(33): p. 7446-56. [0240] 15. Junutula, J. R.,
et al., Rapid identification of reactive cysteine residues for
site-specific labeling of antibody-Fabs. J Immunol Methods, 2008.
332(1-2): p. 41-52.
Sequence CWU 1
1
181103PRTHomo sapiens 1Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Ser Ser Lys1 5 10 15 Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30 Phe Pro Glu Pro Val Thr Val
Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45 Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60 Leu Ser Ser
Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80 Tyr
Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90
95 Arg Val Glu Pro Lys Ser Cys 100 2103PRTHomo sapiens 2Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15 Ser
Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25
30 Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser
35 40 45 Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu
Tyr Ser 50 55 60 Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe
Gly Thr Gln Thr65 70 75 80 Tyr Thr Cys Asn Val Asp His Lys Pro Ser
Asn Thr Lys Val Asp Lys 85 90 95 Thr Val Glu Arg Lys Cys Cys 100
3103PRTHomo sapiens 3Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Cys Ser Arg1 5 10 15 Ser Thr Ser Glu Ser Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30 Phe Pro Glu Pro Val Thr Val
Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45 Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60 Leu Ser Ser
Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80 Tyr
Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90
95 Arg Val Glu Ser Lys Tyr Gly 100 4103PRTHomo sapiens 4Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15 Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25
30 Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser
35 40 45 Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu
Tyr Ser 50 55 60 Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu
Gly Thr Gln Thr65 70 75 80 Tyr Thr Cys Asn Val Asn His Lys Pro Ser
Asn Thr Lys Val Asp Lys 85 90 95 Arg Val Glu Pro Lys Thr Pro 100
517PRTHomo sapiens 5Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly1 5 10 15 Gly613PRTHomo sapiens 6Val Glu Cys Pro Pro
Cys Pro Ala Pro Pro Val Ala Gly1 5 10 714PRTHomo sapiens 7Pro Pro
Cys Pro Ser Cys Pro Ala Pro Glu Phe Leu Gly Gly1 5 10 826PRTHomo
sapiens 8Leu Gly Thr Thr His Thr Cys Pro Arg Cys Pro Glu Pro Lys
Cys Pro1 5 10 15 Arg Cys Pro Ala Pro Glu Leu Leu Gly Gly 20 25
9108PRTHomo sapiens 9Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile1 5 10 15 Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu 20 25 30 Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 35 40 45 Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 50 55 60 Val Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys65 70 75 80 Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 85 90
95 Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 100 105
10108PRTHomo sapiens 10Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile1 5 10 15 Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu 20 25 30 Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 35 40 45 Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg 50 55 60 Val Val Ser
Val Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys65 70 75 80 Glu
Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu 85 90
95 Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 100 105
11108PRTHomo sapiens 11Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile1 5 10 15 Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser Gln Glu 20 25 30 Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 35 40 45 Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg 50 55 60 Val Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys65 70 75 80 Glu
Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu 85 90
95 Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 100 105
12108PRTHomo sapiens 12Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile1 5 10 15 Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu 20 25 30 Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 35 40 45 Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 50 55 60 Val Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys65 70 75 80 Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 85 90
95 Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 100 105
13102PRTHomo sapiens 13Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu
Glu Met Thr Lys Asn1 5 10 15 Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile 20 25 30 Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr 35 40 45 Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 50 55 60 Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys65 70 75 80 Ser
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 85 90
95 Ser Leu Ser Pro Gly Lys 100 14102PRTHomo sapiens 14Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn1 5 10 15 Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 20 25
30 Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
35 40 45 Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser Lys 50 55 60 Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys65 70 75 80 Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu 85 90 95 Ser Leu Ser Pro Gly Lys 100
15102PRTHomo sapiens 15Pro Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu
Glu Met Thr Lys Asn1 5 10 15 Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile 20 25 30 Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr 35 40 45 Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg 50 55 60 Leu Thr Val
Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys65 70 75 80 Ser
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 85 90
95 Ser Leu Ser Leu Gly Lys 100 16102PRTHomo sapiens 16Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn1 5 10 15 Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 20 25
30 Ala Val Glu Trp Glu Ser Ser Gly Gln Pro Glu Asn Asn Tyr Lys Thr
35 40 45 Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser Lys 50 55 60 Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Ile Phe Ser Cys65 70 75 80 Ser Val Met His Glu Ala Leu His Asn His
Phe Thr Gln Lys Ser Leu 85 90 95 Ser Leu Ser Pro Gly Lys 100
17103PRTHomo sapiens 17Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro
Ser Ser Glu Glu Leu1 5 10 15 Gln Ala Asn Lys Ala Thr Leu Val Cys
Leu Ile Ser Asp Phe Tyr Pro 20 25 30 Gly Ala Val Thr Val Ala Trp
Lys Ala Asp Ser Ser Pro Val Lys Ala 35 40 45 Gly Val Glu Thr Thr
Thr Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala 50 55 60 Ala Ser Ser
Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser His Arg65 70 75 80 Ser
Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr Val Glu Lys Thr 85 90
95 Val Ala Pro Thr Glu Cys Ser 100 18105PRTHomo sapiens 18Val Ala
Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu1 5 10 15
Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro 20
25 30 Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser
Gly 35 40 45 Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp
Ser Thr Tyr 50 55 60 Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala
Asp Tyr Glu Lys His65 70 75 80 Lys Val Tyr Ala Cys Glu Val Thr His
Gln Gly Leu Ser Ser Pro Val 85 90 95 Thr Lys Ser Phe Asn Arg Gly
Glu Cys 100 105
* * * * *