U.S. patent application number 15/403987 was filed with the patent office on 2017-07-06 for activin-actriia antagonists and uses for treating multiple myeloma.
The applicant listed for this patent is Acceleron Pharma Inc.. Invention is credited to John Knopf, Ravindra Kumar, Jasbir Seehra.
Application Number | 20170190784 15/403987 |
Document ID | / |
Family ID | 39690668 |
Filed Date | 2017-07-06 |
United States Patent
Application |
20170190784 |
Kind Code |
A1 |
Knopf; John ; et
al. |
July 6, 2017 |
ACTIVIN-ACTRIIA ANTAGONISTS AND USES FOR TREATING MULTIPLE
MYELOMA
Abstract
In certain aspects, the present invention provides compositions
and methods for promoting bone growth and increasing bone density,
as well as for the treatment of multiple myeloma.
Inventors: |
Knopf; John; (Carlisle,
MA) ; Seehra; Jasbir; (Lexington, MA) ; Kumar;
Ravindra; (Acton, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Acceleron Pharma Inc. |
Cambridge |
MA |
US |
|
|
Family ID: |
39690668 |
Appl. No.: |
15/403987 |
Filed: |
January 11, 2017 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13460342 |
Apr 30, 2012 |
9572865 |
|
|
15403987 |
|
|
|
|
13176718 |
Jul 5, 2011 |
8629109 |
|
|
13460342 |
|
|
|
|
12284862 |
Sep 24, 2008 |
8067360 |
|
|
13176718 |
|
|
|
|
11603485 |
Nov 22, 2006 |
7612041 |
|
|
12284862 |
|
|
|
|
12012525 |
Feb 1, 2008 |
8173601 |
|
|
13460342 |
|
|
|
|
60844855 |
Sep 15, 2006 |
|
|
|
60783322 |
Mar 17, 2006 |
|
|
|
60739462 |
Nov 23, 2005 |
|
|
|
61000528 |
Oct 25, 2007 |
|
|
|
60937365 |
Jun 26, 2007 |
|
|
|
60932762 |
May 31, 2007 |
|
|
|
60900580 |
Feb 9, 2007 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 39/39558 20130101;
A61P 19/00 20180101; C07K 2317/55 20130101; A61P 13/12 20180101;
A61P 5/18 20180101; C07K 2317/24 20130101; A61P 5/14 20180101; A61P
35/04 20180101; C07K 2317/21 20130101; A61P 35/00 20180101; C07K
2317/622 20130101; C07K 2319/30 20130101; A61K 2039/505 20130101;
A61K 38/1796 20130101; C07K 14/71 20130101; C07K 2317/54 20130101;
A61P 21/00 20180101; A61P 19/08 20180101; C07K 2317/31 20130101;
C07K 2319/02 20130101; A61K 45/06 20130101; A61P 19/10 20180101;
A61P 43/00 20180101; C07K 16/3061 20130101; A61K 38/179
20130101 |
International
Class: |
C07K 16/30 20060101
C07K016/30; A61K 39/395 20060101 A61K039/395; C07K 14/71 20060101
C07K014/71; A61K 45/06 20060101 A61K045/06 |
Claims
1-65. (canceled)
66. A method for treating or preventing multiple myeloma in a human
patient, the method comprising administering to the patient an
effective amount of an anti-activin antibody or fragment
thereof.
67. The method of claim 66, wherein the antibody or fragment
thereof is a chimeric antibody.
68. The method of claim 66, wherein the antibody or fragment
thereof is a humanized antibody.
69. The method of claim 66, wherein the antibody or fragment
thereof is a human antibody.
70. The method of claim 66, wherein the antibody or fragment
thereof is a monoclonal antibody.
71. The method of claim 66, wherein the antibody or fragment
thereof is an F(ab).sub.2 fragment.
72. The method of claim 66, wherein the antibody or fragment
thereof is an Fab fragment.
73. The method of claim 66, wherein the antibody or fragment
thereof is a single chain antibody.
74. The method of claim 66, wherein the antibody or fragment
thereof is a bi-specific antibody.
75. The method of claim 66, wherein the antibody or fragment
thereof further comprises one or more agents selected from: a
radioisotope, a fluorescent compound, and an enzyme or enzyme
co-factor.
76. The method of claim 66, wherein the antibody or fragment
thereof binds to activin A.
77. The method of claim 66, wherein the antibody or fragment
thereof binds to activin B.
78. The method of claim 66, wherein the antibody or fragment
thereof binds to activin A and B.
79. The method of claim 66, wherein the antibody or fragment
thereof inhibits activin from binding to ActRIIa.
80. The method of claim 66, wherein the antibody or fragment
thereof reduces tumor burden in the patient.
81. The method of claim 66, wherein the antibody or fragment
thereof treats or prevents bone loss in the patient.
82. The method of claim 66, wherein the antibody or fragment
thereof is administered to the patient in combination with one or
more bone-active agents selected from: a calcium supplement,
vitamin D, a bisphosphonate, calcitonin, estrogen, parathyroid
hormone, and raloxifene.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 12/012,525, filed Feb. 1, 2008, which claims the benefit of
U.S. Provisional Application Ser. No. 60/900,580, filed Feb. 9,
2007; 60/932,762 filed May 31, 2007; 60/937,365, filed Jun. 26,
2007; and 61/000,528, filed Oct. 25, 2007. This application is also
a continuation-in-part of U.S. application Ser. No. 13/176,718,
filed Jul. 5, 2011, which is a continuation of U.S. application
Ser. No. 12/284,862, filed Sep. 24, 2008 (now U.S. Pat. No.
8,067,360), which is a continuation of U.S. application Ser. No.
11/603,485, filed Nov. 22, 2006 (now U.S. Pat. No. 7,612,041),
which claims the benefit of U.S. Provisional Application Nos.
60/844,855, filed Sep. 15, 2006, 60/783,322, filed Mar. 17, 2006,
and 60/739,462, filed Nov. 23, 2005. The specifications of each of
the foregoing applications are incorporated herein by reference in
their entirety.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted via EFS-Web and is hereby incorporated by
reference in its entirety. Said ASCII copy, created on Apr. 27,
2012, is named PHPH025102Seq.txt, and is 25,245 bytes in size.
BACKGROUND OF THE INVENTION
[0003] Disorders of the bone, ranging from osteoporosis to
fractures, represent a set of pathological states for which there
are few effective pharmaceutical agents. Treatment instead focuses
on physical and behavioral interventions, including immobilization,
exercise and changes in diet. It would be beneficial to have
therapeutic agents that promote bone growth and increase bone
density for the purpose of treating a variety of bone
disorders.
[0004] Bone growth and mineralization are dependent on the
activities of two cell types, osteoclasts and osteoblasts, although
chondrocytes and cells of the vasculature also participate in
critical aspects of these processes. Developmentally, bone
formation occurs through two mechanisms, endochondral ossification
and intramembranous ossification, with the former responsible for
longitudinal bone formation and the later responsible for the
formation of topologically flat bones, such as the bones of the
skull. Endochondral ossification requires the sequential formation
and degradation of cartilaginous structures in the growth plates
that serve as templates for the formation of osteoblasts,
osteoclasts, the vasculature and subsequent mineralization. During
intramembranous ossification, bone is formed directly in the
connective tissues. Both processes require the infiltration of
osteoblasts and subsequent matrix deposition.
[0005] Fractures and other structural disruptions of bone are
healed through a process that, at least superficially, resembles
the sequence of developmental events of osteogenesis, including the
formation of cartilaginous tissue and subsequent mineralization.
The process of fracture healing can occur in two ways. Direct or
primary bone healing occurs without callus formation. Indirect or
secondary bone healing occurs with a callus precursor stage.
Primary healing of fractures involves the reformation of mechanical
continuity across a closely-set disruption. Under suitable
conditions, bone-resorbing cells surrounding the disruption show a
tunnelling resorptive response and establish pathways for the
penetration of blood vessels and subsequent healing. Secondary
healing of bones follows a process of inflammation, soft callus
formation, callus mineralisation and callus remodelling. In the
inflammation stage, haematoma and haemorrhage formation results
from the disruption of periosteal and endosteal blood vessels at
the site of injury. Inflammatory cells invade the area. In soft
callus formation stage, the cells produce new vessels, fibroblasts,
intracellular material and supporting cells, forming granulation
tissue in the space between the fracture fragments. Clinical union
across the disruption is established by fibrous or cartilaginous
tissue (soft callus). Osteoblasts are formed and mediate the
mineralization of soft callus, which is then replaced by lamellar
bone and subjected to the normal remodeling processes.
[0006] In addition to fractures and other physical disruptions of
bone structure, loss of bone mineral content and bone mass can be
caused by a wide variety of conditions and may result in
significant medical problems. Changes to bone mass occur in a
relatively predictable way over the life of an individual. Up to
about age 30, bones of both men and women grow to maximal mass
through linear growth of the endochondral growth plates and radial
growth. After about age 30 (for trabecular bone, e.g., flat bones
such as the vertebrae and pelvis) and age 40 (for cortical bone,
e.g., long bones found in the limbs), slow bone loss occurs in both
men and women. In women, a final phase of substantial bone loss
also occurs, probably due to postmenopausal estrogen deficiencies.
During this phase, women may lose an additional 10% of bone mass
from the cortical bone and 25% from the trabecular compartment.
Whether progressive bone loss results in a pathological condition
such as osteoporosis depends largely on the initial bone mass of
the individual and whether there are exacerbating conditions.
[0007] Bone loss is sometimes characterized as an imbalance in the
normal bone remodeling process. Healthy bone is constantly subject
to remodeling. Remodeling begins with resorption of bone by
osteoclasts. The resorbed bone is then replaced by new bone tissue,
which is characterized by collagen formation by osteoblasts, and
subsequent calcification. In healthy individuals the rates of
resorption and formation are balanced. Osteoporosis is a chronic,
progressive condition, marked by a shift towards resorption,
resulting in an overall decrease in bone mass and bone
mineralization. Osteoporosis in humans is preceded by clinical
osteopenia (bone mineral density that is greater than one standard
deviation but less than 2.5 standard deviations below the mean
value for young adult bone). Worldwide, approximately 75 million
people are at risk for osteoporosis.
[0008] Thus, methods for controlling the balance between osteoclast
and osteoblast activity can be useful for promoting the healing of
fractures and other damage to bone as well as the treatment of
disorders, such as osteoporosis, associated with loss of bone mass
and bone mineralization.
[0009] With respect to osteoporosis, estrogen, calcitonin,
osteocalcin with vitamin K, or high doses of dietary calcium are
all used as therapeutic interventions. Other therapeutic approaches
to osteoporosis include bisphosphonates, parathyroid hormone,
calcimimetics, statins, anabolic steroids, lanthanum and strontium
salts, and sodium fluoride. Such therapeutics, however, are often
associated with undesirable side effects.
[0010] Thus, it is an object of the present disclosure to provide
compositions and methods for promoting bone growth and
mineralization.
SUMMARY OF THE INVENTION
[0011] In part, the disclosure demonstrates that molecules having
activin or ActRIIa antagonist activity ("activin antagonists" and
"ActRIIa antagonists", collectively "activin-ActRIIa antagonists")
can be used to increase bone density, promote bone growth, and/or
increase bone strength. In particular, the disclosure demonstrates
that a soluble form of ActRIIa acts as an inhibitor of
activin-ActRIIa signaling and promotes increased bone density, bone
growth, and bone strength in vivo. While most pharmaceutical agents
that promote bone growth or inhibit bone loss act as either
anti-catabolic agents (also commonly referred to as "catabolic
agents") (e.g., bisphosphonates) or anabolic agents (e.g.,
parathyroid hormone, PTH, when appropriately dosed), the soluble
ActRIIa protein exhibits dual activity, having both anti-catabolic
and anabolic effects. Thus, the disclosure establishes that
antagonists of the activin-ActRIIa signaling pathway may be used to
increase bone density and promote bone growth. While soluble
ActRIIa may affect bone through a mechanism other than activin
antagonism, the disclosure nonetheless demonstrates that desirable
therapeutic agents may be selected on the basis of an
activin-ActRIIa antagonist activity. Therefore, in certain
embodiments, the disclosure provides methods for using
activin-ActRIIa antagonists, including, for example,
activin-binding ActRIIa polypeptides, anti-activin antibodies,
anti-ActRIIa antibodies, activin- or ActRIIa-targeted small
molecules and aptamers, and nucleic acids that decrease expression
of activin and ActRIIa, to treat disorders associated with low bone
density or low bone strength, such as osteoporosis, or to promote
bone growth in patients in need thereof, such as in patients having
a bone fracture. The disclosure further demonstrates that
activin-ActRIIa antagonists are effective in preventing and/or
repairing bone damage caused by multiple myeloma tumors and breast
tumors, and, additionally, that activin-ActRIIa antagonists
diminish the tumor load in multiple myeloma. Soluble ActRIIa
polypeptide promotes bone growth without causing a consistently
measurable increase in muscle mass.
[0012] In certain aspects, the disclosure provides polypeptides
comprising a soluble, activin-binding ActRIIa polypeptide that
binds to activin. ActRIIa polypeptides may be formulated as a
pharmaceutical preparation comprising the activin-binding ActRIIa
polypeptide and a pharmaceutically acceptable carrier. Preferably,
the activin-binding ActRIIa polypeptide binds to activin with a
K.sub.D less than 1 micromolar or less than 100, 10 or 1 nanomolar.
Optionally, the activin-binding ActRIIa polypeptide selectively
binds activin versus GDF11 and/or GDF8, and preferably with a
K.sub.D that is at least 10-fold, 20-fold or 50-fold lower with
respect to activin than with respect to GDF11 and/or GDF8. While
not wishing to be bound to a particular mechanism of action, it is
expected that this degree of selectivity for activin inhibition
over GDF11/GDF8 inhibition accounts for the selective effect on
bone without a consistently measurable effect on muscle. In many
embodiments, an ActRIIa polypeptide will be selected for causing
less than 15%, less than 10% or less than 5% increase in muscle at
doses that achieve desirable effects on bone. Preferably the
composition is at least 95% pure, with respect to other polypeptide
components, as assessed by size exclusion chromatography, and more
preferably, the composition is at least 98% pure. An
activin-binding ActRIIa polypeptide for use in such a preparation
may be any of those disclosed herein, such as a polypeptide having
an amino acid sequence selected from SEQ ID NOs: 2, 3, 7 or 12, or
having an amino acid sequence that is at least 80%, 85%, 90%, 95%,
97% or 99% identical to an amino acid sequence selected from SEQ ID
NOs: 2, 3, 7, 12 or 13. An activin-binding ActRIIa polypeptide may
include a functional fragment of a natural ActRIIa polypeptide,
such as one comprising at least 10, 20 or 30 amino acids of a
sequence selected from SEQ ID NOs: 1-3 or a sequence of SEQ ID NO:
2, lacking the C-terminal 10 to 15 amino acids (the "tail").
[0013] A soluble, activin-binding ActRIIa polypeptide may include
one or more alterations in the amino acid sequence (e.g., in the
ligand-binding domain) relative to a naturally occurring ActRIIa
polypeptide. Examples of altered ActRIIa polypeptides are provided
in WO 2006/012627, pp. 59-60, incorporated by reference herein. The
alteration in the amino acid sequence may, for example, alter
glycosylation of the polypeptide when produced in a mammalian,
insect or other eukaryotic cell or alter proteolytic cleavage of
the polypeptide relative to the naturally occurring ActRIIa
polypeptide.
[0014] An activin-binding ActRIIa polypeptide may be a fusion
protein that has, as one domain, an ActRIIa polypeptide (e.g., a
ligand-binding portion of an ActRIIa) and one or more additional
domains that provide a desirable property, such as improved
pharmacokinetics, easier purification, targeting to particular
tissues, etc. For example, a domain of a fusion protein may enhance
one or more of in vivo stability, in vivo half life,
uptake/administration, tissue localization or distribution,
formation of protein complexes, multimerization of the fusion
protein, and/or purification. Dimerization or multimerization may
provide increased ligand-binding affinity. An activin-binding
ActRIIa fusion protein may include an immunoglobulin Fc domain
(wild-type or mutant) or a serum albumin or other polypeptide
portion that provides desirable properties such as improved
pharmacokinetics, improved solubility or improved stability.
Typically, an ActRIIa-Fc fusion protein will be produced as a
homodimeric complex. Optionally, an ActRIIa-Fc fusion comprises a
relatively unstructured linker positioned between the Fc domain and
the extracellular ActRIIa domain. This unstructured linker may
correspond to the roughly 15 amino acid unstructured region at the
C-terminal end of the extracellular domain of ActRIIa (the "tail"),
or it may be an artificial sequence of 1, 2, 3, 4 or 5 amino acids
or a length of between 5 and 15, 20, 30, 50 or more amino acids
that are relatively free of secondary structure, or a mixture of
both. A linker may be rich in glycine and proline residues and may,
for example, contain a single sequence of threonine/serine and
glycines or repeating sequences of threonine/serine and glycines
(e.g., TG.sub.4 (SEQ ID NO: 16) or SG.sub.4 (SEQ ID NO: 17)
singlets or repeats). A fusion protein may include a purification
subsequence, such as an epitope tag, a FLAG tag, a polyhistidine
sequence, and a GST fusion. Optionally, a soluble ActRIIa
polypeptide includes one or more modified amino acid residues
selected from: a glycosylated amino acid, a PEGylated amino acid, a
farnesylated amino acid, an acetylated amino acid, a biotinylated
amino acid, an amino acid conjugated to a lipid moiety, and an
amino acid conjugated to an organic derivatizing agent. A
pharmaceutical preparation may also include one or more additional
compounds such as a compound that is used to treat a bone disorder.
Preferably, a pharmaceutical preparation is substantially pyrogen
free. In general, it is preferable that an ActRIIa protein be
expressed in a mammalian cell line that mediates suitably natural
glycosylation of the ActRIIa protein so as to diminish the
likelihood of an unfavorable immune response in a patient. Human
and CHO cell lines have been used successfully, and it is expected
that other common mammalian expression systems will be useful.
[0015] As described herein, ActRIIa proteins designated ActRIIa-Fc
have desirable properties, including selective binding to activin
versus GDF8 and/or GDF11, high affinity ligand binding and serum
half life greater than two weeks in animal models. In certain
embodiments the invention provides ActRIIa-Fc polypeptides and
pharmaceutical preparations comprising such polypeptides and a
pharmaceutically acceptable excipient.
[0016] In certain aspects, the disclosure provides nucleic acids
encoding a soluble activin-binding ActRIIa polypeptide. An isolated
polynucleotide may comprise a coding sequence for a soluble,
activin-binding ActRIIa polypeptide, such as described above. For
example, an isolated nucleic acid may include a sequence coding for
an extracellular domain (e.g., ligand-binding domain) of an ActRIIa
and a sequence that would code for part or all of the transmembrane
domain and/or the cytoplasmic domain of an ActRIIa, but for a stop
codon positioned within the transmembrane domain or the cytoplasmic
domain, or positioned between the extracellular domain and the
transmembrane domain or cytoplasmic domain. For example, an
isolated polynucleotide may comprise a full-length ActRIIa
polynucleotide sequence such as SEQ ID NO: 4 or 5, or a partially
truncated version, said isolated polynucleotide further comprising
a transcription termination codon at least six hundred nucleotides
before the 3'-terminus or otherwise positioned such that
translation of the polynucleotide gives rise to an extracellular
domain optionally fused to a truncated portion of a full-length
ActRIIa. A preferred nucleic acid sequence is SEQ ID NO:14. Nucleic
acids disclosed herein may be operably linked to a promoter for
expression, and the disclosure provides cells transformed with such
recombinant polynucleotides. Preferably the cell is a mammalian
cell such as a CHO cell.
[0017] In certain aspects, the disclosure provides methods for
making a soluble, activin-binding ActRIIa polypeptide. Such a
method may include expressing any of the nucleic acids (e.g., SEQ
ID NO: 4, 5 or 14) disclosed herein in a suitable cell, such as a
Chinese hamster ovary (CHO) cell. Such a method may comprise: a)
culturing a cell under conditions suitable for expression of the
soluble ActRIIa polypeptide, wherein said cell is transformed with
a soluble ActRIIa expression construct; and b) recovering the
soluble ActRIIa polypeptide so expressed. Soluble ActRIIa
polypeptides may be recovered as crude, partially purified or
highly purified fractions. Purification may be achieved by a series
of purification steps, including, for example, one, two or three or
more of the following, in any order: protein A chromatography,
anion exchange chromatography (e.g., Q sepharose), hydrophobic
interaction chromatography (e.g., phenylsepharose), size exclusion
chromatography, and cation exchange chromatography.
[0018] In certain aspects, an activin-ActRIIa antagonist disclosed
herein, such as a soluble, activin-binding ActRIIa polypeptide, may
be used in a method for promoting bone growth or increasing bone
density in a subject. In certain embodiments, the disclosure
provides methods for treating a disorder associated with low bone
density, or to promote bone growth, in patients in need thereof. A
method may comprise administering to a subject in need thereof an
effective amount of activin-ActRIIa antagonist. In certain aspects,
the disclosure provides uses of activin-ActRIIa antagonist for
making a medicament for the treatment of a disorder or condition as
described herein.
[0019] In certain aspects, the disclosure provides a method for
identifying an agent that stimulates growth of, or increased
mineralization of, bone. The method comprises: a) identifying a
test agent that binds to activin or a ligand-binding domain of an
ActRIIa polypeptide; and b) evaluating the effect of the agent on
growth of, or mineralization of, bone.
BRIEF DESCRIPTION OF THE DRAWINGS
[0020] The patent or application file contains at least one drawing
executed in color. Copies of this patent or patent application
publication with color drawing(s) will be provided by the Office
upon request any payment of the necessary fee.
[0021] FIG. 1 shows the purification of ActRIIa-hFc expressed in
CHO cells. The protein purifies as a single, well-defined peak.
[0022] FIG. 2 shows the binding of ActRIIa-hFc to activin and
GDF-11, as measured by BiaCore.TM. assay.
[0023] FIG. 3 shows a schematic for the A-204 Reporter Gene Assay.
The figure shows the Reporter vector: pGL3(CAGA)12 (described in
Dennler et al, 1998, EMBO 17: 3091-3100.) The CAGA12 motif (SEQ ID
NO: 15) is present in TGF-Beta responsive genes (PAI-1 gene), so
this vector is of general use for factors signaling through Smad 2
and 3.
[0024] FIG. 4 shows the effects of ActRIIa-hFc (diamonds) and
ActRIIa-mFc (squares) on GDF-8 signaling in the A-204 Reporter Gene
Assay. Both proteins exhibited substantial inhibition of GDF-8
mediated signaling at picomolar concentrations.
[0025] FIG. 5 shows the effects of three different preparations of
ActRIIa-hFc on GDF-11 signaling in the A-204 Reporter Gene
Assay.
[0026] FIG. 6 shows examples of DEXA images of control- and
ActRIIa-mFc-treated BALB/c mice, before (top panels) and after
(bottom panels) the 12-week treatment period. Paler shading
indicates increased bone density.
[0027] FIG. 7 shows a quantification of the effects of ActRIIa-mFc
on bone mineral density in BALB/c mice over the 12-week period.
Treatments were control (diamonds), 2 mg/kg dosing of ActRIIa-mFc
(squares), 6 mg/kg dosing of ActRIIa-mFc (triangles) and 10 mg/kg
dosing of ActRIIa-mFc (circles).
[0028] FIG. 8 shows a quantification of the effects of ActRIIa-mFc
on bone mineral content in BALB/c mice over the 12-week period.
Treatments were control (diamonds), 2 mg/kg dosing of ActRIIa-mFc
(squares), 6 mg/kg dosing of ActRIIa-mFc (triangles) and 10 mg/kg
dosing of ActRIIa-mFc (circles).
[0029] FIG. 9 shows a quantification of the effects of ActRIIa-mFc
on bone mineral density of the trabecular bone in ovariectomized
(OVX) or sham operated (SHAM) C57BL6 mice over after a 6-week
period. Treatments were control (PBS) or 10 mg/kg dosing of
ActRIIa-mFc (ActRIIa).
[0030] FIG. 10 shows a quantification of the effects of ActRIIa-mFc
on the trabecular bone in ovariectomized (OVX) C57BL6 mice over a
12-week period. Treatments were control (PBS; pale bars) or 10
mg/kg dosing of ActRIIa-mFc (ActRIIa; dark bars).
[0031] FIG. 11 shows a quantification of the effects of ActRIIa-mFc
on the trabecular bone in sham operated C57BL6 mice after 6 or 12
weeks of treatment period. Treatments were control (PBS; pale bars)
or 10 mg/kg dosing of ActRIIa-mFc (ActRIIa; dark bars).
[0032] FIG. 12 shows the results of pQCT analysis of bone density
in ovariectomized mice over 12 weeks of treatment. Treatments were
control (PBS; pale bars) or ActRIIa-mFc (dark bars). y-axis:
mg/ccm
[0033] FIG. 13 depicts the results of pQCT analysis of bone density
in sham operated mice over 12 weeks of treatment. Treatments were
control (PBS; pale bars) or ActRIIa-mFc (dark bars). y-axis;
mg/ccm
[0034] FIGS. 14A and 14B show whole body DEXA analysis after 12
weeks of treatment (A) and ex vivo analysis of femurs (B). Light
areas depict areas of high bone density.
[0035] FIG. 15 shows ex vivo pQCT analysis of the femoral midshaft
after twelve weeks of treatment. Treatments were vehicle control
(PBS, dark bars) and ActRIIa-mFc (pale bars). The four bars to the
left show total bone density while the four bars to the right show
cortical bone density. The first pair of bars in each set of four
bars represent data from ovariectomized mice while the second pair
of bars represent data from sham operated mice.
[0036] FIG. 16 shows ex vivo pQCT analysis and diaphyseal bone
content of the femoral midshaft after twelve weeks of treatment.
Treatments were vehicle control (PBS, dark bars) or ActRIIa-mFc
(pale bars). The four bars to the left show total bone content
while the four bars to the right show cortical bone content. The
first pair of bars in each set of four bars represent data from
ovariectomized mice while the second pair of bars represent data
from sham operated mice.
[0037] FIG. 17 shows ex vivo pQCT analysis of the femoral midshaft
and femoral cortical thickness. Treatments were control (PBS, dark
bars) and ActRIIa-mFc (pale bars). The four bars to the left show
endosteal circumference while the four bars to the right show
periosteal circumference. The first pair of bars in each set of
four bars represent data from ovariectomized mice while the second
pair of bars represent data from sham operated mice.
[0038] FIG. 18 depicts the results of mechanical testing of femurs
after twelve weeks of treatment. Treatments were control (PBS, dark
bars) and ActRIIa-mFc (pale bars). The two bars to the left
represent data from ovariectomized mice while the last two bars
represent data from sham operated mice.
[0039] FIG. 19 shows the effects of ActrIIa-mFc on trabecular bone
volume.
[0040] FIG. 20 shows the effects of ActrIIa-mFc on trabecular
architecture in the distal femur.
[0041] FIG. 21 shows the effects of ActrIIa-mFc on cortical
bone.
[0042] FIG. 22 shows the effects of ActrIIa-mFc on the mechanical
strength of bone.
[0043] FIG. 23 shows the effects of different doses of ActRIIa-mFc
on bone characteristics at three different dosages.
[0044] FIG. 24 shows bone histomorphometry indicating that
ActRIIa-mFc has dual anabolic and anti-resorptive activity.
[0045] FIG. 25 shows additional histomorphometric data.
[0046] FIG. 26 shows images of mouse femurs from naive and
tumor-carrying mice, and the effects of ActRIIa-mFc treatment on
bone morphology in the multiple myeloma model. Mice carrying
multiple myeloma tumors (5T2) show marked pitting and degradation
in the bone relative to normal mice (naive). Treatment with
ActRIIa-mFc eliminates this effect.
[0047] FIG. 27 shows results from the human clinical trial
described in Example 5, where the area-under-curve (AUC) and
administered dose of ActRIIa-hFc have a linear correlation,
regardless of whether ActRIIa-hFc was administered intravenously
(IV) or subcutaneously (SC).
[0048] FIG. 28 shows a comparison of serum levels of ActRIIa-hFc in
patients administered IV or SC.
[0049] FIG. 29 shows bone alkaline phosphatase (BAP) levels in
response to different dose levels of ActRIIa-hFc. BAP is a marker
for anabolic bone growth.
[0050] FIG. 30 shows the cooperative effects of ActRIIa-mFc
(RAP-011) and a bisphosphonate agent (zoledronate) in mice.
DETAILED DESCRIPTION OF THE INVENTION
1. Overview
[0051] The transforming growth factor-beta (TGF-beta) superfamily
contains a variety of growth factors that share common sequence
elements and structural motifs. These proteins are known to exert
biological effects on a large variety of cell types in both
vertebrates and invertebrates. Members of the superfamily perform
important functions during embryonic development in pattern
formation and tissue specification and can influence a variety of
differentiation processes, including adipogenesis, myogenesis,
chondrogenesis, cardiogenesis, hematopoiesis, neurogenesis, and
epithelial cell differentiation. The family is divided into two
general branches: the BMP/GDF and the TGF-beta/Activin/BMP10
branches, whose members have diverse, often complementary effects.
By manipulating the activity of a member of the TGF-beta family, it
is often possible to cause significant physiological changes in an
organism. For example, the Piedmontese and Belgian Blue cattle
breeds carry a loss-of-function mutation in the GDF8 (also called
myostatin) gene that causes a marked increase in muscle mass.
Grobet et al., Nat Genet. 1997, 17(1):71-4. Furthermore, in humans,
inactive alleles of GDF8 are associated with increased muscle mass
and, reportedly, exceptional strength. Schuelke et al., N Engl J
Med 2004, 350:2682-8.
[0052] Activins are dimeric polypeptide growth factors that belong
to the TGF-beta superfamily. There are three principle activin
forms (A, B, and AB) that are homo/heterodimers of two closely
related .beta. subunits (.beta..sub.A.beta..sub.A,
.beta..sub.B.beta..sub.B, and .beta..sub.A.beta..sub.B). The human
genome also encodes an activin C and an activin E, which are
primarily expressed in the liver. In the TGF-beta superfamily,
activins are unique and multifunctional factors that can stimulate
hormone production in ovarian and placental cells, support neuronal
cell survival, influence cell-cycle progress positively or
negatively depending on cell type, and induce mesodermal
differentiation at least in amphibian embryos (DePaolo et al.,
1991, Proc Soc Ep Biol Med. 198:500-512; Dyson et al., 1997, Curr
Biol. 7:81-84; Woodruff, 1998, Biochem Pharmacol. 55:953-963).
Moreover, erythroid differentiation factor (EDF) isolated from the
stimulated human monocytic leukemic cells was found to be identical
to activin A (Murata et al., 1988, PNAS, 85:2434). It has been
suggested that activin A acts as a natural, positive regulator of
erythropoiesis in the bone marrow. In several tissues, activin
signaling is antagonized by its related heterodimer, inhibin. For
example, during the release of follicle-stimulating hormone (FSH)
from the pituitary, activin promotes FSH secretion and synthesis,
while inhibin prevents FSH secretion and synthesis. Other proteins
that may regulate activin bioactivity and/or bind to activin
include follistatin (FS), follistatin-related protein (FSRP), and
.alpha..sub.2-macroglobulin.
[0053] TGF-.beta. signals are mediated by heteromeric complexes of
type I and type II serine/threonine kinase receptors, which
phosphorylate and activate downstream Smad proteins upon ligand
stimulation (Massague, 2000, Nat. Rev. Mol. Cell Biol. 1:169-178).
These type I and type II receptors are transmembrane proteins,
composed of a ligand-binding extracellular domain with
cysteine-rich region, a transmembrane domain, and a cytoplasmic
domain with predicted serine/threonine specificity. Type I
receptors are essential for signaling; and type II receptors are
required for binding ligands and for expression of type I
receptors. Type I and II activin receptors form a stable complex
after ligand binding, resulting in phosphorylation of type I
receptors by type II receptors.
[0054] Two related type II receptors, ActRIIa and ActRIIb, have
been identified as the type II receptors for activins (Mathews and
Vale, 1991, Cell 65:973-982; Attisano et al., 1992, Cell 68:
97-108). Besides activins, ActRIIa and ActRIIb can biochemically
interact with several other TGF-.beta. family proteins, including
BMP7, Nodal, GDF8, and GDF11 (Yamashita et al., 1995, J. Cell Biol.
130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad. Sci.
98:9306-9311; Yeo and Whitman, 2001, Mol. Cell 7: 949-957; Oh et
al., 2002, Genes Dev. 16:2749-54). ALK4 is the primary type I
receptor for activins, particularly for activin A, and ALK-7 may
serve as a receptor for activins as well, particularly for activin
B.
[0055] As demonstrated herein, a soluble ActRIIa polypeptide
(sActRIIa), which shows substantial preference in binding to
activin A as opposed to other TGF-beta family members, such as GDF8
or GDF11, is effective to promote bone growth and increase bone
density in vivo. While not wishing to be bound to any particular
mechanism, it is expected that the effect of sActRIIa is caused
primarily by an activin antagonist effect, given the very strong
activin binding (picomolar dissociation constant) exhibited by the
particular sActRIIa construct used in these studies. Regardless of
mechanism, it is apparent from the data presented herein that
ActRIIa-activin antagonists do increase bone density in normal
mice, in mouse models for osteoporosis and in a mouse model of
multiple myeloma. It should be noted that bone is a dynamic tissue,
with growth or shrinkage and increased or decreased density
depending on a balance of factors that produce bone and stimulate
mineralization (primarily osteoblasts) and factors that destroy and
demineralize bone (primarily osteoclasts). Bone growth and
mineralization may be increased by increasing the productive
factors, by decreasing the destructive factors, or both. The terms
"promote bone growth" and "increase bone mineralization" refer to
the observable physical changes in bone and are intended to be
neutral as to the mechanism by which changes in bone occur.
[0056] The mouse models for osteoporosis and bone growth/density
that were used in the studies described herein are considered to be
highly predictive of efficacy in humans, and therefore, this
disclosure provides methods for using ActRIIa polypeptides and
other activin-ActRIIa antagonists to promote bone growth and
increase bone density in humans. Activin-ActRIIa antagonists
include, for example, activin-binding soluble ActRIIa polypeptides,
antibodies that bind to activin (particularly the activin A or B
subunits, also referred to as .beta.A or .beta.B) and disrupt
ActRIIa binding, antibodies that bind to ActRIIa and disrupt
activin binding, non-antibody proteins selected for activin or
ActRIIa binding (see e.g., WO/2002/088171, WO/2006/055689, and
WO/2002/032925 for examples of such proteins and methods for design
and selection of such non-antibody affinity binding reagents), and
randomized peptides selected for activin or ActRIIa binding, often
affixed to an Fc domain. Two different proteins (or other moieties)
with activin or ActRIIa binding activity, especially activin
binders that block the type I (e.g., a soluble type I activin
receptor) and type II (e.g., a soluble type II activin receptor)
binding sites, respectively, may be linked together to create a
bifunctional binding molecule. Nucleic acid aptamers, small
molecules and other agents that inhibit the activin-ActRIIa
signaling axis. Various proteins have activin-ActRIIa antagonist
activity, including inhibin (i.e., inhibin alpha subunit), although
inhibin does not universally antagonize activin in all tissues,
follistatin (e.g., follistatin-288 and follistatin-315), FSRP,
activin C, alpha(2)-macroglobulin, and an M108A (methionine to
alanine change at position 108) mutant activin A. Generally,
alternative forms of activin, particularly those with alterations
in the type I receptor binding domain can bind to type II receptors
and fail to form an active ternary complex, thus acting as
antagonists. Additionally, nucleic acids, such as antisense
molecules, siRNAs or ribozymes that inhibit activin A, B, C or E,
or, particularly, ActRIIa expression, can be used as
activin-ActRIIa antagonists. Preferably, the activin-ActRIIa
antagonist to be used will exhibit selectivity for inhibiting
activin-mediated signaling versus other members of the TGF-beta
family, and particularly with respect to GDF8 and GDF11. Soluble
ActRIIb proteins do bind to activin, however, the wild type protein
does not exhibit significant selectivity in binding to activin
versus GDF8/11, and preliminary experiments suggest that this
protein does not provide the desired effects on bone, while also
causing substantial muscle growth. However, altered forms of
ActRIIb with different binding properties have been identified
(see, e.g., WO 2006/012627, pp. 55-59, incorporated herein by
reference) and these proteins may achieve the desired effects on
bone. Native or altered ActRIIb may be given added specificity for
activin by coupling with a second, activin-selective binding
agent.
[0057] The terms used in this specification generally have their
ordinary meanings in the art, within the context of this invention
and in the specific context where each term is used. Certain terms
are discussed below or elsewhere in the specification, to provide
additional guidance to the practitioner in describing the
compositions and methods of the invention and how to make and use
them. The scope or meaning of any use of a term will be apparent
from the specific context in which the term is used.
[0058] "About" and "approximately" shall generally mean an
acceptable degree of error for the quantity measured given the
nature or precision of the measurements. Typically, exemplary
degrees of error are within 20 percent (%), preferably within 10%,
and more preferably within 5% of a given value or range of
values.
[0059] Alternatively, and particularly in biological systems, the
terms "about" and "approximately" may mean values that are within
an order of magnitude, preferably within 5-fold and more preferably
within 2-fold of a given value. Numerical quantities given herein
are approximate unless stated otherwise, meaning that the term
"about" or "approximately" can be inferred when not expressly
stated.
[0060] The methods of the invention may include steps of comparing
sequences to each other, including wild-type sequence to one or
more mutants (sequence variants). Such comparisons typically
comprise alignments of polymer sequences, e.g., using sequence
alignment programs and/or algorithms that are well known in the art
(for example, BLAST, FASTA and MEGALIGN, to name a few). The
skilled artisan can readily appreciate that, in such alignments,
where a mutation contains a residue insertion or deletion, the
sequence alignment will introduce a "gap" (typically represented by
a dash, or "A") in the polymer sequence not containing the inserted
or deleted residue.
[0061] "Homologous," in all its grammatical forms and spelling
variations, refers to the relationship between two proteins that
possess a "common evolutionary origin," including proteins from
superfamilies in the same species of organism, as well as
homologous proteins from different species of organism. Such
proteins (and their encoding nucleic acids) have sequence homology,
as reflected by their sequence similarity, whether in terms of
percent identity or by the presence of specific residues or motifs
and conserved positions.
[0062] The term "sequence similarity," in all its grammatical
forms, refers to the degree of identity or correspondence between
nucleic acid or amino acid sequences that may or may not share a
common evolutionary origin.
[0063] However, in common usage and in the instant application, the
term "homologous," when modified with an adverb such as "highly,"
may refer to sequence similarity and may or may not relate to a
common evolutionary origin.
2. ActRIIa Polypeptides
[0064] In certain aspects, the present invention relates to ActRIIa
polypeptides. As used herein, the term "ActRIIa" refers to a family
of activin receptor type IIa (ActRIIa) proteins from any species
and variants derived from such ActRIIa proteins by mutagenesis or
other modification. Reference to ActRIIa herein is understood to be
a reference to any one of the currently identified forms. Members
of the ActRIIa family are generally transmembrane proteins,
composed of a ligand-binding extracellular domain with a
cysteine-rich region, a transmembrane domain, and a cytoplasmic
domain with predicted serine/threonine kinase activity.
[0065] The term "ActRIIa polypeptide" includes polypeptides
comprising any naturally occurring polypeptide of an ActRIIa family
member as well as any variants thereof (including mutants,
fragments, fusions, and peptidomimetic forms) that retain a useful
activity. For example, ActRIIa polypeptides include polypeptides
derived from the sequence of any known ActRIIa having a sequence at
least about 80% identical to the sequence of an ActRIIa
polypeptide, and preferably at least 85%, 90%, 95%, 97%, 99% or
greater identity. For example, an ActRIIa polypeptide of the
invention may bind to and inhibit the function of an ActRIIa
protein and/or activin. Preferably, an ActRIIa polypeptide promotes
bone growth and bone mineralization. Examples of ActRIIa
polypeptides include human ActRIIa precursor polypeptide (SEQ ID
NO: 1) and soluble human ActRIIa polypeptides (e.g., SEQ ID NOs: 2,
3, 7 and 12).
[0066] The human ActRIIa precursor protein sequence is as
follows:
TABLE-US-00001 (SEQ ID NO: 1)
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPC
YGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEV
YFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPLMLI
AGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKAR
GRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFI
GAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAG
KSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASR
CTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAG
MAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTM
VTNVDFPPKESSL
[0067] The signal peptide is single underlined; the extracellular
domain is in bold and the potential N-linked glycosylation sites
are double underlined.
[0068] The human ActRIIa soluble (extracellular), processed
polypeptide sequence is as follows:
TABLE-US-00002 (SEQ ID NO: 2)
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS
IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPP
[0069] The C-terminal "tail" of the extracellular domain is
underlined. The sequence with the "tail" deleted (a .DELTA.15
sequence) is as follows:
TABLE-US-00003 (SEQ ID NO: 3)
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS
IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
[0070] The nucleic acid sequence encoding human ActRIIa precursor
protein is as follows (nucleotides 164-1705 of Genbank entry
NM_001616):
TABLE-US-00004 (SEQ ID NO: 4)
ATGGGAGCTGCTGCAAAGTTGGCGTTTGCCGTCTTTCTTATCTCCTGTTC
TTCAGGTGCTATACTTGGTAGATCAGAAACTCAGGAGTGTCTTTTCTTTA
ATGCTAATTGGGAAAAAGACAGAACCAATCAAACTGGTGTTGAACCGTGT
TATGGTGACAAAGATAAACGGCGGCATTGTTTTGCTACCTGGAAGAATAT
TTCTGGTTCCATTGAAATAGTGAAACAAGGTTGTTGGCTGGATGATATCA
ACTGCTATGACAGGACTGATTGTGTAGAAAAAAAAGACAGCCCTGAAGTA
TATTTTTGTTGCTGTGAGGGCAATATGTGTAATGAAAAGTTTTCTTATTT
TCCAGAGATGGAAGTCACACAGCCCACTTCAAATCCAGTTACACCTAAGC
CACCCTATTACAACATCCTGCTCTATTCCTTGGTGCCACTTATGTTAATT
GCGGGGATTGTCATTTGTGCATTTTGGGTGTACAGGCATCACAAGATGGC
CTACCCTCCTGTACTTGTTCCAACTCAAGACCCAGGACCACCCCCACCTT
CTCCATTACTAGGGTTGAAACCACTGCAGTTATTAGAAGTGAAAGCAAGG
GGAAGATTTGGTTGTGTCTGGAAAGCCCAGTTGCTTAACGAATATGTGGC
TGTCAAAATATTTCCAATACAGGACAAACAGTCATGGCAAAATGAATACG
AAGTCTACAGTTTGCCTGGAATGAAGCATGAGAACATATTACAGTTCATT
GGTGCAGAAAAACGAGGCACCAGTGTTGATGTGGATCTTTGGCTGATCAC
AGCATTTCATGAAAAGGGTTCACTATCAGACTTTCTTAAGGCTAATGTGG
TCTCTTGGAATGAACTGTGTCATATTGCAGAAACCATGGCTAGAGGATTG
GCATATTTACATGAGGATATACCTGGCCTAAAAGATGGCCACAAACCTGC
CATATCTCACAGGGACATCAAAAGTAAAAATGTGCTGTTGAAAAACAACC
TGACAGCTTGCATTGCTGACTTTGGGTTGGCCTTAAAATTTGAGGCTGGC
AAGTCTGCAGGCGATACCCATGGACAGGTTGGTACCCGGAGGTACATGGC
TCCAGAGGTATTAGAGGGTGCTATAAACTTCCAAAGGGATGCATTTTTGA
GGATAGATATGTATGCCATGGGATTAGTCCTATGGGAACTGGCTTCTCGC
TGTACTGCTGCAGATGGACCTGTAGATGAATACATGTTGCCATTTGAGGA
GGAAATTGGCCAGCATCCATCTCTTGAAGACATGCAGGAAGTTGTTGTGC
ATAAAAAAAAGAGGCCTGTTTTAAGAGATTATTGGCAGAAACATGCTGGA
ATGGCAATGCTCTGTGAAACCATTGAAGAATGTTGGGATCACGACGCAGA
AGCCAGGTTATCAGCTGGATGTGTAGGTGAAAGAATTACCCAGATGCAGA
GACTAACAAATATTATTACCACAGAGGACATTGTAACAGTGGTCACAATG
GTGACAAATGTTGACTTTCCTCCCAAAGAATCTAGTCTATGA
[0071] The nucleic acid sequence encoding a human ActRIIa soluble
(extracellular) polypeptide is as follows:
TABLE-US-00005 (SEQ ID NO: 5)
ATACTTGGTAGATCAGAAACTCAGGAGTGTCTTTTCTTTAATGCTAATTG
GGAAAAAGACAGAACCAATCAAACTGGTGTTGAACCGTGTTATGGTGACA
AAGATAAACGGCGGCATTGTTTTGCTACCTGGAAGAATATTTCTGGTTCC
ATTGAAATAGTGAAACAAGGTTGTTGGCTGGATGATATCAACTGCTATGA
CAGGACTGATTGTGTAGAAAAAAAAGACAGCCCTGAAGTATATTTTTGTT
GCTGTGAGGGCAATATGTGTAATGAAAAGTTTTCTTATTTTCCAGAGATG
GAAGTCACACAGCCCACTTCAAATCCAGTTACACCTAAGCCACCC
[0072] In a specific embodiment, the invention relates to soluble
ActRIIa polypeptides. As described herein, the term "soluble
ActRIIa polypeptide" generally refers to polypeptides comprising an
extracellular domain of an ActRIIa protein. The term "soluble
ActRIIa polypeptide," as used herein, includes any naturally
occurring extracellular domain of an ActRIIa protein as well as any
variants thereof (including mutants, fragments and peptidomimetic
forms). An activin-binding ActRIIa polypeptide is one that retains
the ability to bind to activin, particularly activin AA, AB or BB.
Preferably, an activin-binding ActRIIa polypeptide will bind to
activin AA with a dissociation constant of 1 nM or less. Amino acid
sequences of human ActRIIa precursor protein is provided below. The
extracellular domain of an ActRIIa protein binds to activin and is
generally soluble, and thus can be termed a soluble,
activin-binding ActRIIa polypeptide. Examples of soluble,
activin-binding ActRIIa polypeptides include the soluble
polypeptide illustrated in SEQ ID NOs: 2, 3, 7, 12 and 13. SEQ ID
NO:7 is referred to as ActRIIa-hFc, and is described further in the
Examples. Other examples of soluble, activin-binding ActRIIa
polypeptides comprise a signal sequence in addition to the
extracellular domain of an ActRIIa protein, for example, the honey
bee mellitin leader sequence (SEQ ID NO: 8), the tissue plaminogen
activator (TPA) leader (SEQ ID NO: 9) or the native ActRIIa leader
(SEQ ID NO: 10). The ActRIIa-hFc polypeptide illustrated in SEQ ID
NO:13 uses a TPA leader.
[0073] Functionally active fragments of ActRIIa polypeptides can be
obtained by screening polypeptides recombinantly produced from the
corresponding fragment of the nucleic acid encoding an ActRIIa
polypeptide. In addition, fragments can be chemically synthesized
using techniques known in the art such as conventional Merrifield
solid phase f-Moc or t-Boc chemistry. The fragments can be produced
(recombinantly or by chemical synthesis) and tested to identify
those peptidyl fragments that can function as antagonists
(inhibitors) of ActRIIa protein or signaling mediated by
activin.
[0074] Functionally active variants of ActRIIa polypeptides can be
obtained by screening libraries of modified polypeptides
recombinantly produced from the corresponding mutagenized nucleic
acids encoding an ActRIIa polypeptide. The variants can be produced
and tested to identify those that can function as antagonists
(inhibitors) of ActRIIa protein or signaling mediated by activin.
In certain embodiments, a functional variant of the ActRIIa
polypeptides comprises an amino acid sequence that is at least 75%
identical to an amino acid sequence selected from SEQ ID NOs: 2 or
3. In certain cases, the functional variant has an amino acid
sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%
identical to an amino acid sequence selected from SEQ ID NOs: 2 or
3.
[0075] Functional variants may be generated by modifying the
structure of an ActRIIa polypeptide for such purposes as enhancing
therapeutic efficacy, or stability (e.g., ex vivo shelf life and
resistance to proteolytic degradation in vivo). Such modified
ActRIIa polypeptides when selected to retain activin binding, are
considered functional equivalents of the naturally-occurring
ActRIIa polypeptides. Modified ActRIIa polypeptides can also be
produced, for instance, by amino acid substitution, deletion, or
addition. For instance, it is reasonable to expect that an isolated
replacement of a leucine with an isoleucine or valine, an aspartate
with a glutamate, a threonine with a serine, or a similar
replacement of an amino acid with a structurally related amino acid
(e.g., conservative mutations) will not have a major effect on the
biological activity of the resulting molecule. Conservative
replacements are those that take place within a family of amino
acids that are related in their side chains. Whether a change in
the amino acid sequence of an ActRIIa polypeptide results in a
functional homolog can be readily determined by assessing the
ability of the variant ActRIIa polypeptide to produce a response in
cells in a fashion similar to the wild-type ActRIIa
polypeptide.
[0076] In certain embodiments, the present invention contemplates
specific mutations of the ActRIIa polypeptides so as to alter the
glycosylation of the polypeptide. Such mutations may be selected so
as to introduce or eliminate one or more glycosylation sites, such
as O-linked or N-linked glycosylation sites. Asparagine-linked
glycosylation recognition sites generally comprise a tripeptide
sequence, asparagine-X-threonine (or asparagines-X-serine) (where
"X" is any amino acid) which is specifically recognized by
appropriate cellular glycosylation enzymes. The alteration may also
be made by the addition of, or substitution by, one or more serine
or threonine residues to the sequence of the wild-type ActRIIa
polypeptide (for O-linked glycosylation sites). A variety of amino
acid substitutions or deletions at one or both of the first or
third amino acid positions of a glycosylation recognition site
(and/or amino acid deletion at the second position) results in
non-glycosylation at the modified tripeptide sequence. Another
means of increasing the number of carbohydrate moieties on an
ActRIIa polypeptide is by chemical or enzymatic coupling of
glycosides to the ActRIIa polypeptide. Depending on the coupling
mode used, the sugar(s) may be attached to (a) arginine and
histidine; (b) free carboxyl groups; (c) free sulfhydryl groups
such as those of cysteine; (d) free hydroxyl groups such as those
of serine, threonine, or hydroxyproline; (e) aromatic residues such
as those of phenylalanine, tyrosine, or tryptophan; or (f) the
amide group of glutamine. These methods are described in WO
87/05330 published Sep. 11, 1987, and in Aplin and Wriston (1981)
CRC Crit. Rev. Biochem., pp. 259-306, incorporated by reference
herein. Removal of one or more carbohydrate moieties present on an
ActRIIa polypeptide may be accomplished chemically and/or
enzymatically. Chemical deglycosylation may involve, for example,
exposure of the ActRIIa polypeptide to the compound
trifluoromethanesulfonic acid, or an equivalent compound. This
treatment results in the cleavage of most or all sugars except the
linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while
leaving the amino acid sequence intact. Chemical deglycosylation is
further described by Hakimuddin et al. (1987) Arch. Biochem.
Biophys. 259:52 and by Edge et al. (1981) Anal. Biochem. 118:131.
Enzymatic cleavage of carbohydrate moieties on ActRIIa polypeptides
can be achieved by the use of a variety of endo- and
exo-glycosidases as described by Thotakura et al. (1987) Meth.
Enzymol. 138:350. The sequence of an ActRIIa polypeptide may be
adjusted, as appropriate, depending on the type of expression
system used, as mammalian, yeast, insect and plant cells may all
introduce differing glycosylation patterns that can be affected by
the amino acid sequence of the peptide. In general, ActRIIa
proteins for use in humans will be expressed in a mammalian cell
line that provides proper glycosylation, such as HEK293 or CHO cell
lines, although other mammalian expression cell lines, yeast cell
lines with engineered glycosylation enzymes and insect cells are
expected to be useful as well.
[0077] This disclosure further contemplates a method of generating
mutants, particularly sets of combinatorial mutants of an ActRIIa
polypeptide, as well as truncation mutants; pools of combinatorial
mutants are especially useful for identifying functional variant
sequences. The purpose of screening such combinatorial libraries
may be to generate, for example, ActRIIa polypeptide variants which
can act as either agonists or antagonist, or alternatively, which
possess novel activities all together. A variety of screening
assays are provided below, and such assays may be used to evaluate
variants. For example, an ActRIIa polypeptide variant may be
screened for ability to bind to an ActRIIa ligand, to prevent
binding of an ActRIIa ligand to an ActRIIa polypeptide or to
interfere with signaling caused by an ActRIIa ligand.
[0078] The activity of an ActRIIa polypeptide or its variants may
also be tested in a cell-based or in vivo assay. For example, the
effect of an ActRIIa polypeptide variant on the expression of genes
involved in bone production or bone destruction may be assessed.
This may, as needed, be performed in the presence of one or more
recombinant ActRIIa ligand proteins (e.g., activin), and cells may
be transfected so as to produce an ActRIIa polypeptide and/or
variants thereof, and optionally, an ActRIIa ligand. Likewise, an
ActRIIa polypeptide may be administered to a mouse or other animal,
and one or more bone properties, such as density or volume may be
assessed. The healing rate for bone fractures may also be
evaluated. Dual-energy x-ray absorptiometry (DEXA) is a
well-established, non-invasive, quantitative technique for
assessing bone density in an animal. In humans central DEXA systems
may be used to evaluate bone density in the spine and pelvis. These
are the best predictors of overall bone density. Peripheral DEXA
systems may be used to evaluate bone density in peripheral bones,
including, for example, the bones of the hand, wrist, ankle and
foot. Traditional x-ray imaging systems, including CAT scans, may
be used to evaluate bone growth and fracture healing. The
mechanical strength of bone may also be evaluated.
[0079] Combinatorially-derived variants can be generated which have
a selective or generally increased potency relative to a naturally
occurring ActRIIa polypeptide. Likewise, mutagenesis can give rise
to variants which have intracellular half-lives dramatically
different than the corresponding a wild-type ActRIIa polypeptide.
For example, the altered protein can be rendered either more stable
or less stable to proteolytic degradation or other cellular
processes which result in destruction of, or otherwise inactivation
of a native ActRIIa polypeptide. Such variants, and the genes which
encode them, can be utilized to alter ActRIIa polypeptide levels by
modulating the half-life of the ActRIIa polypeptides. For instance,
a short half-life can give rise to more transient biological
effects and can allow tighter control of recombinant ActRIIa
polypeptide levels within the patient. In an Fc fusion protein,
mutations may be made in the linker (if any) and/or the Fc portion
to alter the half-life of the protein.
[0080] A combinatorial library may be produced by way of a
degenerate library of genes encoding a library of polypeptides
which each include at least a portion of potential ActRIIa
polypeptide sequences. For instance, a mixture of synthetic
oligonucleotides can be enzymatically ligated into gene sequences
such that the degenerate set of potential ActRIIa polypeptide
nucleotide sequences are expressible as individual polypeptides, or
alternatively, as a set of larger fusion proteins (e.g., for phage
display).
[0081] There are many ways by which the library of potential
homologs can be generated from a degenerate oligonucleotide
sequence. Chemical synthesis of a degenerate gene sequence can be
carried out in an automatic DNA synthesizer, and the synthetic
genes then be ligated into an appropriate vector for expression.
The synthesis of degenerate oligonucleotides is well known in the
art (see for example, Narang, S A (1983) Tetrahedron 39:3; Itakura
et al., (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos.
Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp 273-289;
Itakura et al., (1984) Annu. Rev. Biochem. 53:323; Itakura et al.,
(1984) Science 198:1056; Ike et al., (1983) Nucleic Acid Res.
11:477). Such techniques have been employed in the directed
evolution of other proteins (see, for example, Scott et al., (1990)
Science 249:386-390; Roberts et al., (1992) PNAS USA 89:2429-2433;
Devlin et al., (1990) Science 249: 404-406; Cwirla et al., (1990)
PNAS USA 87: 6378-6382; as well as U.S. Pat. Nos. 5,223,409,
5,198,346, and 5,096,815).
[0082] Alternatively, other forms of mutagenesis can be utilized to
generate a combinatorial library. For example, ActRIIa polypeptide
variants can be generated and isolated from a library by screening
using, for example, alanine scanning mutagenesis and the like (Ruf
et al., (1994) Biochemistry 33:1565-1572; Wang et al., (1994) J.
Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137:109-118;
Grodberg et al., (1993) Eur. J. Biochem. 218:597-601; Nagashima et
al., (1993) J. Biol. Chem. 268:2888-2892; Lowman et al., (1991)
Biochemistry 30:10832-10838; and Cunningham et al., (1989) Science
244:1081-1085), by linker scanning mutagenesis (Gustin et al.,
(1993) Virology 193:653-660; Brown et al., (1992) Mol. Cell Biol.
12:2644-2652; McKnight et al., (1982) Science 232:316); by
saturation mutagenesis (Meyers et al., (1986) Science 232:613); by
PCR mutagenesis (Leung et al., (1989) Method Cell Mol Biol
1:11-19); or by random mutagenesis, including chemical mutagenesis,
etc. (Miller et al., (1992) A Short Course in Bacterial Genetics,
CSHL Press, Cold Spring Harbor, N.Y.; and Greener et al., (1994)
Strategies in Mol Biol 7:32-34). Linker scanning mutagenesis,
particularly in a combinatorial setting, is an attractive method
for identifying truncated (bioactive) forms of ActRIIa
polypeptides.
[0083] A wide range of techniques are known in the art for
screening gene products of combinatorial libraries made by point
mutations and truncations, and, for that matter, for screening cDNA
libraries for gene products having a certain property. Such
techniques will be generally adaptable for rapid screening of the
gene libraries generated by the combinatorial mutagenesis of
ActRIIa polypeptides. The most widely used techniques for screening
large gene libraries typically comprises cloning the gene library
into replicable expression vectors, transforming appropriate cells
with the resulting library of vectors, and expressing the
combinatorial genes under conditions in which detection of a
desired activity facilitates relatively easy isolation of the
vector encoding the gene whose product was detected. Preferred
assays include activin binding assays and activin-mediated cell
signaling assays.
[0084] In certain embodiments, the ActRIIa polypeptides of the
invention may further comprise post-translational modifications in
addition to any that are naturally present in the ActRIIa
polypeptides. Such modifications include, but are not limited to,
acetylation, carboxylation, glycosylation, phosphorylation,
lipidation, and acylation. As a result, the modified ActRIIa
polypeptides may contain non-amino acid elements, such as
polyethylene glycols, lipids, poly- or mono-saccharide, and
phosphates. Effects of such non-amino acid elements on the
functionality of a ActRIIa polypeptide may be tested as described
herein for other ActRIIa polypeptide variants. When an ActRIIa
polypeptide is produced in cells by cleaving a nascent form of the
ActRIIa polypeptide, post-translational processing may also be
important for correct folding and/or function of the protein.
Different cells (such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or
HEK293) have specific cellular machinery and characteristic
mechanisms for such post-translational activities and may be chosen
to ensure the correct modification and processing of the ActRIIa
polypeptides.
In certain aspects, functional variants or modified forms of the
ActRIIa polypeptides include fusion proteins having at least a
portion of the ActRIIa polypeptides and one or more fusion domains.
Well known examples of such fusion domains include, but are not
limited to, polyhistidine, Glu-Glu, glutathione S transferase
(GST), thioredoxin, protein A, protein G, an immunoglobulin heavy
chain constant region (Fc), maltose binding protein (MBP), or human
serum albumin. A fusion domain may be selected so as to confer a
desired property. For example, some fusion domains are particularly
useful for isolation of the fusion proteins by affinity
chromatography. For the purpose of affinity purification, relevant
matrices for affinity chromatography, such as glutathione-,
amylase-, and nickel- or cobalt-conjugated resins are used. Many of
such matrices are available in "kit" form, such as the Pharmacia
GST purification system and the QIAexpress.TM. system (Qiagen)
useful with (HIS.sub.6) (SEQ ID NO: 18) fusion partners. As another
example, a fusion domain may be selected so as to facilitate
detection of the ActRIIa polypeptides. Examples of such detection
domains include the various fluorescent proteins (e.g., GFP) as
well as "epitope tags," which are usually short peptide sequences
for which a specific antibody is available. Well known epitope tags
for which specific monoclonal antibodies are readily available
include FLAG, influenza virus haemagglutinin (HA), and c-myc tags.
In some cases, the fusion domains have a protease cleavage site,
such as for Factor Xa or Thrombin, which allows the relevant
protease to partially digest the fusion proteins and thereby
liberate the recombinant proteins therefrom. The liberated proteins
can then be isolated from the fusion domain by subsequent
chromatographic separation. In certain preferred embodiments, an
ActRIIa polypeptide is fused with a domain that stabilizes the
ActRIIa polypeptide in vivo (a "stabilizer" domain). By
"stabilizing" is meant anything that increases serum half life,
regardless of whether this is because of decreased destruction,
decreased clearance by the kidney, or other pharmacokinetic effect.
Fusions with the Fc portion of an immunoglobulin are known to
confer desirable pharmacokinetic properties on a wide range of
proteins. Likewise, fusions to human serum albumin can confer
desirable properties. Other types of fusion domains that may be
selected include multimerizing (e.g., dimerizing, tetramerizing)
domains and functional domains (that confer an additional
biological function, such as further stimulation of bone growth or
muscle growth, as desired).
[0085] As a specific example, the present invention provides a
fusion protein comprising a soluble extracellular domain of ActRIIa
fused to an Fc domain (e.g., SEQ ID NO: 6).
TABLE-US-00006 THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD(A)VSHE
DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY
KCK(A)VSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGPFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHN(A)HYTQKSLSLSPGK*
[0086] Optionally, the Fc domain has one or more mutations at
residues such as Asp-265, lysine 322, and Asn-434. In certain
cases, the mutant Fc domain having one or more of these mutations
(e.g., Asp-265 mutation) has reduced ability of binding to the
Fc.gamma. receptor relative to a wildtype Fc domain. In other
cases, the mutant Fc domain having one or more of these mutations
(e.g., Asn-434 mutation) has increased ability of binding to the
MHC class I-related Fc-receptor (FcRN) relative to a wildtype Fc
domain.
[0087] It is understood that different elements of the fusion
proteins may be arranged in any manner that is consistent with the
desired functionality. For example, an ActRIIa polypeptide may be
placed C-terminal to a heterologous domain, or, alternatively, a
heterologous domain may be placed C-terminal to an ActRIIa
polypeptide. The ActRIIa polypeptide domain and the heterologous
domain need not be adjacent in a fusion protein, and additional
domains or amino acid sequences may be included C- or N-terminal to
either domain or between the domains.
[0088] In certain embodiments, the ActRIIa polypeptides of the
present invention contain one or more modifications that are
capable of stabilizing the ActRIIa polypeptides. For example, such
modifications enhance the in vitro half life of the ActRIIa
polypeptides, enhance circulatory half life of the ActRIIa
polypeptides or reduce proteolytic degradation of the ActRIIa
polypeptides. Such stabilizing modifications include, but are not
limited to, fusion proteins (including, for example, fusion
proteins comprising an ActRIIa polypeptide and a stabilizer
domain), modifications of a glycosylation site (including, for
example, addition of a glycosylation site to an ActRIIa
polypeptide), and modifications of carbohydrate moiety (including,
for example, removal of carbohydrate moieties from an ActRIIa
polypeptide). In the case of fusion proteins, an ActRIIa
polypeptide is fused to a stabilizer domain such as an IgG molecule
(e.g., an Fc domain). As used herein, the term "stabilizer domain"
not only refers to a fusion domain (e.g., Fc) as in the case of
fusion proteins, but also includes nonproteinaceous modifications
such as a carbohydrate moiety, or nonproteinaceous polymer, such as
polyethylene glycol.
[0089] In certain embodiments, the present invention makes
available isolated and/or purified forms of the ActRIIa
polypeptides, which are isolated from, or otherwise substantially
free of, other proteins. ActRIIa polypeptides will generally be
produced by expression from recombinant nucleic acids.
3. Nucleic Acids Encoding ActRIIa Polypeptides
[0090] In certain aspects, the invention provides isolated and/or
recombinant nucleic acids encoding any of the ActRIIa polypeptides
(e.g., soluble ActRIIa polypeptides), including fragments,
functional variants and fusion proteins disclosed herein. For
example, SEQ ID NO: 4 encodes the naturally occurring human ActRIIa
precursor polypeptide, while SEQ ID NO: 5 encodes the processed
extracellular domain of ActRIIa. The subject nucleic acids may be
single-stranded or double stranded. Such nucleic acids may be DNA
or RNA molecules. These nucleic acids may be used, for example, in
methods for making ActRIIa polypeptides or as direct therapeutic
agents (e.g., in a gene therapy approach).
[0091] In certain aspects, the subject nucleic acids encoding
ActRIIa polypeptides are further understood to include nucleic
acids that are variants of SEQ ID NO: 4 or 5. Variant nucleotide
sequences include sequences that differ by one or more nucleotide
substitutions, additions or deletions, such as allelic
variants.
[0092] In certain embodiments, the invention provides isolated or
recombinant nucleic acid sequences that are at least 80%, 85%, 90%,
95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 4 or 5. One of
ordinary skill in the art will appreciate that nucleic acid
sequences complementary to SEQ ID NO: 4 or 5, and variants of SEQ
ID NO: 4 or 5 are also within the scope of this invention. In
further embodiments, the nucleic acid sequences of the invention
can be isolated, recombinant, and/or fused with a heterologous
nucleotide sequence, or in a DNA library.
[0093] In other embodiments, nucleic acids of the invention also
include nucleotide sequences that hybridize under highly stringent
conditions to the nucleotide sequence designated in SEQ ID NO: 4 or
5, complement sequence of SEQ ID NO: 4 or 5, or fragments thereof.
As discussed above, one of ordinary skill in the art will
understand readily that appropriate stringency conditions which
promote DNA hybridization can be varied. One of ordinary skill in
the art will understand readily that appropriate stringency
conditions which promote DNA hybridization can be varied. For
example, one could perform the hybridization at 6.0.times. sodium
chloride/sodium citrate (SSC) at about 45.degree. C., followed by a
wash of 2.0.times.SSC at 50.degree. C. For example, the salt
concentration in the wash step can be selected from a low
stringency of about 2.0.times.SSC at 50.degree. C. to a high
stringency of about 0.2.times.SSC at 50.degree. C. In addition, the
temperature in the wash step can be increased from low stringency
conditions at room temperature, about 22.degree. C., to high
stringency conditions at about 65.degree. C. Both temperature and
salt may be varied, or temperature or salt concentration may be
held constant while the other variable is changed. In one
embodiment, the invention provides nucleic acids which hybridize
under low stringency conditions of 6.times.SSC at room temperature
followed by a wash at 2.times.SSC at room temperature.
[0094] Isolated nucleic acids which differ from the nucleic acids
as set forth in SEQ ID NOs: 4 or 5 due to degeneracy in the genetic
code are also within the scope of the invention. For example, a
number of amino acids are designated by more than one triplet.
Codons that specify the same amino acid, or synonyms (for example,
CAU and CAC are synonyms for histidine) may result in "silent"
mutations which do not affect the amino acid sequence of the
protein. However, it is expected that DNA sequence polymorphisms
that do lead to changes in the amino acid sequences of the subject
proteins will exist among mammalian cells. One skilled in the art
will appreciate that these variations in one or more nucleotides
(up to about 3-5% of the nucleotides) of the nucleic acids encoding
a particular protein may exist among individuals of a given species
due to natural allelic variation. Any and all such nucleotide
variations and resulting amino acid polymorphisms are within the
scope of this invention.
[0095] In certain embodiments, the recombinant nucleic acids of the
invention may be operably linked to one or more regulatory
nucleotide sequences in an expression construct. Regulatory
nucleotide sequences will generally be appropriate to the host cell
used for expression. Numerous types of appropriate expression
vectors and suitable regulatory sequences are known in the art for
a variety of host cells. Typically, said one or more regulatory
nucleotide sequences may include, but are not limited to, promoter
sequences, leader or signal sequences, ribosomal binding sites,
transcriptional start and termination sequences, translational
start and termination sequences, and enhancer or activator
sequences. Constitutive or inducible promoters as known in the art
are contemplated by the invention. The promoters may be either
naturally occurring promoters, or hybrid promoters that combine
elements of more than one promoter. An expression construct may be
present in a cell on an episome, such as a plasmid, or the
expression construct may be inserted in a chromosome. In a
preferred embodiment, the expression vector contains a selectable
marker gene to allow the selection of transformed host cells.
Selectable marker genes are well known in the art and will vary
with the host cell used.
[0096] In certain aspects of the invention, the subject nucleic
acid is provided in an expression vector comprising a nucleotide
sequence encoding an ActRIIa polypeptide and operably linked to at
least one regulatory sequence. Regulatory sequences are
art-recognized and are selected to direct expression of the ActRIIa
polypeptide. Accordingly, the term regulatory sequence includes
promoters, enhancers, and other expression control elements.
Exemplary regulatory sequences are described in Goeddel; Gene
Expression Technology: Methods in Enzymology, Academic Press, San
Diego, Calif. (1990). For instance, any of a wide variety of
expression control sequences that control the expression of a DNA
sequence when operatively linked to it may be used in these vectors
to express DNA sequences encoding an ActRIIa polypeptide. Such
useful expression control sequences, include, for example, the
early and late promoters of SV40, tet promoter, adenovirus or
cytomegalovirus immediate early promoter, RSV promoters, the lac
system, the trp system, the TAC or TRC system, T7 promoter whose
expression is directed by T7 RNA polymerase, the major operator and
promoter regions of phage lambda, the control regions for fd coat
protein, the promoter for 3-phosphoglycerate kinase or other
glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5,
the promoters of the yeast .alpha.-mating factors, the polyhedron
promoter of the baculovirus system and other sequences known to
control the expression of genes of prokaryotic or eukaryotic cells
or their viruses, and various combinations thereof. It should be
understood that the design of the expression vector may depend on
such factors as the choice of the host cell to be transformed
and/or the type of protein desired to be expressed. Moreover, the
vector's copy number, the ability to control that copy number and
the expression of any other protein encoded by the vector, such as
antibiotic markers, should also be considered.
[0097] A recombinant nucleic acid of the invention can be produced
by ligating the cloned gene, or a portion thereof, into a vector
suitable for expression in either prokaryotic cells, eukaryotic
cells (yeast, avian, insect or mammalian), or both. Expression
vehicles for production of a recombinant ActRIIa polypeptide
include plasmids and other vectors. For instance, suitable vectors
include plasmids of the types: pBR322-derived plasmids,
pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived
plasmids and pUC-derived plasmids for expression in prokaryotic
cells, such as E. coli.
[0098] Some mammalian expression vectors contain both prokaryotic
sequences to facilitate the propagation of the vector in bacteria,
and one or more eukaryotic transcription units that are expressed
in eukaryotic cells. The pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt,
pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg
derived vectors are examples of mammalian expression vectors
suitable for transfection of eukaryotic cells. Some of these
vectors are modified with sequences from bacterial plasmids, such
as pBR322, to facilitate replication and drug resistance selection
in both prokaryotic and eukaryotic cells. Alternatively,
derivatives of viruses such as the bovine papilloma virus (BPV-1),
or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used
for transient expression of proteins in eukaryotic cells. Examples
of other viral (including retroviral) expression systems can be
found below in the description of gene therapy delivery systems.
The various methods employed in the preparation of the plasmids and
in transformation of host organisms are well known in the art. For
other suitable expression systems for both prokaryotic and
eukaryotic cells, as well as general recombinant procedures, see
Molecular Cloning A Laboratory Manual, 3rd Ed., ed. by Sambrook,
Fritsch and Maniatis (Cold Spring Harbor Laboratory Press, 2001).
In some instances, it may be desirable to express the recombinant
polypeptides by the use of a baculovirus expression system.
Examples of such baculovirus expression systems include pVL-derived
vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived
vectors (such as pAcUW1), and pBlueBac-derived vectors (such as the
.beta.-gal containing pBlueBac III).
[0099] In a preferred embodiment, a vector will be designed for
production of the subject ActRIIa polypeptides in CHO cells, such
as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4
vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors
(Promega, Madison, Wis.). As will be apparent, the subject gene
constructs can be used to cause expression of the subject ActRIIa
polypeptides in cells propagated in culture, e.g., to produce
proteins, including fusion proteins or variant proteins, for
purification.
[0100] This disclosure also pertains to a host cell transfected
with a recombinant gene including a coding sequence (e.g., SEQ ID
NO: 4 or 5) for one or more of the subject ActRIIa polypeptides.
The host cell may be any prokaryotic or eukaryotic cell. For
example, an ActRIIa polypeptide of the invention may be expressed
in bacterial cells such as E. coli, insect cells (e.g., using a
baculovirus expression system), yeast, or mammalian cells. Other
suitable host cells are known to those skilled in the art.
[0101] Accordingly, the present invention further pertains to
methods of producing the subject ActRIIa polypeptides. For example,
a host cell transfected with an expression vector encoding an
ActRIIa polypeptide can be cultured under appropriate conditions to
allow expression of the ActRIIa polypeptide to occur. The ActRIIa
polypeptide may be secreted and isolated from a mixture of cells
and medium containing the ActRIIa polypeptide. Alternatively, the
ActRIIa polypeptide may be retained cytoplasmically or in a
membrane fraction and the cells harvested, lysed and the protein
isolated. A cell culture includes host cells, media and other
byproducts. Suitable media for cell culture are well known in the
art. The subject ActRIIa polypeptides can be isolated from cell
culture medium, host cells, or both, using techniques known in the
art for purifying proteins, including ion-exchange chromatography,
gel filtration chromatography, ultrafiltration, electrophoresis,
immunoaffinity purification with antibodies specific for particular
epitopes of the ActRIIa polypeptides and affinity purification with
an agent that binds to a domain fused to the ActRIIa polypeptide
(e.g., a protein A column may be used to purify an ActRIIa-Fc
fusion). In a preferred embodiment, the ActRIIa polypeptide is a
fusion protein containing a domain which facilitates its
purification. In a preferred embodiment, purification is achieved
by a series of column chromatography steps, including, for example,
three or more of the following, in any order: protein A
chromatography, Q sepharose chromatography, phenylsepharose
chromatography, size exclusion chromatography, and cation exchange
chromatography. The purification could be completed with viral
filtration and buffer exchange. As demonstrated herein, ActRIIa-hFc
protein was purified to a purity of >98% as determined by size
exclusion chromatography and >95% as determined by SDS PAGE.
This level of purity was sufficient to achieve desirable effects on
bone in mice and an acceptable safety profile in mice, rats and
non-human primates.
[0102] In another embodiment, a fusion gene coding for a
purification leader sequence, such as a poly-(His)/enterokinase
cleavage site sequence at the N-terminus of the desired portion of
the recombinant ActRIIa polypeptide, can allow purification of the
expressed fusion protein by affinity chromatography using a
Ni.sup.2+ metal resin. The purification leader sequence can then be
subsequently removed by treatment with enterokinase to provide the
purified ActRIIa polypeptide (e.g., see Hochuli et al., (1987) J.
Chromatography 411:177; and Janknecht et al., PNAS USA
88:8972).
[0103] Techniques for making fusion genes are well known.
Essentially, the joining of various DNA fragments coding for
different polypeptide sequences is performed in accordance with
conventional techniques, employing blunt-ended or stagger-ended
termini for ligation, restriction enzyme digestion to provide for
appropriate termini, filling-in of cohesive ends as appropriate,
alkaline phosphatase treatment to avoid undesirable joining, and
enzymatic ligation. In another embodiment, the fusion gene can be
synthesized by conventional techniques including automated DNA
synthesizers. Alternatively, PCR amplification of gene fragments
can be carried out using anchor primers which give rise to
complementary overhangs between two consecutive gene fragments
which can subsequently be annealed to generate a chimeric gene
sequence (see, for example, Current Protocols in Molecular Biology,
eds. Ausubel et al., John Wiley & Sons: 1992).
4. Alternative Activin and ActRIIa Antagonists
[0104] The data presented herein demonstrates that antagonists of
activin-ActRIIa signaling can be used to promote bone growth and
bone mineralization. Although soluble ActRIIa polypeptides, and
particularly ActrIIa-Fc, are preferred antagonists, and although
such antagonists may affect bone through a mechanism other than
activin antagonism (e.g., activin inhibition may be an indicator of
the tendency of an agent to inhibit the activities of a spectrum of
molecules, including, perhaps, other members of the TGF-beta
superfamily, and such collective inhibition may lead to the desired
effect on bone), other types of activin-ActRIIa antagonists are
expected to be useful, including anti-activin (e.g., A, B, C or E)
antibodies, anti-ActRIIa antibodies, antisense, RNAi or ribozyme
nucleic acids that inhibit the production of ActRIIa and other
inhibitors of activin or ActRIIa, particularly those that disrupt
activin-ActRIIa binding.
[0105] An antibody that is specifically reactive with an ActRIIa
polypeptide (e.g., a soluble ActRIIa polypeptide) and which either
binds competitively to ligand with the ActRIIa polypeptide or
otherwise inhibits ActRIIa-mediated signaling may be used as an
antagonist of ActRIIa polypeptide activities. Likewise, an antibody
that is specifically reactive with an activin A polypeptide and
which disrupts ActRIIa binding may be used as an antagonist.
[0106] By using immunogens derived from an ActRIIa polypeptide or
an activin polypeptide, anti-protein/anti-peptide antisera or
monoclonal antibodies can be made by standard protocols (see, for
example, Antibodies: A Laboratory Manual ed. by Harlow and Lane
(Cold Spring Harbor Press: 1988)). A mammal, such as a mouse, a
hamster or rabbit can be immunized with an immunogenic form of the
ActRIIa polypeptide, an antigenic fragment which is capable of
eliciting an antibody response, or a fusion protein. Techniques for
conferring immunogenicity on a protein or peptide include
conjugation to carriers or other techniques well known in the art.
An immunogenic portion of an ActRIIa or activin polypeptide can be
administered in the presence of adjuvant. The progress of
immunization can be monitored by detection of antibody titers in
plasma or serum. Standard ELISA or other immunoassays can be used
with the immunogen as antigen to assess the levels of
antibodies.
[0107] Following immunization of an animal with an antigenic
preparation of an ActRIIa polypeptide, antisera can be obtained
and, if desired, polyclonal antibodies can be isolated from the
serum. To produce monoclonal antibodies, antibody-producing cells
(lymphocytes) can be harvested from an immunized animal and fused
by standard somatic cell fusion procedures with immortalizing cells
such as myeloma cells to yield hybridoma cells. Such techniques are
well known in the art, and include, for example, the hybridoma
technique (originally developed by Kohler and Milstein, (1975)
Nature, 256: 495-497), the human B cell hybridoma technique (Kozbar
et al., (1983) Immunology Today, 4: 72), and the EBV-hybridoma
technique to produce human monoclonal antibodies (Cole et al.,
(1985) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc.
pp. 77-96). Hybridoma cells can be screened immunochemically for
production of antibodies specifically reactive with an ActRIIa
polypeptide and monoclonal antibodies isolated from a culture
comprising such hybridoma cells.
[0108] The term "antibody" as used herein is intended to include
fragments thereof which are also specifically reactive with a
subject polypeptide. Antibodies can be fragmented using
conventional techniques and the fragments screened for utility in
the same manner as described above for whole antibodies. For
example, F(ab).sub.2 fragments can be generated by treating
antibody with pepsin. The resulting F(ab).sub.2 fragment can be
treated to reduce disulfide bridges to produce Fab fragments. The
antibody of the present invention is further intended to include
bispecific, single-chain, chimeric, humanized and fully human
molecules having affinity for an ActRIIa or activin polypeptide
conferred by at least one CDR region of the antibody. An antibody
may further comprise a label attached thereto and able to be
detected (e.g., the label can be a radioisotope, fluorescent
compound, enzyme or enzyme co-factor).
[0109] In certain embodiments, the antibody is a recombinant
antibody, which term encompasses any antibody generated in part by
techniques of molecular biology, including CDR-grafted or chimeric
antibodies, human or other antibodies assembled from
library-selected antibody domains, single chain antibodies and
single domain antibodies (e.g., human V.sub.H proteins or camelid
V.sub.HH proteins). In certain embodiments, an antibody of the
invention is a monoclonal antibody, and in certain embodiments, the
invention makes available methods for generating novel antibodies.
For example, a method for generating a monoclonal antibody that
binds specifically to an ActRIIa polypeptide or activin polypeptide
may comprise administering to a mouse an amount of an immunogenic
composition comprising the antigen polypeptide effective to
stimulate a detectable immune response, obtaining
antibody-producing cells (e.g., cells from the spleen) from the
mouse and fusing the antibody-producing cells with myeloma cells to
obtain antibody-producing hybridomas, and testing the
antibody-producing hybridomas to identify a hybridoma that produces
a monocolonal antibody that binds specifically to the antigen. Once
obtained, a hybridoma can be propagated in a cell culture,
optionally in culture conditions where the hybridoma-derived cells
produce the monoclonal antibody that binds specifically to the
antigen. The monoclonal antibody may be purified from the cell
culture.
[0110] The adjective "specifically reactive with" as used in
reference to an antibody is intended to mean, as is generally
understood in the art, that the antibody is sufficiently selective
between the antigen of interest (e.g., an ActRIIa polypeptide) and
other antigens that are not of interest that the antibody is useful
for, at minimum, detecting the presence of the antigen of interest
in a particular type of biological sample. In certain methods
employing the antibody, such as therapeutic applications, a higher
degree of specificity in binding may be desirable. Monoclonal
antibodies generally have a greater tendency (as compared to
polyclonal antibodies) to discriminate effectively between the
desired antigens and cross-reacting polypeptides. One
characteristic that influences the specificity of an
antibody:antigen interaction is the affinity of the antibody for
the antigen. Although the desired specificity may be reached with a
range of different affinities, generally preferred antibodies will
have an affinity (a dissociation constant) of about 10.sup.-6,
10.sup.-7, 10.sup.-8, 10.sup.-9 or less. Given the extraordinarily
tight binding between activin and ActRIIa, it is expected that a
neutralizing anti-activin or anti-ActRIIa antibody would generally
have a dissociation constant of 10.sup.-10 or less.
[0111] In addition, the techniques used to screen antibodies in
order to identify a desirable antibody may influence the properties
of the antibody obtained. For example, if an antibody is to be used
for binding an antigen in solution, it may be desirable to test
solution binding. A variety of different techniques are available
for testing interaction between antibodies and antigens to identify
particularly desirable antibodies. Such techniques include ELISAs,
surface plasmon resonance binding assays (e.g., the Biacore.TM.
binding assay, Biacore AB, Uppsala, Sweden), sandwich assays (e.g.,
the paramagnetic bead system of IGEN International, Inc.,
Gaithersburg, Md.), western blots, immunoprecipitation assays, and
immunohistochemistry.
[0112] Examples of categories of nucleic acid compounds that are
activin or ActRIIa antagonists include antisense nucleic acids,
RNAi constructs and catalytic nucleic acid constructs. A nucleic
acid compound may be single or double stranded. A double stranded
compound may also include regions of overhang or
non-complementarity, where one or the other of the strands is
single stranded. A single stranded compound may include regions of
self-complementarity, meaning that the compound forms a so-called
"hairpin" or "stem-loop" structure, with a region of double helical
structure. A nucleic acid compound may comprise a nucleotide
sequence that is complementary to a region consisting of no more
than 1000, no more than 500, no more than 250, no more than 100 or
no more than 50, 35, 30, 25, 22, 20 or 18 nucleotides of the
full-length ActRIIa nucleic acid sequence or activin .beta.A or
activin .beta.B nucleic acid sequence. The region of
complementarity will preferably be at least 8 nucleotides, and
optionally at least 10 or at least 15 nucleotides, and optionally
between 15 and 25 nucleotides. A region of complementarity may fall
within an intron, a coding sequence or a noncoding sequence of the
target transcript, such as the coding sequence portion. Generally,
a nucleic acid compound will have a length of about 8 to about 500
nucleotides or base pairs in length, and optionally the length will
be about 14 to about 50 nucleotides. A nucleic acid may be a DNA
(particularly for use as an antisense), RNA or RNA:DNA hybrid. Any
one strand may include a mixture of DNA and RNA, as well as
modified forms that cannot readily be classified as either DNA or
RNA. Likewise, a double stranded compound may be DNA:DNA, DNA:RNA
or RNA:RNA, and any one strand may also include a mixture of DNA
and RNA, as well as modified forms that cannot readily be
classified as either DNA or RNA. A nucleic acid compound may
include any of a variety of modifications, including one or
modifications to the backbone (the sugar-phosphate portion in a
natural nucleic acid, including internucleotide linkages) or the
base portion (the purine or pyrimidine portion of a natural nucleic
acid). An antisense nucleic acid compound will preferably have a
length of about 15 to about 30 nucleotides and will often contain
one or more modifications to improve characteristics such as
stability in the serum, in a cell or in a place where the compound
is likely to be delivered, such as the stomach in the case of
orally delivered compounds and the lung for inhaled compounds. In
the case of an RNAi construct, the strand complementary to the
target transcript will generally be RNA or modifications thereof.
The other strand may be RNA, DNA or any other variation. The duplex
portion of double stranded or single stranded "hairpin" RNAi
construct will preferably have a length of 18 to 40 nucleotides in
length and optionally about 21 to 23 nucleotides in length, so long
as it serves as a Dicer substrate. Catalytic or enzymatic nucleic
acids may be ribozymes or DNA enzymes and may also contain modified
forms. Nucleic acid compounds may inhibit expression of the target
by about 50%, 75%, 90% or more when contacted with cells under
physiological conditions and at a concentration where a nonsense or
sense control has little or no effect. Preferred concentrations for
testing the effect of nucleic acid compounds are 1, 5 and 10
micromolar. Nucleic acid compounds may also be tested for effects
on, for example, bone growth and mineralization.
5. Screening Assays
[0113] In certain aspects, the present invention relates to the use
of ActRIIa polypeptides (e.g., soluble ActRIIa polypeptides) and
activin polypeptides to identify compounds (agents) which are
agonist or antagonists of the activin-ActRIIa signaling pathway.
Compounds identified through this screening can be tested to assess
their ability to modulate bone growth or mineralization in vitro.
Optionally, these compounds can further be tested in animal models
to assess their ability to modulate tissue growth in vivo.
[0114] There are numerous approaches to screening for therapeutic
agents for modulating tissue growth by targeting activin and
ActRIIa polypeptides. In certain embodiments, high-throughput
screening of compounds can be carried out to identify agents that
perturb activin or ActRIIa-mediated effects on bone. In certain
embodiments, the assay is carried out to screen and identify
compounds that specifically inhibit or reduce binding of an ActRIIa
polypeptide to activin. Alternatively, the assay can be used to
identify compounds that enhance binding of an ActRIIa polypeptide
to activin. In a further embodiment, the compounds can be
identified by their ability to interact with an activin or ActRIIa
polypeptide.
[0115] A variety of assay formats will suffice and, in light of the
present disclosure, those not expressly described herein will
nevertheless be comprehended by one of ordinary skill in the art.
As described herein, the test compounds (agents) of the invention
may be created by any combinatorial chemical method. Alternatively,
the subject compounds may be naturally occurring biomolecules
synthesized in vivo or in vitro. Compounds (agents) to be tested
for their ability to act as modulators of tissue growth can be
produced, for example, by bacteria, yeast, plants or other
organisms (e.g., natural products), produced chemically (e.g.,
small molecules, including peptidomimetics), or produced
recombinantly. Test compounds contemplated by the present invention
include non-peptidyl organic molecules, peptides, polypeptides,
peptidomimetics, sugars, hormones, and nucleic acid molecules. In a
specific embodiment, the test agent is a small organic molecule
having a molecular weight of less than about 2,000 daltons.
[0116] The test compounds of the invention can be provided as
single, discrete entities, or provided in libraries of greater
complexity, such as made by combinatorial chemistry. These
libraries can comprise, for example, alcohols, alkyl halides,
amines, amides, esters, aldehydes, ethers and other classes of
organic compounds. Presentation of test compounds to the test
system can be in either an isolated form or as mixtures of
compounds, especially in initial screening steps. Optionally, the
compounds may be optionally derivatized with other compounds and
have derivatizing groups that facilitate isolation of the
compounds. Non-limiting examples of derivatizing groups include
biotin, fluorescein, digoxygenin, green fluorescent protein,
isotopes, polyhistidine, magnetic beads, glutathione S transferase
(GST), photoactivatible crosslinkers or any combinations
thereof.
[0117] In many drug screening programs which test libraries of
compounds and natural extracts, high throughput assays are
desirable in order to maximize the number of compounds surveyed in
a given period of time. Assays which are performed in cell-free
systems, such as may be derived with purified or semi-purified
proteins, are often preferred as "primary" screens in that they can
be generated to permit rapid development and relatively easy
detection of an alteration in a molecular target which is mediated
by a test compound. Moreover, the effects of cellular toxicity or
bioavailability of the test compound can be generally ignored in
the in vitro system, the assay instead being focused primarily on
the effect of the drug on the molecular target as may be manifest
in an alteration of binding affinity between an ActRIIa polypeptide
and activin.
[0118] Merely to illustrate, in an exemplary screening assay of the
present invention, the compound of interest is contacted with an
isolated and purified ActRIIa polypeptide which is ordinarily
capable of binding to activin. To the mixture of the compound and
ActRIIa polypeptide is then added a composition containing an
ActRIIa ligand. Detection and quantification of ActRIIa/activin
complexes provides a means for determining the compound's efficacy
at inhibiting (or potentiating) complex formation between the
ActRIIa polypeptide and activin. The efficacy of the compound can
be assessed by generating dose response curves from data obtained
using various concentrations of the test compound. Moreover, a
control assay can also be performed to provide a baseline for
comparison. For example, in a control assay, isolated and purified
activin is added to a composition containing the ActRIIa
polypeptide, and the formation of ActRIIa/activin complex is
quantitated in the absence of the test compound. It will be
understood that, in general, the order in which the reactants may
be admixed can be varied, and can be admixed simultaneously.
Moreover, in place of purified proteins, cellular extracts and
lysates may be used to render a suitable cell-free assay
system.
[0119] Complex formation between the ActRIIa polypeptide and
activin may be detected by a variety of techniques. For instance,
modulation of the formation of complexes can be quantitated using,
for example, detectably labeled proteins such as radiolabeled
(e.g., .sup.32P, .sup.35S, .sup.14C or .sup.3H), fluorescently
labeled (e.g., FITC), or enzymatically labeled ActRIIa polypeptide
or activin, by immunoassay, or by chromatographic detection.
[0120] In certain embodiments, the present invention contemplates
the use of fluorescence polarization assays and fluorescence
resonance energy transfer (FRET) assays in measuring, either
directly or indirectly, the degree of interaction between an
ActRIIa polypeptide and its binding protein. Further, other modes
of detection, such as those based on optical waveguides (PCT
Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface
plasmon resonance (SPR), surface charge sensors, and surface force
sensors, are compatible with many embodiments of the invention.
[0121] Moreover, the present invention contemplates the use of an
interaction trap assay, also known as the "two hybrid assay," for
identifying agents that disrupt or potentiate interaction between
an ActRIIa polypeptide and its binding protein. See for example,
U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232;
Madura et al. (1993) J Biol Chem 268:12046-12054; Bartel et al.
(1993) Biotechniques 14:920-924; and Iwabuchi et al. (1993)
Oncogene 8:1693-1696). In a specific embodiment, the present
invention contemplates the use of reverse two hybrid systems to
identify compounds (e.g., small molecules or peptides) that
dissociate interactions between an ActRIIa polypeptide and its
binding protein. See for example, Vidal and Legrain, (1999) Nucleic
Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol
17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and
5,965,368.
[0122] In certain embodiments, the subject compounds are identified
by their ability to interact with an ActRIIa or activin polypeptide
of the invention. The interaction between the compound and the
ActRIIa or activin polypeptide may be covalent or non-covalent. For
example, such interaction can be identified at the protein level
using in vitro biochemical methods, including photo-crosslinking,
radiolabeled ligand binding, and affinity chromatography (Jakoby W
B et al., 1974, Methods in Enzymology 46: 1). In certain cases, the
compounds may be screened in a mechanism based assay, such as an
assay to detect compounds which bind to an activin or ActRIIa
polypeptide. This may include a solid phase or fluid phase binding
event. Alternatively, the gene encoding an activin or ActRIIa
polypeptide can be transfected with a reporter system (e.g.,
.beta.-galactosidase, luciferase, or green fluorescent protein)
into a cell and screened against the library preferably by a high
throughput screening or with individual members of the library.
Other mechanism based binding assays may be used, for example,
binding assays which detect changes in free energy. Binding assays
can be performed with the target fixed to a well, bead or chip or
captured by an immobilized antibody or resolved by capillary
electrophoresis. The bound compounds may be detected usually using
colorimetric or fluorescence or surface plasmon resonance.
[0123] In certain aspects, the present invention provides methods
and agents for modulating (stimulating or inhibiting) bone
formation and increasing bone mass. Therefore, any compound
identified can be tested in whole cells or tissues, in vitro or in
vivo, to confirm their ability to modulate bone growth or
mineralization. Various methods known in the art can be utilized
for this purpose.
[0124] For example, the effect of the ActRIIa or activin
polypeptides or test compounds on bone or cartilage growth can be
determined by measuring induction of Msx2 or differentiation of
osteoprogenitor cells into osteoblasts in cell based assays (see,
e.g., Daluiski et al., Nat Genet. 2001, 27(1):84-8; Hino et al.,
Front Biosci. 2004, 9:1520-9). Another example of cell-based assays
includes analyzing the osteogenic activity of the subject ActRIIa
or activin polypeptides and test compounds in mesenchymal
progenitor and osteoblastic cells. To illustrate, recombinant
adenoviruses expressing an activin or ActRIIa polypeptide can be
constructed to infect pluripotent mesenchymal progenitor C3H10T1/2
cells, preosteoblastic C2C12 cells, and osteoblastic TE-85 cells.
Osteogenic activity is then determined by measuring the induction
of alkaline phosphatase, osteocalcin, and matrix mineralization
(see, e.g., Cheng et al., J bone Joint Surg Am. 2003,
85-A(8):1544-52).
[0125] The present invention also contemplates in vivo assays to
measure bone or cartilage growth. For example, Namkung-Matthai et
al., Bone, 28:80-86 (2001) discloses a rat osteoporotic model in
which bone repair during the early period after fracture is
studied. Kubo et al., Steroid Biochemistry & Molecular Biology,
68:197-202 (1999) also discloses a rat osteoporotic model in which
bone repair during the late period after fracture is studied.
Andersson et al., J. Endocrinol. 170:529-537 describe a mouse
osteoporosis model in which mice are ovariectomized, which causes
the mice to lose substantial bone mineral content and bone mineral
density, with the trabecular bone losing roughly 50% of bone
mineral density. Bone density could be increased in the
ovariectomized mice by administration of factors such as
parathyroid hormone. In certain aspects, the present invention
makes use of fracture healing assays that are known in the art.
These assays include fracture technique, histological analysis, and
biomechanical analysis, which are described in, for example, U.S.
Pat. No. 6,521,750, which is incorporated by reference in its
entirety for its disclosure of experimental protocols for causing
as well as measuring the extent of fractures, and the repair
process.
6. Exemplary Therapeutic Uses
[0126] In certain embodiments, activin-ActRIIa antagonists (e.g.,
ActRIIa polypeptides) of the present invention can be used for
treating or preventing a disease or condition that is associated
with bone damage, whether, e.g., through breakage, loss or
demineralization. As demonstrated herein, activin-ActRIIa
antagonists, and particularly ActRIIa-Fc constructs, are effective
in treating or preventing cancer-related bone loss. In certain
embodiments, the present invention provides methods of treating or
preventing bone damage in an individual in need thereof through
administering to the individual a therapeutically effective amount
of an activin-ActRIIa antagonist, particularly an ActRIIa
polypeptide. In certain embodiments, the present invention provides
methods of promoting bone growth or mineralization in an individual
in need thereof through administering to the individual a
therapeutically effective amount of an activin-ActRIIa antagonist,
particularly an ActRIIa polypeptide. These methods are preferably
aimed at therapeutic and prophylactic treatments of animals, and
more preferably, humans. In certain embodiments, the disclosure
provides for the use of activin-ActRIIa antagonists (particularly
soluble ActRIIa polypeptides and neutralizing antibodies targeted
to activin or ActRIIa) for the treatment of disorders associated
with low bone density or decreased bone strength.
[0127] As used herein, a therapeutic that "prevents" a disorder or
condition refers to a compound that, in a statistical sample,
reduces the occurrence of the disorder or condition in the treated
sample relative to an untreated control sample, or delays the onset
or reduces the severity of one or more symptoms of the disorder or
condition relative to the untreated control sample. The term
"treating" as used herein includes prophylaxis of the named
condition or amelioration or elimination of the condition once it
has been established. In either case, prevention or treatment may
be discerned in the diagnosis provided by a physician and the
intended result of administration of the therapeutic agent.
[0128] The disclosure provides methods of inducing bone and/or
cartilage formation, preventing bone loss, increasing bone
mineralization or preventing the demineralization of bone. For
example, the subject activin-ActRIIa antagonists have application
in treating osteoporosis and the healing of bone fractures and
cartilage defects in humans and other animals. ActRIIa or activin
polypeptides may be useful in patients that are diagnosed with
subclinical low bone density, as a protective measure against the
development of osteoporosis.
[0129] In one specific embodiment, methods and compositions of the
present invention may find medical utility in the healing of bone
fractures and cartilage defects in humans and other animals. The
subject methods and compositions may also have prophylactic use in
closed as well as open fracture reduction and also in the improved
fixation of artificial joints. De novo bone formation induced by an
osteogenic agent contributes to the repair of congenital,
trauma-induced, or oncologic resection induced craniofacial
defects, and also is useful in cosmetic plastic surgery. In certain
cases, the subject activin-ActRIIa antagonists may provide an
environment to attract bone-forming cells, stimulate growth of
bone-forming cells or induce differentiation of progenitors of
bone-forming cells. Activin-ActRIIa antagonists of the invention
may also be useful in the treatment of osteoporosis.
[0130] Methods and compositions of the invention can be applied to
conditions characterized by or causing bone loss, such as
osteoporosis (including secondary osteoporosis),
hyperparathyroidism, Cushing's disease, Paget's disease,
thyrotoxicosis, chronic diarrheal state or malabsorption, renal
tubular acidosis, or anorexia nervosa.
[0131] Osteoporosis may be caused by, or associated with, various
factors. Being female, particularly a post-menopausal female,
having a low body weight, and leading a sedentary lifestyle are all
risk factors for osteoporosis (loss of bone mineral density,
leading to fracture risk). Persons having any of the following
profiles may be candidates for treatment with an ActRIIa
antagonist: a post-menopausal woman and not taking estrogen or
other hormone replacement therapy; a person with a personal or
maternal history of hip fracture or smoking; a post-menopausal
woman who is tall (over 5 feet 7 inches) or thin (less than 125
pounds); a man with clinical conditions associated with bone loss;
a person using medications that are known to cause bone loss,
including corticosteroids such as Prednisone.TM., various
anti-seizure medications such as Dilantin.TM. and certain
barbiturates, or high-dose thyroid replacement drugs; a person
having type 1 diabetes, liver disease, kidney disease or a family
history of osteoporosis; a person having high bone turnover (e.g.,
excessive collagen in urine samples); a person with a thyroid
condition, such as hyperthyroidism; a person who has experienced a
fracture after only mild trauma; a person who has had x-ray
evidence of vertebral fracture or other signs of osteoporosis.
[0132] As noted above, osteoporosis can also result as a condition
associated with another disorder or from the use of certain
medications. Osteoporosis resulting from drugs or another medical
condition is known as secondary osteoporosis. In a condition known
as Cushing's disease, the excess amount of cortisol produced by the
body results in osteoporosis and fractures. The most common
medications associated with secondary osteoporosis are the
corticosteroids, a class of drugs that act like cortisol, a hormone
produced naturally by the adrenal glands. Although adequate levels
of thyroid hormones (which are produced by the thyroid gland) are
needed for the development of the skeleton, excess thyroid hormone
can decrease bone mass over time. Antacids that contain aluminum
can lead to bone loss when taken in high doses by people with
kidney problems, particularly those undergoing dialysis. Other
medications that can cause secondary osteoporosis include phenytoin
(Dilantin) and barbiturates that are used to prevent seizures;
methotrexate (Rheumatrex, Immunex, Folex PFS), a drug for some
forms of arthritis, cancer, and immune disorders; cyclosporine
(Sandimmune, Neoral), a drug used to treat some autoimmune diseases
and to suppress the immune system in organ transplant patients;
luteinizing hormone-releasing hormone agonists (Lupron, Zoladex),
used to treat prostate cancer and endometriosis; heparin
(Calciparine, Liquaemin), an anticlotting medication; and
cholestyramine (Questran) and colestipol (Colestid), used to treat
high cholesterol. Bone loss resulting from cancer therapy is widely
recognized and termed cancer therapy induced bone loss (CTIBL).
Bone metastases can create cavities in the bone that may be
corrected by treatment with activin-ActRIIa antagonists.
[0133] In a preferred embodiment, activin-ActRIIa antagonists,
particularly a soluble ActRIIa, disclosed herein may be used in
cancer patients. Patients having certain tumors (e.g. prostate,
breast, multiple myeloma or any tumor causing hyperparathyroidism)
are at high risk for bone loss due to tumor-induced bone loss as
well as bone metastases and therapeutic agents. Such patients may
be treated with activin-ActRIIa antagonists even in the absence of
evidence of bone loss or bone metastases. Patients may also be
monitored for evidence of bone loss or bone metastases, and may be
treated with activin-ActRIIa antagonists in the event that
indicators suggest an increased risk. Generally, DEXA scans are
employed to assess changes in bone density, while indicators of
bone remodeling may be used to assess the likelihood of bone
metastases. Serum markers may be monitored. Bone specific alkaline
phosphatase (B SAP) is an enzyme that is present in osteoblasts.
Blood levels of BSAP are increased in patients with bone metastasis
and other conditions that result in increased bone remodeling.
Osteocalcin and procollagen peptides are also associated with bone
formation and bone metastases. Increases in BSAP have been detected
in patients with bone metastasis caused by prostate cancer, and to
a lesser degree, in bone metastases from breast cancer. Bone
Morphogenetic Protein-7 (BMP-7) levels are high in prostate cancer
that has metastasized to bone, but not in bone metastases due to
bladder, skin, liver, or lung cancer. Type I Carboxy-terminal
telopeptide (ICTP) is a crosslink found in collagen that is formed
during to the resorption of bone. Since bone is constantly being
broken down and reformed, ICTP will be found throughout the body.
However, at the site of bone metastasis, the level will be
significantly higher than in an area of normal bone. ICTP has been
found in high levels in bone metastasis due to prostate, lung, and
breast cancer. Another collagen crosslink, Type I N-terminal
telopeptide (NTx), is produced along with ICTP during bone
turnover. The amount of NTx is increased in bone metastasis caused
by many different types of cancer including lung, prostate, and
breast cancer. Also, the levels of NTx increase with the
progression of the bone metastasis. Therefore, this marker can be
used to both detect metastasis as well as measure the extent of the
disease. Other markers of resorption include pyridinoline and
deoxypyridinoline. Any increase in resorption markers or markers of
bone metastases indicate the need for activin-ActRIIa antagonist
therapy in a patient.
[0134] Activin-ActRIIa antagonists may be conjointly administered
with other pharmaceutical agents. Conjoint administration may be
accomplished by administration of a single co-formulation, by
simultaneous administration or by administration at separate times.
Activin-ActRIIa antagonists may be particularly advantageous if
administered with other bone-active agents. A patient may benefit
from conjointly receiving activin-ActRIIa antagonist and taking
calcium supplements, vitamin D, appropriate exercise and/or, in
some cases, other medication. Examples of other medications
include, bisphosphonates (alendronate, ibandronate and
risedronate), calcitonin, estrogens, parathyroid hormone and
raloxifene. The bisphosphonates (alendronate, ibandronate and
risedronate), calcitonin, estrogens and raloxifene affect the bone
remodeling cycle and are classified as anti-resorptive medications.
Bone remodeling consists of two distinct stages: bone resorption
and bone formation. Anti-resorptive medications slow or stop the
bone-resorbing portion of the bone-remodeling cycle but do not slow
the bone-forming portion of the cycle. As a result, new formation
continues at a greater rate than bone resorption, and bone density
may increase over time. Teriparatide, a form of parathyroid
hormone, increases the rate of bone formation in the bone
remodeling cycle. Alendronate is approved for both the prevention
(5 mg per day or 35 mg once a week) and treatment (10 mg per day or
70 mg once a week) of postmenopausal osteoporosis. Alendronate
reduces bone loss, increases bone density and reduces the risk of
spine, wrist and hip fractures. Alendronate also is approved for
treatment of glucocorticoid-induced osteoporosis in men and women
as a result of long-term use of these medications (i.e., prednisone
and cortisone) and for the treatment of osteoporosis in men.
Alendronate plus vitamin D is approved for the treatment of
osteoporosis in postmenopausal women (70 mg once a week plus
vitamin D), and for treatment to improve bone mass in men with
osteoporosis. Ibandronate is approved for the prevention and
treatment of postmenopausal osteoporosis. Taken as a once-a-month
pill (150 mg), ibandronate should be taken on the same day each
month. Ibandronate reduces bone loss, increases bone density and
reduces the risk of spine fractures. Risedronate is approved for
the prevention and treatment of postmenopausal osteoporosis. Taken
daily (5 mg dose) or weekly (35 mg dose or 35 mg dose with
calcium), risedronate slows bone loss, increases bone density and
reduces the risk of spine and non-spine fractures. Risedronate also
is approved for use by men and women to prevent and/or treat
glucocorticoid-induced osteoporosis that results from long-term use
of these medications (i.e., prednisone or cortisone). Calcitonin is
a naturally occurring hormone involved in calcium regulation and
bone metabolism. In women who are more than 5 years beyond
menopause, calcitonin slows bone loss, increases spinal bone
density, and may relieve the pain associated with bone fractures.
Calcitonin reduces the risk of spinal fractures. Calcitonin is
available as an injection (50-100 IU daily) or nasal spray (200 IU
daily). Estrogen therapy (ET)/Hormone therapy (HT) is approved for
the prevention of osteoporosis. ET has been shown to reduce bone
loss, increase bone density in both the spine and hip, and reduce
the risk of hip and spinal fractures in postmenopausal women. ET is
administered most commonly in the form of a pill or skin patch that
delivers a low dose of approximately 0.3 mg daily or a standard
dose of approximately 0.625 mg daily and is effective even when
started after age 70. When estrogen is taken alone, it can increase
a woman's risk of developing cancer of the uterine lining
(endometrial cancer). To eliminate this risk, healthcare providers
prescribe the hormone progestin in combination with estrogen
(hormone replacement therapy or HT) for those women who have an
intact uterus. ET/HT relieves menopause symptoms and has been shown
to have a beneficial effect on bone health. Side effects may
include vaginal bleeding, breast tenderness, mood disturbances and
gallbladder disease. Raloxifene, 60 mg a day, is approved for the
prevention and treatment of postmenopausal osteoporosis. It is from
a class of drugs called Selective Estrogen Receptor Modulators
(SERMs) that have been developed to provide the beneficial effects
of estrogens without their potential disadvantages. Raloxifene
increases bone mass and reduces the risk of spine fractures. Data
are not yet available to demonstrate that raloxifene can reduce the
risk of hip and other non-spine fractures. Teriparatide, a form of
parathyroid hormone, is approved for the treatment of osteoporosis
in postmenopausal women and men who are at high risk for a
fracture. This medication stimulates new bone formation and
significantly increases bone mineral density. In postmenopausal
women, fracture reduction was noted in the spine, hip, foot, ribs
and wrist. In men, fracture reduction was noted in the spine, but
there were insufficient data to evaluate fracture reduction at
other sites. Teriparatide is self-administered as a daily injection
for up to 24 months.
7. Pharmaceutical Compositions
[0135] In certain embodiments, activin-ActRIIa antagonists (e.g.,
ActRIIa polypeptides) of the present invention are formulated with
a pharmaceutically acceptable carrier. For example, an ActRIIa
polypeptide can be administered alone or as a component of a
pharmaceutical formulation (therapeutic composition). The subject
compounds may be formulated for administration in any convenient
way for use in human or veterinary medicine.
[0136] In certain embodiments, the therapeutic method of the
invention includes administering the composition systemically, or
locally as an implant or device. When administered, the therapeutic
composition for use in this invention is in a pyrogen-free,
physiologically acceptable form. Therapeutically useful agents
other than the ActRIIa antagonists which may also optionally be
included in the composition as described above, may be administered
simultaneously or sequentially with the subject compounds (e.g.,
ActRIIa polypeptides) in the methods of the invention.
[0137] Typically, ActRIIa antagonists will be administered
parentally, and particularly intravenously or subcutaneously.
Pharmaceutical compositions suitable for parenteral administration
may comprise one or more ActRIIa polypeptides in combination with
one or more pharmaceutically acceptable sterile isotonic aqueous or
nonaqueous solutions, dispersions, suspensions or emulsions, or
sterile powders which may be reconstituted into sterile injectable
solutions or dispersions just prior to use, which may contain
antioxidants, buffers, bacteriostats, solutes which render the
formulation isotonic with the blood of the intended recipient or
suspending or thickening agents. Examples of suitable aqueous and
nonaqueous carriers which may be employed in the pharmaceutical
compositions of the invention include water, ethanol, polyols (such
as glycerol, propylene glycol, polyethylene glycol, and the like),
and suitable mixtures thereof, vegetable oils, such as olive oil,
and injectable organic esters, such as ethyl oleate. Proper
fluidity can be maintained, for example, by the use of coating
materials, such as lecithin, by the maintenance of the required
particle size in the case of dispersions, and by the use of
surfactants.
[0138] Further, the composition may be encapsulated or injected in
a form for delivery to a target tissue site (e.g., bone). In
certain embodiments, compositions of the present invention may
include a matrix capable of delivering one or more therapeutic
compounds (e.g., ActRIIa polypeptides) to a target tissue site
(e.g., bone), providing a structure for the developing tissue and
optimally capable of being resorbed into the body. For example, the
matrix may provide slow release of the ActRIIa polypeptides. Such
matrices may be formed of materials presently in use for other
implanted medical applications.
[0139] The choice of matrix material is based on biocompatibility,
biodegradability, mechanical properties, cosmetic appearance and
interface properties. The particular application of the subject
compositions will define the appropriate formulation. Potential
matrices for the compositions may be biodegradable and chemically
defined calcium sulfate, tricalciumphosphate, hydroxyapatite,
polylactic acid and polyanhydrides. Other potential materials are
biodegradable and biologically well defined, such as bone or dermal
collagen. Further matrices are comprised of pure proteins or
extracellular matrix components. Other potential matrices are
non-biodegradable and chemically defined, such as sintered
hydroxyapatite, bioglass, aluminates, or other ceramics. Matrices
may be comprised of combinations of any of the above mentioned
types of material, such as polylactic acid and hydroxyapatite or
collagen and tricalciumphosphate. The bioceramics may be altered in
composition, such as in calcium-aluminate-phosphate and processing
to alter pore size, particle size, particle shape, and
biodegradability.
[0140] In certain embodiments, methods of the invention can be
administered for orally, e.g., in the form of capsules, cachets,
pills, tablets, lozenges (using a flavored basis, usually sucrose
and acacia or tragacanth), powders, granules, or as a solution or a
suspension in an aqueous or nonaqueous liquid, or as an
oil-in-water or water-in-oil liquid emulsion, or as an elixir or
syrup, or as pastilles (using an inert base, such as gelatin and
glycerin, or sucrose and acacia) and/or as mouth washes and the
like, each containing a predetermined amount of an agent as an
active ingredient. An agent may also be administered as a bolus,
electuary or paste.
[0141] In solid dosage forms for oral administration (capsules,
tablets, pills, dragees, powders, granules, and the like), one or
more therapeutic compounds of the present invention may be mixed
with one or more pharmaceutically acceptable carriers, such as
sodium citrate or dicalcium phosphate, and/or any of the following:
(1) fillers or extenders, such as starches, lactose, sucrose,
glucose, mannitol, and/or silicic acid; (2) binders, such as, for
example, carboxymethylcellulose, alginates, gelatin, polyvinyl
pyrrolidone, sucrose, and/or acacia; (3) humectants, such as
glycerol; (4) disintegrating agents, such as agar-agar, calcium
carbonate, potato or tapioca starch, alginic acid, certain
silicates, and sodium carbonate; (5) solution retarding agents,
such as paraffin; (6) absorption accelerators, such as quaternary
ammonium compounds; (7) wetting agents, such as, for example, cetyl
alcohol and glycerol monostearate; (8) absorbents, such as kaolin
and bentonite clay; (9) lubricants, such a talc, calcium stearate,
magnesium stearate, solid polyethylene glycols, sodium lauryl
sulfate, and mixtures thereof; and (10) coloring agents. In the
case of capsules, tablets and pills, the pharmaceutical
compositions may also comprise buffering agents. Solid compositions
of a similar type may also be employed as fillers in soft and
hard-filled gelatin capsules using such excipients as lactose or
milk sugars, as well as high molecular weight polyethylene glycols
and the like.
[0142] Liquid dosage forms for oral administration include
pharmaceutically acceptable emulsions, microemulsions, solutions,
suspensions, syrups, and elixirs. In addition to the active
ingredient, the liquid dosage forms may contain inert diluents
commonly used in the art, such as water or other solvents,
solubilizing agents and emulsifiers, such as ethyl alcohol,
isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol,
benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in
particular, cottonseed, groundnut, corn, germ, olive, castor, and
sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene
glycols and fatty acid esters of sorbitan, and mixtures thereof.
Besides inert diluents, the oral compositions can also include
adjuvants such as wetting agents, emulsifying and suspending
agents, sweetening, flavoring, coloring, perfuming, and
preservative agents.
[0143] Suspensions, in addition to the active compounds, may
contain suspending agents such as ethoxylated isostearyl alcohols,
polyoxyethylene sorbitol, and sorbitan esters, microcrystalline
cellulose, aluminum metahydroxide, bentonite, agar-agar and
tragacanth, and mixtures thereof.
[0144] The compositions of the invention may also contain
adjuvants, such as preservatives, wetting agents, emulsifying
agents and dispersing agents. Prevention of the action of
microorganisms may be ensured by the inclusion of various
antibacterial and antifungal agents, for example, paraben,
chlorobutanol, phenol sorbic acid, and the like. It may also be
desirable to include isotonic agents, such as sugars, sodium
chloride, and the like into the compositions. In addition,
prolonged absorption of the injectable pharmaceutical form may be
brought about by the inclusion of agents which delay absorption,
such as aluminum monostearate and gelatin.
[0145] It is understood that the dosage regimen will be determined
by the attending physician considering various factors which modify
the action of the subject compounds of the invention (e.g., ActRIIa
polypeptides). The various factors include, but are not limited to,
amount of bone weight desired to be formed, the degree of bone
density loss, the site of bone damage, the condition of the damaged
bone, the patient's age, sex, and diet, the severity of any disease
that may be contributing to bone loss, time of administration, and
other clinical factors. Optionally, the dosage may vary with the
type of matrix used in the reconstitution and the types of
compounds in the composition. The addition of other known growth
factors to the final composition, may also affect the dosage.
Progress can be monitored by periodic assessment of bone growth
and/or repair, for example, X-rays (including DEXA),
histomorphometric determinations, and tetracycline labeling.
[0146] Experiments with primates and humans have demonstrated that
effects of ActRIIa-Fc on bone are detectable when the compound is
dosed at intervals and amounts sufficient to achieve serum
concentrations of about 200 ng/ml, with half-maximal effects on
anabolic bone biomarkers occurring at a dosage of 0.3 mg/kg or the
equivalent in terms of area-under-curve. In humans, serum levels of
200 ng/ml may be achieved with a single dose of 0.1 mg/kg or
greater and serum levels of 1000 ng/ml may be achieved with a
single dose of 0.3 mg/kg or greater. The observed serum half-life
of the molecule is between about 25 and 35 days, substantially
longer than most Fc fusion proteins, and thus a sustained effective
serum level may be achieved, for example, by dosing with about 0.05
to 0.5 mg/kg on a weekly or biweekly basis, or higher doses may be
used with longer intervals between dosings. For example, doses of
0.1, 0.3, 0.5, 0.7, 1, 2 or 3 mg/kg, or values in between, might be
used on a monthly or bimonthly basis, and the effect on bone may be
sufficiently durable that dosing is necessary only once every 3, 4,
5, 6, 9, 12 or more months. Longer intervals between doses are
further supported by the duration of the pharmacodynamic effect,
which is longer than the duration of drug in the serum. PD effects
are observed for at least 120 days in human patients.
[0147] In certain embodiments, the present invention also provides
gene therapy for the in vivo production of ActRIIa polypeptides.
Such therapy would achieve its therapeutic effect by introduction
of the ActRIIa polynucleotide sequences into cells or tissues
having the disorders as listed above. Delivery of ActRIIa
polynucleotide sequences can be achieved using a recombinant
expression vector such as a chimeric virus or a colloidal
dispersion system. Preferred for therapeutic delivery of ActRIIa
polynucleotide sequences is the use of targeted liposomes.
[0148] Various viral vectors which can be utilized for gene therapy
as taught herein include adenovirus, herpes virus, vaccinia, or,
preferably, an RNA virus such as a retrovirus. Preferably, the
retroviral vector is a derivative of a murine or avian retrovirus.
Examples of retroviral vectors in which a single foreign gene can
be inserted include, but are not limited to: Moloney murine
leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV),
murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV). A
number of additional retroviral vectors can incorporate multiple
genes. All of these vectors can transfer or incorporate a gene for
a selectable marker so that transduced cells can be identified and
generated. Retroviral vectors can be made target-specific by
attaching, for example, a sugar, a glycolipid, or a protein.
Preferred targeting is accomplished by using an antibody. Those of
skill in the art will recognize that specific polynucleotide
sequences can be inserted into the retroviral genome or attached to
a viral envelope to allow target specific delivery of the
retroviral vector containing the ActRIIa polynucleotide. In a
preferred embodiment, the vector is targeted to bone or
cartilage.
[0149] Alternatively, tissue culture cells can be directly
transfected with plasmids encoding the retroviral structural genes
gag, pol and env, by conventional calcium phosphate transfection.
These cells are then transfected with the vector plasmid containing
the genes of interest. The resulting cells release the retroviral
vector into the culture medium.
[0150] Another targeted delivery system for ActRIIa polynucleotides
is a colloidal dispersion system. Colloidal dispersion systems
include macromolecule complexes, nanocapsules, microspheres, beads,
and lipid-based systems including oil-in-water emulsions, micelles,
mixed micelles, and liposomes. The preferred colloidal system of
this invention is a liposome. Liposomes are artificial membrane
vesicles which are useful as delivery vehicles in vitro and in
vivo. RNA, DNA and intact virions can be encapsulated within the
aqueous interior and be delivered to cells in a biologically active
form (see e.g., Fraley, et al., Trends Biochem. Sci., 6:77, 1981).
Methods for efficient gene transfer using a liposome vehicle, are
known in the art, see e.g., Mannino, et al., Biotechniques, 6:682,
1988. The composition of the liposome is usually a combination of
phospholipids, usually in combination with steroids, especially
cholesterol. Other phospholipids or other lipids may also be used.
The physical characteristics of liposomes depend on pH, ionic
strength, and the presence of divalent cations.
[0151] Examples of lipids useful in liposome production include
phosphatidyl compounds, such as phosphatidylglycerol,
phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine,
sphingolipids, cerebrosides, and gangliosides. Illustrative
phospholipids include egg phosphatidylcholine,
dipalmitoylphosphatidylcholine, and di stearoylphosphatidylcholine.
The targeting of liposomes is also possible based on, for example,
organ-specificity, cell-specificity, and organelle-specificity and
is known in the art.
EXEMPLIFICATION
[0152] The invention now being generally described, it will be more
readily understood by reference to the following examples, which
are included merely for purposes of illustration of certain
embodiments and embodiments of the present invention, and are not
intended to limit the invention.
Example 1: ActRIIa-Fc Fusion Proteins
[0153] Applicants constructed a soluble ActRIIa fusion protein that
has the extracellular domain of human ActRIIa fused to a human or
mouse Fc domain with a minimal linker in between. The constructs
are referred to as ActRIIa-hFc and ActRIIa-mFc, respectively.
[0154] ActRIIa-hFc is shown below as purified from CHO cell lines
(SEQ ID NO: 7):
TABLE-US-00007 ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS
IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV
SVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPP
SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0155] The ActRIIa-hFc and ActRIIa-mFc proteins were expressed in
CHO cell lines. Three different leader sequences were
considered:
(i) Honey bee mellitin (HBML):
TABLE-US-00008 (SEQ ID NO: 8) MKFLVNVALVFMVVYISYIYA
(ii) Tissue Plasminogen Activator (TPA):
TABLE-US-00009 [0156] (SEQ ID NO: 9) MDAMKRGLCCVLLLCGAVFVSP
(iii) Native:
TABLE-US-00010 (SEQ ID NO: 10) MGAAAKLAFAVFLISCSSGA.
[0157] The selected form employs the TPA leader and has the
following unprocessed amino acid sequence:
TABLE-US-00011 (SEQ ID NO: 13)
MDAMKRGLCCVLLLCGAVFVSPGAAILGRSETQECLFFNANWEKDRTNQT
GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKK
DSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPP
CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL
PVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA
VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK
[0158] This polypeptide is encoded by the following nucleic acid
sequence:
TABLE-US-00012 (SEQ ID NO: 14)
ATGGATGCAATGAAGAGAGGGCTCTGCTGTGTGCTGCTGCTGTGTGGAGC
AGTCTTCGTTTCGCCCGGCGCCGCTATACTTGGTAGATCAGAAACTCAGG
AGTGTCTTTTTTTAATGCTAATTGGGAAAAAGACAGAACCAATCAAACT
GGTGTTGAACCGTGTTATGGTGACAAAGATAAACGGCGGCATTGTTTTGC
TACCTGGAAGAATATTTCTGGTTCCATTGAATAGTGAAACAAGGTTGTTG
GCTGGATGATATCAACTGCTATGACAGGACTGATTGTGTAGAAAAAAAAG
ACAGCCCTGAAGTATATTTCTGTTGCTGTGAGGGCAATATGTGTAATGAA
AAGTTTTCTTATTTTCCGGAGATGGAAGTCACACAGCCCACTTCAAATCC
AGTTACACCTAAGCCACCCACCGGTGGTGGAACTCACACATGCCCACCGT
GCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCA
AAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGT
GGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACG
TGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAG
TACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGA
CTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCC
CAGTCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAA
CCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCA
GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCG
TGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCT
CCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGT
GGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGC
ATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCG
GGTAAATGAGAATTC
[0159] Both ActRIIa-hFc and ActRIIa-mFc were remarkably amenable to
recombinant expression. As shown in FIG. 1, the protein was
purified as a single, well-defined peak of protein. N-terminal
sequencing revealed a single sequence of -ILGRSETQE (SEQ ID NO:
11). Purification could be achieved by a series of column
chromatography steps, including, for example, three or more of the
following, in any order: protein A chromatography, Q sepharose
chromatography, phenylsepharose chromatography, size exclusion
chromatography, and cation exchange chromatography. The
purification could be completed with viral filtration and buffer
exchange. The ActRIIa-hFc protein was purified to a purity of
>98% as determined by size exclusion chromatography and >95%
as determined by SDS PAGE.
[0160] ActRIIa-hFc and ActRIIa-mFc showed a high affinity for
ligands, particularly activin A. GDF-11 or Activin A ("ActA") were
immobilized on a Biacore CMS chip using standard amine coupling
procedure. ActRIIa-hFc and ActRIIa-mFc proteins were loaded onto
the system, and binding was measured. ActRIIa-hFc bound to activin
with a dissociation constant (K.sub.D) of 5.times.10.sup.-12, and
the protein bound to GDF11 with a K.sub.D of 9.96.times.10.sup.-9.
See FIG. 2. ActRIIa-mFc behaved similarly.
[0161] An A-204 Reporter Gene Assay was used to evaluate the
effects of ActRIIa-hFc proteins on signaling by GDF-11 and Activin
A. Cell line: Human Rhabdomyosarcoma (derived from muscle).
Reporter vector: pGL3(CAGA)12 (Described in Dennler et al, 1998,
EMBO 17: 3091-3100.) See FIG. 3. The CAGA12 motif is present in
TGF-Beta responsive genes (PAI-1 gene), so this vector is of
general use for factors signaling through Smad2 and 3.
[0162] Day 1: Split A-204 cells into 48-well plate.
[0163] Day 2: A-204 cells transfected with 10 .mu.g pGL3(CAGA)12 or
pGL3(CAGA)12 (10 .mu.g)+pRLCMV (1 .mu.g) and Fugene.
[0164] Day 3: Add factors (diluted into medium+0.1% BSA).
Inhibitors need to be preincubated with Factors for 1 hr before
adding to cells. 6 hrs later, cells rinsed with PBS, and lyse
cells.
[0165] This is followed by a Luciferase assay. Typically in this
assay, in the absence of any inhibitors, Activin A shows roughly 10
fold stimulation of reporter gene expression and an ED50 .about.2
ng/ml. GDF-11: 16 fold stimulation, ED50: .about.1.5 ng/ml. GDF-8
shows an effect similar to GDF-11.
[0166] As shown in FIG. 4, ActRIIa-hFc and ActRIIa-mFc inhibit
GDF-8 mediated signaling at picomolar concentrations. As shown in
FIG. 5, three different preparations of ActRIIa-hFc inhibited
GDF-11 signaling with an IC50 of approximately 200 pM.
[0167] The ActRIIa-hFc was very stable in pharmacokinetic studies.
Rats were dosed with 1 mg/kg, 3 mg/kg or 10 mg/kg of ActRIIa-hFc
protein and plasma levels of the protein were measured at 24, 48,
72, 144 and 168 hours. In a separate study, rats were dosed at 1
mg/kg, 10 mg/kg or 30 mg/kg. In rats, ActRIIa-hFc had an 11-14 day
serum half life and circulating levels of the drug were quite high
after two weeks (11 .mu.g/ml, 110 .mu.g/ml or 304 .mu.g/ml for
initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg,
respectively.) In cynomolgus monkeys, the plasma half life was
substantially greater than 14 days and circulating levels of the
drug were 25 .mu.g/ml, 304 .mu.g/ml or 1440 .mu.g/ml for initial
administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.
Preliminary results in humans suggests that the serum half life is
between about 20 and 30 days.
Example 2: ActRIIa-mFc Promotes Bone Growth In Vivo
[0168] Normal female mice (BALB/c) were dosed with ActRIIa-mFc at a
level of 1 mg/kg/dose, 3 mg/kg/dose or 10 mg/kg/dose, with doses
given twice weekly. Bone mineral density and bone mineral content
were determined by DEXA, see FIG. 6.
[0169] In BALB/c female mice, DEXA scans showed a significant
increase (>20%) in bone mineral density and content as a result
of ActRIIa-mFc treatment. See FIGS. 7 and 8.
[0170] Thus, antagonism of ActRIIa caused increased bone density
and content in normal female mice. As a next step, the effect of
ActRIIa-mFc on bone in a mouse model for osteoporosis was
tested.
[0171] Andersson et al. (2001), established that ovariectomized
mice suffered substantial bone loss (rougly 50% loss of trabecular
bone six weeks post-operation), and that bone loss in these mice
could be corrected with candidate therapeutic agents, such as
parathyroid hormone.
[0172] Applicants used C57BL6 female mice that were ovariectomized
(OVX) or sham operated at 4-5 weeks of age. Eight weeks after
surgery, treatment with ActRIIa-mFc (10 mg/kg, twice weekly) or
control (PBS) was initiated. Bone density was measured by CT
scanner.
[0173] As shown in FIG. 9, untreated, ovariectomized mice showed
substantial loss of trabecular bone density relative to the sham
controls after six weeks. ActRIIa-mFc treatment restored bone
density to the level of the sham operated mice. At 6 and 12 weeks
of the treatment, ActRIIa-mFc caused substantial increase in
trabecular bone of OVX mice. See FIG. 10. After 6 weeks of
treatment, bone density increased by 24% relative to PBS controls.
After 12 weeks, the increase was 27%.
[0174] In the sham operated mice, ActRIIa-mFc also caused a
substantial increase in trabecular bone. See FIG. 11. After 6 and
12 weeks, the treatment produced a 35% increase relative to
controls.
[0175] In an additional set of experiments, ovariectomized (OVX) or
sham operated mice as described above were treated with ActRIIa-mFc
(10 mg/kg, twice weekly) or control (PBS) over twelve weeks.
Similar to the results described above for ActRIIa-mFc, OVX mice
receiving ActRIIa-mFc exhibited an increase in trabecular bone
density of 15% by as early as four weeks and 25% after 12 weeks of
treatment (FIG. 12). Sham operated mice receiving ActRIIa-mFc
similarly showed an increase in trabecular bone density of 22% by
as early as four weeks and of 32% after 12 weeks of treatment (FIG.
13).
[0176] After twelve weeks of treatment with ActRIIa-mFc, whole body
and ex vivo femur DEXA analysis showed that treatment induces an
increase in bone density in both ovariectomized and sham operated
mice (FIGS. 14A and 14B, respectively). These results are also
supported by ex vivo pQCT analysis of the femoral midshaft which
demonstrated a significant increase in both total and cortical bone
density after twelve weeks of treatment with ActRIIa-mFc.
Vehicle-treated control ovariectomized mice exhibited bone
densities that were comparable to vehicle-treated control sham
operated mice (FIG. 15). In addition to bone density, bone content
increased following ActRIIa-mFC treatment. Ex vivo pQCT analysis of
the femoral midshaft demonstrated a significant increase in both
total and cortical bone content after twelve weeks of treatment
with ActRIIa-mFc while both ovariectomized and sham operated
vehicle control-treated mice exhibited comparable bone content
(FIG. 16). Ex vivo pQCT analysis of the femoral midshaft also
showed that ActRIIa-mFc treated mice did not show a change in
periosteal circumference; however ActRIIa-mFc treatment resulted in
a decrease in endosteal circumference indicating an increase in
cortical thickness due to growth on the inner surface of the femur
(FIG. 17).
[0177] Mechanical testing of femurs determined that ActRIIa-mFc was
able to increase the extrinsic characteristics of the bone (maximal
load, stiffness and energy to break) which contributed to a
significant increase in the intrinsic properties (ultimate
strength) of the bones. Ovariectomized mice treated with
ActRIIa-mFc exhibited increased bone strength to levels beyond sham
operated, vehicle treated controls, indicating a complete reversal
of the osteoporotic phenotype (FIG. 18).
[0178] These data demonstrate that an activin-ActRIIa antagonist
can increase bone density in normal female mice and, furthermore,
correct defects in bone density, bone content, and ultimately bone
strength, in a mouse model of osteoporosis.
[0179] In a further set of experiments, mice were ovariectomized or
sham operated at 4 weeks, and beginning at 12 weeks received either
placebo or ActRIIa-mFc (2 times/week, 10 mg/kg) (also referred to
as RAP-11 in FIGS. 19-24), for a further period of 12 weeks. A
variety of bone parameters were evaluated. As shown in FIG. 19,
ActRIIa-mFc increased vertebral trabecular bone volume to total
volume ratios (BV/TV) in both the OVX and SHAM operated mice.
ActRIIa-mFc also improved the trabecular architecture (FIG. 20),
increased cortical thickness (FIG. 21) and improved bone strength
(FIG. 22). As shown in FIG. 23, ActRIIa-mFc produced desirable
effects at a range of doses from 1 mg/kg to 10 mg/kg.
[0180] Bone histomorphometry was conducted at a 2 week time point
in sham operated mice. These data, presented in FIG. 24,
demonstrate that ActRIIa-mFc has a dual effect, both inhibiting
bone resorption and promoting bone growth. Thus ActRIIa-mFc
stimulates bone growth (anabolic effect) and inhibits bone
resorption (anti-catabolic effect). BV=Bone volume; TV=total tissue
volume. BV/TV is a measure of the percentage of bone volume that is
mineralized. ES=Eroded surface; BS=Bone surface. ES/BS is a measure
of bone erosion, and the decrease caused by RAP-011 demonstrates an
anti-resorptive or anti-catabolic effect. Ms/Bs is the mineralizing
surface/bone surface ratio, which is an indicator of bone growth,
or anabolic effect. Similarly, mineral apposition rate (MAR) and
bone formation rate per bone surface per day (BFR/BSd) indicate
bone growth. Measures of osteoblasts (Nob/BPm) and osteoclasts
(Noc/BPm) are taken in order to probe the mechanism of action.
[0181] A second bone histomorphometry experiment was conducted in
female C57BL/6 mice, beginning at an age of twelve weeks. Mice were
dosed intraperitoneally twice per week with 10 mg/kg ActRIIa-mFc
for two weeks, four weeks, eight weeks or twelve weeks. Each group
was sacrificed five days after the last dose and bones taken for
analysis. Mice were calcein labeled nine days and two days prior to
euthanasia. As shown in FIG. 25, the metrics show that ActRIIa-mFc
promotes bone growth and mineralization and has both anabolic and
anti-catabolic effects. See for example the BV/TV ratio, the ES/BS
ratio and the MS/BS ratio. The anabolic effects appear to persist
throughout the dosing regimen, while the anti-resorptive effects
appear to be shorter lived in the mice.
Example 3: ActRIIa-mFc Ameliorates or Prevents Bone Damage in a
Murine Model of Multiple Myeloma
[0182] Multiple myeloma patients exhibit a bone loss disorder
characterized by increased osteoclast activity and decreased bone
formation by osteoblasts. The 5T2MM model of myeloma in mice is
based on the use of tumor cells (5T2MM cells) from a type of
spontaneous tumor that develops in aged mice and causes effects in
mice that are similar to those seen in human multiple myeloma
patients. See, e.g., Vanderkerken et al., Methods Mol Med. 2005;
113:191-205. ActRIIa-mFc was tested for effects in this model.
[0183] 5T2MM cells injected into C57B1/KaLwRij mice promoted an
increase in osteoclast surface, the formation of osteolytic lesions
and caused a decrease in bone area. Bone disease was associated
with a decrease in osteoblast number, osteoblast surface and a
reduction in mineralization.
[0184] Mice bearing 5T2MM cells were treated with ActRIIa-mFc
(RAP-011) (10 mg/kg, i.p. twice weekly), or a vehicle, from the
time of 5T2MM injection, for a total of 12 weeks. MicroCT analysis
of the proximal tibia and lumbar vertebrae demonstrated a 39% and
21% reduction in cancellous bone volume (p<0.001 and p<0.01)
and a 37% and 15% reduction in trabecular number (p<0.01 and
p<0.05) in 5T2MM-bearing mice compared to naive mice. RAP-011
completely prevented 5T2MM-induced decreases in trabecular volume
and number in both tibia (p<0.001 and p<0.05) and vertebrae
(p<0.01 and p<0.05) when compared to vehicle treated mice.
Bone volume was 19% higher in the tibia (p=168) and 12% higher in
vertebrae (p<0.05) of RAP-011 treated mice when compared to
naive mice. RAP-011 prevented the development of osteolytic bone
lesions (p<0.05). This effect is illustrated in FIG. 26. While a
preliminary assessment of the data failed to identify significant
effects on serum paraprotein (a biomarker of multiple myeloma tumor
cells) or myeloma burden in this study, a further analysis
indicated that serum paraprotein was substantially decreased in all
but one of the treated animals, and further that the volume of
healthy bone marrow was substantially increased, indicating a
decrease in the myeloma tumor cell burden.
[0185] Therefore, ActRIIa-mFc may be used to decrease the effects
of bone disease resulting from multiple myeloma and to treat the
tumor cells themselves.
Example 4: Characterization of an ActRIIa-hFc Protein
[0186] ActRIIa-hFc fusion protein was expressed in stably
transfected CHO-DUKX B11 cells from a pAID4 vector (SV40
ori/enhancer, CMV promoter), using a tissue plasminogen leader
sequence of SEQ ID NO:9. The protein, purified as described above
in Example 1, had a sequence of SEQ ID NO:7. The Fc portion is a
human IgG1 Fc sequence, as shown in SEQ ID NO:7. Sialic acid
analysis showed that the protein contained, on average, between
about 1.5 and 2.5 moles of sialic acid per molecule of ActRIIa-hFc
fusion protein.
[0187] This purified protein showed a remarkably long serum
half-life in all animals tested, including a half-life of 25-32
days in human patients (see Example 5, below). Additionally, the
CHO cell expressed material has a higher affinity for activin B
ligand than that reported for an ActRIIa-hFc fusion protein
expressed in human 293 cells (del Re et al., J Biol Chem. 2004 Dec.
17; 279(51):53126-35.) Additionally, the use of the tPa leader
sequence provided greater production than other leader sequences
and, unlike ActRIIa-Fc expressed with a native leader, provided a
highly pure N-terminal sequence. Use of the native leader sequence
resulted in two major species of ActRIIa-Fc, each having a
different N-terminal sequence.
Example 5: Human Clinical Trial
[0188] The protein described in Example 4 was administered to human
patients in a randomized, double-blind, placebo-controlled study
that was conducted to evaluate, primarily, the safety of the
protein in healthy, postmenopausal women. Forty-eight subjects were
randomized in cohorts of 6 to receive either a single dose of
ActRIIa-hFc or placebo (5 active:1 placebo). Dose levels ranged
from 0.01 to 3.0 mg/kg intravenously (IV) and 0.03 to 0.1 mg/kg
subcutaneously (SC). All subjects were followed for 120 days.
Subjects were excluded from study participation if they took
medications affecting bone metabolism within 6 months of study
entry. Safety evaluations were conducted following each cohort to
determine dose escalation. In addition to pharmacokinetic (PK)
analyses, the biologic activity of ActRIIa-hFc was also assessed by
measurement of biochemical markers of bone formation and
resorption, and FSH levels.
[0189] No serious adverse events were reported in this study.
Adverse events (AEs) were generally mild and transient. Preliminary
analysis of AEs included headache, elevated laboratory values, cold
symptoms, emesis or vomiting, intravenous infiltration, and
hematoma at injection site.
[0190] PK analysis of ActRIIa-hFc displayed a linear profile with
dose, and a mean half-life of approximately 25-32 days. The
area-under-curve (AUC) for ActRIIa-hFc was linearly related to
dose, and the absorption after SC dosing was essentially complete
(see FIGS. 27 and 28). These data indicate that SC is a desirable
approach to dosing because it provides equivalent bioavailability
and serum-half life for the drug while avoiding the spike in serum
concentrations of drug associated with the first few days of IV
dosing (see FIG. 28). ActRIIa-hFc caused a rapid, sustained
dose-dependent increase in serum levels of bone-specific alkaline
phosphatase (BAP), which is a marker for anabolic bone growth, and
a dose-dependent decrease in C-terminal type 1 collagen telopeptide
and tartrate-resistant acid phosphatase 5b levels, which are
markers for bone resorption. Other markers, such as P1NP showed
inconclusive results. BAP levels showed near saturating effects at
the highest dosage of drug, indicating that half-maximal effects on
this anabolic bone biomarker could be achieved at a dosage of 0.3
mg/kg, with increases ranging up to 3 mg/kg. Calculated as a
relationship of pharmacodynamic effect to AUC for drug, the EC50 is
51,465 (day*ng/ml). See FIG. 29. These bone biomarker changes were
sustained for approximately 120 days at the highest dose levels
tested. There was also a dose-dependent decrease in serum FSH
levels consistent with inhibition of activin.
[0191] A single dose of ActRIIa-hFc given to healthy postmenopausal
women was safe and well-tolerated for the range of dose levels
tested. The prolonged PK and pharmacodynamic effects suggest that
intermittent dosing would be appropriate for future studies. For
example, dosing on the basis of serum half-life could be performed
on a monthly basis, or on the order of once every two, three, four,
five or six weeks. Additionally, because the pharmacodynamic effect
extends far beyond the serum residence of the drug, dosing could be
performed on the basis of the pharmacodynamic effect, meaning that
dosing every three months or every two, three, four, five, six or
even twelve months may be effective to produce the desired effect
in patients. This clinical trial demonstrates that, in humans,
ActRIIa-hFc is an osteoanabolic agent with biological evidence of
both an increase in bone formation and a decrease in bone
resorption.
Example 6: Co-Administration of ActRIIa-mFc and a
Bisphosphonate
[0192] Bisphosphonates are a class of drugs that are widely used to
treat disorders associated with low bone mineral density, including
osteoporosis and cancer-related bone loss. Bisphosphonates have a
potent anti-resorptive activity, inhibiting osteoclasts. Perhaps
because osteoclasts are required both for bone breakdown and bone
growth, bisphosphonates appear to diminish the effects of
parathyroid hormone (PTH), one of the only known anabolic bone
growth agents (Black et al., N Engl J Med. 2003 Sep. 25;
349(13):1207-15; Samadfam et al., Endocrinology. 2007 June;
148(6):2778-87.)
[0193] To test the utility of ActRIIa-Fc treatment in patients that
had previously or were concomitantly receiving bisphosphonate or
other anti-resorptive therapy, mice were tested with combined
ActRIIa-mFc and zoledronate, a bisphosphonate compound. 12 week old
C57BL/6N mice were treated as follows:
Group 1 PBS
[0194] Group 2 ActRIIa-mFc (RAP-011) (10 mg/kg) twice per week
(with Group 3 and 4) Group 3 Zoledronic Acid (ZOL) singe dose (20
mg/kg) Group 4 ZOL (1 dose), 3 days later ActRIIa-mFc (RAP-011) (1
mg/kg) twice per week Group 5 ZOL (1 dose), 3 days later
ActRIIa-mFc (RAP-011) (10 mg/kg) twice per week Total BMD was
determined by DEXA scan (PIXI) prior to dosing and at 3 and 8 weeks
of treatment.
[0195] As shown in FIG. 30, total BMD increased markedly in all
treatment groups, with the combination of ZOL and ActRIIa-mFc
producing the greatest effects. These results indicate that
ActRIIa-Fc proteins can be used to increase bone density, even in
patients that have received bisphosphonate therapy.
Example 7: ActRIIa-Fc Ameliorates or Prevents Bone Loss Caused by
Breast Cancer Metastases
[0196] It is estimated that 65 to 75 percent of breast cancers
metastasize to the bone, causing substantial damage to the bone
structure, increasing fracture risk and causing pain and other side
effects. We tested the effects of ActRIIa-Fc in a mouse model of
breast cancer that has metastasized to the bone.
[0197] A subline of the human breast cancer cell line MDA-MB-231
(clone 2287) was cultured in vitro and cells harvested at a density
of 5.times.106 cells/ml. MDA-MB-231 is a cell line that is highly
competent for seeding into bone and causing bone damage similar to
that caused by bone metastases. 10 ml of cells were injected into
the tibia of 6 week old female athymic nude mice on study day 0. On
study day 10 mice received ActRIIa-mFc (10 mg/kg/twice
weekly/subcutaneous) (n=8) or PBS vehicle (n=7). Disease
progression was assessed by dual energy x-ray absorptiometry
(PIXIMus) at weekly intervals. Mice were treated with ActRIIa-mFc
for 4 weeks and then sacrificed and tibae (both tumor injected and
untumored) were collected from each animal. Tibiae were then
processed and prepared for microCT and histololgical analysis.
[0198] Intratibial injection of MDA-MB-231 cells into athymic nude
mice promoted the development of osteolytic bone lesions in the
injected tibia compared to the contralateral leg. MicroCT analysis
of the proximal tibia, demonstrated a 62%, reduction in cancellous
bone volume in the MDA-MB-231 bearing tibiae compared to the
untumored tibia in PBS vehicle treated mice. ActRIIa-mFc treatment
led to an increase of 70% or 147% in the naive or tumor bearing
tibia respectively compared to vehicle (P<0.01 for both). The
tumor bearing tibiae of ActRIIa-mFc treated mice had a similar
cancellous bone density as the naive tibiae of the VEH treated mice
(p=0.39).
[0199] Thus, ActRIIa-mFc is able to eliminate the bone damage
associated with the presence of breast tumor cells in the bone.
Example 8: Alternative ActRIIa-Fc Proteins
[0200] An alternative construct may have a deletion of the
C-terminal tail (the final 15 amino acids of the extracellular
domain of ActRIIa. The sequence for such a construct is presented
below (Fc portion underlined)(SEQ ID NO: 12):
TABLE-US-00013 ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS
IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
TGGGTHTCPPCPAPELLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSH
EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE
YKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
INCORPORATION BY REFERENCE
[0201] All publications and patents mentioned herein are hereby
incorporated by reference in their entirety as if each individual
publication or patent was specifically and individually indicated
to be incorporated by reference.
[0202] While specific embodiments of the subject matter have been
discussed, the above specification is illustrative and not
restrictive. Many variations will become apparent to those skilled
in the art upon review of this specification and the claims below.
The full scope of the invention should be determined by reference
to the claims, along with their full scope of equivalents, and the
specification, along with such variations.
Sequence CWU 1
1
181513PRTHomo sapiens 1Met Gly Ala Ala Ala Lys Leu Ala Phe Ala Val
Phe Leu Ile Ser Cys 1 5 10 15 Ser Ser Gly Ala Ile Leu Gly Arg Ser
Glu Thr Gln Glu Cys Leu Phe 20 25 30 Phe Asn Ala Asn Trp Glu Lys
Asp Arg Thr Asn Gln Thr Gly Val Glu 35 40 45 Pro Cys Tyr Gly Asp
Lys Asp Lys Arg Arg His Cys Phe Ala Thr Trp 50 55 60 Lys Asn Ile
Ser Gly Ser Ile Glu Ile Val Lys Gln Gly Cys Trp Leu 65 70 75 80 Asp
Asp Ile Asn Cys Tyr Asp Arg Thr Asp Cys Val Glu Lys Lys Asp 85 90
95 Ser Pro Glu Val Tyr Phe Cys Cys Cys Glu Gly Asn Met Cys Asn Glu
100 105 110 Lys Phe Ser Tyr Phe Pro Glu Met Glu Val Thr Gln Pro Thr
Ser Asn 115 120 125 Pro Val Thr Pro Lys Pro Pro Tyr Tyr Asn Ile Leu
Leu Tyr Ser Leu 130 135 140 Val Pro Leu Met Leu Ile Ala Gly Ile Val
Ile Cys Ala Phe Trp Val 145 150 155 160 Tyr Arg His His Lys Met Ala
Tyr Pro Pro Val Leu Val Pro Thr Gln 165 170 175 Asp Pro Gly Pro Pro
Pro Pro Ser Pro Leu Leu Gly Leu Lys Pro Leu 180 185 190 Gln Leu Leu
Glu Val Lys Ala Arg Gly Arg Phe Gly Cys Val Trp Lys 195 200 205 Ala
Gln Leu Leu Asn Glu Tyr Val Ala Val Lys Ile Phe Pro Ile Gln 210 215
220 Asp Lys Gln Ser Trp Gln Asn Glu Tyr Glu Val Tyr Ser Leu Pro Gly
225 230 235 240 Met Lys His Glu Asn Ile Leu Gln Phe Ile Gly Ala Glu
Lys Arg Gly 245 250 255 Thr Ser Val Asp Val Asp Leu Trp Leu Ile Thr
Ala Phe His Glu Lys 260 265 270 Gly Ser Leu Ser Asp Phe Leu Lys Ala
Asn Val Val Ser Trp Asn Glu 275 280 285 Leu Cys His Ile Ala Glu Thr
Met Ala Arg Gly Leu Ala Tyr Leu His 290 295 300 Glu Asp Ile Pro Gly
Leu Lys Asp Gly His Lys Pro Ala Ile Ser His 305 310 315 320 Arg Asp
Ile Lys Ser Lys Asn Val Leu Leu Lys Asn Asn Leu Thr Ala 325 330 335
Cys Ile Ala Asp Phe Gly Leu Ala Leu Lys Phe Glu Ala Gly Lys Ser 340
345 350 Ala Gly Asp Thr His Gly Gln Val Gly Thr Arg Arg Tyr Met Ala
Pro 355 360 365 Glu Val Leu Glu Gly Ala Ile Asn Phe Gln Arg Asp Ala
Phe Leu Arg 370 375 380 Ile Asp Met Tyr Ala Met Gly Leu Val Leu Trp
Glu Leu Ala Ser Arg 385 390 395 400 Cys Thr Ala Ala Asp Gly Pro Val
Asp Glu Tyr Met Leu Pro Phe Glu 405 410 415 Glu Glu Ile Gly Gln His
Pro Ser Leu Glu Asp Met Gln Glu Val Val 420 425 430 Val His Lys Lys
Lys Arg Pro Val Leu Arg Asp Tyr Trp Gln Lys His 435 440 445 Ala Gly
Met Ala Met Leu Cys Glu Thr Ile Glu Glu Cys Trp Asp His 450 455 460
Asp Ala Glu Ala Arg Leu Ser Ala Gly Cys Val Gly Glu Arg Ile Thr 465
470 475 480 Gln Met Gln Arg Leu Thr Asn Ile Ile Thr Thr Glu Asp Ile
Val Thr 485 490 495 Val Val Thr Met Val Thr Asn Val Asp Phe Pro Pro
Lys Glu Ser Ser 500 505 510 Leu 2115PRTHomo sapiens 2Ile Leu Gly
Arg Ser Glu Thr Gln Glu Cys Leu Phe Phe Asn Ala Asn 1 5 10 15 Trp
Glu Lys Asp Arg Thr Asn Gln Thr Gly Val Glu Pro Cys Tyr Gly 20 25
30 Asp Lys Asp Lys Arg Arg His Cys Phe Ala Thr Trp Lys Asn Ile Ser
35 40 45 Gly Ser Ile Glu Ile Val Lys Gln Gly Cys Trp Leu Asp Asp
Ile Asn 50 55 60 Cys Tyr Asp Arg Thr Asp Cys Val Glu Lys Lys Asp
Ser Pro Glu Val 65 70 75 80 Tyr Phe Cys Cys Cys Glu Gly Asn Met Cys
Asn Glu Lys Phe Ser Tyr 85 90 95 Phe Pro Glu Met Glu Val Thr Gln
Pro Thr Ser Asn Pro Val Thr Pro 100 105 110 Lys Pro Pro 115
3100PRTHomo sapiens 3Ile Leu Gly Arg Ser Glu Thr Gln Glu Cys Leu
Phe Phe Asn Ala Asn 1 5 10 15 Trp Glu Lys Asp Arg Thr Asn Gln Thr
Gly Val Glu Pro Cys Tyr Gly 20 25 30 Asp Lys Asp Lys Arg Arg His
Cys Phe Ala Thr Trp Lys Asn Ile Ser 35 40 45 Gly Ser Ile Glu Ile
Val Lys Gln Gly Cys Trp Leu Asp Asp Ile Asn 50 55 60 Cys Tyr Asp
Arg Thr Asp Cys Val Glu Lys Lys Asp Ser Pro Glu Val 65 70 75 80 Tyr
Phe Cys Cys Cys Glu Gly Asn Met Cys Asn Glu Lys Phe Ser Tyr 85 90
95 Phe Pro Glu Met 100 41542DNAHomo sapiens 4atgggagctg ctgcaaagtt
ggcgtttgcc gtctttctta tctcctgttc ttcaggtgct 60atacttggta gatcagaaac
tcaggagtgt cttttcttta atgctaattg ggaaaaagac 120agaaccaatc
aaactggtgt tgaaccgtgt tatggtgaca aagataaacg gcggcattgt
180tttgctacct ggaagaatat ttctggttcc attgaaatag tgaaacaagg
ttgttggctg 240gatgatatca actgctatga caggactgat tgtgtagaaa
aaaaagacag ccctgaagta 300tatttttgtt gctgtgaggg caatatgtgt
aatgaaaagt tttcttattt tccagagatg 360gaagtcacac agcccacttc
aaatccagtt acacctaagc caccctatta caacatcctg 420ctctattcct
tggtgccact tatgttaatt gcggggattg tcatttgtgc attttgggtg
480tacaggcatc acaagatggc ctaccctcct gtacttgttc caactcaaga
cccaggacca 540cccccacctt ctccattact agggttgaaa ccactgcagt
tattagaagt gaaagcaagg 600ggaagatttg gttgtgtctg gaaagcccag
ttgcttaacg aatatgtggc tgtcaaaata 660tttccaatac aggacaaaca
gtcatggcaa aatgaatacg aagtctacag tttgcctgga 720atgaagcatg
agaacatatt acagttcatt ggtgcagaaa aacgaggcac cagtgttgat
780gtggatcttt ggctgatcac agcatttcat gaaaagggtt cactatcaga
ctttcttaag 840gctaatgtgg tctcttggaa tgaactgtgt catattgcag
aaaccatggc tagaggattg 900gcatatttac atgaggatat acctggccta
aaagatggcc acaaacctgc catatctcac 960agggacatca aaagtaaaaa
tgtgctgttg aaaaacaacc tgacagcttg cattgctgac 1020tttgggttgg
ccttaaaatt tgaggctggc aagtctgcag gcgataccca tggacaggtt
1080ggtacccgga ggtacatggc tccagaggta ttagagggtg ctataaactt
ccaaagggat 1140gcatttttga ggatagatat gtatgccatg ggattagtcc
tatgggaact ggcttctcgc 1200tgtactgctg cagatggacc tgtagatgaa
tacatgttgc catttgagga ggaaattggc 1260cagcatccat ctcttgaaga
catgcaggaa gttgttgtgc ataaaaaaaa gaggcctgtt 1320ttaagagatt
attggcagaa acatgctgga atggcaatgc tctgtgaaac cattgaagaa
1380tgttgggatc acgacgcaga agccaggtta tcagctggat gtgtaggtga
aagaattacc 1440cagatgcaga gactaacaaa tattattacc acagaggaca
ttgtaacagt ggtcacaatg 1500gtgacaaatg ttgactttcc tcccaaagaa
tctagtctat ga 15425345DNAHomo sapiens 5atacttggta gatcagaaac
tcaggagtgt cttttcttta atgctaattg ggaaaaagac 60agaaccaatc aaactggtgt
tgaaccgtgt tatggtgaca aagataaacg gcggcattgt 120tttgctacct
ggaagaatat ttctggttcc attgaaatag tgaaacaagg ttgttggctg
180gatgatatca actgctatga caggactgat tgtgtagaaa aaaaagacag
ccctgaagta 240tatttttgtt gctgtgaggg caatatgtgt aatgaaaagt
tttcttattt tccagagatg 300gaagtcacac agcccacttc aaatccagtt
acacctaagc caccc 3456225PRTArtificial SequenceDescription of
Artificial Sequence Synthetic construct 6Thr His Thr Cys Pro Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr
Pro Glu Val Thr Cys Val Val Val Xaa Val Ser His Glu Asp 35 40 45
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50
55 60 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val 65 70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu 85 90 95 Tyr Lys Cys Xaa Val Ser Asn Lys Ala Leu Pro
Val Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Glu Glu
Met Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 145 150 155 160 Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175
Asp Ser Asp Gly Pro Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180
185 190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu 195 200 205 Ala Leu His Xaa His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly 210 215 220 Lys 225 7344PRTArtificial
SequenceDescription of Artificial Sequence Synthetic construct 7Ile
Leu Gly Arg Ser Glu Thr Gln Glu Cys Leu Phe Phe Asn Ala Asn 1 5 10
15 Trp Glu Lys Asp Arg Thr Asn Gln Thr Gly Val Glu Pro Cys Tyr Gly
20 25 30 Asp Lys Asp Lys Arg Arg His Cys Phe Ala Thr Trp Lys Asn
Ile Ser 35 40 45 Gly Ser Ile Glu Ile Val Lys Gln Gly Cys Trp Leu
Asp Asp Ile Asn 50 55 60 Cys Tyr Asp Arg Thr Asp Cys Val Glu Lys
Lys Asp Ser Pro Glu Val 65 70 75 80 Tyr Phe Cys Cys Cys Glu Gly Asn
Met Cys Asn Glu Lys Phe Ser Tyr 85 90 95 Phe Pro Glu Met Glu Val
Thr Gln Pro Thr Ser Asn Pro Val Thr Pro 100 105 110 Lys Pro Pro Thr
Gly Gly Gly Thr His Thr Cys Pro Pro Cys Pro Ala 115 120 125 Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 130 135 140
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 145
150 155 160 Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val 165 170 175 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln 180 185 190 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln 195 200 205 Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Ala 210 215 220 Leu Pro Val Pro Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 225 230 235 240 Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr 245 250 255 Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 260 265
270 Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
275 280 285 Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr 290 295 300 Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val Phe 305 310 315 320 Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys 325 330 335 Ser Leu Ser Leu Ser Pro Gly
Lys 340 821PRTApis mellifera 8Met Lys Phe Leu Val Asn Val Ala Leu
Val Phe Met Val Val Tyr Ile 1 5 10 15 Ser Tyr Ile Tyr Ala 20
922PRTUnknownDescription of Unknown Tissue Plasminogen Activator
sequence 9Met Asp Ala Met Lys Arg Gly Leu Cys Cys Val Leu Leu Leu
Cys Gly 1 5 10 15 Ala Val Phe Val Ser Pro 20
1020PRTUnknownDescription of Unknown Native Activin A receptor type
IIA peptide 10Met Gly Ala Ala Ala Lys Leu Ala Phe Ala Val Phe Leu
Ile Ser Cys 1 5 10 15 Ser Ser Gly Ala 20 119PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 11Ile
Leu Gly Arg Ser Glu Thr Gln Glu 1 5 12329PRTArtificial
SequenceDescription of Artificial Sequence Synthetic construct
12Ile Leu Gly Arg Ser Glu Thr Gln Glu Cys Leu Phe Phe Asn Ala Asn 1
5 10 15 Trp Glu Lys Asp Arg Thr Asn Gln Thr Gly Val Glu Pro Cys Tyr
Gly 20 25 30 Asp Lys Asp Lys Arg Arg His Cys Phe Ala Thr Trp Lys
Asn Ile Ser 35 40 45 Gly Ser Ile Glu Ile Val Lys Gln Gly Cys Trp
Leu Asp Asp Ile Asn 50 55 60 Cys Tyr Asp Arg Thr Asp Cys Val Glu
Lys Lys Asp Ser Pro Glu Val 65 70 75 80 Tyr Phe Cys Cys Cys Glu Gly
Asn Met Cys Asn Glu Lys Phe Ser Tyr 85 90 95 Phe Pro Glu Met Thr
Gly Gly Gly Thr His Thr Cys Pro Pro Cys Pro 100 105 110 Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 115 120 125 Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 130 135
140 Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
145 150 155 160 Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu 165 170 175 Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His 180 185 190 Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys 195 200 205 Ala Leu Pro Val Pro Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln 210 215 220 Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met 225 230 235 240 Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 245 250 255
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 260
265 270 Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu 275 280 285 Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val 290 295 300 Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln 305 310 315 320 Lys Ser Leu Ser Leu Ser Pro Gly
Lys 325 13369PRTArtificial SequenceDescription of Artificial
Sequence Synthetic construct 13Met Asp Ala Met Lys Arg Gly Leu Cys
Cys Val Leu Leu Leu Cys Gly 1 5 10 15 Ala Val Phe Val Ser Pro Gly
Ala Ala Ile Leu Gly Arg Ser Glu Thr 20 25 30 Gln Glu Cys Leu Phe
Phe Asn Ala Asn Trp Glu Lys Asp Arg Thr Asn 35 40 45 Gln Thr Gly
Val Glu Pro Cys Tyr Gly Asp Lys Asp Lys Arg Arg His 50 55 60 Cys
Phe Ala Thr Trp Lys Asn Ile Ser Gly Ser Ile Glu Ile Val Lys 65 70
75 80 Gln Gly Cys Trp Leu Asp Asp Ile Asn Cys Tyr Asp Arg Thr Asp
Cys 85 90 95 Val Glu Lys Lys Asp Ser Pro Glu Val Tyr Phe Cys Cys
Cys Glu Gly 100 105 110 Asn Met Cys Asn Glu Lys Phe Ser Tyr Phe Pro
Glu Met Glu Val Thr 115 120 125 Gln Pro Thr Ser Asn Pro Val Thr Pro
Lys Pro Pro Thr Gly Gly Gly 130 135 140 Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro 145 150 155 160 Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 165 170 175 Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 180 185 190
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 195
200 205 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val 210
215 220 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu 225 230 235 240 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Val
Pro Ile Glu Lys 245 250 255 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr 260 265 270 Leu Pro Pro Ser Arg Glu Glu Met
Thr Lys Asn Gln Val Ser Leu Thr 275 280 285 Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 290 295 300 Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 305 310 315 320 Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 325 330
335 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
340 345 350 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly 355 360 365 Lys 141114DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 14atggatgcaa tgaagagagg
gctctgctgt gtgctgctgc tgtgtggagc agtcttcgtt 60tcgcccggcg ccgctatact
tggtagatca gaaactcagg agtgtctttt tttaatgcta 120attgggaaaa
agacagaacc aatcaaactg gtgttgaacc gtgttatggt gacaaagata
180aacggcggca ttgttttgct acctggaaga atatttctgg ttccattgaa
tagtgaaaca 240aggttgttgg ctggatgata tcaactgcta tgacaggact
gattgtgtag aaaaaaaaga 300cagccctgaa gtatatttct gttgctgtga
gggcaatatg tgtaatgaaa agttttctta 360ttttccggag atggaagtca
cacagcccac ttcaaatcca gttacaccta agccacccac 420cggtggtgga
actcacacat gcccaccgtg cccagcacct gaactcctgg ggggaccgtc
480agtcttcctc ttccccccaa aacccaagga caccctcatg atctcccgga
cccctgaggt 540cacatgcgtg gtggtggacg tgagccacga agaccctgag
gtcaagttca actggtacgt 600ggacggcgtg gaggtgcata atgccaagac
aaagccgcgg gaggagcagt acaacagcac 660gtaccgtgtg gtcagcgtcc
tcaccgtcct gcaccaggac tggctgaatg gcaaggagta 720caagtgcaag
gtctccaaca aagccctccc agtccccatc gagaaaacca tctccaaagc
780caaagggcag ccccgagaac cacaggtgta caccctgccc ccatcccggg
aggagatgac 840caagaaccag gtcagcctga cctgcctggt caaaggcttc
tatcccagcg acatcgccgt 900ggagtgggag agcaatgggc agccggagaa
caactacaag accacgcctc ccgtgctgga 960ctccgacggc tccttcttcc
tctatagcaa gctcaccgtg gacaagagca ggtggcagca 1020ggggaacgtc
ttctcatgct ccgtgatgca tgaggctctg cacaaccact acacgcagaa
1080gagcctctcc ctgtctccgg gtaaatgaga attc 111415108DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
15agccagacaa gccagacaag ccagacaagc cagacaagcc agacaagcca gacaagccag
60acaagccaga caagccagac aagccagaca agccagacaa gccagaca
108165PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 16Thr Gly Gly Gly Gly 1 5 175PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 17Ser
Gly Gly Gly Gly 1 5 186PRTArtificial SequenceDescription of
Artificial Sequence Synthetic 6xHis tag 18His His His His His His 1
5
* * * * *