U.S. patent application number 15/135363 was filed with the patent office on 2017-03-16 for methods of treating inflammatory pain.
The applicant listed for this patent is Labrys Biologics, Inc.. Invention is credited to Laura Corradini, Ian Machin, Kristian Todd Poulsen, David Louis Shelton, Joerg Zeller.
Application Number | 20170073398 15/135363 |
Document ID | / |
Family ID | 40823474 |
Filed Date | 2017-03-16 |
United States Patent
Application |
20170073398 |
Kind Code |
A1 |
Poulsen; Kristian Todd ; et
al. |
March 16, 2017 |
METHODS OF TREATING INFLAMMATORY PAIN
Abstract
The invention relates to an anti-CGRP antibody for use in the
prevention and/or treatment of inflammatory pain and/or symptoms of
inflammatory pain, and to a method of treating and/or preventing
inflammatory pain and/or symptoms of inflammatory pain using an
anti-CGRP antibody.
Inventors: |
Poulsen; Kristian Todd; (San
Francisco, CA) ; Shelton; David Louis; (Oakland,
CA) ; Zeller; Joerg; (Ann Arbor, MI) ; Machin;
Ian; (Sandwich, GB) ; Corradini; Laura;
(Sandwich, GB) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Labrys Biologics, Inc. |
Redwood City |
CA |
US |
|
|
Family ID: |
40823474 |
Appl. No.: |
15/135363 |
Filed: |
April 21, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14855929 |
Sep 16, 2015 |
|
|
|
15135363 |
|
|
|
|
14612117 |
Feb 2, 2015 |
|
|
|
14855929 |
|
|
|
|
13892130 |
May 10, 2013 |
|
|
|
14612117 |
|
|
|
|
13621981 |
Sep 18, 2012 |
|
|
|
13892130 |
|
|
|
|
12920634 |
Sep 2, 2010 |
8298536 |
|
|
PCT/IB2009/050849 |
Mar 3, 2009 |
|
|
|
13621981 |
|
|
|
|
61033568 |
Mar 4, 2008 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/33 20130101;
C07K 2317/92 20130101; A61P 19/00 20180101; C07K 2317/76 20130101;
C07K 2317/56 20130101; A61P 25/24 20180101; A61K 9/0019 20130101;
A61P 43/00 20180101; A61K 45/06 20130101; A61P 29/00 20180101; A61K
39/3955 20130101; A61P 25/08 20180101; C07K 2317/94 20130101; C07K
2317/24 20130101; C07K 2317/21 20130101; A61P 25/00 20180101; A61P
19/02 20180101; C07K 16/18 20130101; A61P 19/08 20180101; A61K
2039/505 20130101; C07K 2317/565 20130101; A61P 25/04 20180101 |
International
Class: |
C07K 16/18 20060101
C07K016/18; A61K 9/00 20060101 A61K009/00; A61K 39/395 20060101
A61K039/395 |
Claims
1. A method for preventing and/or treating inflammatory pain and/or
symptoms of inflammatory pain, comprising peripheral administration
to the individual of an effective amount of an anti-CGRP antagonist
antibody.
2. The method according to claim 1, wherein the medicament is
prepared to be peripherally administered.
3. The method according to claim 1, wherein the medicament is
administered peripherally.
4. The method according to claim 1, wherein the medicament is
prepared to be administered orally, sublingually, via inhalation,
transdermally, subcutaneously, intravenously, intra-arterially,
intra-articularly, peri-articularly, locally and/or
intramuscularly.
5. The method according to claim 4, wherein the medicament is
prepared to be administered subcutaneously or intravenously.
6. The method according to claim 1, wherein the anti-CGRP
antagonist antibody acts peripherally on administration.
7. The method according to claim 1, wherein the inflammatory pain
is arthritic pain.
8. The method according to claim 7, wherein the arthritic pain is
osteoarthritis pain.
9. The method according to claim 1, wherein the anti-CGRP
antagonist antibody: (a) binds to CGRP; (b) blocks CGRP from
binding to its receptor; (c) blocks or decreases CGRP receptor
activation; (d) inhibits blocks, suppresses or reduces CGRP
biological activity; (e) increases clearance of CGRP; and/or (g)
inhibits CGRP synthesis, production or release.
10. The method according to claim 1, wherein the anti-CGRP
antagonist antibody: (i) is a human antibody, (ii) is a humanized
antibody, (iii) is a monoclonal antibody, (iv) binds CGRP with a Kd
of 50 nM or less (as measured by surface plasmon resonance at
37.degree. C.); and/or (v) has a half life in-vivo of at least 7
days.
11. The method according to claim 1, wherein the anti-CGRP
antagonist antibody specifically binds to the C-terminal region of
CGRP.
12. The method according to claim 10, wherein the anti-CGRP
antagonist antibody specifically recognises the epitope defined by
the sequence GSKAF.
13. The method according to claim 1, wherein the anti-CGRP antibody
comprises a VH domain that is at least 90% identical in amino acid
sequence to SEQ ID NO: 1 or 19.
14. The method according to claim 1, wherein the anti-CGRP antibody
comprises a VL domain that is at least 90% identical in amino acid
sequence to SEQ ID NO: 2 or 20.
15. The method according to claim 14, wherein the anti-CGRP
antibody further comprises a VH domain that is at least 90%
identical in amino acid sequence to SEQ ID NO: 1 or 19.
16. The method according to claim 1, wherein the anti-CGRP antibody
comprises at least one CDR selected from the group consisting of:
(a) CDR H1 as set forth in SEQ ID NO: 3 or 21; (b) CDR H2 as set
forth in SEQ ID NO: 4 or 22; (c) CDR H3 as set forth in SEQ ID NO:
5 or 23; (d) CDR L1 as set forth in SEQ ID NO: 6 or 24; (e) CDR L2
as set forth in SEQ ID NO: 7 or 25; (f) CDR L3 as set forth in SEQ
ID NO: 8 or 26; and (g) variants of L1, L2 and H2.
17. The method according to claim 1, wherein the anti-CGRP antibody
comprises a VH domain that is at least 90% identical in amino acid
sequence to SEQ ID NO: 1 and a VL domain that is at least 90%
identical in amino acid sequence to SEQ ID NO: 2.
18. The method according to claim 1, wherein the anti-CGRP antibody
comprises a heavy chain produced by the expression vector with ATCC
Accession No. PTA-6867.
19. The method according to claim 1, wherein the anti-CGRP antibody
comprises a light chain produced by the expression vector with ATCC
Accession No. PTA-6866.
20. The method according to claim 1, wherein the anti-CGRP antibody
is produced by the expression vectors with ATCC Accession Nos.
PTA-6867 and PTA-6866.
21-31. (canceled)
Description
[0001] This application is a continuation of U.S. patent
application Ser. No. 14/855,929, filed Sep. 16, 2015, which is a
continuation of U.S. patent application Ser. No. 14/612,117, filed
Feb. 2, 2015, which is a continuation of U.S. patent application
Ser. No. 13/892,130, filed May 10, 2013, which is a continuation of
U.S. patent application Ser. No. 13/621,981 filed Sep. 18, 2012,
which is a divisional of U.S. patent application Ser. No.
12/920,634 (now U.S. Pat. No. 8,298,536), which is a National Stage
Application under 35 U.S.C. .sctn.371 of PCT/IB2009/050849, filed
on Mar. 3, 2009, which claims the benefit of U.S. Patent
Application No. 61/033,568, filed on Mar. 4, 2008; each of which
applications is herein incorporated by reference in its entirety
for all purposes.
REFERENCE TO SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted in ASCII format via EFS-Web and is hereby
incorporated by reference in its entirety. The sequence listing
contains no new matter. Said ASCII copy, created on Apr. 21, 2016,
is named 4430670305SeqList.txt and is 27 Kilobytes in size.
FIELD OF THE INVENTION
[0003] The invention relates to an anti-CGRP antibody for use in
the prevention and/or treatment of inflammatory pain and/or
symptoms of inflammatory pain, and to a method of treating and/or
preventing inflammatory pain and/or symptoms of inflammatory pain
using an anti-CGRP antibody.
BACKGROUND OF THE INVENTION
[0004] The inflammatory process is a complex series of biochemical
and cellular events, activated in response to tissue injury or the
presence of foreign substances, which results in swelling and pain
(Levine and Taiwo, 1994, Textbook of Pain, 45-56). Arthritic pain
is the most common inflammatory pain. Rheumatoid disease is one of
the commonest chronic inflammatory conditions in developed
countries and rheumatoid arthritis is a common cause of disability.
The exact aetiology of rheumatoid arthritis is unknown, but current
hypotheses suggest that both genetic and microbiological factors
may be important (Grennan & Jayson, 1994, Textbook of Pain,
397-407). It has been estimated that almost 16 million Americans
have symptomatic osteoarthritis (OA) or degenerative joint disease,
most of whom are over 60 years of age, and this is expected to
increase to 40 million as the age of the population increases,
making this a public health problem of enormous magnitude (Houge
& Mersfelder, 2002, Ann Pharmacother., 36, 679-686; McCarthy et
al., 1994, Textbook of Pain, 387-395). Most patients with
osteoarthritis seek medical attention because of the associated
pain. Arthritis has a significant impact on psychosocial and
physical function and is known to be the leading cause of
disability in later life. Ankylosing spondylitis is also a
rheumatic disease that causes arthritis of the spine and sacroiliac
joints. It varies from intermittent episodes of back pain that
occur throughout life to a severe chronic disease that attacks the
spine, peripheral joints and other body organs.
[0005] Another type of inflammatory pain is visceral pain which
includes pain associated with inflammatory bowel disease (IBD).
Visceral pain is pain associated with the viscera, which encompass
the organs of the abdominal cavity. These organs include the sex
organs, spleen and part of the digestive system. Pain associated
with the viscera can be divided into digestive visceral pain and
non-digestive visceral pain. Commonly encountered gastrointestinal
(GI) disorders that cause pain include functional bowel disorder
(FBD) and inflammatory bowel disease (IBD). These GI disorders
include a wide range of disease states that are currently only
moderately controlled, including, in respect of FBD,
gastro-esophageal reflux, dyspepsia, irritable bowel syndrome (IBS)
and functional abdominal pain syndrome (FAPS), and, in respect of
IBD, Crohn's disease, ileitis and ulcerative colitis, all of which
regularly produce visceral pain. Other types of visceral pain
include the pain associated with dysmenorrhea, cystitis and
pancreatitis and pelvic pain.
[0006] There is a critical medical need to identify new
pharmaceutically active compounds that interfere with key steps of
the inflammatory pain process and particularly for the treatment
and/or prevention of arthritis pain and/or symptoms of arthritis
pain.
[0007] Surprisingly we have found that administration of an
anti-CGRP antibody is effective in prevention and/or treatment of
inflammatory pain, arthritis pain and in particular osteoarthritis
pain.
[0008] CGRP (calcitonin gene-related peptide) is a 37 amino acid
neuropeptide which acts as a neurotransmitter in the central
nervous system. It binds with high affinity to the CGRP receptor,
Calcitonin receptor-like receptor (CRLR), activating adenylate
cyclase and protein kinase A production.
[0009] Centrally penetrating spinally administered, small molecule
selective CGRP antagonists have been shown to be useful in the
treatment of neuropathic and nociceptive pain conditions (Adwanikar
et al, Pain 2007) suggesting that removal of endogenous CGRP in the
spinal cord has an antinociceptive effect. Additionally intrathecal
administration of antiserum against CGRP has been shown to reduce
nociceptive behaviour in rodent models of arthritis (Kuraishi, Y.,
et. al Neurosci. lett (1998) 92, 325-329).
[0010] Surprisingly we have found that administration of an
anti-CGRP antibody is effective, with a peripheral site of action,
in the prevention and/or treatment of inflammatory pain and in
particular osteoarthritis pain when administered peripherally. This
peripheral administration route provides a distinct advantage over
the requirement to administer antibodies intrathecally or spinally,
a more high risk and inconvenient proceedure.
BRIEF DESCRIPTION OF THE INVENTION
[0011] The present invention provides the use of an anti-CGRP
antagonist antibody for the manufacture of a medicament for the
prevention and/or treatment of inflammatory pain and/or symptoms of
inflammatory pain, wherein the medicament is prepared to be
peripherally administered.
[0012] The present invention further provides a method of
prevention and/or treatment of inflammatory pain and/or symptoms of
inflammatory pain, in an individual, which comprises peripherally
administering to said individual a therapeutically effective amount
of an anti-CGRP antagonist antibody.
[0013] In one embodiment, the anti-CGRP antagonist antibody acts
peripherally on administration.
DESCRIPTION OF THE FIGURES
[0014] FIG. 1: Osteoarthritis pain model. Antibody G2 was
administered at 1 and 10 mg/kg, intravenously (1 ml/kg, IV) and, a
null antibody (does not bind CGRP) was administered at 10 mg/kg, IV
as a negative control. Both antibodies were dissolved in a vehicle
solution containing PBS+0.01% Tween 20. Celecoxib was used as
positive control in the study. It was suspended in 0.5%
methylcellulose and 0.025% Tween-20 and was administered by oral
gavage (1 ml/kg) at 30 mg/kg, twice a day throughout the study
period. Pain responses were assessed on day 2, 3, 7 and 10
following initiation of the pharmacology study (day 0) and were
assessed in a fully blinded fashion. Data re the mean.+-.SEM of 6
rats per group. *p<0.05 and p<0.01 vs baseline value
(Dunnett's test in GraphPad Prism). In the figure, from left to
right, bar 1=baseline, bars 2-5 =null antibody, bars 6-9=1 mg/ml
G2, bars 10-13=10 mg/ml G2, bars 14-17=Celecoxib 30 mg/ml.
[0015] FIG. 2: Binding assay data demonstrating that antibody G1
inhibits the binding of .alpha.-CGRP to the CGRP1 receptor.
[0016] FIG. 3a: serum level of anti-CGRP concentration (ug/ml) vs
time after IV administration of 10 mg/kg, measured by anti-IgG
ELISA.
[0017] FIG. 3b: serum level of anti-CGRP concentration (ug/ml) vs
time after IV administration of 10, 30, 100 mg/kg, measured by
anti-IgG ELISA.
[0018] FIG. 4: Alanine scan using a C-terminal CGRP fragment (CGRP
25-37). The change in affinity is expressed in fold loss of
affinity and which shows that anti-CGRP antibody G1 binds to the
C-terminal region of human .alpha.-CGRP.
[0019] FIG. 5: Solution competition by Biacore: CGRP, CGRP
fragments or peptides related in sequence to CGRP were used to
determine the specificity of G1.
[0020] FIG. 6: CGRP sequences from human, cynomolgus monkey, rat,
mouse , dog and rabbit. Non-conserved residues between species are
underlined, the epitope of G1 is in bold.
[0021] FIG. 7: Data showing G1 inhibits neurogenic flare in the
skin starting from 90 min post-treatment. G1 was administered by
intravenous administration (1 ml/kg). Data are from 6-8 or 13 rats
per group. *p=0.05, **p=0.01 vs vehicle (phosphate buffered saline)
treated group at each time point (AVOVA).
[0022] Table 1: Kd and IC50 of anti-CGRP antibodies measured at
25.degree. C. against human .alpha.-CGRP [muMab7E9=murine precursor
of G1. Its K.sub.D for rat .beta.-CGRP=1 nM . RN4901=murine tool,
recognising same epitope as G1 but showed same affinities and
selectivity in rats (.beta.-CGRP K.sub.D=17 nM); G1=antibody
humanized from muMab7E9 (K.sub.D for rat .beta.-CGRP=0.1 nM).]
[0023] Table 2: G1 binding affinities as determined by Biacore
DESCRIPTION OF THE INVENTION
[0024] General Techniques
[0025] The practice of the present invention will employ, unless
otherwise indicated, conventional techniques of molecular biology
(including recombinant techniques), microbiology, cell biology,
biochemistry and immunology, which are within the skill of the art.
Such techniques are explained fully in the literature, such as,
Molecular Cloning: A Laboratory Manual, second edition (Sambrook et
al., 1989) Cold Spring Harbor Press; Oligonucleotide Synthesis (M.
J. Gait, ed., 1984); Methods in Molecular Biology, Humana Press;
Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1998)
Academic Press; Animal Cell Culture (R. I. Freshney, ed., 1987);
Introduction to Cell and Tissue Culture (J. P. Mather and P. E.
Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory
Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds.,
1993-1998) J. Wiley and Sons; Methods in Enzymology (Academic
Press, Inc.); Handbook of Experimental Immunology (D. M. Weir and
C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells
(J. M. Miller and M. P. Calos, eds., 1987); Current Protocols in
Molecular Biology (F. M. Ausubel et al., eds., 1987); PCR: The
Polymerase Chain Reaction, (Mullis et al., eds., 1994); Current
Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short
Protocols in Molecular Biology (Wiley and Sons, 1999);
Immunobiology (C. A. Janeway and P. Travers, 1997); Antibodies (P.
Finch, 1997); Antibodies: a practical approach (D. Catty., ed., IRL
Press, 1988-1989); Monoclonal antibodies: a practical approach (P.
Shepherd and C. Dean, eds., Oxford University Press, 2000); Using
antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring
Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J.
D. Capra, eds., Harwood Academic Publishers, 1995); and Cancer:
Principles and Practice of Oncology (V. T. DeVita et al., eds., J.
B. Lippincott Company, 1993).
[0026] Definitions
[0027] An "antibody" is an immunoglobulin molecule capable of
specific binding to a target, such as a carbohydrate,
polynucleotide, lipid, polypeptide, etc., through at least one
antigen recognition site, located in the variable region of the
immunoglobulin molecule. As used herein, the term encompasses not
only intact polyclonal or monoclonal antibodies, but also fragments
thereof (such as Fab, Fab', F(ab').sub.2, Fv, dAb), single chain
antibodies (ScFv), mutants thereof, chimeric antibodies, diabodies,
fusion proteins comprising an antibody portion, and any other
modified configuration of the immunoglobulin molecule that
comprises an antigen recognition site. An antibody includes an
antibody of any class, such as IgG, IgA, or IgM (or sub-class
thereof), and the antibody need not be of any particular class.
Depending on the antibody amino acid sequence of the constant
domain of its heavy chains, immunoglobulins can be assigned to
different classes. There are five major classes of immunoglobulins:
IgA, IgD, IgE, IgG, and IgM, and several of these may be further
divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4,
IgA1 and IgA2. The heavy-chain constant domains that correspond to
the different classes of immunoglobulins are called alpha, delta,
epsilon, gamma, and mu, respectively. The subunit structures and
three-dimensional configurations of different classes of
immunoglobulins are well known
[0028] "Fv" is an antibody fragment that contains a complete
antigen-recognition and -binding site. In a two-chain Fv species,
this region consists of a dimer of one heavy and one light chain
variable domain in tight, non-covalent association. In a
single-chain Fv species, one heavy and one light chain variable
domain can be covalently linked by a flexible peptide linker such
that the light and heavy chains can associate in a dimeric
structure analogous to that in a two-chain Fv species. It is in
this configuration that the three CDRs of each variable domain
interact to define an antigen-binding specificity on the surface of
the VH-VL dimer. However, even a single variable domain (or half of
a Fv comprising only 3 CDRs specific for an antigen) has the
ability to recognize and bind antigen, although generally at a
lower affinity than the entire binding site.
[0029] The Fab fragment also contains the constant domain of the
light chain and the first constant domain (CH1) of the heavy chain.
Fab' fragments differ from Fab fragments by the addition of a few
residues at the carboxy terminus of the heavy chain CH1 domain
including one or more cysteines from the antibody hinge regions. A
F(ab)2 fragment is a bivalent fragment comprising two Fab fragments
linked by a disulfide bridge at the hinge region.
[0030] An antibody can have one or more binding sites (for
combining with antigen). If there is more than one binding site,
the binding sites may be identical to one another or may be
different. For instance, a naturally-occurring immunoglobulin has
two identical binding sites, a single chain antibody or Fab
fragment has one binding site, while a "bispecific" or
"bifunctional" antibody (diabody) has two different binding sites,
in terms of sequence and/or antigen/epitope recognition.
[0031] An "isolated antibody" is an antibody that (1) is not
associated with naturally-associated components, including other
naturally-associated antibodies, that accompany it in its native
state, (2) is free of other proteins from the same species, (3) is
expressed by a cell from a different species, or (4) does not occur
in nature.
[0032] A "monoclonal antibody" refers to a homogeneous antibody
population wherein the monoclonal antibody is comprised of amino
acids (naturally occurring and non-naturally occurring) that are
involved in the selective binding of an antigen. A population of
monoclonal antibodies is highly specific, being directed against a
single antigenic site. The term "monoclonal antibody" encompasses
not only intact monoclonal antibodies and full-length monoclonal
antibodies, but also fragments thereof (such as Fab, Fab',
F(ab').sub.2, Fv), single chain (ScFv), mutants thereof, fusion
proteins comprising an antibody portion, and any other modified
configuration of the immunoglobulin molecule that comprises an
antigen recognition site of the required specificity and the
ability to bind to an antigen. It is not intended to be limited as
regards to the source of the antibody or the manner in which it is
made (e.g., by hybridoma, phage selection, recombinant expression,
transgenic animals, etc.).
[0033] As used herein, "humanized" antibodies refer to forms of
non-human (e.g. murine) antibodies that are specific chimeric
immunoglobulins, immunoglobulin chains, or fragments thereof (such
as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of
antibodies) that contain minimal sequence derived from non-human
immunoglobulin. For the most part, humanized antibodies are human
immunoglobulins (recipient antibody) in which residues from a
complementarity determining region (CDR) of the recipient are
replaced by residues from a CDR of a non-human species (donor
antibody) such as mouse, rat, or rabbit having the desired
specificity, affinity, and biological activity. In some instances,
Fv framework region (FR) residues of the human immunoglobulin are
replaced by corresponding non-human residues. Furthermore, the
humanized antibody may comprise residues that are found neither in
the recipient antibody nor in the imported CDR or framework
sequences, but are included to further refine and optimize antibody
performance. In general, the humanized antibody will comprise
substantially all of at least one, and typically two, variable
domains, in which all or substantially all of the CDR regions
correspond to those of a non-human immunoglobulin and all or
substantially all of the FR regions are those of a human
immunoglobulin consensus sequence. The humanized antibody optimally
also will comprise at least a portion of an immunoglobulin constant
region or domain (Fc), typically that of a human immunoglobulin.
Antibodies may have Fc regions modified as described in WO
99/58572. Other forms of humanized antibodies have one or more CDRs
(one, two, three, four, five, six) which are altered with respect
to the original antibody, which are also termed one or more CDRs
"derived from" one or more CDRs from the original antibody.
[0034] As used herein, "human antibody" means an antibody having an
amino acid sequence corresponding to that of an antibody produced
by a human and/or has been made using any of the techniques for
making human antibodies known in the art or disclosed herein. This
definition of a human antibody includes antibodies comprising at
least one human heavy chain polypeptide or at least one human light
chain polypeptide. One such example is an antibody comprising
murine light chain and human heavy chain polypeptides. Human
antibodies can be produced using various techniques known in the
art. In one embodiment, the human antibody is selected from a phage
library, where that phage library expresses human antibodies
(Vaughan et al., 1996, Nature Biotechnology, 14:309-314; Sheets et
al., 1998, PNAS, (USA) 95:6157-6162; Hoogenboom and Winter, 1991,
J. Mol. Biol., 227:381; Marks et al., 1991, J. Mol. Biol.,
222:581). Human antibodies can also be made by introducing human
immunoglobulin loci into transgenic animals, e.g., mice in which
the endogenous immunoglobulin genes have been partially or
completely inactivated. This approach is described in U.S. Pat.
Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and
5,661,016. Alternatively, the human antibody may be prepared by
immortalizing human B lymphocytes that produce an antibody directed
against a target antigen (such B lymphocytes may be recovered from
an individual or may have been immunized in vitro). See, e.g., Cole
et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p.
77 (1985); Boerner et al., 1991, J. Immunol., 147 (1):86-95; and
U.S. Pat. No. 5,750,373.
[0035] A single chain antibody (scFc) is an antibody in which VL
and VH regions are paired to form a monovalent molecule via a
synthetic linker that enables them to be made as a single protein
chain (Bird et al Science, 242: 423-426 (1988) and Huston et al.,
Proc. Natl. Acad. Sci. USA, 85:5879-5883 (1988)).
[0036] Diabodies are bivalent, bispecific antibodies in which VH
and VL domains are expressed on a single polypeptide chain, but
using a linker that is tooshort to allow for pairing between the
two domains on the same chain, thereby forcing the domains to pair
with complementary domains of another chain and creating two
antigen binding sites.
[0037] "Chimeric antibodies" refers to those antibodies wherein one
portion of each of the amino acid sequences of heavy and light
chains is homologous to corresponding sequences in antibodies
derived from a particular species or belonging to a particular
class, while the remaining segment of the chains is homologous to
corresponding sequences in another. Typically, in these chimeric
antibodies, the variable region of both light and heavy chains
mimics the variable regions of antibodies derived from one species
of mammals, while the constant portions are homologous to the
sequences in antibodies derived from another. One clear advantage
to such chimeric forms is that, for example, the variable regions
can conveniently be derived from presently known sources using
readily available hybridomas or B cells from non human host
organisms in combination with constant regions derived from, for
example, human cell preparations. While the variable region has the
advantage of ease of preparation, and the specificity is not
affected by its source, the constant region being human, is less
likely to elicit an immune response from a human subject when the
antibodies are injected than would the constant region from a
non-human source. However, the definition is not limited to this
particular example.
[0038] A "functional Fc region" possesses at least one effector
function of a native sequence Fc region. Exemplary "effector
functions" include C1q binding; complement dependent cytotoxicity
(CDC); Fc receptor binding; antibody-dependent cell-mediated
cytotoxicity (ADCC); phagocytosis; down-regulation of cell surface
receptors (e.g. B cell receptor; BCR), etc. Such effector functions
generally require the Fc region to be combined with a binding
domain (e.g. an antibody variable domain) and can be assessed using
various assays known in the art for evaluating such antibody
effector functions.
[0039] A "native sequence Fc region" comprises an amino acid
sequence identical to the amino acid sequence of an Fc region found
in nature. A "variant Fc region" comprises an amino acid sequence
which differs from that of a native sequence Fc region by virtue of
at least one amino acid modification, yet retains at least one
effector function of the native sequence Fc region. Preferably, the
variant Fc region has at least one amino acid substitution compared
to a native sequence Fc region or to the Fc region of a parent
polypeptide, e.g. from about one to about ten amino acid
substitutions, and preferably from about one to about five amino
acid substitutions in a native sequence Fc region or in the Fc
region of the parent polypeptide. The variant Fc region herein will
preferably possess at least about 80% sequence identity with a
native sequence Fc region and/or with an Fc region of a parent
polypeptide, and most preferably at least about 90% sequence
identity therewith, more preferably at least about 95% sequence
identity therewith.
[0040] As used herein "antibody-dependent cell-mediated
cytotoxicity" and "ADCC" refer to a cell-mediated reaction in which
nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g.
natural killer (NK) cells, neutrophils, and macrophages) recognize
bound antibody on a target cell and subsequently cause lysis of the
target cell. ADCC activity of a molecule of interest can be
assessed using an in vitro ADCC assay, such as that described in
U.S. Pat. No. 5,500,362 or 5,821,337. Useful effector cells for
such assays include peripheral blood mononuclear cells (PBMC) and
NK cells. Alternatively, or additionally, ADCC activity of the
molecule of interest may be assessed in vivo, e.g., in a animal
model such as that disclosed in Clynes et al., 1998, PNAS (USA),
95:652-656.
[0041] As used herein, "Fc receptor" and "FcR" describe a receptor
that binds to the Fc region of an antibody. The preferred FcR is a
native sequence human FcR. Moreover, a preferred FcR is one which
binds an IgG antibody (a gamma receptor) and includes receptors of
the FcyRI, FcyRII, and FcyRII) subclasses, including allelic
variants and alternatively spliced forms of these receptors. FcyRII
receptors include FcyRIIA (an "activating receptor") and FcyRIIB
(an "inhibiting receptor"), which have similar amino acid sequences
that differ primarily in the cytoplasmic domains thereof. FcRs are
reviewed in Ravetch and Kinet, 1991, Ann. Rev. Immunol., 9:457-92;
Capel et al., 1994, Immunomethods, 4:25-34; and de Haas et al.,
1995, J. Lab. Clin. Med., 126:330-41. "FcR" also includes the
neonatal receptor, FcRn, which is responsible for the transfer of
maternal IgGs to the fetus (Guyer et al., 1976, J. Immunol.,
117:587; and Kim et al., 1994, J. Immunol., 24:249).
[0042] "Complement dependent cytotoxicity" and "CDC" refer to the
lysing of a target in the presence of complement. The complement
activation pathway is initiated by the binding of the first
component of the complement system (C1q) to a molecule (e.g. an
antibody) complexed with a cognate antigen. To assess complement
activation, a CDC assay, e.g. as described in Gazzano-Santoro et
al., J. Immunol. Methods, 202:163 (1996), may be performed.
[0043] As used herein, the terms "G1" and "antibody G1" are used
interchangeably to refer to an antibody produced by the expression
vectors having deposit numbers ATCC-PTA-6867 and ATCC-PTA-6866. The
amino acid sequence of the heavy chain and light chain variable
regions are shown in SEQ ID Nos. 1 and 2. The CDR portions of
antibody G1 (including Chothia and Kabat CDRs) are diagrammatically
depicted in FIG. 5 of WO2007/054809, the content of which is herein
incorporated by reference in its entirety.
[0044] The polynucleotides encoding the heavy and light chain
variable regions are shown in SEQ ID Nos. 9 and 10. The
characterization of antibody G1 is described in the Examples of
WO2007/054809, the entire content of which is herein incorporated
by reference. G1 is a humanized monoclonal blocking antibody (IgG2)
which blocks binding and activity of the neuropeptide CGRP (a and
b) and its effect of neurogenic vasodilatation caused by CGRP
release. G1 is an IgG2.DELTA.a monoclonal anti-CGRP antagonist
antibody derived from the murine anti-CGRP antagonist antibody
precursor, denoted muMAb7E9 as identified in a screen using spleen
cells prepared from a mouse immunized with human and rat CGRP that
were fused with murine plasmacytoma cells. G1 was created by
grafting the muMAb 7E9 derived CDRs of light and heavy chain into
the closest human germ line sequence followed by the introduction
of at least 1 mutation into each CDR and 2 framework mutations in
V.sub.H. Two mutations were introduced into the Fc domain of G1 to
suppress human Fc-receptor activation. G1 and muMab7E9 have been
shown to recognise the same epitope.
[0045] As used herein, the terms "G2" and "antibody G2" are used
interchangeably to refer to an anti-rat CGRP mouse monoclonal
antibody as described in Wong HC et al. Hybridoma 12:93-106 (1993).
The amino acid sequence of the heavy chain and light chain variable
regions are shown in SEQ ID Nos. 19 and 20. The polynucleotides
encoding the heavy and light chain variable regions are shown in
SEQ ID Nos. 27 and 28. The CDR portions of antibody G2 are provided
in SEQ ID Nos. 21 to 26. G2 has been shown to recognise the same
epitope as G1.
[0046] As used herein, "immunospecific" binding of antibodies
refers to the antigen specific binding interaction that occurs
between the antigen-combining site of an antibody and the specific
antigen recognized by that antibody (i.e., the antibody reacts with
the protein in an ELISA or other immunoassay, and does not react
detectably with unrelated proteins).
[0047] An epitope that "specifically binds", or "preferentially
binds" (used interchangeably herein) to an antibody or a
polypeptide is a term well understood in the art, and methods to
determine such specific or preferential binding are also well known
in the art. A molecule is said to exhibit "specific binding" or
"preferential binding" if it reacts or associates more frequently,
more rapidly, with greater duration and/or with greater affinity
with a particular cell or substance than it does with alternative
cells or substances. An antibody "specifically binds" or
"preferentially binds" to a target if it binds with greater
affinity, avidity, more readily, and/or with greater duration than
it binds to other substances. It is also understood by reading this
definition that, for example, an antibody (or moiety or epitope)
that specifically or preferentially binds to a first target may or
may not specifically or preferentially bind to a second target. As
such, "specific binding" or "preferential binding" does not
necessarily require (although it can include) exclusive binding.
Generally, but not necessarily, reference to binding means
preferential binding.
[0048] The terms "polypeptide", "oligopeptide", "peptide" and
"protein" are used interchangeably herein to refer to polymers of
amino acids of any length. The polymer may be linear or branched,
it may comprise modified amino acids, and it may be interrupted by
non-amino acids. The terms also encompass an amino acid polymer
that has been modified naturally or by intervention; for example,
disulfide bond formation, glycosylation, lipidation, acetylation,
phosphorylation, or any other manipulation or modification, such as
conjugation with a labeling component. Also included within the
definition are, for example, polypeptides containing one or more
analogs of an amino acid (including, for example, unnatural amino
acids, etc.), as well as other modifications known in the art. It
is understood that, because the polypeptides of this invention are
based upon an antibody, the polypeptides can occur as single chains
or associated chains.
[0049] "Polynucleotide," or "nucleic acid," as used interchangeably
herein, refer to polymers of nucleotides of any length, and include
DNA and RNA. The nucleotides can be deoxyribonucleotides,
ribonucleotides, modified nucleotides or bases, and/or their
analogs, or any substrate that can be incorporated into a polymer
by DNA or RNA polymerase. A polynucleotide may comprise modified
nucleotides, such as methylated nucleotides and their analogs. If
present, modification to the nucleotide structure may be imparted
before or after assembly of the polymer. The sequence of
nucleotides may be interrupted by non-nucleotide components. A
polynucleotide may be further modified after polymerization, such
as by conjugation with a labeling component. Other types of
modifications include, for example, "caps", substitution of one or
more of the naturally occurring nucleotides with an analog,
internucleotide modifications such as, for example, those with
uncharged linkages (e.g., methyl phosphonates, phosphotriesters,
phosphoamidates, cabamates, etc.) and with charged linkages (e.g.,
phosphorothioates, phosphorodithioates, etc.), those containing
pendant moieties, such as, for example, proteins (e.g., nucleases,
toxins, antibodies, signal peptides, ply-L-lysine, etc.), those
with intercalators (e.g., acridine, psoralen, etc.), those
containing chelators (e.g., metals, radioactive metals, boron,
oxidative metals, etc.), those containing alkylators, those with
modified linkages (e.g., alpha anomeric nucleic acids, etc.), as
well as unmodified forms of the polynucleotide(s). Further, any of
the hydroxyl groups ordinarily present in the sugars may be
replaced, for example, by phosphonate groups, phosphate groups,
protected by standard protecting groups, or activated to prepare
additional linkages to additional nucleotides, or may be conjugated
to solid supports. The 5' and 3' terminal OH can be phosphorylated
or substituted with amines or organic capping groups moieties of
from 1 to 20 carbon atoms. Other hydroxyls may also be derivatized
to standard protecting groups. Polynucleotides can also contain
analogous forms of ribose or deoxyribose sugars that are generally
known in the art, including, for example, 2'-O-methyl-, 2'-O-allyl,
2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs,
.alpha.-anomeric sugars, epimeric sugars such as arabinose, xyloses
or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses,
acyclic analogs and abasic nucleoside analogs such as methyl
riboside. One or more phosphodiester linkages may be replaced by
alternative linking groups. These alternative linking groups
include, but are not limited to, embodiments wherein phosphate is
replaced by P(O)S("thioate"), P(S)S ("dithioate"), "(O)NR.sub.2
("amidate"), P(O)R, P(O)OR', CO or CH.sub.2 ("formacetal"), in
which each R or R' is independently H or substituted or
unsubstituted alkyl (1-20 C) optionally containing an ether (--O--)
linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not
all linkages in a polynucleotide need be identical. The preceding
description applies to all polynucleotides referred to herein,
including RNA and DNA.
[0050] A "variable region" of an antibody refers to the variable
region of the antibody light chain or the variable region of the
antibody heavy chain, either alone or in combination. The variable
regions of the heavy and light chain each consist of four framework
regions
[0051] (FR) connected by three complementarity determining regions
(CDRs) also known as hypervariable regions. The CDRs in each chain
are held together in close proximity by the FRs and, with the CDRs
from the other chain, contribute to the formation of the
antigen-binding site of antibodies. There are at least two
techniques for determining CDRs: (1) an approach based on
cross-species sequence variability (i.e., Kabat et al. Sequences of
Proteins of Immunological Interest, (5th ed., 1991, National
Institutes of Health, Bethesda Md.)); and (2) an approach based on
crystallographic studies of antigen-antibody complexes (Chothia et
al. (1989) Nature 342:877; Al-lazikani et al (1997) J. Molec. Biol.
273:927-948)). As used herein, a CDR may refer to CDRs defined by
either approach or by a combination of both approaches.
[0052] A "constant region" of an antibody refers to the constant
region of the antibody light chain or the constant region of the
antibody heavy chain, either alone or in combination.
[0053] As used herein, an "anti-CGRP antagonist antibody"
(interchangeably termed "anti-CGRP antibody") refers to an antibody
which is able to bind to CGRP and inhibit CGRP biological activity
and/or downstream pathway(s). An anti-CGRP antagonist antibody
encompasses antibodies that block, antagonize, suppress or reduce
(including significantly) CGRP biological activity. For purpose of
the present invention, it will be explicitly understood that the
term "anti-CGRP antagonist antibody" encompass all the previously
identified terms, titles, and functional states and characteristics
whereby the CGRP itself, a CGRP biological activity, or the
consequences of the biological activity, are substantially
nullified, decreased, or neutralized in any meaningful degree.
Examples of anti-CGRP antagonist antibodies are provided
herein.
[0054] As used herein, "substantially pure" refers to material
which is at least 50% pure (i.e., free from contaminants), more
preferably at least 90% pure, more preferably at least 95% pure,
more preferably at least 98% pure, more preferably at least 99%
pure.
[0055] A "host cell" includes an individual cell or cell culture
that can be or has been a recipient for vector(s) for incorporation
of polynucleotide inserts. Host cells include progeny of a single
host cell, and the progeny may not necessarily be completely
identical (in morphology or in genomic DNA complement) to the
original parent cell due to natural, accidental, or deliberate
mutation. A host cell includes cells transfected in vivo with a
polynucleotide(s) of this invention.
[0056] As used herein, "treatment" is an approach for obtaining
beneficial or desired clinical results. For purposes of this
invention, beneficial or desired clinical results include, but are
not limited to, one or more of the following: improvement or
alleviation of any aspect of inflammatory pain and/or symptom of
inflammatory pain. For purposes of this invention, beneficial or
desired clinical results include, but are not limited to, one or
more of the following: including lessening severity, alleviation of
pain and/or a symptom associated with inflammatory pain.
[0057] An "effective amount" of drug, compound, or pharmaceutical
composition is an amount sufficient to effect beneficial or desired
results including clinical results such as alleviation or reduction
in pain sensation. An effective amount can be administered in one
or more administrations. For purposes of this invention, an
effective amount of drug, compound, or pharmaceutical composition
is an amount sufficient to treat, ameliorate, reduce the intensity
of and/or prevent inflammatory pain or symptom associated with
inflammatory pain. As is understood in the clinical context, an
effective amount of a drug, compound, or pharmaceutical composition
may or may not be achieved in conjunction with another drug,
compound, or pharmaceutical composition.
[0058] Thus, an "effective amount" may be considered in the context
of administering one or more therapeutic agents, and a single agent
may be considered to be given in an effective amount if, in
conjunction with one or more other agents, a desirable result may
be or is achieved.
[0059] In one embodiment, "prepared for" herein means the
medicament is in the form of a dosage unit or the like suitably
packaged and/or marked for use in peripheral administration.
[0060] "Reducing incidence" of inflammatory pain and/or a symptom
associated with inflammatory pain means any of reducing severity
(which can include reducing need for and/or amount of (e.g.,
exposure to) other drugs and/or therapies generally used for these
conditions), duration, and/or frequency.
[0061] "Ameliorating" inflammatory pain and/or a symptom associated
with inflammatory pain means a lessening or improvement of one or
more symptoms of inflammatory pain and/or symptoms associated with
inflammatory pain as compared to not administering an anti-CGRP
antagonist antibody. "Ameliorating" also includes shortening or
reduction in duration of a symptom.
[0062] "Palliating" inflammatory pain and/or a symptom associated
with inflammatory pain means lessening the extent of one or more
undesirable clinical manifestations of inflammatory pain in an
individual or population of individuals treated with an anti-CGRP
antagonist antibody in accordance with the invention.
[0063] As used therein, "delaying" the development of inflammatory
pain means to defer, hinder, slow, retard, stabilize, and/or
postpone progression of inflammatory pain and/or a symptom
associated with inflammatory pain. This delay can be of varying
lengths of time, depending on the history of the disease and/or
individuals being treated. As is evident to one skilled in the art,
a sufficient or significant delay can, in effect, encompass
prevention, in that the individual does not develop inflammatory
pain. A method that "delays" development of the symptom is a method
that reduces probability of developing the symptom in a given time
frame and/or reduces extent of the symptoms in a given time frame,
when compared to not using the method. Such comparisons are
typically based on clinical studies, using a statistically
significant number of subjects.
[0064] A "biological sample" encompasses a variety of sample types
obtained from an individual and can be used in a diagnostic or
monitoring assay. The definition encompasses blood and other liquid
samples of biological origin, solid tissue samples such as a biopsy
specimen or tissue cultures or cells derived therefrom, and the
progeny thereof. The definition also includes samples that have
been manipulated in any way after their procurement, such as by
treatment with reagents, solubilization, or enrichment for certain
components, such as proteins or polynucleotides, or embedding in a
semi-solid or solid matrix for sectioning purposes. The term
"biological sample" encompasses a clinical sample, and also
includes cells in culture, cell supernatants, cell lysates, serum,
plasma, biological fluid, and tissue samples.
[0065] An "individual" or "subject" is a vertebrate, preferably a
mammal, more preferably a human. Mammals include, but are not
limited to, farm animals (such as cows), sport animals, pets (such
as cats, dogs and horses), primates, mice and rats.
[0066] As used herein, "vector" means a construct, which is capable
of delivering, and preferably expressing, one or more gene(s) or
sequence(s) of interest in a host cell.
[0067] Examples of vectors include, but are not limited to, viral
vectors, naked DNA or RNA expression vectors, plasmid, cosmid or
phage vectors, DNA or RNA expression vectors associated with
cationic condensing agents, DNA or RNA expression vectors
encapsulated in liposomes, and certain eukaryotic cells, such as
producer cells.
[0068] As used herein, "expression control sequence" means a
nucleic acid sequence that directs transcription of a nucleic acid.
An expression control sequence can be a promoter, such as a
constitutive or an inducible promoter, or an enhancer. The
expression control sequence is operably linked to the nucleic acid
sequence to be transcribed.
[0069] As used herein, "pharmaceutically acceptable carrier"
includes any material which, when combined with an active
ingredient, allows the ingredient to retain biological activity and
is non-reactive with the subject's immune system. Examples include,
but are not limited to, any of the standard pharmaceutical carriers
such as a phosphate buffered saline solution, water, emulsions such
as oil/water emulsion, and various types of wetting agents.
Preferred diluents for aerosol or parenteral administration are
phosphate buffered saline or normal (0.9%) saline. Compositions
comprising such carriers are formulated by well known conventional
methods (see, for example, Remington's Pharmaceutical Sciences,
18th edition, A. Gennaro, ed., Mack Publishing
[0070] Co., Easton, Pa., 1990; and Remington, The Science and
Practice of Pharmacy 20th Ed. Mack Publishing, 2000).
[0071] The term "peripherally administered" as used herein refers
to the route by which the a substance, medicament and/or anti-CGRP
antagonist antibody is to be delivered, in particular it means not
centrally, not spinally, not intrathecally, not delivered directly
into the CNS. The term refers to administration routes other than
those immediately forgoing and includes via a route which is oral,
sublingual, buccal, topical, rectal, via inhalation, transdermal,
subcutaneous, intravenous, intra-arterial, intramuscular,
intracardiac, intraosseous, intradermal, intraperitoneal,
transmucosal, vaginal, intravitreal, intra-articular,
peri-articular, local or epicutaneous.
[0072] The term "acts peripherally" as used herein refers to the
site of action of a substance, compound, medicament and/or
anti-CGRP antagonist antibody said site being within the peripheral
nervous system as opposed to the central nervous system, said
compound, medicament and/or anti-CGRP antagonist antibody said
being limited by inability to cross the barrier to the CNS and
brain when peripherally administered. The term "centrally
penetrating" refers to the ability of a substance to cross the
barrier to the brain or CNS.
[0073] The term "K.sub.off", as used herein, is intended to refer
to the off rate constant for dissociation of an antibody from the
antibody/antigen complex.
[0074] The term "K.sub.d", as used herein, is intended to refer to
the dissociation constant of an antibody-antigen interaction.
[0075] The present invention is directed to a medicament for the
prevention and/or treatment of inflammatory pain and/or symptoms of
inflammatory pain and methods for prevention and/or treatment of
inflammatory pain and/or symptoms of inflammatory pain in an
individual.
[0076] In a first aspect, the invention provides the use of an
anti-CGRP antagonist antibody for the manufacture of a medicament
for the prevention and/or treatment of inflammatory pain and/or
symptoms of inflammatory pain, wherein the medicament is prepared
for peripheral administration or wherein the medicament is
administered peripherally.
[0077] In a second aspect, the invention provides an anti-CGRP
antagonist antibody for use in the prevention and/or treatment of
inflammatory pain and/or symptoms of inflammatory pain wherein the
antibody is prepared for peripheral administration or wherein the
antibody is administered peripherally.
[0078] In third aspect, the invention provides the use of an
anti-CGRP antagonist antibody for the manufacture of a medicament
for ameliorating, controlling, reducing incidence of, or delaying
the development or progression of inflammatory pain and/or symptoms
of inflammatory pain, wherein the medicament is prepared for
peripheral administration or wherein the medicament is administered
peripherally.
[0079] In a fourth aspect, the invention provides a method of
preventing and/or treating inflammatory pain and/or symptoms of
inflammatory pain in an individual, comprising peripheral
administration to the individual of an effective amount of an
anti-CGRP antagonist antibody.
[0080] In a fifth aspect, the invention provides a method of
ameliorating, controlling, reducing incidence of, or delaying the
development or progression of inflammatory pain and/or symptoms of
inflammatory pain in an individual, comprising peripheral
administration to the individual of an effective amount of an
anti-CGRP antagonist antibody.
[0081] According to a preferred embodiment of the present invention
the individual is preferably a mammal, for example a companion
animal such as a horse, cat or dog or a farm animal such as a
sheep, cow or pig. Most preferably the mammal is a human.
[0082] According to a preferred embodiment of the present invention
the medicament and/or anti-CGRP antagonist antibody is prepared for
oral, sublingual, buccal, topical, rectal, inhalation, transdermal,
subcutaneous, intravenous, intra-arterial, intramuscular,
intracardiac, intraosseous, intradermal, intraperitoneal,
transmucosal, vaginal, intravitreal, intra-articular,
peri-articular, local or epicutaneous administration.
[0083] According to a further preferred embodiment the medicament
is is prepared for peripheral administration prior to and/or during
and/or after the development of inflammatory pain.
[0084] In one embodiment, the anti-CGRP antagonist antibody acts
peripherally on administration. In one embodiment, the anti-CGRP
antagonist antibody is not administered centrally, spinally or
intrathecally.
[0085] According to a preferred embodiment of the present invention
the inflammatory pain is arthritic pain, which may be rheumatoid
arthritis pain or osteoarthritis pain. Preferably, the inflammatory
pain is osteoarthritis pain.
[0086] The uses and methods of the invention may be for improving
physical function in an individual having osteoarthritis and/or
improving stiffness in an individual having osteoarthritis.
[0087] Diagnosis or assessment of rheumatoid arthritis pain is
well-established in the art.
[0088] Assessment may be performed based on measures known in the
art, such as patient characterization of pain using various pain
scales. See, e.g., Katz et al, Surg Clin North Am. (1999) 79
(2):231-52; Caraceni et al. J Pain Symptom Manage (2002)
23(3):239-55. There are also commonly used scales to measure
disease state such as the American College of Rheumatology (ACR)
(Felson, et al., Arthritis and Rheumatism (1993) 36(6):729-740),
the Health Assessment Questionnaire (HAQ) (Fries, et al., (1982) J.
Rheumatol. 9: 789-793), the Paulus Scale (Paulus, et al., Arthritis
and Rheumatism (1990) 33: 477-484), and the Arthritis Impact
Measure Scale (AIMS) (Meenam, et al., Arthritis and Rheumatology
(1982) 25: 1048-1053).
[0089] In one embodiment, ameliorating, controlling, reducing
incidence of, or delaying the development or progression of
rheumatoid arthritis pain and/or symptoms of rheumatoid arthritis
pain is measured by one or more of ACR, HAQ and AIMS.
[0090] Diagnosis or assessment of osteoarthritis pain is also
well-established in the art.
[0091] Assessment may be performed based on measures known in the
art, such as patient characterization of pain using various pain
scales. See, e.g., Katz et al, Surg Clin North Am. (1999) 79
(2):231-52; Caraceni et al. J Pain Symptom Manage (2002)
23(3):239-55. For example, WOMAC Ambulation Pain Scale (including
pain, stiffness, and physical function) and 100 mm Visual Analogue
Scale (VAS) may be employed to assess pain and evaluate response to
the treatment.
[0092] In one embodiment, ameliorating, controlling, reducing
incidence of, or delaying the development or progression of
osteoarthritis pain and/or symptoms of osteoarthritis pain is
measured by one or more of WOMAC Ambulation Pain Scale and VAS.
[0093] According to a preferred embodiment of the present invention
the anti-CGRP antagonist antibody binds to CGRP, more preferably
binds to CGRP and inhibits the ability of CGRP to bind to the CGRP
receptor. Preferably the anti-CGRP antagonist antibody binds to
both human and rodent CGRP, preferably human and rat CGRP. More
preferably the antibody binds to human CGRP, further preferably the
anti-CGRP antagonist antibody binds to human .alpha.-CGRP or to
human .alpha.-CGRP and/or .beta.-CGRP. Most preferably the
anti-CGRP antagonist antibody is an antibody that exhibits any one
or more of the following functional characteristics: (a) binds to
CGRP; (b) blocks CGRP from binding to its receptor(s); (c) blocks
or decreases CGRP receptor activation, including cAMP activation;
(d) inhibits, blocks, suppresses or reduces CGRP biological
activity, including downstream pathways mediated by CGRP
signalling, such as receptor binding and/or elicitation of a
cellular response to CGRP; (e) prevents, ameliorates, or treats any
aspect of inflammatory pain; (f) increases clearance of CGRP; and
(g) inhibits (reduces) CGRP synthesis, production or release.
[0094] Antibodies of the invention, including G1 and G2, are known
to bind CGRP and remove its biological availability for example in
the serum thus preventing CGRP acces to the its receptor and
downstream cellular responses and biological effects of CGRP such
as flare and vasodilation.
[0095] In a further preferred embodiment of the invention the
anti-CGRP antagonist antibody binds to a fragment of CGRP, more
preferably to a fragment of CGRP as well as to the full length
CGRP. Preferably, the anti-CGRP antagonist antibody binds to the
C-terminal region or fragment of CRGP. The C-terminal region or
fragment of CRGP preferably comprises amino acids 19-37 or 25-37 or
29-37 or alternatively 30-37, further alternatively 31-37 of CGRP.
In a further embodiment, the C-terminal region or fragment of CRGP
preferably comprises amino acids 32-37 most preferably 33 to 37 of
CGRP. Preferably the CGRP is either .alpha.-CGRP or .beta.-CGRP,
further preferably human or rodent, further preferably human or
rat, more preferably human, further preferably human .alpha.-CGRP
or .beta.-CGRP, most preferably human .alpha.-CGRP.
[0096] In a further preferred embodiment of the invention the
anti-CGRP antagonist antibody specifically binds to the amino acid
sequence GSKAF. Preferably the sequence GSKAF of CGRP is the
epitope to which the anti-CGRP antagonist antibody binds,
preferably at position 33 to 37, most preferably the sequence is
GXXXF where X can be any amino acid, preferably at positions 33 to
37 of CGRP, the ends defined by amino acids G33 and F37 of
CGRP.
[0097] In one embodiment, the present invention provides an
anti-CGRP antagonist antibody which specifically binds to an
epitope defined by amino acids G33 to F37 of CGRP. The anti-CGRP
antagonist antibody may specifically bind to the epitope defined by
the amino acid sequence GSKAF. In one embodiment, the present
invention provides the use of such an antibody in the uses and
methods defined in the various aspects of the present
invention.
[0098] In one embodiment, the anti-CGRP antagonist antibody
inhibits or prevents activation of the CGRP receptor. Preferably
the anti-CGRP antibody has an IC50 of between 0.0001 (0.1 nM) to
500 .mu.M. In some preferred embodiments, the IC50 is between
0.0001 .mu.M and, or is at about, any of 250 .mu.M, 100 .mu.M, 50
.mu.M, 10 .mu.M, 1 .mu.M, 500 nM, 250 nM, 100 nM, 50 nM, 20 nM, 15
nM, 10 nM, 5 nM, 1 nM, or 0.5 nM as measured in an in vitro binding
assay. In some further preferred embodiments, IC50 is less than any
of 500 pM, or 100 pM, or 50 pM, as measured in an in vitro binding
assay. In a further more preferred embodiment IC50 is 1.2 nM or 31
nM.
[0099] In a further preferred embodiment, the anti-CGRP antagonist
antibody used is capable of competing with an antibody herein above
described for the binding of CGRP or to a fragment of CGRP, or to a
fragment of CGRP as well as the full length CGRP, preferably to the
C-terminal region or fragment of CRGP, preferably the C-terminal
region or fragment of CRGP comprises amino acids 19-37 or 25-37 or
29-37 or alternatively 30-37, further alternatively 31-37 of CGRP.
In a further embodiment, the C-terminal region or fragment of CRGP
preferably comprises amino acids 32-37, most preferably 33 to 37 of
CGRP.
[0100] In a further preferred embodiment, the anti-CGRP antagonist
antibody or antigen binding portion thereof as used in the
invention is capable of competing with an anti-CGRP antagonist
antibody herein above described, in particular G1 or G2 as herein
described, for: [0101] (a) the binding of CGRP or a fragment of
CGRP, or a fragment of CGRP as well as the full length CGRP,
preferably the C-terminal region or fragment of CRGP, preferably
the C-terminal region or fragment of CRGP comprising amino acids
19-37 or 25-37 or 29-37 or alternatively 30-37, further
alternatively 31-37, preferably amino acids 32-37, most preferably
33 to 37 of CGRP, preferably the CGRP is alpha or beta, preferably
beta, more preferably rodent or human, most preferably human,
[0102] (b) the binding of the epitope sequence GSKAF, preferably at
amino acid position 33 to 37 of CGRP as defined in (a), more
preferably to the sequence GXXXF, where X is any amino acid,
preferably GXXXF at amino acid position 33 to 37 of CGRP as defined
in (a), [0103] (c) the binding as described in (a) or (b) with
substantially the same Kd and/or substantially the same K.sub.off,
and/or [0104] (d) binding to CGRP and inhibiting/antagonising CGRP
biological activity and/or downstream pathway(s), preferably the
CGRP is alpha or beta, preferably beta, more preferably rodent or
human, most preferably human.
[0105] The anti-CGRP antagonist antibody preferably binds to CGRP,
region of CGRP or fragment of CGRP with a binding affinity
(K.sub.d) of between 0.00001 .mu.M (0.01 nM) to 500 .mu.M. In some
preferred embodiments, the binding affinity (Kd) is between 0.00001
.mu.M and, or is at about, any of 250 .mu.M, 100 .mu.M, 50 .mu.M,
10 .mu.M, 1 .mu.M, 500 nM, 250 nM, 100 nM, 50 nM, 20 nM, 15 nM, 10
nM, 5 nM, 1 nM, 0.5 nM, 1 nM, 0.05 nM, or 0.01 nM as measured in an
in vitro binding assay. In some further preferred embodiments,
binding affinity (Kd) is less than any of 500 pM, or 100 pM, 50 pM,
or 10 pM, as measured in an in vitro binding assay. In a further
more preferred embodiment binding affinity (Kd) is 0.04 nM or 16
nM.
[0106] The anti-CGRP antagonist antibody as used in the present
invention may be selected from the group of: monoclonal antibodies,
polyclonal antibodies, antibody fragments (e.g., Fab, Fab',
F(ab')2, Fv, Fc, ScFv etc.), chimeric antibodies, bispecific
antibodies, heteroconjugate antibodies, single chain (ScFv)
antibodies, mutants thereof, fusion proteins comprising an antibody
portion (e.g., a domain antibody), humanized antibodies, and any
other modified configuration of the immunoglobulin molecule that
comprises an antigen recognition site of the required specificity,
including glycosylation variants of antibodies, amino acid sequence
variants of antibodies, and covalently modified antibodies. The
anti-CGRP antagonist antibody may be murine, rat, human, or any
other origin (including chimeric or humanized antibodies). In some
embodiments, the anti-CGRP antagonist antibody may be humanized but
is more preferably human. Preferably the anti-CGRP antagonist
antibody is isolated, further preferably it is substantially pure.
Where the anti-CGRP antagonist antibody is an antibody fragment the
fragment preferably retains the functional characteristics of the
original antibody i.e. the CGRP binding and/or antagonist activity
as described in the functional characteristics above.
[0107] Examples of anti-CGRP antagonist antibodies are known in the
art. Hence according to a preferred embodiment of the present
invention the anti-CGRP antagonist antibody as used in the present
invention is preferably an anti-CGRP antibody as generally or
specifically disclosed in any of (i) WO2007/054809, (ii)
WO2007/076336, (iii) Tan et al., Clin. Sci. (Lond). 89:565-73,
1995, (iv) Sigma (Missouri, US), product number C7113 (clone
#4901), (v) Plourde et al., Peptides 14:1225-1229, 1993 or which
comprises or consists of: [0108] (a) a fragment of said antibody
(e.g., Fab, Fab', F(ab')2, Fv, Fc, ScFv etc.), [0109] (b) a light
chain of said antibody, [0110] (c) a heavy chain of said antibody,
[0111] (d) one or more variable region(s) from a light chain and/or
a heavy chain of said antibody, [0112] (e) one or more CDR(s) (one,
two, three, four, five or six CDRs) of said antibody, [0113] (f)
CDR H3 from the heavy chain of said antibody, [0114] (g) CDR L3
from the light chain of said antibody, [0115] (h) three CDRs from
the light chain of said antibody, [0116] (i) three CDRs from the
heavy chain of said antibody, [0117] (j) three CDRs from the light
chain and three CDRs from the heavy chain, of said antibody, [0118]
(k) any one or more of (a) through (j).
[0119] According to a preferred embodiment of the present invention
the anti-CGRP antagonist antibody is antibody G2 or antibody G1.
According to a most preferred embodiment of the present the
anti-CGRP antagonist antibody used is the anti-CGRP antibody G1 as
specifically disclosed in the patent application WO2007/054809, or
comprising its variants shown in Table 6 of WO2007/054809, also
including functionally equivalent antibodies to G1, i.e. comprising
conservative substitutions of amino acid residues or one or more
deletions or additions of amino acids which do not significantly
affect their functional characteristics e.g. CRGP binding or
antagonist activity and variants which have enhanced or decreased
activity and/or binding. As used herein, the terms "G1" and
"antibody G1" are used interchangeably to refer to an antibody
produced by expression vectors having deposit numbers of ATCC
PTA-6867 and ATCC PTA-6866 as disclosed in application
WO2007/054809.
[0120] According to a further embodiment of the present invention,
the anti-CGRP antagonist antibody comprises or consists of a
polypeptide selected from: (a) antibody G1 or its variants shown in
Table 6 of WO2007/054809; (b) a fragment or a region of antibody G1
or its variants shown in Table 6 of WO2007/054809; (c) a light
chain of antibody G1 or its variants shown in Table 6 of
WO2007/054809; (d) a heavy chain of antibody G1 or its variants
shown in Table 6 of WO2007/054809 (e) one or more variable
region(s) from a light chain and/or a heavy chain of antibody G1 or
its variants shown in Table 6 of WO2007/054809; (f) one or more
CDR(s) (one, two, three, four, five or six CDRs) of antibody G1 or
its variants shown in Table 6 of WO2007/054809; (g) CDR H3 from the
heavy chain of antibody G1 or its variants shown in Table 6 of
WO2007/054809; (h) CDR L3 from the light chain of antibody G1 or
its variants shown in Table 6 of WO2007/054809; (i) three CDRs from
the light chain of antibody G1 or its variants shown in Table 6 of
WO2007/054809; (j) three CDRs from the heavy chain of antibody G1
or its variants shown in Table 6 of WO2007/054809; (k) three CDRs
from the light chain and/or three CDRs from the heavy chain, of
antibody G1 or its variants shown in Table 6 of WO2007/054809; and
(i) an antibody comprising any one of (b) through (k). The
invention also provides polypeptides comprising any one or more of
the above. In some embodiments, the at least one, two, three, four,
five, or six CDR(s) are at least about 85%, 86%, 87%, 88%, 89%,
90%, 95%, 96%, 97%, 98%, or 99% identical to at least one, two,
three, four, five or six CDRs of G1 or its variants shown in Table
6 of WO2007/054809.
[0121] Determination of CDR regions is well within the ability of
the skilled person. It is understood that in some embodiments, CDRs
can be a combination of the Kabat and Chothia CDR. In some
embodiments, the CDRs are the Kabat CDRs. In other embodiments, the
CDRs are the Chothia CDRs.
[0122] The anti-CGRP antagonist antibody preferably comprises or
consists of a fragment or a region of the antibody G1 (e.g., Fab,
Fab', F(ab')2, Fv, Fc, ScFv etc.) or its variants shown in Table 6
of WO2007/054809. Preferably said fragment or region has the
functional characteristics of an anti-CGRP antagonist antibody for
example CGRP binding activity and/or antagonist activity and
comprises or consists one or more of a light chain, heavy chain,
fragment containing one or more variable regions from a light chain
and/or a heavy chain, or one or more CDRs from a light chain and/or
a heavy chain of the antibody G1.
[0123] According to a further preferred embodiment of the invention
the anti-CGRP antagonist antibody comprises a light chain variable
region, LCVR, comprising a peptide with a sequence selected from
the group consisting of SEQ ID NOs: 28-32 and/or a heavy chain
variable region, HCVR, comprising a peptide with a sequence
selected from the group consisting of SEQ ID NOs: 34-38 of patent
application WO2007/076336.
[0124] Further preferably the anti-CGRP antagonist antibody
comprises an LCVR polypeptide of a SEQ ID NO as shown in Table 1 of
patent application WO2007/076336 and further comprises a HCVR
polypeptide of a SED ID NO as shown in Table 1 of patent
application WO2007/076336.
[0125] According to a further embodiment of the invention the
anti-CGRP antagonist antibody used comprises a light chain CDR
(CDRL) selected from the group consisting of SEQ ID NOs: 8-13
and/or a heavy chain CDR (CDRH) selected from the group consisting
of SEQ ID NOs: 14-22 of patent application WO2007/076336.
[0126] Methods of making and isolating the anti-CGRP antagonist
antibodies of application WO2007/076336 and data demonstrating the
CGRP binding and antagonist characterisation of the same are
described in application WO2007/076336.
[0127] Preferably the anti-CGRP antagonist antibody for use in the
present invention comprises a VH domain that is at least 85%, at
least 86%, at least 87%, at least 88%, at least 89%, at least 90%,
at least 91%, at least 92%, at least 93%, at least 94%, at least
95%, at least 96%, at least 97% at least 98%, at least 99% or 100%
identical in amino acid sequence to SEQ ID NO: 1 or SEQ ID NO: 19
presented herein.
[0128] Preferably the anti-CGRP antagonist antibody comprises a VL
domain that is at least 85%, at least 86%, at least 87%, at least
88%, at least 89%, at least 90%, at least 91%, at least 92%, at
least 93%, at least 94%, at least 95%, at least 96%, at least 97%
at least 98%, at least 99% or 100% identical in amino acid sequence
to SEQ ID NO: 2 or SEQ ID NO: 20 presented herein.
[0129] The anti-CGRP antagonist antibody preferably comprises a VH
domain and a VL domain that are at least 85%, at least 86%, at
least 87%, at least 88%, at least 89%, at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97% at least 98%, at least 99% or 100% identical in
amino acid sequence to SEQ ID NO: 1 and 2 respectively or SEQ ID
NO: 19 and 20 presented herein, respectively.
[0130] Preferably the anti-CGRP antagonist antibody comprises a VH
domain that is at least 90% identical in amino acid sequence to SEQ
ID NO: 1 and a VL domain that is at least 90% identical in amino
acid sequence to SEQ ID NO: 2 presented herein.
[0131] Alternatively, the anti-CGRP antagonist antibody preferably
comprises a VH domain that is at least 90% identical in amino acid
sequence to SEQ ID NO: 19 and a VL domain that is at least 90%
identical in amino acid sequence to SEQ ID NO: 20 presented
herein.
[0132] The anti-CGRP antagonist antibody preferably comprises at
least one CDR selected from the group consisting of: (a). CDR H1 as
set forth in SEQ ID NO: 3 or 21; (b). CDR H2 as set forth in SEQ ID
NO: 4 or 22; (c). CDR H3 as set forth in SEQ ID NO: 5 or 23;
[0133] (d). CDR L1 as set forth in SEQ ID NO: 6 or 24; (e) CDR L2
as set forth in SEQ ID NO: 7 or 25; (f). CDR L3 as set forth in SEQ
ID NO: 8 or 26; and (g). variants of CDR L1 , CDR L2 and CDR H2 as
shown in Table 6 of WO2007/054809.
[0134] According to a preferred embodiment of the present invention
the anti-CGRP antagonist antibody heavy chain constant region may
be from any types of constant region, such as IgG, IgM, IgD, IgA,
and IgE; and any isotypes, such as IgG1, IgG2, IgG3, and IgG4.
[0135] Further preferably the anti-CGRP antagonist antibody
comprises a heavy chain produced by the expression vector with ATCC
Accession No. PTA-6867. Further preferably the anti-CGRP antagonist
antibody comprises a light chain produced by the expression vector
with ATCC Accession No. PTA-6866. Further preferably the anti-CGRP
antagonist antibody is produced by the expression vectors with ATCC
Accession Nos. PTA-6867 and PTA-6866.
[0136] Preferably the anti-CGRP antagonist antibody for use in the
present invention is antibody G1 or antibody G2 defined herein.
[0137] According to a further embodiment of the invention, the
anti-CGRP antagonist antibody comprises a modified constant region
as for example described in WO2007/054809. Preferably the modified
constant region is immunologically inert, including partially
immunologically inert, such that it does not trigger complement
mediated lysis, does not stimulate antibody-dependent cell mediated
cytotoxicity (ADCC), does not activate microglia. Preferably the
modified constant region is reduced in one or more of these
activities. Most preferably the constant region is modified as
described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application
No. PCT/GB99/01441 and/or UK Patent Application No. 9809951.8.
According to a preferred embodiment of the invention the anti-CGRP
antagonist antibody comprises a human heavy chain IgG2 constant
region comprising the following mutations: A330, P331 to S330, S331
(amino acid numbering with reference to the wildtype IgG2
sequence). Eur. J. Immunol. (1999) 29:2613-2624.
[0138] Methods of making and isolating the anti-CGRP antagonist
antibodies of application WO2007/054809 and data demonstrating the
CGRP binding and antagonist characterisation of the same are
described in application WO2007/054809. Sequences of SEQ ID No. 1
to 14 of said application are provided herein as SEQ ID No. 1 to
14, respectively.
[0139] According to a further embodiment of the present invention
the medicament is prepared for peripheral administration between
once to 7 times per week, further preferably between once to four
times per month, further preferably between once to six times per 6
month period, further preferably once to twelve times per year.
Preferably the medicament is prepared to be peripherally
administered in a period selected from: once daily, once every two,
three, four, five or six days, weekly, once every two weeks, once
every three weeks, monthly, once every two months, once every three
months, once every four months, once every five months, once every
six months, once every seven months, once every eight months, once
every nine months, once every ten months, once every eleven months
or yearly. According to preferred embodiments the medicament is
prepared to be peripherally administered via a route selected from
one or more of; orally, sublingually, buccally, topically,
rectally, via inhalation, transdermally, subcutaneously,
intravenously, intra-arterially or intramuscularly, via
intracardiac administration, intraosseously, intradermally,
intraperitoneally, transmucosally, vaginally, intravitreally
,epicutaneously, intra-articularly, peri-articularly or
locally.
[0140] According to a further embodiment of the present invention
the medicament is prepared for peripheral administration with an
antibody concentration of between 0.1 to 200 mg/ml, preferably at
about, or between 0.1 and about, any one of 0.5, 1, 5, 10,15 20,
25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100,
110, 120, 130, 140, 150, 160, 170, 180, 190 or 200 mg/ml+/-10%
error, most preferably at 50 mg/ml.
[0141] According to a further embodiment of the present invention
the medicament is prepared for peripheral administration with an
antibody concentration of between 0.1 to 200 mg/kg of body weight;
preferably at about, or between 0.1 and about, any one of 0.5, 1,
5, 10,15 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85,
90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190 or 200
mg/kg of body weight+/-10% error, most preferably at 10 mg/kg.
[0142] According to a preferred embodiment of the present invention
the anti-CGRP antagonist antibody has a half life in-vivo of more
than any one of 2, 4, 6, 8,10, 12, 14, 16, 18, 20, 22, 24, 26, 28,
30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62,
64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96,
98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122,
124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148,
150, 152,154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174,
176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200,
202, 204, 206, 208 or 210 days+/-1 day, further preferably more
than any one of 7, 8, 9, 10, 11, or 12 months.
[0143] Preferably the anti-CGRP antagonist antibody has a half life
in-vivo of more than 6 days.
[0144] According to a further preferred embodiment of the present
invention, the medicament and/or the anti-CGRP antagonist antibody
does not produce effects of central nervous system and/or cognitive
impairment. Preferably the medicament and/or the anti-CGRP
antagonist antibody does not induce any one ore more of the
following: amnesia, confusion, depersonalization, hypesthesia,
abnormal thinking, trismus, vertigo, akathisia, apathy, ataxia,
circumoral paresthesia, CNS stimulation, emotional lability,
euphoria, hallucinations, hostility, hyperesthesia, hyperkinesia,
hypotonia, incoordination, libido increase, manic reaction,
myoclonus, neuralgia, neuropathy, psychosis, seizure, abnormal
speech, stupor, suicidal ideation; dizziness, somnolence, Insomnia,
anxiety, tremor, depression or paresthesia. Most preferably the
medicament and/or the anti-CGRP antagonist antibody does not induce
impairment of motor coordination or attention.
[0145] According to a further embodiment of the present invention
the medicament and/or the anti-CGRP antagonist antibody does not
produce respiratory, renal or gastro-intestinal impairment.
[0146] According to a further embodiment of the present invention
the medicament and/or the anti-CGRP antagonist antibody does not
produce effects of physical and/or psychological dependence.
Preferably the medicament and/or the anti-CGRP antagonist antibody
does not demonstrate affinity for opiate, benzodiazepine,
phencyclidine (PCP), or N-methyl-D-aspartic acid (NMDA) receptors,
or CNS stimulant, or produce any sedating or euphoric effect.
[0147] In one embodiment, the anti-CGRP antagonist antibody, on
administration, ameliorates, controls, reduces incidence of, or
delays the development or progression of central pain
sensation.
[0148] In another embodiment the effect of the anti-CGRP antagonist
antibody is equal and/or superior to the effects of NSAIDS and/or
opiates in the same models of inflammatory pain. In one embodiment,
the anti-CGRP antagonist antibody is effective in treating
refractory pain populations.
[0149] According to a further aspect of the present invention there
is provided the use or method according to any other aspect of the
invention wherein the anti-CGRP antagonist antibody is administered
separately, sequentially or simultaneously in combination with one
or more further pharmacologically active compounds or agents,
preferably compounds or agents useful for treating inflammatory
pain. Preferably the additional agent(s) is/are selected from one
or more of: [0150] (i) an opioid analgesic, e.g. morphine, heroin,
hydromorphone, oxymorphone, levorphanol, levallorphan, methadone,
meperidine, fentanyl, cocaine, codeine, dihydrocodeine, oxycodone,
hydrocodone, propoxyphene, nalmefene, nalorphine, naloxone,
naltrexone, buprenorphine, butorphanol, nalbuphine or pentazocine;
[0151] (ii) a nonsteroidal antiinflammatory drug (NSAID), e.g.
aspirin, diclofenac, diflusinal, etodolac, fenbufen, fenoprofen,
flufenisal, flurbiprofen, ibuprofen, indomethacin, ketoprofen,
ketorolac, meclofenamic acid, mefenamic acid, nabumetone, naproxen,
oxaprozin, phenylbutazone, piroxicam, sulindac, tolmetin or
zomepirac, cyclooxygenase-2 (COX-2) inhibitors, celecoxib;
rofecoxib; meloxicam, JTE-522; L-745,337; NS398;, or a
pharmaceutically acceptable salt thereof; [0152] (iii) a
barbiturate sedative, e.g. amobarbital, aprobarbital, butabarbital,
butabital, mephobarbital, metharbital, methohexital, pentobarbital,
phenobartital, secobarbital, talbutal, theamylal or thiopental or a
pharmaceutically acceptable salt thereof; [0153] (iv)a
benzodiazepine having a sedative action, e.g. chlordiazepoxide,
clorazepate, diazepam, flurazepam, lorazepam, oxazepam, temazepam
or triazolam or a pharmaceutically acceptable salt thereof; [0154]
(v) an H.sub.1 antagonist having a sedative action, e.g.
diphenhydramine, pyrilamine, promethazine, chlorpheniramine or
chlorcyclizine or a pharmaceutically acceptable salt thereof;
[0155] (vi)a sedative such as glutethimide, meprobamate,
methaqualone or dichloralphenazone or a pharmaceutically acceptable
salt thereof; [0156] (vii)a skeletal muscle relaxant, e.g.
baclofen, carisoprodol, chlorzoxazone, cyclobenzaprine,
methocarbamol or orphrenadine or a pharmaceutically acceptable salt
thereof; [0157] (viii)an NMDA receptor antagonist, e.g.
dextromethorphan ((+)-3-hydroxy-N-methylmorphinan) or its
metabolite dextrorphan ((+)-3-hydroxy-N-methylmorphinan), ketamine,
memantine, pyrroloquinoline quinone or
cis-4-(phosphonomethyl)-2-piperidinecarboxylic acid or a
pharmaceutically acceptable salt thereof; [0158] (ix)an
alpha-adrenergic, e.g. doxazosin, tamsulosin, clonidine or
4-amino-6,7-dimethoxy-2-(5-methanesulfonamido-1,2,3,4-tetrahydroisoquino1-
-2-yl)-5-(2-pyridyl) quinazoline; [0159] (x) a tricyclic
antidepressant, e.g. desipramine, imipramine, amytriptiline or
nortriptiline; [0160] (xi)an anticonvulsant, e.g. carbamazepine or
valproate, [0161] (xii)a tachykinin (NK) antagonist, particularly
an NK-3, NK-2 or NK-1 antagonist, e.g.
(.alpha.R,9R)-7-[3,5-bis(trifluoromethyl)benzyl]-8,9,10,11-tetrahydro-9-m-
ethyl-5-(4-methylphenyl)-7H-[1,4]diazocino[2,1-g][1,7]naphthridine-6-13-di-
one (TAK-637),
5-[[(2R,3S)-2-[(1R)-1-[3,5-bis(trifluoromethyl)phenyl]ethoxy-3-(4-fluorop-
henyl)-4-morpholinyl]methyl]-1,2-dihydro-3H-1,2,4-triazol-3-one
(MK-869), lanepitant, dapitant or
3[[2-methoxy-5-(trifluoromethoxy)phenyl]methylamino]-2-phenyl-piperidine
(2S,3S); [0162] (xiii)a muscarinic antagonist, e.g oxybutin,
tolterodine, propiverine, tropsium chloride or darifenacin; [0163]
(xiv)a COX-2 inhibitor, e.g. celecoxib, rofecoxib or valdecoxib;
[0164] (xv)a non-selective COX inhibitor (preferably with GI
protection), e.g. nitroflurbiprofen (HOT-1026), [0165] (xvi)a
coal-tar analgesic, in particular paracetamol; [0166] (xvii)a
neuroleptic such as droperidol; [0167] (xviii)a vanilloid receptor
agonist (e.g. resinferatoxin) or antagonist (e.g. capsazepine);
[0168] (xix) a beta-adrenergic such as propranolol; [0169] (xx) a
local anaesthetic, such as mexiletine; [0170] (xxi) a
corticosteriod, such as dexamethasone; [0171] (xxii) a serotonin
receptor agonist or antagonist; [0172] (xxiii) a cholinergic
(nicotinic) analgesic; [0173] (xxiv) Tramadol (trade mark); [0174]
(xxv) a PDEV inhibitor, such as sildenafil, vardenafil or
taladafil; [0175] (xxvi) an alpha-2-delta ligand such as gabapentin
or pregabalin; [0176] (xxvii) a canabinoid; and [0177] (xxviii) an
antidepressant, such as amitriptyline (Elavil), trazodone
(Desyrel), and imipramine (Tofranil) or anticonvulsants such as
phenytoin (Dilantin) or carbamazepine (Tegretol).
[0178] According to a further aspect of the present invention there
is provided a pharmaceutical composition for the prevention and/or
treatment of inflammatory pain and/or symptoms of inflammatory pain
or for ameliorating, controlling, reducing incidence of, or
delaying the development or progression of inflammatory pain and/or
symptoms of inflammatory pain in an individual, comprising an
anti-CGRP antagonist antibody and a pharmaceutically acceptable
carrier and/or an excipient, wherein the composition is prepared to
be peripherally administered.
[0179] According to a further aspect of the present invention there
is provided a kit comprising: [0180] (a) a pharmaceutical
composition as defined above; and [0181] (b) instructions for the
peripheral administration of an effective amount of said
pharmaceutical composition to an individual for the prevention
and/or treatment of inflammatory pain and/or symptoms of
inflammatory pain or for ameliorating, controlling, reducing
incidence of, or delaying the development or progression of
inflammatory pain and/or symptoms of inflammatory pain.
[0182] The kit may include one or more containers containing an
anti-CGRP antagonist antibody or polypeptide described herein and
instructions for use in accordance with any of the methods and uses
of the invention. The kit may further comprise a description of
selecting an individual suitable for treatment based on identifying
whether that individual has inflammatory pain or is at risk of
having inflammatory pain. The instructions for the peripheral
administration of the pharmaceutical composition may include
information as to dosage, dosing schedule and routes of
administration for the intended treatment.
[0183] Preferred features of each aspect of the invention apply
equally to each other aspect mutatis mutandis.
EXAMPLES
[0184] The present invention is now described with reference to the
following Examples which are intended to illustrate but not to
limit the invention.
[0185] The following examples and figures are made with reference
to antibody G1, an anti-human CGRP human monoclonal antibody; and
to antibody G2, an anti-rat CGRP mouse monoclonal antibody (Wong H
C et al. Hybridoma 12:93-106 (1993)).
Example 1
Osteoarthritis (OA) Mechanistic Pain Models (Transection of the
Medial Meniscus (MMT))
[0186] Transection of the medial meniscus (MMT) in one hind knee of
the rat results in the development of cartilage lesions and other
changes in the joint similar to those that occur in OA. The
resulting joint pain leads to the development of sustained changes
in weight bearing (assessed using an incapacitance meter) in the
rat hind limbs and mechanical (tactile) allodynia (assessed using
von Frey filaments), in the hind paw, lasting several weeks.
Studies were carried out accordingly to a blind protocol, where the
investigator was not aware of the identity of the compound/control
or the treatment of the animal.
[0187] Antibody G2 (an anti-CGRP monoclonal antibody) reversed
weight bearing deficit of the OA hind limb at the highest dose
tested, 10 mg/kg, IV. Its effect was comparable to celecoxib. Both
compounds reversed the shift in weight bearing on the OA limb to
normal value. No effect was seen with the lower dose. This effect
lasted 10 days post administration when the plasma exposure of
antibody G2 achieved an average value of 65.1.+-.3 ug/ml
(6.3.+-.0.3 ug/ml, for the lower dose at 10 days post IV).
[0188] The negative control, null antibody, i.e. does not bind
CGRP,(see FIG. 1), demonstrated an effect on weight bearing at the
early time points. This effect was unexpected and cannot be
explained, but was not sustained and not observed on the allodynia
end points (FIG. 1).
[0189] Repeat experiments under the same conditions using a buffer
as negative control showed no effect on weight bearing for the
negative control and reversed the shift in weight bearing on the OA
limb to normal value for G1.
Example 2
Binding Assay
[0190] A binding assay was performed to measure the IC.sub.50 of
anti-CGRP antibody G2 and G1 in blocking human .alpha.-CGRP from
binding to the CGRP1-receptor in SK-N-MC cells. Dose response
curves were plotted and K.sub.i values were determined using the
equation: K.sub.i=IC.sub.50/(1+([ligand]/K.sub.D); FIG. 2, where
the equilibrium dissociation constant K.sub.D=0.37 nM for human
.alpha.-CGRP to CGRP1-receptor as present in SK-N-MC cells. The
reported IC.sub.50 value (in terms of IgG molecules) was converted
to binding sites so that it could be compared with the affinities
(K.sub.D) determined by Biacore using N-biotinylated human and rat
.alpha.-CGRPs were captured on individual flow cells at low levels
(typically 100 response units) to provide the reaction surfaces,
while an unmodified flow cell served as a reference channel. G1 was
titrated over the chip surface Binding affinities were deduced from
the quotient of the kinetic rate constants
(K.sub.D=k.sub.off/k.sub.on) see Table 1.
TABLE-US-00001 TABLE 1 G2 Mouse Mab 7E9 G1 KD (nM), .alpha.-Hu 17
1.0 0.04 IC50 (nM) .alpha.-Hu 37 2.6 1.2 KD (nM) .alpha.-Rat 1.0 58
1.2
TABLE-US-00002 TABLE 2 N-biotin-CGRP on chip .degree. C. k.sub.on
(1/Ms) k.sub.off (1/s) T.sub.1/2 (h) K.sub.D (nM) .alpha.-human 25
1.86 .times. 10.sup.5 7.80 .times. 10.sup.-5 24.68 0.042
.alpha.-human 37 5.87 .times. 10.sup.5 3.63 .times. 10.sup.-5 5.30
0.063 .beta.-human 37 4.51 .times. 10.sup.5 6.98 .times. 10.sup.-5
2.76 0.155 .alpha.-rat 25 5.08 .times. 10.sup.4 6.18 .times.
10.sup.-5 3.12 1.22 .alpha.-rat 37 1.55 .times. 10.sup.5 3.99
.times. 10.sup.-4 0.48 2.57 .beta.-rat 37 5.16 .times. 10.sup.5
7.85 .times. 10.sup.-5 2.45 0.152
[0191] Binding affinity of G1 for human .alpha. and .beta. CGRP was
equivalent (Kd=0.155 and 0.152 nM respectively). Binding affinity
of G2 for rat .alpha. and .beta. CGRP was equivalent (16 and 17 nM,
respectively). Additionally G1 binding affinity is 40-fold more
potent in human than rat for .alpha.-CGRP (Kd=0.042 and 1.22 nM,
respectively) and equi-potent in human and rat for .beta.-CGRP
(Kd=0.155 and 0.152 nM, respectively). Antibody G1 also
demonstrated good cross species selectivity and binds rat
.alpha.-CGRP with the same affinity as antibody G2 (around 1.2 nM)
Table 2.
[0192] G1 binds human and cynomolgus monkey .alpha.- and
.beta.-CGRP with high affinity (K.sub.D=63 and 155 pM,
respectively). G1 displays species selectivity for human/cyno CGRP
and binds .alpha.- and .beta.-CGRP from other species e.g. rat with
lower affinity (K.sub.D=2.57 nM and 152 pM, respectively).
Example 3
Half Life of Anti-CGRP In-Vivo
[0193] Serum measurements of anti-CGRP in rat, FIG. 3, indicate
that the half life is of the order of 7 days. The antibody is
peripherally restricted having a molecular weight of around
150,000, FIGS. 3a, 3b, i.e. it does not cross into the central
nervous system or cross the blood brain barrier.
Example 4
Selectivity of Anti-CGRP Antibody
[0194] We determined the specificity of antibody G1 to human or rat
CGRP by using the Biacore chip to "probe" the free concentration of
a premixed complex of mAb+peptide. As expected when we
pre-incubated antibody G1 with human or rat CGRP the response was
fully blocked. In contrast pre-incubating G1, with an excess of
amylin, calcitonin or adrenomedullin was comparable to the control
response (G1 plus buffer) demonstrating that G1 did not form a
complex with these peptides (FIG. 5).
Example 5
Identification of Antibody GI Binding Epitope
[0195] Interaction analysis was conducted at 25.degree. C. on a
Biacore 3000.TM. system equipped with streptavidin-coated (SA)
sensor chips (Biacore AB, Uppsala, Sweden) using a standard Biacore
running buffer (HBS-P). First we confirmed that an N-biotinylated
25-37 human .alpha.-CGRP fragment bound with the same affinity to
antibody G1, as full-length N-biotinylated human .alpha.-CGRP. Each
amino acid between position 27-37 was then mutated individually to
alanine and expressed the fold loss in affinity compared to the
wild-type fragment. N-biotinylated fragments were captured on
individual flow cells at low levels (typically 100 response units)
to provide the reaction surfaces, while an unmodified flow cell
served as a reference channel. Purified Fab fragments of antibody
G1 were generated. Fab fragments were titrated over the chip using
1 .mu.M as the top concentration of a two-fold dilution series.
Association and dissociation phases were monitored at 100 .mu.l/min
for 1 minute and 5 minutes respectively. Surfaces were regenerated
with a mixture of 35% ethanol+25 mM NaOH+0.5 M NaCl.
[0196] The alanine scan results show that antibody G1 binds to the
C-terminal region of human .alpha.-CGRP, particularly residues 25
to 37, and shows specific binding to a region (i.e. loss of
affinity is markedly increased when the specific binding region is
mutated) which can be defined as the epitope and which lies within
the last 5 C-terminal amino acids, i.e. from G33A to F37A. Most
profound changes in affinity are caused through the G33A and F37A
mutation (FIG. 4). C-terminal Phe is important for selectivity of
antibody G1 for CGRP vs related peptides and gene family members
(FIG. 6).
[0197] Thus, in one embodiment, the present invention provides an
anti-CGRP antagonist antibody which specifically binds to an
epitope defined by amino acids G33 to F37 of CGRP. The anti-CGRP
antagonist antibody may specifically bind to the epitope defined by
the amino acid sequence GSKAF, more specifically to the epitope of
CGRP is defined as GXXXF where X can be any amino acid, the G33 and
F37 being the most important residues of the epitope for defining
high affinity binding of the anti-CGRP antagonist antibody.
Example 6
Analysis of Indicators of Physical or Psychological Dependence
[0198] Neither antibody G1 nor antibody G2 demonstrate CNS
penetration. Additionally long term observation of animals (rats)
dosed with either antibody to levels used in the previous examples
did not reveal adverse CNS events such as sedation or
stimulation/euphoric behaviour in comparison to control animals.
These observations indicate an absence of dependency risk for the
antibodies and hence a significantly improved safety of the
antibodies over current opiates used in current pain therapies.
Example 7
Analysis of Indicators of Gastro-Intestinal Adverse Effects
[0199] A 1 month in-vivo rat study with antibody G2 and 1 week
comparative study with antibody G1 demonstrated that no adverse
gastro intestinal effects were observed on behaviour, food intake,
stool production or histopathology in comparison to control
animals. These observations indicate an absence of gastrointestinal
risk for the antibodies and hence a significantly improved safety
of the antibodies over current NSAIDs used in current pain
therapies.
Example 8
G1 and G2 as Anti-CGRP Antagonist Antibodies
[0200] A known consequence of CGRP biological activity is the
generation neurogenic flare when delivered in vivo. G1 and G2 are
demonstrated to be anti-CGRP antagonist antibodies in that they
prevent the development of neurogenic flare in vivo.
[0201] Using a neurogenic skin flare rat model the efficacy of G1
was tested for its ability to block CGRP effect in vivo. The
saphenous nerve in the rat is electrically stimulated causing CGRP
release from nerve endings and leading to vasodilation, the
resulting changes in blood flow can be measured using laser Dopler
methods.
[0202] Changes in blood flow parameters were expressed as the area
under the curve (AUC, change in arbitrary Doppler flux units
multiplied by time). CGRP receptor antagonist CGRP.sub.8-37 (400
nmol/kg, i.v.) was used as a positive control to validate the
specificity of the model (data not shown). To determine the effect
of G1 prior to dosing for each animal, the baseline blood flow
response to stimulation was established with two saphenous nerve
stimulations each 30 minutes apart. Rats were treated with G1 after
the blood flow response of the second stimulation had returned to
baseline levels (approximately 10 minutes post stimulation) and an
additional four stimulations at 30 minute intervals were
performed.
[0203] Results (FIG. 7) demonstrated that in vehicle treated
animals no significant change in blood flow response was but rats
treated with G1 showed a significant decrease in blood flow
response starting at 90 and 120 minutes post dose for 10 mg/kg and
1 mg/kg, respectively. Similar activity was achieved using D2.
Additionally in further neurogenic flare and vasodilatation model
tests G1 showed marked effect at 7 days post IV dosing (predicted
ED.sub.50=6 ug/ml in saphenous nerve stimulation model). The
conclusions form the tests done is that G1 and G2 demonstrate
anti-CGRP antagonist activity. Similar CGRP function-blocking
ability for the antibodies is also shown in the publication, Zeller
J, et. al. Br J Pharmacol. 2008 Dec; 155(7): 1093-103. Epub 2008
Sep 8.
[0204] Below are given antibody sequences useful for practising the
present invention.
[0205] Antibody Sequences
TABLE-US-00003 Antibody G1 heavy chain variable region amino acid
sequence (SEQ ID NO: 1)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWISWVRQAPGKGLEWVAEIRSESDA
SATHYAEAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCLAYFDYGLAIQNYWGQG TLVTVSS
Antibody G1 light chain variable region amino acid sequence (SEQ ID
NO: 2) EIVLTQSPATLSLSPGERATLSCKASKRVTTYVSWYQQKPGQAPRLLIYGASNRYLGIP
ARFSGSGSGTDFTLTISSLEPEDFAVYYCSQSYNYPYTFGQGTKLEIK Antibody G1 CDR H1
(extended CDR) (SEQ ID NO: 3) GFTFSNYWIS Antibody G1 CDR H2
(extended CDR) (SEQ ID NO: 4) EIRSESDASATHYAEAVKG Antibody G1 CDR
H3 (SEQ ID NO: 5) YFDYGLAIQNY Antibody G1 CDR L1 (SEQ ID NO: 6)
KASKRVTTYVS Antibody G1 CDR L2 (SEQ ID NO: 7) GASNRYL Antibody G1
CDR L3 (SEQ ID NO: 8) SQSYNYPYT Antibody G1 heavy chain variable
region nucleotide sequence (SEQ ID NO: 9)
GAAGTTCAGCTGGTTGAATCCGGTGGTGGTCTGGTTCAGCCAGGTGGTTCCCTGC
GTCTGTCCTGCGCTGCTTCCGGTTTCACCTTCTCCAACTACTGGATCTCCTGGGTT
CGTCAGGCTCCTGGTAAAGGTCTGGAATGGGTTGCTGAAATCCGTTCCGAATCCGA
CGCGTCCGCTACCCATTACGCTGAAGCTGTTAAAGGTCGTTTCACCATCTCCCGTG
ACAACGCTAAGAACTCCCTGTACCTGCAGATGAACTCCCTGCGTGCTGAAGACACC
GCTGTTTACTACTGCCTGGCTTACTTTGACTACGGTCTGGCTATCCAGAACTACTGG
GGTCAGGGTACCCTGGTTACCGTTTCCTCC Antibody G1 light chain variable
region nucleotide sequence (SEQ ID NO: 10)
GAAATCGTTCTGACCCAGTCCCCGGCTACCCTGTCCCTGTCCCCAGGTGAACGTGCT
ACCCTGTCCTGCAAAGCTTCCAAACGGGTTACCACCTACGTTTCCTGGTACCAGCAGA
AACCCGGTCAGGCTCCTCGTCTGCTGATCTACGGTGCTTCCAACCGTTACCTCGGTAT
CCCAGCTCGTTTCTCCGGTTCCGGTTCCGGTACCGACTTCACCCTGACCATCTCCTCC
CTGGAACCCGAAGACTTCGCTGTTTACTACTGCAGTCAGTCCTACAACTACCCCTACA
CCTTCGGTCAGGGTACCAAACTGGAAATCAAA Antibody G1 heavy chain full
antibody amino acid sequence (including modified IgG2 as described
herein) (SEQ ID NO: 11)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWISWVRQAPGKGLEWVAEIRSESDA
SATHYAEAVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCLAYFDYGLAIQNYWGQG
TLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVH
TFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPC
PAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK
TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREP
QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Antibody G1 light chain
full antibody amino acid sequence (SEQ ID NO: 12)
EIVLTQSPATLSLSPGERATLSCKASKRVTTYVSWYQQKPGQAPRLLIYGASNRYLGIP
ARFSGSGSGTDFTLTISSLEPEDFAVYYCSQSYNYPYTFGQGTKLEIKRTVAAPSVFIF
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Antibody G1 heavy chain
full antibody nucleotide sequence (including modified IgG2 as
described herein) (SEQ ID NO: 13)
GAAGTTCAGCTGGTTGAATCCGGTGGTGGTCTGGTTCAGCCAGGTGGTTCCCTGC
GTCTGTCCTGCGCTGCTTCCGGTTTCACCTTCTCCAACTACTGGATCTCCTGGGTT
CGTCAGGCTCCTGGTAAAGGTCTGGAATGGGTTGCTGAAATCCGTTCCGAATCCGA
CGCGTCCGCTACCCATTACGCTGAAGCTGTTAAAGGTCGTTTCACCATCTCCCGTG
ACAACGCTAAGAACTCCCTGTACCTGCAGATGAACTCCCTGCGTGCTGAAGACACC
GCTGTTTACTACTGCCTGGCTTACTTTGACTACGGTCTGGCTATCCAGAACTACTG
GGGTCAGGGTACCCTGGTTACCGTTTCCTCCGCCTCCACCAAGGGCCCATCTGTC
TTCCCACTGGCCCCATGCTCCCGCAGCACCTCCGAGAGCACAGCCGCCCTGGGCT
GCCTGGTCAAGGACTACTTCCCAGAACCTGTGACCGTGTCCTGGAACTCTGGCGC
TCTGACCAGCGGCGTGCACACCTTCCCAGCTGTCCTGCAGTCCTCAGGTCTCTACT
CCCTCAGCAGCGTGGTGACCGTGCCATCCAGCAACTTCGGCACCCAGACCTACAC
CTGCAACGTAGATCACAAGCCAAGCAACACCAAGGTCGACAAGACCGTGGAGAGA
AAGTGTTGTGTGGAGTGTCCACCTTGTCCAGCCCCTCCAGTGGCCGGACCATCCG
TGTTCCTGTTCCCTCCAAAGCCAAAGGACACCCTGATGATCTCCAGAACCCCAGAG
GTGACCTGTGTGGTGGTGGACGTGTCCCACGAGGACCCAGAGGTGCAGTTCAACT
GGTATGTGGACGGAGTGGAGGTGCACAACGCCAAGACCAAGCCAAGAGAGGAGC
AGTTCAACTCCACCTTCAGAGTGGTGAGCGTGCTGACCGTGGTGCACCAGGACTG
GCTGAACGGAAAGGAGTATAAGTGTAAGGTGTCCAACAAGGGACTGCCATCCAGC
ATCGAGAAGACCATCTCCAAGACCAAGGGACAGCCAAGAGAGCCACAGGTGTATA
CCCTGCCCCCATCCAGAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCT
GGTGAAGGGATTCTATCCATCCGACATCGCCGTGGAGTGGGAGTCCAACGGACAG
CCAGAGAACAACTATAAGACCACCCCTCCAATGCTGGACTCCGACGGATCCTTCTT
CCTGTATTCCAAGCTGACCGTGGACAAGTCCAGATGGCAGCAGGGAAACGTGTTC
TCTTGTTCCGTGATGCACGAGGCCCTGCACAACCACTATACCCAGAAGAGCCTGTC
CCTGTCTCCAGGAAAGTAA Antibody G1 light chain full antibody
nucleotide sequence (SEQ ID NO: 14)
GAAATCGTTCTGACCCAGTCCCCGGCTACCCTGTCCCTGTCCCCAGGTGAACGTG
CTACCCTGTCCTGCAAAGCTTCCAAACGGGTTACCACCTACGTTTCCTGGTACCAG
CAGAAACCCGGTCAGGCTCCTCGTCTGCTGATCTACGGTGCTTCCAACCGTTACCT
CGGTATCCCAGCTCGTTTCTCCGGTTCCGGTTCCGGTACCGACTTCACCCTGACCA
TCTCCTCCCTGGAACCCGAAGACTTCGCTGTTTACTACTGCAGTCAGTCCTACAAC
TACCCCTACACCTTCGGTCAGGGTACCAAACTGGAAATCAAACGCACTGTGGCTGC
ACCATCTGTCTTCATCTTCCCTCCATCTGATGAGCAGTTGAAATCCGGAACTGCCT
CTGTTGTGTGCCTGCTGAATAACTTCTATCCGCGCGAGGCCAAAGTACAGTGGAAG
GTGGATAACGCCCTCCAATCCGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACA
GCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACCCTGAGCAAAGCAGACTA
CGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGTTCTCCA
GTCACAAAGAGCTTCAACCGCGGTGAGTGCTAA Amino acid sequence comparison of
human and rat CGRP (human .alpha.-CGRP (SEQ ID NO: 15); human
.beta.-CGRP (SEQ ID NO: 16); rat .alpha.-CGRP (SEQ ID NO: 17); and
rat .beta.- CGRP (SEQ ID NO: 18)): ##STR00001## (SEQ ID NO: 15)
##STR00002## (SEQ ID NO: 16) ##STR00003## (SEQ ID NO: 17)
##STR00004## (SEQ ID NO: 18) Antibody G2 heavy chain variable
region amino acid sequence (SEQ ID NO: 19)
EVQLQQSGPELVKPGASVKMSCKASGYTFTSSVMHWVKQKPGQGLEWIGYINPYNDG
TKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCAKGGNDGYWGQGTTLTVSS Antibody
G2 light chain variable region amino acid sequence (SEQ ID NO: 20)
EIVLTQSPTTMAASPGEKITITCSASSSISSIYLHWYQQKPGFSPKVLIYRASNLASGVPA
RFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSTIPFTFGSGTKLEIK Antibody G2 CDR H1
(extended CDR) (SEQ ID NO: 21) SSVMH Antibody G2 CDR H2 (extended
CDR) (SEQ ID NO: 22) YINPYNDGTKYNEKFKG Antibody G2 CDR H3 (SEQ ID
NO:23) GGNDGY Antibody G2 CDR L1 (SEQ ID NO: 24) SASSSISSIYLH
Antibody G2 CDR L2 (SEQ ID NO: 25) RASNLAS Antibody G2 CDR L3 (SEQ
ID NO: 26) QQGSTIPFT Antibody G2 heavy chain variable region
nucleotide sequence (SEQ ID NO: 27)
GAGGTCCAGCTGCAGCAGTCTGGACCTGAGCTGGTAAAGCCTGGGGCTTCAGTGAAG
ATGTCCTGCAAGGCTTCTGGATACACATTCACTAGCTCTGTTATGCACTGGGTGAAGC
AGAAGCCTGGGCAGGGCCTTGAGTGGATTGGATATATTAATCCTTACAATGATGGTAC
TAAGTACAATGAGAAGTTCAAAGGCAAGGCCACACTGACTTCAGACAAATCCTCCAGC
ACAGCCTACATGGAACTCAGCAGCCTGACCTCTGAGGACTCTGCGGTCTATTACTGTG
CAAAAGGGGGTAACGATGGCTACTGGGGCCAAGGCACTACTCTCACAGTCTCCTCA Antibody
G2 light chain variable region nucleotide sequence (SEQ ID NO: 28)
GAAATTGTGCTCACCCAGTCTCCAACCACCATGGCTGCATCTCCCGGGGAGAAGATCA
CTATCACCTGTAGTGCCAGCTCAAGTATAAGTTCCATTTACTTGCATTGGTATCAGCAG
AAGCCAGGATTCTCCCCTAAAGTCTTGATTTATAGGGCATCCAATCTGGCTTCTGGAGT
CCCAGCTCGCTTCAGTGGCAGTGGGTCTGGGACCTCTTACTCTCTCACAATTGGCACC
ATGGAGGCTGAAGATGTTGCCACTTACTACTGCCAGCAGGGTAGTACTATACCATTCA
CGTTCGGCTCGGGGACAAAGTTGGAAATAAAA Antibody G2 heavy chain full
antibody amino acid sequence (not including Fc domain) (SEQ ID NO:
29) EVQLQQSGPELVKPGASVKMSCKASGYTFTSSVMHWVKQKPGQGLEWIGYINPYNDGTK
YNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCAKGGNDGYWGQGTTLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD Antibody G2 light chain full
antibody amino acid sequence (SEQ ID NO: 30)
EIVLTQSPTTMAASPGEKITITCSASSSISSIYLHWYQQKPGFSPKVLIYRASNLASGVPARF
SGSGSGTSYSLTIGTMEAEDVATYYCQQGSTIPFTFGSGTKLEIKRADAAPTVSIFPPSSEQ
LTSGGASWCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKD
EYERHNSYTCEATHKTSTSPIVKSFNRNEC Antibody G2 heavy chain full
antibody nucleotide sequence (not includinq Fc domain) (SEQ ID NO:
31) GAGGTCCAGCTGCAGCAGTCTGGACCTGAGCTGGTAAAGCCTGGGGCTTCAGTGAAG
ATGTCCTGCAAGGCTTCTGGATACACATTCACTAGCTCTGTTATGCACTGGGTGAAGC
AGAAGCCTGGGCAGGGCCTTGAGTGGATTGGATATATTAATCCTTACAATGATGGTAC
TAAGTACAATGAGAAGTTCAAAGGCAAGGCCACACTGACTTCAGACAAATCCTCCAGC
ACAGCCTACATGGAACTCAGCAGCCTGACCTCTGAGGACTCTGCGGTCTATTACTGTG
CAAAAGGGGGTAACGATGGCTACTGGGGCCAAGGCACTACTCTCACAGTCTCCTCAG
CCAAAACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAA
CTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGT
GACCTGGAACTCTGGATCCCTGTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCA
GTCTGACCTCTACACTCTGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAG
CGAGACCGTCACCTGCAACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGACAAGAA
AATTGTGCCCAGGGAT Antibody G2 liqht chain full antibody nucleotide
sequence (SEQ ID NO: 32)
GAAATTGTGCTCACCCAGTCTCCAACCACCATGGCTGCATCTCCCGGGGAGAAGA
TCACTATCACCTGTAGTGCCAGCTCAAGTATAAGTTCCATTTACTTGCATTGGTATC
AGCAGAAGCCAGGATTCTCCCCTAAAGTCTTGATTTATAGGGCATCCAATCTGGCT
TCTGGAGTCCCAGCTCGCTTCAGTGGCAGTGGGTCTGGGACCTCTTACTCTCTCA
CAATTGGCACCATGGAGGCTGAAGATGTTGCCACTTACTACTGCCAGCAGGGTAG
TACTATACCATTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAACGGGCTGATG
CTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGT
GCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAGAGACATCAATGTCAAGTG
GAAGATTGATGGCAGTGAACGACAAAATGGTGTCCTGAACAGTTGGACTGATCAG
GACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACATTGACCAAGGACG
AGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCA
CCCATCGTCAAGAGCTTCAACAGGAATGAGTGTTAA
Sequence CWU 1
1
321122PRTArtificial sequenceSynthetic polypeptide, Antibody G1
heavy chain variable region 1Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Trp Ile Ser Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Glu Ile
Arg Ser Glu Ser Asp Ala Ser Ala Thr His Tyr Ala Glu 50 55 60 Ala
Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser 65 70
75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr 85 90 95 Tyr Cys Leu Ala Tyr Phe Asp Tyr Gly Leu Ala Ile Gln
Asn Tyr Trp 100 105 110 Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115
120 2107PRTArtificial sequenceSynthetic polypeptide, Antibody G1
light chain variable region 2Glu Ile Val Leu Thr Gln Ser Pro Ala
Thr Leu Ser Leu Ser Pro Gly 1 5 10 15 Glu Arg Ala Thr Leu Ser Cys
Lys Ala Ser Lys Arg Val Thr Thr Tyr 20 25 30 Val Ser Trp Tyr Gln
Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45 Tyr Gly Ala
Ser Asn Arg Tyr Leu Gly Ile Pro Ala Arg Phe Ser Gly 50 55 60 Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro 65 70
75 80 Glu Asp Phe Ala Val Tyr Tyr Cys Ser Gln Ser Tyr Asn Tyr Pro
Tyr 85 90 95 Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys 100 105
310PRTArtificial sequenceSynthetic polypeptide, Antibody G1 CDR H1
3Gly Phe Thr Phe Ser Asn Tyr Trp Ile Ser 1 5 10 419PRTArtificial
sequenceSynthetic polypeptide, Antibody G1 CDR H2 4Glu Ile Arg Ser
Glu Ser Asp Ala Ser Ala Thr His Tyr Ala Glu Ala 1 5 10 15 Val Lys
Gly 511PRTArtificial sequenceSynthetic polypeptide, Antibody G1 CDR
H3 5Tyr Phe Asp Tyr Gly Leu Ala Ile Gln Asn Tyr 1 5 10
611PRTArtificial sequenceSynthetic polypeptide, Antibody G1 CDR L1
6Lys Ala Ser Lys Arg Val Thr Thr Tyr Val Ser 1 5 10 77PRTArtificial
sequenceSynthetic polypeptide, Antibody G1 CDR L2 7Gly Ala Ser Asn
Arg Tyr Leu 1 5 89PRTArtificial sequenceSynthetic polypeptide,
Antibody G1 CDR L3 8Ser Gln Ser Tyr Asn Tyr Pro Tyr Thr 1 5
9366DNAArtificial sequenceSynthetic oligonucleotide, Antibody G1
heavy chain variable region 9gaagttcagc tggttgaatc cggtggtggt
ctggttcagc caggtggttc cctgcgtctg 60tcctgcgctg cttccggttt caccttctcc
aactactgga tctcctgggt tcgtcaggct 120cctggtaaag gtctggaatg
ggttgctgaa atccgttccg aatccgacgc gtccgctacc 180cattacgctg
aagctgttaa aggtcgtttc accatctccc gtgacaacgc taagaactcc
240ctgtacctgc agatgaactc cctgcgtgct gaagacaccg ctgtttacta
ctgcctggct 300tactttgact acggtctggc tatccagaac tactggggtc
agggtaccct ggttaccgtt 360tcctcc 36610321DNAArtificial
sequenceSynthetic oligonucleotide, Antibody G1 light chain variable
region 10gaaatcgttc tgacccagtc cccggctacc ctgtccctgt ccccaggtga
acgtgctacc 60ctgtcctgca aagcttccaa acgggttacc acctacgttt cctggtacca
gcagaaaccc 120ggtcaggctc ctcgtctgct gatctacggt gcttccaacc
gttacctcgg tatcccagct 180cgtttctccg gttccggttc cggtaccgac
ttcaccctga ccatctcctc cctggaaccc 240gaagacttcg ctgtttacta
ctgcagtcag tcctacaact acccctacac cttcggtcag 300ggtaccaaac
tggaaatcaa a 32111448PRTArtificial sequenceSynthetic polypeptide,
Antibody G1 heavy chain 11Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Trp Ile Ser Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Glu Ile Arg
Ser Glu Ser Asp Ala Ser Ala Thr His Tyr Ala Glu 50 55 60 Ala Val
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser 65 70 75 80
Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 85
90 95 Tyr Cys Leu Ala Tyr Phe Asp Tyr Gly Leu Ala Ile Gln Asn Tyr
Trp 100 105 110 Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr
Lys Gly Pro 115 120 125 Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser
Thr Ser Glu Ser Thr 130 135 140 Ala Ala Leu Gly Cys Leu Val Lys Asp
Tyr Phe Pro Glu Pro Val Thr 145 150 155 160 Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser Gly Val His Thr Phe Pro 165 170 175 Ala Val Leu Gln
Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr 180 185 190 Val Pro
Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp 195 200 205
His Lys Pro Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg Lys Cys 210
215 220 Cys Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro
Ser 225 230 235 240 Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg 245 250 255 Thr Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro 260 265 270 Glu Val Gln Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala 275 280 285 Lys Thr Lys Pro Arg Glu
Glu Gln Phe Asn Ser Thr Phe Arg Val Val 290 295 300 Ser Val Leu Thr
Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 305 310 315 320 Lys
Cys Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr 325 330
335 Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
340 345 350 Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys 355 360 365 Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser 370 375 380 Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Met Leu Asp 385 390 395 400 Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415 Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420 425 430 Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440 445
12214PRTArtificial sequenceSynthetic polypeptide, Antibody G1 light
chain 12Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro
Gly 1 5 10 15 Glu Arg Ala Thr Leu Ser Cys Lys Ala Ser Lys Arg Val
Thr Thr Tyr 20 25 30 Val Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala
Pro Arg Leu Leu Ile 35 40 45 Tyr Gly Ala Ser Asn Arg Tyr Leu Gly
Ile Pro Ala Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile Ser Ser Leu Glu Pro 65 70 75 80 Glu Asp Phe Ala Val
Tyr Tyr Cys Ser Gln Ser Tyr Asn Tyr Pro Tyr 85 90 95 Thr Phe Gly
Gln Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro
Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120
125 Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala
130 135 140 Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn
Ser Gln 145 150 155 160 Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser
Thr Tyr Ser Leu Ser 165 170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp
Tyr Glu Lys His Lys Val Tyr 180 185 190 Ala Cys Glu Val Thr His Gln
Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205 Phe Asn Arg Gly Glu
Cys 210 131347DNAArtificial sequenceSynthetic oligonucleotide,
Antibody G1 heavy chain 13gaagttcagc tggttgaatc cggtggtggt
ctggttcagc caggtggttc cctgcgtctg 60tcctgcgctg cttccggttt caccttctcc
aactactgga tctcctgggt tcgtcaggct 120cctggtaaag gtctggaatg
ggttgctgaa atccgttccg aatccgacgc gtccgctacc 180cattacgctg
aagctgttaa aggtcgtttc accatctccc gtgacaacgc taagaactcc
240ctgtacctgc agatgaactc cctgcgtgct gaagacaccg ctgtttacta
ctgcctggct 300tactttgact acggtctggc tatccagaac tactggggtc
agggtaccct ggttaccgtt 360tcctccgcct ccaccaaggg cccatctgtc
ttcccactgg ccccatgctc ccgcagcacc 420tccgagagca cagccgccct
gggctgcctg gtcaaggact acttcccaga acctgtgacc 480gtgtcctgga
actctggcgc tctgaccagc ggcgtgcaca ccttcccagc tgtcctgcag
540tcctcaggtc tctactccct cagcagcgtg gtgaccgtgc catccagcaa
cttcggcacc 600cagacctaca cctgcaacgt agatcacaag ccaagcaaca
ccaaggtcga caagaccgtg 660gagagaaagt gttgtgtgga gtgtccacct
tgtccagccc ctccagtggc cggaccatcc 720gtgttcctgt tccctccaaa
gccaaaggac accctgatga tctccagaac cccagaggtg 780acctgtgtgg
tggtggacgt gtcccacgag gacccagagg tgcagttcaa ctggtatgtg
840gacggagtgg aggtgcacaa cgccaagacc aagccaagag aggagcagtt
caactccacc 900ttcagagtgg tgagcgtgct gaccgtggtg caccaggact
ggctgaacgg aaaggagtat 960aagtgtaagg tgtccaacaa gggactgcca
tccagcatcg agaagaccat ctccaagacc 1020aagggacagc caagagagcc
acaggtgtat accctgcccc catccagaga ggagatgacc 1080aagaaccagg
tgtccctgac ctgtctggtg aagggattct atccatccga catcgccgtg
1140gagtgggagt ccaacggaca gccagagaac aactataaga ccacccctcc
aatgctggac 1200tccgacggat ccttcttcct gtattccaag ctgaccgtgg
acaagtccag atggcagcag 1260ggaaacgtgt tctcttgttc cgtgatgcac
gaggccctgc acaaccacta tacccagaag 1320agcctgtccc tgtctccagg aaagtaa
134714645DNAArtificial sequenceSynthetic oligonucleotide, Antibody
G1 light chain 14gaaatcgttc tgacccagtc cccggctacc ctgtccctgt
ccccaggtga acgtgctacc 60ctgtcctgca aagcttccaa acgggttacc acctacgttt
cctggtacca gcagaaaccc 120ggtcaggctc ctcgtctgct gatctacggt
gcttccaacc gttacctcgg tatcccagct 180cgtttctccg gttccggttc
cggtaccgac ttcaccctga ccatctcctc cctggaaccc 240gaagacttcg
ctgtttacta ctgcagtcag tcctacaact acccctacac cttcggtcag
300ggtaccaaac tggaaatcaa acgcactgtg gctgcaccat ctgtcttcat
cttccctcca 360tctgatgagc agttgaaatc cggaactgcc tctgttgtgt
gcctgctgaa taacttctat 420ccgcgcgagg ccaaagtaca gtggaaggtg
gataacgccc tccaatccgg taactcccag 480gagagtgtca cagagcagga
cagcaaggac agcacctaca gcctcagcag caccctgacc 540ctgagcaaag
cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc
600ctgagttctc cagtcacaaa gagcttcaac cgcggtgagt gctaa 6451537PRTHomo
sapiensPolypeptide, Alpha-CGRP 15Ala Cys Asp Thr Ala Thr Cys Val
Thr His Arg Leu Ala Gly Leu Leu 1 5 10 15 Ser Arg Ser Gly Gly Val
Val Lys Asn Asn Phe Val Pro Thr Asn Val 20 25 30 Gly Ser Lys Ala
Phe 35 1637PRTHomo sapiensPolypeptide, Beta-CGRP 16Ala Cys Asn Thr
Ala Thr Cys Val Thr His Arg Leu Ala Gly Leu Leu 1 5 10 15 Ser Arg
Ser Gly Gly Met Val Lys Ser Asn Phe Val Pro Thr Asn Val 20 25 30
Gly Ser Lys Ala Phe 35 1737PRTRattus norvegicusPolypeptide,
Alpha-CGRP 17Ser Cys Asn Thr Ala Thr Cys Val Thr His Arg Leu Ala
Gly Leu Leu 1 5 10 15 Ser Arg Ser Gly Gly Val Val Lys Asp Asn Phe
Val Pro Thr Asn Val 20 25 30 Gly Ser Glu Ala Phe 35 1837PRTRattus
norvegicusPolypeptide, Beta-CGRP 18Ser Cys Asn Thr Ala Thr Cys Val
Thr His Arg Leu Ala Gly Leu Leu 1 5 10 15 Ser Arg Ser Gly Gly Val
Val Lys Asp Asn Phe Val Pro Thr Asn Val 20 25 30 Gly Ser Lys Ala
Phe 35 19115PRTArtificial sequenceSynthetic polypeptide, Antibody
G2 heavy chain variable region 19Glu Val Gln Leu Gln Gln Ser Gly
Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Thr Ser Ser 20 25 30 Val Met His Trp
Val Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Tyr
Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr Asn Glu Lys Phe 50 55 60
Lys Gly Lys Ala Thr Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr 65
70 75 80 Met Glu Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr
Tyr Cys 85 90 95 Ala Lys Gly Gly Asn Asp Gly Tyr Trp Gly Gln Gly
Thr Thr Leu Thr 100 105 110 Val Ser Ser 115 20108PRTArtificial
sequenceSynthetic polypeptide, Antibody G2 light chain variable
region 20Glu Ile Val Leu Thr Gln Ser Pro Thr Thr Met Ala Ala Ser
Pro Gly 1 5 10 15 Glu Lys Ile Thr Ile Thr Cys Ser Ala Ser Ser Ser
Ile Ser Ser Ile 20 25 30 Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly
Phe Ser Pro Lys Val Leu 35 40 45 Ile Tyr Arg Ala Ser Asn Leu Ala
Ser Gly Val Pro Ala Arg Phe Ser 50 55 60 Gly Ser Gly Ser Gly Thr
Ser Tyr Ser Leu Thr Ile Gly Thr Met Glu 65 70 75 80 Ala Glu Asp Val
Ala Thr Tyr Tyr Cys Gln Gln Gly Ser Thr Ile Pro 85 90 95 Phe Thr
Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys 100 105 215PRTArtificial
sequenceSynthetic polypeptide, Antibody G2 CDR H1 21Ser Ser Val Met
His 1 5 2217PRTArtificial sequenceSynthetic polypeptide, Antibody
G2 CDR H2 22Tyr Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr Asn Glu Lys
Phe Lys 1 5 10 15 Gly 236PRTArtificial sequenceSynthetic
polypeptide, Antibody G2 CDR H3 23Gly Gly Asn Asp Gly Tyr 1 5
2412PRTArtificial sequenceSynthetic polypeptide, Antibody G2 CDR L1
24Ser Ala Ser Ser Ser Ile Ser Ser Ile Tyr Leu His 1 5 10
257PRTArtificial sequenceSynthetic polypeptide, Antibody G2 CDR L2
25Arg Ala Ser Asn Leu Ala Ser 1 5 269PRTArtificial
sequenceSynthetic polypeptide, Antibody G2 CDR L3 26Gln Gln Gly Ser
Thr Ile Pro Phe Thr 1 5 27345DNAArtificial sequenceSynthetic
oligonucleotide, Antibody G2 heavy chain variable region
27gaggtccagc tgcagcagtc tggacctgag ctggtaaagc ctggggcttc agtgaagatg
60tcctgcaagg cttctggata cacattcact agctctgtta tgcactgggt gaagcagaag
120cctgggcagg gccttgagtg gattggatat attaatcctt acaatgatgg
tactaagtac 180aatgagaagt tcaaaggcaa ggccacactg acttcagaca
aatcctccag cacagcctac 240atggaactca gcagcctgac ctctgaggac
tctgcggtct attactgtgc aaaagggggt 300aacgatggct actggggcca
aggcactact ctcacagtct cctca 34528324DNAArtificial sequenceSynthetic
oligonucleotide, Antibody G2 light chain variable region
28gaaattgtgc tcacccagtc tccaaccacc atggctgcat ctcccgggga gaagatcact
60atcacctgta gtgccagctc aagtataagt tccatttact tgcattggta tcagcagaag
120ccaggattct cccctaaagt cttgatttat agggcatcca atctggcttc
tggagtccca 180gctcgcttca gtggcagtgg gtctgggacc tcttactctc
tcacaattgg caccatggag 240gctgaagatg ttgccactta ctactgccag
cagggtagta ctataccatt cacgttcggc 300tcggggacaa agttggaaat aaaa
32429216PRTArtificial sequenceSynthetic polypeptide, Antibody G2
heavy chain 29Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys
Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Ser 20 25 30 Val Met His Trp Val Lys Gln Lys Pro
Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Asn Pro Tyr Asn
Asp Gly Thr Lys Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys Ala Thr
Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75
80 Met Glu Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys
85 90 95 Ala Lys Gly Gly Asn Asp Gly Tyr Trp Gly Gln Gly Thr Thr
Leu Thr 100 105 110 Val Ser Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr
Pro Leu Ala Pro 115 120 125 Gly Ser Ala Ala Gln Thr Asn Ser Met Val
Thr Leu Gly Cys Leu Val 130 135 140 Lys Gly Tyr Phe Pro Glu Pro Val
Thr Val Thr Trp Asn Ser Gly Ser 145 150 155 160 Leu Ser Ser Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Asp Leu 165 170 175 Tyr Thr Leu
Ser Ser Ser Val Thr Val Pro Ser Ser Thr Trp Pro Ser 180 185 190 Glu
Thr Val Thr Cys Asn Val Ala His Pro Ala Ser Ser Thr Lys Val 195 200
205 Asp Lys Lys Ile Val Pro Arg Asp 210 215 30215PRTArtificial
sequenceSynthetic polypeptide, Antibody G2 light chain 30Glu Ile
Val Leu Thr Gln Ser Pro Thr Thr Met Ala Ala Ser Pro Gly 1 5 10 15
Glu Lys Ile Thr Ile Thr Cys Ser Ala Ser Ser Ser Ile Ser Ser Ile 20
25 30 Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Phe Ser Pro Lys Val
Leu 35 40 45 Ile Tyr Arg Ala Ser Asn Leu Ala Ser Gly Val Pro Ala
Arg Phe Ser 50 55 60 Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr
Ile Gly Thr Met Glu 65 70 75 80 Ala Glu Asp Val Ala Thr Tyr Tyr Cys
Gln Gln Gly Ser Thr Ile Pro 85 90 95 Phe Thr Phe Gly Ser Gly Thr
Lys Leu Glu Ile Lys Arg Ala Asp Ala 100 105 110 Ala Pro Thr Val Ser
Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser 115 120 125 Gly Gly Ala
Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Arg Asp 130 135 140 Ile
Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val 145 150
155 160 Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser
Met 165 170 175 Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg
His Asn Ser 180 185 190 Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr
Ser Pro Ile Val Lys 195 200 205 Ser Phe Asn Arg Asn Glu Cys 210 215
31648DNAArtificial sequenceSynthetic oligonucleotide, Antibody G2
heavy chain 31gaggtccagc tgcagcagtc tggacctgag ctggtaaagc
ctggggcttc agtgaagatg 60tcctgcaagg cttctggata cacattcact agctctgtta
tgcactgggt gaagcagaag 120cctgggcagg gccttgagtg gattggatat
attaatcctt acaatgatgg tactaagtac 180aatgagaagt tcaaaggcaa
ggccacactg acttcagaca aatcctccag cacagcctac 240atggaactca
gcagcctgac ctctgaggac tctgcggtct attactgtgc aaaagggggt
300aacgatggct actggggcca aggcactact ctcacagtct cctcagccaa
aacgacaccc 360ccatctgtct atccactggc ccctggatct gctgcccaaa
ctaactccat ggtgaccctg 420ggatgcctgg tcaagggcta tttccctgag
ccagtgacag tgacctggaa ctctggatcc 480ctgtccagcg gtgtgcacac
cttcccagct gtcctgcagt ctgacctcta cactctgagc 540agctcagtga
ctgtcccctc cagcacctgg cccagcgaga ccgtcacctg caacgttgcc
600cacccggcca gcagcaccaa ggtggacaag aaaattgtgc ccagggat
64832648DNAArtificial sequenceSynthetic oligonucleotide, Antibody
G2 light chain 32gaaattgtgc tcacccagtc tccaaccacc atggctgcat
ctcccgggga gaagatcact 60atcacctgta gtgccagctc aagtataagt tccatttact
tgcattggta tcagcagaag 120ccaggattct cccctaaagt cttgatttat
agggcatcca atctggcttc tggagtccca 180gctcgcttca gtggcagtgg
gtctgggacc tcttactctc tcacaattgg caccatggag 240gctgaagatg
ttgccactta ctactgccag cagggtagta ctataccatt cacgttcggc
300tcggggacaa agttggaaat aaaacgggct gatgctgcac caactgtatc
catcttccca 360ccatccagtg agcagttaac atctggaggt gcctcagtcg
tgtgcttctt gaacaacttc 420taccccagag acatcaatgt caagtggaag
attgatggca gtgaacgaca aaatggtgtc 480ctgaacagtt ggactgatca
ggacagcaaa gacagcacct acagcatgag cagcaccctc 540acattgacca
aggacgagta tgaacgacat aacagctata cctgtgaggc cactcacaag
600acatcaactt cacccatcgt caagagcttc aacaggaatg agtgttaa 648
* * * * *