U.S. patent application number 15/294058 was filed with the patent office on 2017-02-02 for antigen binding constructs.
The applicant listed for this patent is Glaxo Group Limited. Invention is credited to Claire ASHMAN, Ian Richard Catchpole, Zoe Hughes-Thomas, Alan Peter Lewis, Michael Steward.
Application Number | 20170029494 15/294058 |
Document ID | / |
Family ID | 46579044 |
Filed Date | 2017-02-02 |
United States Patent
Application |
20170029494 |
Kind Code |
A1 |
ASHMAN; Claire ; et
al. |
February 2, 2017 |
Antigen Binding Constructs
Abstract
The present invention is directed to antigen binding constructs
comprising one or two epitope binding domains separated by a single
chain Fc region of an antibody, wherein each epitope binding domain
in capable of binding to VEGF, to dimers comprising two antigen
binding constructs of the invention, pharmaceutical compositions
comprising said dimers and their use in the treatment of diseases
associated with VEGF signalling, such as diabetic macular edema
(DME), wet age-related macular degeneration (Wet AMD), diabetic
retinopathy, retinal vein occlusion (RVO), and corneal
neovascularisation, and polynucleotide sequences encoding said
antigen binding constructs.
Inventors: |
ASHMAN; Claire; (Stevenage,
GB) ; Catchpole; Ian Richard; (Stevenage, GB)
; Hughes-Thomas; Zoe; (Stevenage, GB) ; Lewis;
Alan Peter; (Stevenage, GB) ; Steward; Michael;
(Stevenage, GB) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Glaxo Group Limited |
Brentford |
|
GB |
|
|
Family ID: |
46579044 |
Appl. No.: |
15/294058 |
Filed: |
October 14, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14235330 |
Jan 27, 2014 |
9499612 |
|
|
PCT/EP2012/064632 |
Jul 25, 2012 |
|
|
|
15294058 |
|
|
|
|
61512138 |
Jul 27, 2011 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 27/02 20180101;
A61P 3/10 20180101; C07K 16/46 20130101; C07K 2317/569 20130101;
C07K 2317/60 20130101; C07K 2317/92 20130101; C07K 16/22 20130101;
C07K 2317/52 20130101; A61K 2039/505 20130101; C07K 2317/33
20130101; A61K 2039/70 20130101; A61K 2039/54 20130101; C07K
2317/35 20130101; C07K 2317/31 20130101; A61P 35/00 20180101; C07K
2317/76 20130101; C07K 2317/565 20130101; C07K 2319/00 20130101;
C07K 2317/64 20130101 |
International
Class: |
C07K 16/22 20060101
C07K016/22; C07K 16/46 20060101 C07K016/46 |
Claims
1.-25. (canceled)
26. An immunoglobulin single variable domain capable of binding to
VEGF, wherein the immunoglobulin single variable domain comprises
CDR sequences selected from the group consisting of: SEQ ID NOs:
117-119; SEQ ID NOs: 120-122; SEQ ID NOs: 123-125; SEQ ID NOs:
126-128; and SEQ ID NOs: 129-131.
27. An immunoglobulin single variable domain according to claim 26,
wherein the immunoglobulin single variable domain comprises a
sequence selected from the group consisting of: SEQ ID NO: 105, SEQ
ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, and SEQ ID NO: 109.
28. An antigen binding construct comprising an immunoglobulin
single variable domain attached to the N-terminus or the C-terminus
of a single heavy chain constant region of an IgG or IgA antibody
comprising one or more CH1, CH2, and CH3 constant region antibody
domains, wherein the immunoglobulin single variable domain is
capable of binding to VEGF and comprises CDR sequences selected
from the group consisting of: SEQ ID NOs: 117-119; SEQ ID NOs:
120-122; SEQ ID NOs: 123-125; SEQ ID NOs: 126-128; and SEQ ID NOs:
129-131.
29. An antigen binding construct according to claim 28, wherein the
immunoglobulin single variable domain comprises a sequence selected
from the group consisting of: SEQ ID NO: 105, SEQ ID NO: 106, SEQ
ID NO: 107, SEQ ID NO: 108, and SEQ ID NO: 109.
30. An antigen binding construct according to claim 29, wherein the
immunoglobulin single variable domains comprises: a C-terminal
sequence consisting of the sequence VTVS(S)nX as shown in SEQ ID
NO: 219 for a VH immunoglobulin single variable domain or
VEI(K)p(R)qX as shown in SEQ ID NO: 220 for a VL immunoglobulin
single variable domain; wherein: n represents an integer
independently selected from 0 or 1; p and q each represent 0 or 1
such that when p represents 1 q may be 0 or 1 and such that when p
represents 0, q also represents 0; X may be present or absent, and
if present represents an amino acid extension of 1 to 8 amino acid
residues.
31. An antigen binding construct according to claim 30, wherein for
a VL immunoglobulin single variable domain the C-terminal sequence
is VEI(K)p(R)qX as shown in SEQ ID NO: 220 and p is 1, q is 1 and X
is A, AAA or T.
32. An antigen binding construct according to claim 28, wherein the
single heavy chain constant region comprises a sequence selected
from the group consisting of SEQ ID NOs: 83, 84, and 110.
33. An antigen binding construct according to claim 28, wherein the
immunoglobulin single variable domain is attached to the single
heavy chain constant region through a linker.
34. An antigen binding construct according to claim 33, wherein the
linker through which the immunoglobulin single variable domain
attaches to the N-terminus of the single heavy chain constant
region comprises a sequence selected from the group consisting of
SEQ ID NOs: 76-82.
35. An antigen binding construct according to claim 33, wherein the
linker through which the immunoglobulin single variable domain
attaches to the C-terminus of the single heavy chain constant
region comprises a sequence selected from the group consisting of
SEQ ID NOs: 85-94.
36. An antigen binding construct according to claim 28, wherein the
immunoglobulin single variable domain comprises the amino acid
sequence shown in SEQ ID NO: 105.
37. An antigen binding construct according to claim 28, wherein the
antigen binding construct comprises a sequence selected from the
group consisting of: SEQ ID NO: 162, SEQ ID NO: 163, SEQ ID NO:
171, SEQ ID NO: 172, SEQ ID NO: 173, SEQ ID NO: 174. SEQ ID NO:
175, and SEQ ID NO: 176.
38. A dimer comprising two antigen binding constructs according to
claim 28, wherein said dimer is a heterodimer or homodimer.
39. An antigen binding construct comprising two immunoglobulin
single variable domains separated by a single heavy chain constant
region of an IgG or IgA antibody comprising one or more CH1, CH2,
and CH3 constant region antibody domains, wherein each
immunoglobulin single variable domain is capable of binding to VEGF
and further wherein the first immunoglobulin single variable domain
is attached to the N-terminus of the single heavy chain constant
region and comprises CDR sequences selected from the group
consisting of: SEQ ID NOs: 111-113; SEQ ID NOs: 114-116; SEQ ID
NOs: 117-119; SEQ ID NOs: 120-122; SEQ ID NOs: 123-125; SEQ ID NOs:
126-128; and SEQ ID NOs: 129-131, and the second immunoglobulin
single variable domain is attached to the C-terminus of the single
heavy chain constant region and comprises CDR sequences selected
from the group consisting of: SEQ ID NOs: 111-113; SEQ ID NOs:
114-116; SEQ ID NOs: 117-119; SEQ ID NOs: 120-122; SEQ ID NOs:
123-125; SEQ ID NOs: 126-128; and SEQ ID NOs: 129-131.
40. An antigen binding construct according to claim 39, wherein the
first immunoglobulin single variable domain comprises a sequence
selected from the group consisting of SEQ ID NOs: 103-109 and
wherein the second immunoglobulin single variable domain comprises
a sequence selected from the group consisting of SEQ ID NOs:
103-109.
41. An antigen binding construct according to claim 39, wherein the
single heavy chain constant region comprises a sequence selected
from the group consisting of SEQ ID NOs: 83, 84, and 110.
42. An antigen binding construct according to claim 39, wherein
each of the first and second immunoglobulin single variable domains
is attached to the single heavy chain constant region through a
linker.
43. An antigen binding construct according to claim 42, wherein the
linker through which the first immunoglobulin single variable
domain attaches to the N-terminus of the single heavy chain
constant region comprises a sequence selected from the group
consisting of SEQ ID NOs: 76-82 and wherein the linker through
which the second immunoglobulin single variable domain attaches to
the C-terminus of the single heavy chain constant region comprises
a sequence selected from the group consisting of SEQ ID NOs:
85-94.
44. An antigen binding construct according to claim 39, wherein one
or more immunoglobulin single variable domains comprise: a
C-terminal sequence consisting of the sequence VTVS(S)nX as shown
in SEQ ID NO: 219 for a VH immunoglobulin single variable domain or
VEI(K)p(R)qX as shown in SEQ ID NO: 220 for a VL immunoglobulin
single variable domain; wherein: n represents an integer
independently selected from 0 or 1; p and q each represent 0 or 1
such that when p represents 1 q may be 0 or 1 and such that when p
represents 0, q also represents 0; X may be present or absent, and
if present represents an amino acid extension of 1 to 8 amino acids
residues.
45. An antigen binding construct according to claim 44, wherein for
a VL immunoglobulin single variable domain the C-terminal sequence
is VEI(K)p(R)qX as shown in SEQ ID NO: 220 and p is 1, q is 1 and X
is A, AAA or T.
46. A dimer comprising two antigen binding constructs according to
claim 39, wherein said dimer is a heterodimer or homodimer.
47. A pharmaceutical composition comprising a dimer according to
claim 46, and one or more pharmaceutically acceptable
carrier(s).
48. A method of treating ocular disease or cancer in a human in
need thereof, the method comprising administering to the human an
effective amount of the dimer according to claim 46, thereby
treating ocular disease or cancer in the human.
49. The method of claim 48, wherein the ocular disease is diabetic
macular edema (DME), wet age-related macular degeneration (AMD),
diabetic retinopathy, retinal vein occlusion (RVO), or corneal
neovascularisation.
50. A polynucleotide sequence encoding an antigen binding construct
according to claim 14.
51. A recombinant transformed or transfected host cell comprising
one or more polynucleotide sequences encoding an antigen binding
construct according to claim 39.
52. A method for the production of an antigen binding construct
which method comprises the step of culturing a host cell comprising
one or more polynucleotide sequences encoding an antigen binding
construct according to claim 39 and isolating the antigen binding
construct.
53. An antigen binding construct produced by the method according
to claim 52.
Description
[0001] This application is a Continuation of U.S. application Ser.
No. 14/235,330 filed on Jan. 27, 2014, which is a National Stage
Entry of PCT/EP2012/064632 filed on Jul. 25, 2012, which claims
priority to U.S. Provisional Application 61/512,138 filed on Jul.
27, 2011. The entire teachings of the above identified applications
are incorporated herein by reference.
BACKGROUND
[0002] The Vascular Endothelial Growth Factor (VEGF) family of
growth factors and their receptors are essential regulators of
angiogenesis and vascular permeability. The VEGF family comprises
VEGF-A, PIGF (placenta growth factor), VEGF-B, VEGF-C, VEGF-E and
snake venom VEGF and each is thought to have a distinct role in
vascular patterning and vessel development. Due to alternative
splicing of mRNA transcribed from a single 8-exon gene, VEGF-A has
at least 9 subtypes (isoforms) identified by the number of amino
acids remaining after signal peptide cleavage. For example, in
humans the most prominent isoform is VEGF.sub.165, which exists in
equilibrium between a soluble and cell associated form. Longer
isoforms (VEGF.sub.183, VEGF.sub.189 & VEGF.sub.206) possess
C-terminal regions that are highly positively charged and mediate
association with cell surface glycans and heparin that modulates
their bioavailability. All VEGF-A isoforms form homodimers with the
association occurring via a core of approximately 110 N-terminal
residues that constitutes the receptor-binding VEGF fragment. Under
normal circumstances, and in the centre of solid tumours,
expression of VEGF is principally mediated by hypoxic conditions,
signifying a shortage of vascular supply. The hypoxia causes
dimerization of the hypoxia inducible factor HIF-1.alpha. with the
constitutively expressed HIF-1.alpha., forming a transcription
factor that binds to hypoxic response elements in the promoter
region of the VEGF gene. Under normoxia, the HIF-1.alpha. protein
undergoes ubiquitin-mediated degradation as a consequence of
multiple proline hydroxylation events. Other tumour-associated VEGF
up-regulation occurs due to activation via oncogene pathways (i.e.
ras) via inflammatory cytokines & growth factors as well as by
mechanical forces.
[0003] The active VEGF homodimer is bound at the cell surface by
receptors of the VEGFR family. The principal vascular endothelium
associated receptors for VEGF-A are VEGFR1 (Flt1) and VEGFR2
(Flk-2; KDR). Both receptors are members of the tyrosine kinase
family and require ligand-mediated dimerization for activation.
Upon dimerization the kinase domains undergo autophosphorylation,
although the extent of the kinase activity in VEGFR2 is greater
than that in VEGFR1. It has been demonstrated that the angiogenic
signalling of VEGF is mediated largely through VEGFR2, although the
affinity of VEGF is approximately 3-fold greater for VEGFR1
(KD.about.30 pM compared with 100 pM for VEGFR2). This has led to
the proposal that VEGFR1 principally acts as a decoy receptor to
sequester VEGF and moderate the extent of VEGFR2 activation.
Although VEGFR1 expression is associated with some tumours, its
principal role appears to be during embryonic development &
organogenesis. VEGF-A.sub.165 is also bound by the neuropilin
receptors NRP1 & NRP2. Although these receptors lack TK
domains, they are believed to acts as co-receptors for VEGFR2 and
augment signalling by transferring the VEGF to the VEGFR2.
[0004] Numerous studies have helped confirm VEGF-A as a key factor
in tumour angiogenesis. For example VEGF-A is expressed in most
tumours and in tumour associated stroma. In the absence of a well
developed and expanding vasculature system to support growth,
tumour cells become necrotic and apoptotic thereby imposing a limit
to the increase in tumour volume (of the order 1 mm3) that can
result from continuous cell proliferation. The expression of VEGF-A
is highest in hypoxic tumour cells adjacent to necrotic areas
indicating that the induction of VEGF-A by hypoxia in growing
tumours can change the balance of activators and inhibitors of
angiogenesis, leading to the growth of new blood vessels in the
tumour. Consistent with this hypothesis, a number of approaches,
including small-molecular weight tyrosine kinase inhibitors,
monoclonal antibodies, antisense oligonucleotides etc., that
inhibit or capture either VEGF-A or block its signalling receptor,
VEGFR-2, have been developed as therapeutic agents.
[0005] VEGF-A has also been implicated in a number of ocular
diseases, such as age-related macular degeneration (AMD), wet AMD,
geographic atrophy, diabetic retinopathy, retinal vein-occlusive
diseases, diabetic macular oedema and corneal vascularisation.
VEGF-A is produced by various ocular cell types in response to
hypoxia and has a number of functions, including promoting vascular
permeability and stimulating endothelial cell growth.
[0006] AMD is defined as an abnormality of the retinal pigment
epithelium, which leads to degeneration of the overlying
photoreceptor in the macula and results in loss of central vision.
AMD represents a major public health burden and it is estimated
that over 9 million people in the US have intermediate or advanced
forms of AMD. Early AMD is characterised by drusen and hyper or
hypopigmentation of the retinal pigment epithelium without loss of
vision. Advanced AMD, where loss of vision occurs, can present as
geographic atrophy or choriodal neovascularisation (CNV). CNV,
which is also referred to as wet AMD, is a result of the abnormal
growth of blood vessels.
[0007] Ranibizumab (Lucentis), bevacizumab (Avastin) and
aflibercept (Eylea) are examples of anti-VEGF therapies, which are
commonly administered for neovascular AMD. Despite the presence of
such therapies, there exists a need for further therapies for the
treatment of AMD and other ocular diseases.
SUMMARY OF THE INVENTION
[0008] The present invention is directed to antigen binding
constructs comprising one or two epitope binding domains separated
by a single chain Fc region of an antibody, wherein each epitope
binding domain is capable of binding to VEGF.
[0009] In one aspect, each epitope binding domain of an antigen
binding construct of the present invention is a domain antibody,
also referred to as a dAb.
[0010] In a further aspect, the present invention is directed to
the following antigen binding construct: [0011] a) DOM
15-26-597-AS-Fc (SEQ ID No.
110)-Fibronectin.times.4-DT02-K-044-085;
[0012] or [0013] b) DOM 15-26-597-IgG1 hinge-Fc (SEQ ID No.
110)-Fibronectin.times.4-DT02-K-044-085; or [0014] c) A variant of
(a) or (b) having at least 97% amino acid identity across the whole
sequence; or [0015] d) A variant of (a) or (b), wherein each dAb
sequence has at least 97% sequence identity to the sequence of the
specific dAb.
[0016] The present invention is further directed to dimers
comprising two antigen binding constructs of the invention,
pharmaceutical compositions comprising said dimers and their use in
the treatment of diseases associated with VEGF signalling, such as
diabetic macular edema (DME), wet age-related macular degeneration
(Wet AMD), diabetic retinopathy, retinal vein occlusion (RVO), and
corneal neovascularisation, and polynucleotide sequences encoding
said antigen binding constructs.
FIGURES
[0017] FIG. 1: ELISA, with EC50 values, showing comparison of
DMS1529, DMS1576 and Bevacizumab (Avastin) binding to human
VEGF.sub.165.
[0018] FIG. 2A: Binding of Vh dAb-Fc DMS1576 to VEGF after
pre-saturation with Vk Fc-dAb DMS30000 3 ug/mL by MSD.
[0019] FIG. 2B: Binding of Vk Fc-dAb DMS30000 to VEGF after
pre-saturation with Vh dAb-Fc DMS1576 3 ug/mL by MSD.
[0020] FIG. 3: Weighted analysis of variance on maximum inhibition
of VEGF induced Human Umbilical Cord Endothelial Cell (HUVEC)
proliferation assay from anti-VEGF Vh dAb-Fc, Vk Fc-dAb and
dAb-Fc-dAb molecules compared to Bevacizumab (Avastin).
[0021] FIG. 4: Binding of DMS1529 and DMS30000 to mouse
VEGF.sub.164 by MSD.
DETAILED DESCRIPTION OF THE INVENTION
[0022] The present invention is directed to antigen binding
constructs comprising two epitope binding domains separated by a
single chain Fc region of an antibody, wherein each epitope binding
domain in capable of binding to VEGF.
[0023] In one aspect, each epitope binding domain of an antigen
binding construct of the present invention is a domain antibody,
also referred to as a dAb.
[0024] As used herein, the term "epitope binding domain" refers to
a domain that specifically binds an antigen or epitope
independently of a different variable region or domain. This may be
a domain antibody (dAb) or it may be a domain which is a derivative
of a scaffold selected from the group consisting of CTLA-4
(Evibody); lipocalin; Protein A derived molecules such as Z-domain
of Protein A (Affibody, SpA), A-domain (Avimer/Maxibody); Heat
shock proteins such as GroEl and GroES; transferrin (trans-body);
ankyrin repeat protein (DARPin); peptide aptamer; C-type lectin
domain (Tetranectin); human .gamma.-crystallin and human ubiquitin
(affilins); PDZ domains; scorpion toxin (charybdotoxin); kunitz
type domains of human protease inhibitors; PDZ-domains of the
Ras-binding protein AF-6; and fibronectin (adnectin); which has
been subjected to protein engineering in order to obtain binding to
a ligand other than the natural ligand.
[0025] As used herein, the term "domain" is a folded protein
structure which has tertiary structure independent of the rest of
the protein. Generally, domains are responsible for discrete
functional properties of proteins and in many cases may be added,
removed or transferred to other proteins without loss of function
of the remainder of the protein and/or of the domain.
[0026] As used herein, the term "domain antibody" refers to a
folded polypeptide domain comprising sequences characteristic of
antibody variable domains. It therefore includes complete antibody
variable domains such as VH, VHH and VL and modified antibody
variable domains, for example, in which one or more loops have been
replaced by sequences which are not characteristic of antibody
variable domains, or antibody variable domains which have been
truncated or comprise N- or C-terminal extensions, as well as
folded fragments of variable domains which retain at least the
binding activity and specificity of the full-length domain. A
single variable domain is capable of binding an antigen or epitope
independently of a different variable region or domain. A "domain
antibody" or dAb.TM. may also be referred to as a "single variable
domain". A domain antibody may be a human domain antibody, but also
includes single domain antibodies from other species such as rodent
(for example, as disclosed in WO 00/29004), nurse shark and Camelid
VHH dAbs. Camelid VHH are immunoglobulin single variable domain
polypeptides that are derived from species including camel, llama,
alpaca, dromedary, and guanaco, which produce heavy chain
antibodies naturally devoid of light chains. Such VHH domains may
be humanised according to standard techniques available in the art,
and such domains are considered to be "domain antibodies". As used
herein VH includes camelid VHH domains. NARV are another type of
immunoglobulin domain antibody, which were identified in
cartilaginous fish including the nurse shark (Mol. Immunol. 44,
656-665 (2006). These domains are also known as Novel Antigen
Receptor variable region (commonly abbreviated to V(NAR) or
NARV).
[0027] As used herein, the term "single chain Fc region of an
antibody" refers to a single heavy chain Fc region of an IgG, such
as an IgG1, IgG2, IgG3, iGG4 or IgG4PE, or an IgA antibody. A
single heavy chain Fc region may comprise one or more of the CH1,
CH2 and CH3 constant region antibody domains, for example all three
constant region antibody domains or just the CH2 and CH3 domains.
In addition to comprising one or more of the CH1, CH2 and CH3
constant region antibody domains, the single heavy chain FC region
of an antibody may further comprise a hinge region of an antibody
(such a region normally found between the CH1 and CH2 domains).
[0028] In one aspect, the single chain Fc region of an antibody is
a single IgG1 heavy chain, for example a single IgG1 heavy chain
comprising the CH2 and CH3 antibody constant domains.
[0029] In a further aspect, the single chain Fc region of an
antibody is the IgG1 sequence of SEQ ID No. 110.
[0030] In a further aspect, the single chain Fc region of an
antibody is the following sequence:
TABLE-US-00001 QASSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0031] In one aspect the N terminus of the Fc sequence starts "AS"
or no N-terminal amino acid at start of Fc (Fc sequence starts
ASTHTCPPC or THTCPPC).
[0032] In another aspect the Fc region comprises a mutation within
the N-terminus of the Fc, for example THTCPPC is replaced by
TATCPPC. For example THTCPPC is replaced by THPCPPC (eg SEQ ID 83
and 84). Such mutations may be present in any sequence disclosed
herein, and are variant sequences of those specific sequences
disclosed herein.
[0033] The Fc region of an antibody may be selected for its degree
of effector function.
[0034] The term "Effector Function" as used herein is meant to
refer to one or more of Antibody Dependant Cell-mediated Cytotoxic
(ADCC), Complement-Dependant Cytotoxic (CDC) mediated responses,
Fc-mediated phagocytosis and antibody recycling via the FcRn
receptor. For IgG antibodies, effector functionalities including
ADCC and ADCP are mediated by the interaction of the heavy chain
constant region with a family of Fc.gamma. receptors present on the
surface of immune cells. In humans these include Fc.gamma.RI
(CD64), Fc.gamma.RII (CD32) and Fc.gamma.RIII (CD16). Interaction
between the antigen binding protein bound to antigen and the
formation of the Fc/Fc.gamma. complex induces a range of effects
including cytotoxicity, immune cell activation, phagocytosis and
release of inflammatory cytokines.
[0035] The interaction between the constant region of an antigen
binding protein and various Fc receptors (FcR) is believed to
mediate the effector functions of the antigen binding protein.
Significant biological effects can be a consequence of effector
functionality, in particular, antibody-dependent cellular
cytotoxicity (ADCC), fixation of complement (complement dependent
cytotoxicity or CDC), and half-life/clearance of the antigen
binding protein. Usually, the ability to mediate effector function
requires binding of the antigen binding protein to an antigen and
not all antigen binding proteins will mediate every effector
function.
[0036] Effector function can be measured in a number of ways
including for example via binding of the Fc.gamma.RIII to Natural
Killer cells or via Fc.gamma.RI to monocytes/macrophages to measure
for ADCC effector function. For example an antigen binding protein
of the present invention can be assessed for ADCC effector function
in a Natural Killer cell assay. Examples of such assays can be
found in Shields et al, 2001 The Journal of Biological Chemistry,
Vol. 276, p 6591-6604; Chappel et al, 1993 The Journal of
Biological Chemistry, Vol 268, p 25124-25131; Lazar et al, 2006
PNAS USA, 103; 4005-4010. Examples of assays to determine CDC
function include that described in 1995 J Imm Meth 184:29-38.
[0037] Some isotypes of human constant regions, in particular IgG4
and IgG2 isotypes, essentially lack the functions of (a) activation
of complement by the classical pathway; and (b) antibody-dependent
cellular cytotoxicity. Various modifications to the heavy chain
constant region of antigen binding proteins may be carried out
depending on the desired effector property. IgG1 constant regions
containing specific mutations have separately been described to
reduce binding to Fc receptors and therefore reduce ADCC and CDC
(Duncan et al. Nature 1988, 332; 563-564; Lund et al. J. Immunol.
1991, 147; 2657-2662; Chappel et al. PNAS USA 1991, 88; 9036-9040;
Burton and Woof, Adv. Immunol. 1992, 51; 1-84; Morgan et al.,
Immunology 1995, 86; 319-324; Hezareh et al., J. Virol. 2001, 75
(24); 12161-12168).
[0038] Human IgG1 constant regions containing specific mutations or
altered glycosylation on residue Asn297 have also been described to
enhance binding to Fc receptors. In some cases these mutations have
also been shown to enhance ADCC and CDC (Lazar et al. PNAS USA
2006, 103; 4005-4010; Shields et al. J Biol Chem 2001, 276;
6591-6604; Nechansky et al. Mol Immunol, 2007, 44; 1815-1817).
[0039] In one embodiment of the present invention, such mutations
are in one or more of positions selected from 239, 332 and 330
(IgG1), or the equivalent positions in other IgG isotypes. Examples
of suitable mutations are S239D and I332E and A330L. In one
embodiment the antigen binding protein of the invention herein
described is mutated at positions 239 and 332, for example S239D
and I332E or in a further embodiment it is mutated at three or more
positions selected from 239 and 332 and 330, for example S239D and
I332E and A330L (EU index numbering).
[0040] In an alternative embodiment of the present invention, there
is provided an antigen binding protein comprising a heavy chain
constant region with an altered glycosylation profile such that the
antigen binding protein has enhanced effector function. For
example, wherein the antigen binding protein has enhanced ADCC or
enhanced CDC or wherein it has both enhanced ADCC and CDC effector
function. Examples of suitable methodologies to produce antigen
binding proteins with an altered glycosylation profile are
described in WO2003011878, WO2006014679 and EP1229125, all of which
can be applied to the antigen binding proteins of the present
invention.
[0041] The antigen binding constructs of the present invention
comprise epitope binding domains that are capable of binding to
VEGF. As used herein, the term "VEGF" is a reference to any VEGF
molecule, in particular VEGF-A, for example human VEGF-A, and
including any isoform of VEGF-A, such as VEGF.sub.165.
[0042] Antigen binding constructs of the present invention, in one
aspect, comprise two epitope binding domains separated by a single
chain Fc region of an antibody. By separated it is meant that the
epitope binding domains are not directly attached to one another.
In one aspect the epitope binding domains are located at opposite
ends of the Fc region. One epitope binding domain is attached to
the N-terminus and the other it attached to the C-terminus. Each
epitope binding domain is independently selected and such domains
may bind the same epitope on VEGF or different epitopes.
[0043] In one aspect, the epitope binding domain attached to the
N-terminus end of the Fc region of an antibody, in an antigen
binding construct of the present invention, is a heavy or light
chain dAb, wherein the light chain dAb may be a kappa or lambda
light chain.
[0044] In a further aspect, where antigen binding constructs of the
present invention have an epitope binding domain attached to the
C-terminus, the epitope binding domain is an light chain dAb,
wherein the light chain dAb may be a kappa or lambda light
chain.
[0045] In a yet further aspect, where antigen binding constructs of
the present invention comprise two epitope binding domains, the one
attached to the N-terminus of the Fc region is a heavy chain dAb
and the one attached to the C-terminus of the Fc region is a light
chain dAb.
[0046] In a yet further aspect, where antigen binding constructs of
the present invention comprise two epitope binding domains, the one
attached to the N-terminus of the Fc region is a light chain dAb
and the one attached to the C-terminus of the Fc region is a light
chain dAb.
[0047] Antigen binding constructs of the present invention may be
expressed as a fusion protein or the epitope binding domain may be
expressed separately and connected by another means, such as
chemical conjugation using methods well known in the art.
[0048] Epitope binding domains can be attached directly to the Fc
region of an antibody or indirectly through a linker. In constructs
where the N-terminus of a dAb is fused to the C-terminus of a Fc
region of an antibody, a peptide linker may enhance antigen binding
of the dAb. Indeed, the N-terminal end of a dAb is located closely
to the complementarity-determining regions (CDRs) involved in
antigen-binding activity. Thus a peptide linker may act as a spacer
between the epitope-binding, and the constant domain of the protein
scaffold, which may allow the dAb CDRs to more easily reach the
antigen, and in some circumstances bind with higher affinity.
Furthermore, certain peptide linkers, for examples those greater
than 7 amino acids in length, may promote and enable the
association of a heavy chain dAb attached to the N-terminus of the
Fc region of an antibody to a light chain dAb attached to the
C-terminus of the Fc region of an antibody, in heterodimers and
homodimers as described herein. Such association may enhance
antigen binding and/or other properties of the antigen binding
constructs and dimers of the present invention.
[0049] When fused at the C-terminal end of the Fc region of the
antibody, each dAb may be located in the vicinity of the CH3
domains of the Fc portion. This is not expected to impact on the Fc
binding properties to Fc receptors (e.g. Fc.gamma.RI, II, III and
FcRn) as these receptors engage with the C.sub.H2 domains (for the
Fc.gamma.RI, II and III class of receptors) or with the hinge
between the CH2 and CH3 domains (e.g. FcRn receptor). Another
feature of such antigen-binding constructs is that both dAbs are
expected to be spatially close to each other and provided that
flexibility is provided by provision of appropriate linkers, these
dAbs may even form homodimeric species, hence propagating the
`zipped` quaternary structure of the Fc portion, which may enhance
stability of the construct.
[0050] Examples of suitable linkers include amino acid sequences
which may be from 1 amino acid to 150 amino acids in length, or
from 1 amino acid to 140 amino acids, for example, from 1 amino
acid to 130 amino acids, or from 1 to 120 amino acids, or from 1 to
80 amino acids, or from 1 to 50 amino acids, or from 1 to 20 amino
acids, or from 1 to 10 amino acids, or from 5 to 18 amino acids, or
greater than 7 but less than or equal to 10, 20, 30, 40, 50, 60,
70, 80, 90, 100, 110, 120, 130, 140 or 150 amino acids. Such
sequences may have their own tertiary structure, for example, a
linker of the present invention may comprise a single variable
domain. The size of a linker in one embodiment is equivalent to a
single variable domain. Suitable linkers may be of a size from 1 to
100 Angstroms, for example may be of a size from 20 to 80 angstroms
or for example may be of a size from 20 to 60 angstroms or for
example less than 40 angstroms, or less than 20 angstroms, or less
than 5 angstroms in length.
[0051] In one aspect, the linker is greater than 7 and less than or
equal to 150 amino acids in length.
[0052] Examples of linkers include, but are not limited to, those
outlined as SEQ ID No. 57 to 63 and 66 to 82
[0053] In one aspect, the linkers are selected from SEQ ID No.'s
58, 60, 62, 63 and 75.
[0054] Where an antigen binding construct of the present invention
comprises two epitope binding domains, the epitope binding domains
may be attached to the Fc region of an antibody by identical or
different linkers.
[0055] In one aspect, where a linker is used to attach an epitope
binding domain to the N-terminus of the Fc region of an antibody,
the linker is selected from the group consisting of SEQ ID No. 58,
SEQ ID No. 60 and 62. In a further aspect, the N-terminus linker is
SEQ ID no. 58 or SEQ ID No. 60.
[0056] In one aspect, where a linker is used to attach an epitope
binding domain to the C-terminus of the Fc region of an antibody,
the linker is selected from the group consisting of SEQ ID No. 63
and SEQ ID No. 75. A particular preferred linker is SEQ ID No.
63.
[0057] In one aspect, linkers of use in the antigen-binding
constructs of the present invention may comprise, either alone or
in addition to other linkers, one or more sets of GS residues, for
example `GSTVAAPS` or `TVAAPSGS` or `GSTVAAPSGS`.
[0058] In one embodiment the epitope binding domain is linked to
the Fc region of an antibody by the linker `(PAS).sub.n(GS).sub.m`,
`(GGGGS).sub.n(GS).sub.m,`, `(TVAAPS).sub.n(GS).sub.m,`,
`(GS).sub.m(TVAAPSGS).sub.n`, `(PAVPPP).sub.n(GS).sub.m,`,
`(TVSDVP).sub.n(GS).sub.m,`, `(TGLDSP).sub.n(GS).sub.m,`, wherein
n=1-10, and m=0-4.
[0059] Examples of such linkers include (PAS).sub.n(GS).sub.m
wherein n=1 and m=1, (PAS).sub.n(GS).sub.m wherein n=2 and m=1,
(PAS).sub.n(GS).sub.m wherein n=3 and m=1, (PAS).sub.n(GS).sub.m
wherein n=4 and m=1, (PAS).sub.n(GS).sub.m wherein n=2 and m=0,
(PAS).sub.n(GS).sub.m wherein n=3 and m=0, (PAS).sub.n(GS).sub.m
wherein n=4 and m=0.
[0060] Examples of such linkers include (GGGGS).sub.n(GS).sub.m
wherein n=1 and m=1, (GGGGS).sub.n(GS).sub.m wherein n=2 and m=1,
(GGGGS).sub.n(GS).sub.m wherein n=3 and m=1,
(GGGGS).sub.n(GS).sub.m wherein n=4 and m=1,
(GGGGS).sub.n(GS).sub.m wherein n=2 and m=0 (SEQ ID NO:49),
(GGGGS).sub.n(GS).sub.m wherein n=3 and m=0 (SEQ ID NO:50),
(GGGGS).sub.n(GS).sub.m wherein n=4 and m=0.
[0061] Examples of such linkers include (TVAAPS).sub.n(GS).sub.m
wherein n=1 and m=1, (TVAAPS).sub.n(GS).sub.m wherein n=2 and m=1,
(TVAAPS).sub.n(GS).sub.m wherein n=3 and m=1,
(TVAAPS).sub.n(GS).sub.m wherein n=4 and m=1,
(TVAAPS).sub.n(GS).sub.m wherein n=2 and m=0,
(TVAAPS).sub.n(GS).sub.m wherein n=3 and m=0,
(TVAAPS).sub.n(GS).sub.m wherein n=4 and m=0.
[0062] Examples of such linkers include (GS).sub.m(TVAAPSGS).sub.n
wherein n=1 and m=1, (GS).sub.m(TVAAPSGS).sub.n wherein n=2 and
m=1, (GS).sub.m(TVAAPSGS).sub.n wherein n=3 and m=1, or
(GS).sub.m(TVAAPSGS).sub.n wherein n=4 and m=1,
(GS).sub.m(TVAAPSGS).sub.n wherein n=5 and m=1,
(GS).sub.m(TVAAPSGS).sub.n wherein n=6 and m=1,
(GS).sub.m(TVAAPSGS).sub.n wherein n=1 and m=0,
(GS).sub.m(TVAAPSGS).sub.n wherein n=2 and m=10,
(GS).sub.m(TVAAPSGS).sub.n wherein n=3 and m=0, or
(GS).sub.m(TVAAPSGS).sub.n wherein n=0.
[0063] Examples of such linkers include (PAVPPP).sub.n(GS).sub.m
wherein n=1 and m=1, (PAVPPP).sub.n(GS).sub.m wherein n=2 and m=1,
(PAVPPP).sub.n(GS).sub.m wherein n=3 and m=1,
(PAVPPP).sub.n(GS).sub.m wherein n=4 and m=1,
(PAVPPP).sub.n(GS).sub.m wherein n=2 and m=0,
(PAVPPP).sub.n(GS).sub.m wherein n=3 and m=0,
(PAVPPP).sub.n(GS).sub.m wherein n=4 and m=0.
[0064] Examples of such linkers include (TVSDVP).sub.n(GS).sub.m
wherein n=1 and m=1, (TVSDVP).sub.n(GS).sub.m wherein n=2 and m=1,
(TVSDVP).sub.n(GS).sub.m wherein n=3 and m=1,
(TVSDVP).sub.n(GS).sub.m wherein n=4 and m=1,
(TVSDVP).sub.n(GS).sub.m wherein n=2 and m=0,
(TVSDVP).sub.n(GS).sub.m wherein n=3 and m=0,
(TVSDVP).sub.n(GS).sub.m wherein n=4 and m=0.
[0065] Examples of such linkers include (TGLDSP).sub.n(GS).sub.m
wherein n=1 and m=1, (TGLDSP).sub.n GS).sub.m wherein n=2 and m=1,
(TGLDSP).sub.n(GS).sub.m wherein n=3 and m=1,
(TGLDSP).sub.n(GS).sub.m wherein n=4 and m=1,
(TGLDSP).sub.n(GS).sub.m wherein n=2 and m=0,
(TGLDSP).sub.n(GS).sub.m wherein n=3 and m=0,
(TGLDSP).sub.n(GS).sub.m wherein n=4 and m=0.
[0066] Further linkers that may be used are disclosed in WO
2009068649.
[0067] The antigen binding construct may additionally comprise
albumin, or a fragment thereof, as a linker, and derived from human
serum albumin, such as DETYVPKEFNAETFGS, DETYVPKEFNAETF,
EVDETYVPKEFNAETFTFHADGS, EVDETYVPKEFNAETFTFHAD, DDNPNLPRLVRPE,
DEMPADLPSLAADF, HKDDNPNLPRLVRPEVDVM, and ENDEMPADLPSLAADFVESKD. The
linkers may further comprise some additional residues, for example,
they may comprise additional glycine and serine residues or may
have amino acids removed from either end of the linker for example
in one aspect 5 amino acids are removed. These additional residues
may be at the beginning or end of the albumin-derived sequence, or
may be within the albumin-derived sequence.
[0068] In one aspect, the present invention is directed to antigen
binding constructs comprising two epitope binding domains wherein
each epitope binding domains is an independently selected dAb and
comprises an amino acid sequence which is at least 97% identical to
the sequence of DOM 15-26-593, DOM 15-26-597, DT02-K-044-085,
DT02-K-044-251, DT02-K-044-232, DT02-K-044-236 or
DT02-K-044-255.
[0069] In a further aspect, each epitope binding domain is a dAb
independently selected from the group consisting of DOM 15-26-593,
DOM 15-26-597, DT02-K-044-085, DT02-K-044-251, DT02-K-044-232,
DT02-K-044-236 and DT02-K-044-255.
[0070] In a further aspect, the dAb attached to the N-terminus of
the single chain Fc region comprises an amino acid sequence which
is at least 97% identical to the sequence of DOM 15-26-597 or
DT02-K-044-085.
[0071] In a further aspect, the dAb attached to the N-terminus of
the single chain Fc region is DOM 15-26-597 or DT02-K-044-085.
[0072] In a further aspect, the dAb attached to the C-terminus of
the single chain Fc region comprises an amino acid sequence which
is at least 97% identical to the sequence of DT02-K-044-085,
DT02-K-044-251, DT02-K-044-232, DT02-K-044-236 or
DT02-K-044-255.
[0073] In a further aspect, the dAb attached to the C-terminus of
the single chain Fc region is DT02-K-044-085, DT02-K-044-251,
DT02-K-044-232, DT02-K-044-236 or DT02-K-044-255.
[0074] In a further aspect, the antigen binding construct of the
present invention is: [0075] (a) DOM 15-26-597-AS-Fc (SEQ ID No.
110)-Fibronectin.times.4-DT02-K-044-085; or [0076] e) (b) DOM
15-26-597-IgG1 hinge-Fc (SEQ ID No.
110)-Fibronectin.times.4-DT02-K-044-085; or [0077] f) (c) A variant
of (a) or (b) having at least 97% amino acid identity across the
whole sequence; or [0078] g) (d) A variant of (a) or (b), wherein
each dAb sequence has at least 97% sequence identity to the
sequence of the specific dAb.
[0079] The present invention is further directed to antigen binding
constructs comprising one epitope binding domain attached to a
single chain Fc region of an antibody, wherein the epitope binding
domain is a dAb which comprises an amino acid sequence which is at
least 97% identical to the sequence of DT02-K-044-085,
DT02-K-044-251, DT02-K-044-232, DT02-K-044-236 or DT02-K-044-255,
and further wherein the epitope binding domain is capable of
binding to VEGF.
[0080] In a yet further aspect, the present invention is directed
to antigen binding constructs comprising one epitope binding domain
attached to a single chain Fc region of an antibody, wherein the
epitope binding domain is a dAb selected from DT02-K-044-085,
DT02-K-044-251, DT02-K-044-232, DT02-K-044-236 or
DT02-K-044-255.
[0081] In one aspect, the antigen binding construct has the
following structure (N to C terminus): [0082] a. Fc-Linker
C-DT02-K-044-085 dAb; [0083] b. DOM 15-26-593 dAb-Linker
N-Fc-Linker C-DT02-K-044-085 dAb; [0084] c. DOM 15-26-597
dAb-Linker N-Fc-Linker C-DT02-K-044-085 dAb; [0085] d.
DT02-K-044-085 dAb-Linker N-Fc-Linker C DT02-K-044-085 dAb; [0086]
e. Fc-Linker C-DT02-K-044-251 dAb; [0087] f. DOM15-26-597
dAb-Linker N-Fc-Linker C-DT02-K-044-251 dAb; [0088] g.
DT02-K-044-251 dAb-Linker N-Fc-Linker C-DT02-K-044-251 dAb; [0089]
h. Wherein for a-g, Linker N can be any of those described in: SEQ
ID NO:57-63 & SEQ ID NO:76-82; [0090] i. Wherein for a-g,
Linker C can be any of those described in: SEQ ID NO:66-75 &
SEQ ID NO:85-94; [0091] j. Wherein for a-g, Fc can be any of those
described in: SEQ ID NO:64,65,102 & SEQ ID NO:83,84,110; [0092]
k. a variant of any of a-j having at least 97% amino acid identity;
[0093] l. a variant of any of a-j wherein the dAb sequence has at
least 97% identity to the sequence of the specific dAb;
[0094] In a further aspect, the antigen binding construct of the
present invention has the following structure:
dAb1-LinkerN-Fc-LinkerC-dAb2
[0095] Wherein dAb1 can be defined from:
TABLE-US-00002 DNA Amino Acid Sequence Sequence dAb Sequences SEQ
ID No. SEQ ID No. .DOM 15-26-597 96 104 DT02-K-044-085 97 105
DT02-K-044-251 100 108 DT02-K-044-255 101 109
[0096] Wherein LinkerN can be defined from:
TABLE-US-00003 DNA Amino Acid N-terminal Linker Sequence Sequence
Sequences SEQ ID No. SEQ ID No. AAAS Linker 57 76 AS Linker 58 77
TVAAPS Linker 59 78 Hinge IgG1 Linker 60 79 Hinge IgG3 Linker 61 80
Fibronectin x3 Linker 62 81 Fibronectin x4 Linker 63 82
[0097] Wherein Fc can be defined from:
TABLE-US-00004 DNA Amino Acid Sequence Sequence Fc Sequences SEQ ID
No. SEQ ID No. Fc IgG1 102 110 H2A IgG1 Fc 64 83 T3P IgG1 Fc 65
84
[0098] Wherein LinkerC can be defined from:
TABLE-US-00005 DNA Amino Acid Sequence Sequence C-terminal Linker
Sequences SEQ ID No. SEQ ID No. ((GS(TVAAPSGS)x3)) Linker 66 85
Fibronectin x3 Linker 67 86 Fibronectin x4 Linker 68 87 Albumin
Domain 1 Linker 69 88 Albumin Domain 2 Linker 70 89 Albumin Domain
3 Linker 71 90 Truncated Albumin Domain3 72 91 Linker; Alb Dom
3-TFHAD Gly4Ser 3x Linker 73 92 Gly4Ser 4x Linker 74 93 Helical
Linker 75 94
[0099] Wherein dAb2 can be defined from:
TABLE-US-00006 DNA Amino Acid Sequence Sequence dAb Sequences SEQ
ID No. SEQ ID No. DT02-K-044-085 97 105 DT02-K-044-251 100 108
DT02-K-044-255 101 109
[0100] Naturally occurring autoantibodies exist in humans that can
bind to proteins. Autoantibodies can thus bind to endogenous
proteins (present in naive subjects) as well as to proteins or
peptides which are administered to a subject for treatment.
Therapeutic protein-binding autoantibodies and antibodies that are
newly formed in response to drug treatment are collectively termed
anti-drug antibodies (ADAs). Pre-existing antibodies against
molecules such as therapeutic proteins and peptides, administered
to a subject can affect their efficacy and could result in
administration reactions, hypersensitivity, altered clinical
response in treated patients and altered bioavailability by
sustaining, eliminating or neutralizing the molecule. It could be
advantageous to provide molecules for therapy which comprise human
immunoglobulin (antibody) single variable domains or dAbs which
have reduced immunogenicity (i.e. reduced ability to bind to
pre-existing ADAs when administered to a subject, in particular a
human subject.
[0101] Thus in one aspect of the present invention there is
provided a modified dAb or antigen binding construct or dimer
comprising such a modified dAb, which has reduced ability to bind
to pre-existing antibodies (ADAs) as compared to the equivalent
unmodified molecule. By reduced ability to bind it is meant that
the modified molecule binds with a reduced affinity or reduced
avidity to a pre-existing ADA. Said modified dAb comprise one or
more modifications selected from: (a) a C-terminal addition,
extension, deletion or tag, and/or (b) one or more amino acid
framework substitutions.
[0102] In one aspect the modified dAb or antigen binding construct
or dimer comprising such a modified dAb comprises: [0103] a) a
C-terminal sequence consisting of the sequence VTVS(S)nX [for a VH
dAb] or VEIKpRqX [for a VL dAb]; and also optionally [0104] b) one
or more amino acid substitutions at positions 14, 41, 108, 110, or
112 compared to a human germline framework sequence [0105] wherein:
[0106] n represents an integer independently selected from 0 or 1;
[0107] p and q each represent 0 or 1 such that when p represents 1
q may be 0 or 1 and such that when p represents 0, q also
represents 0; [0108] X may be present or absent, and if present
represents an amino acid extension of 1 to 8 amino acids
residues.
[0109] In one aspect, the C-terminal sequence of the dAb is
VEIKpRqX, wherein p is 1 and q is 0 and X is absent.
[0110] In a further aspect, said modified dAb with reduced binding
to pre-existing ADAs has one or more amino acid substitutions
wherein said one or more amino acid substitutions are selected from
the group consisting of a P14A substitution, a P41A substitution, a
L108A substitution, a T110A substitution, a S112A substitution, a
P14K substitution, a P14Q substitution, and a P14T
substitution.
[0111] In a further aspect, X is present, and is an extension of 1
to 8 amino acids, in particular an extension of 1 to 8 amino acids
which comprises an alanine residue, for example a single alanine
extension, or an AS, AST, ASTK, ASTKG, ASTKGP extension.
[0112] In a further aspect, X is present, and is an extension of 1
to 8 amino acids, in particular an extension of 1 to 8 amino acids
which comprises an A, AAA or T extension.
[0113] In one aspect, the modified dAb can comprise a tag present
at the C terminus. The tag can be any tag known in the art for
example affinity tags such as myc-tags, FLAG tags, his-tags,
chemical modification such as PEG, or protein domains such as the
antibody Fc domain
[0114] The C terminal addition or extension or tag can be present
as a direct fusion or conjugate with the C terminus of the
molecule.
[0115] Immunoassays well known to those skilled in the art can be
used to confirm that the modified dAbs have the desired reduced
binding to ADAs.
[0116] In a further aspect, the present invention is directed to
dimers of the antigen binding constructs disclosed herein. As used
herein, the term "dimer" means a polypeptide complex which
comprises two antigen binding constructs, i.e two chains that
associate with one another to form a dimer. A dimer may be a
homodimer, comprising two identical antigen binding constructs of
the invention or a heterodimer comprising two different antigen
binding constructs of the invention. Homodimers and heterodimers of
the present invention may have improved properties, such as
affinity, for the target VEGF molecule.
[0117] In one aspect, homodimers and heterodimers of the present
invention may bind VEGF with a Kd of at least 1 mM, for example a
Kd of at least 10 nM, 1 nM, 500 pM, 200 pM, 100 pM, <100 pM, 10
pM, 5 pM, 1 pM to antigen as measured by Biacore.TM., such as the
Biacore.TM. method as described in methods herein.
[0118] The in-vivo half life of the antigen binding constructs and
dimers of the present invention may be increased by modification of
the immunoglobulin constant domain or FcRn (Fc receptor neonate)
binding domain.
[0119] In adult mammals, FcRn, also known as the neonatal Fc
receptor, plays a key role in maintaining serum antibody levels by
acting as a protective receptor that binds and salvages antibodies
of the IgG isotype from degradation. IgG molecules are endocytosed
by endothelial cells, and if they bind to FcRn, are recycled out
into circulation. In contrast, IgG molecules that do not bind to
FcRn enter the cells and are targeted to the lysosomal pathway
where they are degraded.
[0120] The neonatal FcRn receptor is believed to be involved in
both antibody clearance and the transcytosis across tissues (see
Junghans R. P (1997) Immunol. Res 16. 29-57 and Ghetie et al (2000)
Annu. Rev. Immunol. 18, 739-766). Human IgG1 residues determined to
interact directly with human FcRn includes Ile253, Ser254, Lys288,
Thr307, Gln311, Asn434 and His435. Switches at any of these
positions described in this section may enable increased serum
half-life and/or altered effector properties of antigen binding
proteins of the invention.
[0121] Antigen binding proteins of the present invention may have
amino acid modifications that increase the affinity of the constant
domain or fragment thereof for FcRn. Increasing the half-life of
therapeutic and diagnostic IgG's and other bioactive molecules has
many benefits including reducing the amount and/or frequency of
dosing of these molecules. In one embodiment there is therefore
provided an antigen binding according to the invention provided
herein or a fusion protein comprising all or a portion (an FcRn
binding portion) of an IgG constant domain having one or more of
these amino acid modifications and a non-IgG protein or non-protein
molecule conjugated to such a modified IgG constant domain, wherein
the presence of the modified IgG constant domain increases the in
vivo half life of the antigen binding protein.
[0122] PCT Publication No. WO 00/42072 discloses a polypeptide
comprising a variant Fc region with altered FcRn binding affinity,
which polypeptide comprises an amino acid modification at any one
or more of amino acid positions 238, 252, 253, 254, 255, 256, 265,
272, 286, 288, 303, 305, 307, 309, 311, 312, 317, 340, 356, 360,
362, 376, 378, 380, 386, 388, 400, 413, 415, 424, 433, 434, 435,
436, 439, and 447 of the Fc region, wherein the numbering of the
residues in the Fc region is that of the EU index (Kabat et
al).
[0123] PCT Publication No. WO 02/060919 A2 discloses a modified IgG
comprising an IgG constant domain comprising one or more amino acid
modifications relative to a wild-type IgG constant domain, wherein
the modified IgG has an increased half-life compared to the
half-life of an IgG having the wild-type IgG constant domain, and
wherein the one or more amino acid modifications are at one or more
of positions 251, 253, 255, 285-290, 308-314, 385-389, and 428-435.
Shields et al. (2001, J Biol Chem; 276:6591-604) used alanine
scanning mutagenesis to alter residues in the Fc region of a human
IgG1 antibody and then assessed the binding to human FcRn.
Positions that effectively abrogated binding to FcRn when changed
to alanine include 1253, S254, H435, and Y436. Other positions
showed a less pronounced reduction in binding as follows:
E233-G236, R255, K288, L309, S415, and H433. Several amino acid
positions exhibited an improvement in FcRn binding when changed to
alanine; notable among these are P238, T256, E272, V305, T307,
Q311, D312, K317, D376, E380, E382, S424, and N434. Many other
amino acid positions exhibited a slight improvement (D265, N286,
V303, K360, Q362, and A378) or no change (S239, K246, K248, D249,
M252, E258, T260, S267, H268, S269, D270, K274, N276, Y278, D280,
V282, E283, H285, T289, K290, R292, E293, E294, Q295, Y296, N297,
S298, R301, N315, E318, K320, K322, S324, K326, A327, P329, P331,
E333, K334, T335, S337, K338, K340, Q342, R344, E345, Q345, Q347,
R356, M358, T359, K360, N361, Y373, S375, S383, N384, Q386, E388,
N389, N390, K392, L398, S400, D401, K414, R416, Q418, Q419, N421,
V422, E430, T437, K439, S440, S442, S444, and K447) in FcRn
binding.
[0124] The most pronounced effect was found for combination
variants with improved binding to FcRn. At pH 6.0, the E380A/N434A
variant showed over 8-fold better binding to FcRn, relative to
native IgG1, compared with 2-fold for E380A and 3.5-fold for N434A.
Adding T307A to this effected a 12-fold improvement in binding
relative to native IgG1. In one embodiment the antigen binding
protein of the invention comprises the E380A/N434A mutations and
has increased binding to FcRn.
[0125] Dall'Acqua et al. (2002, J Immunol. 169: 5171-80) described
random mutagenesis and screening of human IgG1 hinge-Fc fragment
phage display libraries against mouse FcRn. They disclosed random
mutagenesis of positions 251, 252, 254-256, 308, 309, 311, 312,
314, 385-387, 389, 428, 433, 434, and 436. The major improvements
in IgG1-human FcRn complex stability occur in substituting residues
located in a band across the Fc-FcRn interface (M252, S254, T256,
H433, N434, and Y436) and to lesser extend substitutions of
residues at the periphery like V308, L309, Q311, G385, Q386, P387,
and N389. The variant with the highest affinity to human FcRn was
obtained by combining the M252Y/S254T/T256E and H433K/N434F/Y436H
mutations and exhibited a 57-fold increase in affinity relative to
the wild-type IgG1. The in vivo behaviour of such a mutated human
IgG1 exhibited a nearly 4-fold increase in serum half-life in
cynomolgus monkey as compared to wild-type IgG1.
[0126] The present invention therefore provides a variant of an
antigen binding protein with optimized binding to FcRn. In a
preferred embodiment, the said variant of an antigen binding
protein comprises at least one amino acid modification in the Fc
region of said antigen binding protein, wherein said modification
is selected from the group consisting of 226, 227, 228, 230, 231,
233, 234, 239, 241, 243, 246, 250, 252, 256, 259, 264, 265, 267,
269, 270, 276, 284, 285, 288, 289, 290, 291, 292, 294, 297, 298,
299, 301, 302, 303, 305, 307, 308, 309, 311, 315, 317, 320, 322,
325, 327, 330, 332, 334, 335, 338, 340, 342, 343, 345, 347, 350,
352, 354, 355, 356, 359, 360, 361, 362, 369, 370, 371, 375, 378,
380, 382, 384, 385, 386, 387, 389, 390, 392, 393, 394, 395, 396,
397, 398, 399, 400, 401 403, 404, 408, 411, 412, 414, 415, 416,
418, 419, 420, 421, 422, 424, 426, 428, 433, 434, 438, 439, 440,
443, 444, 445, 446 and 447 of the Fc region as compared to said
parent polypeptide, wherein the numbering of the amino acids in the
Fc region is that of the EU index in Kabat.
[0127] In a further aspect of the invention the modifications are
M252Y/S254T/T256E. Additionally, various publications describe
methods for obtaining physiologically active molecules whose
half-lives are modified either by introducing an FcRn-binding
polypeptide into the molecules (WO 97/43316; U.S. Pat. No.
5,869,046; U.S. Pat. No. 5,747,035; WO 96/32478; WO 91/14438) or by
fusing the molecules with antibodies whose FcRn-binding affinities
are preserved but affinities for other Fc receptors have been
greatly reduced (WO 99/43713) or fusing with FcRn binding domains
of antibodies (WO 00/09560; U.S. Pat. No. 4,703,039).
[0128] Additionally, methods of producing an antigen binding
protein with a decreased biological half-life are also provided. A
variant IgG in which His435 is mutated to alanine results in the
selective loss of FcRn binding and a significantly reduced serum
half-life (Firan et al. 2001, International immunology 13:993).
U.S. Pat. No. 6,165,745 discloses a method of producing an antigen
binding protein with a decreased biological half-life by
introducing a mutation into the DNA segment encoding the antigen
binding protein. The mutation includes an amino acid substitution
at position 253, 310, 311, 433, or 434 of the Fc-hinge domain.
[0129] The invention also relates to a variant of any specific
antigen binding construct sequence disclosed herein, such as
epitope binding domain sequence, e.g. a dAb sequence, or the
sequence of the whole antigen binding construct. Suitably the
variant comprises an amino acid sequence that has at least 70%, or
at least 75%, or at least 80% or at least 85% or at least 90% or at
least 95%, at least 96%, at least 97%, at least 98% or at least 99%
sequence identity to the specified sequence, suitably whilst
substantially retaining the binding properties of the parent
sequence, or at least one binding property where the parent is
multi-specific, such as some binding affinity for a VEGF, such as
VEGF A.
[0130] Generally any variant will have at least 30% of the binding
affinity of the parent, suitably at least 40%, 50%, 60%, 70, 80%,
90% or more, and suitably 100% of the parent sequence (or
more).
[0131] In one aspect the antigen binding construct may be varied by
1, 2, 3, or 4 amino acids, as long as the antigen binding construct
is capable of binding to a VEGF, such as VEGF A.
[0132] In one aspect the epitope binding domain sequence comprises
a CDR or CDRs from a domain antibody (dAb). CDRs of any sequence
identified or referred to herein may be varied by 1, 2, 3, or 4
amino acids, as long as the antigen binding construct is capable of
binding to a VEGF such as VEGF-A.
[0133] CDRs are defined as the complementarity determining region
amino acid sequences of an antigen binding protein. These are the
hypervariable regions of immunoglobulin heavy and light chains.
[0134] Throughout this specification, amino acid residues in
variable domain sequences are numbered according to the Kabat
numbering convention, unless otherwise specified. For further
information, see Kabat et al., Sequences of Proteins of
Immunological Interest, 4th Ed., U.S. Department of Health and
Human Services, National Institutes of Health (1987).
[0135] The table below, (Table 1), represents one definition using
each numbering convention for each CDR or binding unit. The Kabat
numbering scheme is used in Table 1 to number the variable domain
amino acid sequence. It should be noted that some of the CDR
definitions may vary depending on the individual publication
used.
TABLE-US-00007 TABLE 1 Numbering Convention for CDRs Minimum Kabat
Chothia AbM Contact binding CDR CDR CDR CDR unit H1 31-35/35A/
26-32/33/ 26-35/35A/ 30-35/35A/ 31-32 35B 34 35B 35B H2 50-65 52-56
50-58 47-58 52-56 H3 95-102 95-102 93-101 95-101 L1 24-34 24-34
24-34 30-36 30-34 L2 50-56 50-56 50-56 46-55 50-55 L3 89-97 89-97
89-97 89-96 89-96
[0136] In one aspect, the present invention provides antigen
binding constructs comprising two dAbs, wherein each dAb is
independently selected and comprises: [0137] i) one or more of CDR
sequences SEQ ID No. 111, 112 and 113; [0138] ii) one or more of
CDR sequences SEQ ID No. 114, 115 and 116; [0139] iii) one or more
of CDR sequences SEQ ID No. 117, 118 and 119; [0140] iv) one or
more of CDR sequences SEQ ID No. 120, 121 and 122; [0141] v) one or
more of CDR sequences SEQ ID No. 123, 124 and 125; [0142] vi) one
or more of CDR sequences SEQ ID No. 126, 127 and 128; or [0143]
vii) one or more of CDR sequences SEQ ID No. 129, 130 and 131.
[0144] In a further aspect, the present invention provides antigen
binding constructs comprising two dAbs, wherein the dAb attached to
the N-terminus of the Fc region of an antibody comprises one or
more CDR sequences SEQ ID No. 114, 115 and 116, and the dAb
attached to the C-terminus of the Fc region of an antibody
comprises one or more CDR sequences SEQ ID No. 117, 118 and
119.
[0145] In a yet further aspect, the present invention provides
antigen binding constructs comprising one dAb, which comprises:
[0146] i) one or more of CDR sequences SEQ ID No. 117, 118 and 119;
[0147] ii) one or more of CDR sequences SEQ ID No. 120, 121 and
122; [0148] iii) one or more of CDR sequences SEQ ID No. 123, 124
and 125; [0149] iv) one or more of CDR sequences SEQ ID No. 126,
127 and 128; or [0150] v) one or more of CDR sequences SEQ ID No.
129, 130 and 131.
[0151] In one aspect there is provided an antigen binding construct
or dimer which competes with an antigen binding construct or dimer
herein described, for example, for binding to a VEGF, such as VEGF
A.
[0152] In one aspect an antigen binding construct and dimers as
described herein are able to compete with Avastin for binding to
VEGF-A.
[0153] It will be understood that any of the antigen-binding
constructs and dimers described herein will be capable of
neutralising one or more antigens.
[0154] The term "neutralises" and grammatical variations thereof as
used throughout the present specification in relation to antigen
binding constructs of the invention means that a biological
activity of the target is reduced, either totally or partially, in
the presence of the antigen binding constructs of the present
invention in comparison to the activity of the target in the
absence of such antigen binding constructs. Neutralisation may be
due to but not limited to one or more of blocking ligand binding,
preventing the ligand activating the receptor, down regulating the
receptor or affecting effector functionality.
[0155] Methods of assessing neutralisation, for example, by
assessing the decreased binding between the ligand and its receptor
in the presence of neutralising antigen binding construct are known
in the art, and include receptor binding assays (see Examples 7,
17, 26, 41 and 50 herein) and rabbit retinal leakage model (see
Examples 9 and 42 herein).
[0156] The invention also relates to a polynucleotide sequence
encoding an antigen binding construct of the invention, or encoding
a part of such a construct such as an epitope binding domain
sequence. Suitably the polynucleotide encodes a polypeptide able to
bind to a VEGF, such as VEGF-A. The invention also relates to a
polynucleotide sequence encoding an antigen having at least 70%
sequence identity to that antigen binding construct or portion
thereof, such as at least 75%, at least 80%, at least 85%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%.
In one aspect the antigen binding construct or portion thereof is
able to bind to a VEGF, such as VEGF-A and prevent or treat in
whole or in part disease associated with a VEGF, such as VEGF-A
signalling.
[0157] The invention also relates to a polynucleotide sequences
having at least 70% sequence identity to specific polynucleotide
sequences disclosed herein, such as at least 75%, at least 80%, at
least 85%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 971%, at least
98%, at least 99% identity.
[0158] The antigen binding constructs of the present invention may
be produced by transfection of a host cell with an expression
vector comprising the coding sequence for the antigen binding
construct of the invention. An expression vector or recombinant
plasmid is produced by placing these coding sequences for the
antigen binding construct in operative association with
conventional regulatory control sequences capable of controlling
the replication and expression in, and/or secretion from, a host
cell. Regulatory sequences include promoter sequences, e.g., CMV
promoter, and signal sequences which can be derived from other
known antibodies. Similarly, a second expression vector can be
produced having a DNA sequence which encodes a complementary
antigen binding construct. In certain embodiments this second
expression vector is identical to the first except insofar as the
coding sequences and selectable markers are concerned, so to ensure
as far as possible that each polypeptide chain is functionally
expressed. Alternatively, the coding sequences for the two antigen
binding constructs that form a homodimer or heterodimer may reside
on a single vector, for example in two expression cassettes in the
same vector.
[0159] In one aspect, the present invention relates to a
recombinant transformed or transfected host cell comprising one or
more polynucleotide sequences encoding an antigen binding
construct, homodimer or heterodimer as herein described.
[0160] A selected host cell can be co-transfected by conventional
techniques with both the first and second vectors (or simply
transfected by a single vector) to create the transfected host cell
of the invention. The transfected cell is then cultured by
conventional techniques to produce the engineered antigen binding
construct of the invention, homodimer or heterodimer. The antigen
binding construct, homodimer or heterodimer is screened from
culture by appropriate assay, such as ELISA or RIA. Similar
conventional techniques may be employed to construct other antigen
binding construct, homodimers or heterodimers as disclosed
herein.
[0161] Suitable vectors for the cloning and subcloning steps
employed in the methods and construction of the compositions of
this invention may be selected by one of skill in the art. For
example, the conventional pUC series of cloning vectors may be
used, such as pUC19. Additionally, any vector which is capable of
replicating readily, has an abundance of cloning sites and
selectable genes (e.g., antibiotic resistance), and is easily
manipulated may be used for cloning. Thus, the selection of the
cloning vector is not a limiting factor in this invention.
[0162] The expression vectors may also be characterized by genes
suitable for amplifying expression of the heterologous DNA
sequences, e.g., the mammalian dihydrofolate reductase gene (DHFR).
Other preferable vector sequences include a poly A signal sequence,
such as from bovine growth hormone (BGH) and the betaglobin
promoter sequence (betaglopro). The expression vectors useful
herein may be synthesized by techniques well known to those skilled
in this art.
[0163] The components of such vectors, e.g. replicons, selection
genes, enhancers, promoters, signal sequences and the like, may be
obtained from commercial or natural sources or synthesized by known
procedures for use in directing the expression and/or secretion of
the product of the recombinant DNA in a selected host. Other
appropriate expression vectors of which numerous types are known in
the art for mammalian, bacterial, insect, yeast, and fungal
expression may also be selected for this purpose.
[0164] The present invention also encompasses a cell line
transfected with a recombinant plasmid containing the coding
sequences of the antigen binding constructs, homodimers or
heterodimers of the present invention. Host cells useful for the
cloning and other manipulations of these cloning vectors are also
conventional. However, cells from various strains of E. coli may be
used for replication of the cloning vectors and other steps in the
construction of antigen binding constructs, homodimers or
heterodimers of this invention.
[0165] Suitable host cells or cell lines for the expression of the
antigen binding constructs, heterodimers, or homodimers of the
invention include mammalian cells such as NS0, Sp2/0, CHO (e.g.
DG44), COS, HEK, a fibroblast cell (e.g., 3T3), and myeloma cells,
for example it may be expressed in a CHO or a myeloma cell. Human
cells may be used, thus enabling the molecule to be modified with
human glycosylation patterns. Alternatively, other eukaryotic cell
lines may be employed. The selection of suitable mammalian host
cells and methods for transformation, culture, amplification,
screening and product production and purification are known in the
art. See, e.g., Sambrook, J., Fritsch, E., Maniatis, T. 1989: Cold
Spring harbour Press, Molecular Cloning: Laboratory Manual.
[0166] Bacterial cells and where desired strains of yeast cells
known to those skilled in the art are also available as host cells,
as well as insect cells, e.g. Drosophila and Lepidoptera and viral
expression systems. See, e.g. Miller et al., Genetic Engineering,
8:277-298, Plenum Press (1986) and references cited therein.
[0167] In another aspect, the invention relates to a method for the
production of an antigen binding construct, homodimer or
heterodimer as herein described, which method comprises the step of
culturing a host cell and isolating the antigen binding construct,
homodimer or heterodimer.
[0168] The present invention also provides a method for the
production of an antigen binding construct, homodimer or
heterodimer as described herein comprising the steps of: a)
culturing a recombinant host cell comprising an expression vector
comprising the isolated nucleic acid as described herein, wherein
the FUT8 gene encoding alpha-1,6-fucosyltransferase has been
inactivated in the recombinant host cell; and b) recovering the
antigen binding protein.
[0169] Such methods for the production of antigen binding
constructs, heterodimers and homodimers can be performed, for
example, using the POTELLIGENT.TM. technology system available from
BioWa, Inc. (Princeton, N.J.) which may produce antigen binding
constructs, homodimers and heterodimers having enhanced antibody
dependent cell mediated cytotoxicity (ADCC) activity that is
increased relative to an identical protein produced in a cell with
a functional FUT8 gene. Aspects of the POTELLIGENT.TM. technology
system are described in U.S. Pat. No. 7,214,775, U.S. Pat. No.
6,946,292, WO0061739 and WO0231240 all of which are incorporated
herein by reference. Those of ordinary skill in the art will also
recognize other appropriate systems.
[0170] The present invention also provides a method of producing an
antigen binding construct, homodimer or heterodimer as described
herein comprising the steps of:
[0171] a) culturing a recombinant host cell comprising an
expression vector comprising an isolated nucleic acid as described
herein wherein the expression vector comprises a nucleic acid
sequence encoding an Fc domain having both IgG1 and IgG3 Fc domain
amino acid residues; and
[0172] b) recovering the antigen binding protein.
[0173] Such methods for the production of antigen binding
constructs, heterodimers and homodimers can be performed, for
example, using the COMPLEGENT.TM. technology system available from
BioWa, Inc. (Princeton, N.J.) and Kyowa Hakko Kogyo (now, Kyowa
Hakko Kirin Co., Ltd.) Co., Ltd. in which a recombinant host cell
comprising an expression vector in which a nucleic acid sequence
encoding a chimeric Fc domain having both IgG1 and IgG3 Fc domain
amino acid residues is expressed to produce an antigen binding
construct, heterodimer or homodimer having enhanced complement
dependent cytotoxicity (CDC) activity that is increased relative to
an otherwise identical protein lacking such a chimeric Fc domain.
Aspects of the COMPLEGENT.TM. technology system are described in
WO2007011041 and US20070148165 each of which are incorporated
herein by reference. In an alternative embodiment CDC activity may
be increased by introducing sequence specific mutations into the Fc
region of an IgG chain. Those of ordinary skill in the art will
also recognize other appropriate systems.
[0174] It will be apparent to those skilled in the art that such
modifications may not only be used alone but may be used in
combination with each other in order to further enhance effector
function.
[0175] In one aspect of the present invention there is provided an
antigen binding construct, heterodimer or homodimer comprising a
heavy chain constant region which comprises a mutated and chimaeric
heavy chain constant region, comprising at least one CH2 domain
from IgG3 and one CH2 domain from IgG1, wherein the IgG1 CH2 domain
has one or more mutations at positions selected from 239 and 332
and 330 (for example the mutations may be selected from S239D and
I332E and A330L) such that the antigen binding protein has enhanced
effector function, for example wherein it has one or more of the
following functions, enhanced ADCC or enhanced CDC, for example
wherein it has enhanced ADCC and enhanced CDC. In one aspect the
IgG1 CH2 domain has the mutations S239D and I332E.
[0176] In an alternative aspect of the present invention there is
provided an antigen binding construct, heterodimer or homdimer,
comprising a chimaeric heavy chain constant region and which has an
altered glycosylation profile. In one such aspect, the heavy chain
constant region comprises at least one CH2 domain from IgG3 and one
CH2 domain from IgG1 and has an altered glycosylation profile such
that the ratio of fucose to mannose is 0.8:3 or less, for example
wherein the antigen binding protein is defucosylated so that said
antigen binding protein has an enhanced effector function in
comparison with an equivalent antigen binding protein with an
immunoglobulin heavy chain constant region lacking said mutations
and altered glycosylation profile, for example wherein it has one
or more of the following functions, enhanced ADCC or enhanced CDC,
for example wherein it has enhanced ADCC and enhanced CDC
[0177] In one aspect of the invention, there is provided a method
of producing an antigen binding construct, heterodimer or homdimer
as described herein which uses the ACCRETAMAB.TM. technology system
available from BioWa, Inc. (Princeton, N.J.) which combines the
POTELLIGENT.TM. and COMPLEGENT.TM. technology systems to produce an
antigen binding protein having both ADCC and CDC enhanced activity
that is increased relative to an otherwise identical monoclonal
antibody lacking a chimeric Fc domain and which has fucose on the
oligosaccharide.
[0178] Another method of expression of the antigen binding
constructs may utilize expression in a transgenic animal, such as
described in U.S. Pat. No. 4,873,316. This relates to an expression
system using the animal's casein promoter which when transgenically
incorporated into a mammal permits the female to produce the
desired recombinant protein in its milk.
[0179] The invention also relates to a method for producing an
antigen binding construct as disclosed herein wherein the amino
acid sequence of an antigen binding construct or a nucleic acid
encoding it, or a part thereof, is designed using a computer and
wherein the construct exists in silico on the computer.
[0180] The invention also provides antigen-binding constructs
disclosed herein for use in medicine, for example for use in the
manufacture of a medicament for treating diseases associated with a
VEGF signalling, such as VEGF-A signalling, such as cancer and
ocular diseases such as Diabetic Macular Edema (DME), Wet AMD
(Age-related macular degeneration), Diabetic retinopathy, RVO,
(retinal vein occlusion), and corneal neovascularisation.
[0181] The invention also relates to a method of treating a patient
suffering from ocular vascular diseases caused by a VEGF
signalling, such as VEGF-A, such as cancer and ocular diseases such
as Diabetic Macular Edema (DME), Wet AMD, Diabetic retinopathy,
RVO, and corneal neovascularisation, comprising administering a
therapeutic amount of an antigen-binding construct of the
invention.
[0182] The invention also relates to an antigen-binding construct
of the invention for the treatment of cancer and ocular diseases
such as Diabetic Macular Edema (DME), Wet AMD, Diabetic
retinopathy, RVO, and corneal neovascularisation.
[0183] The dose and duration of treatment relates to the relative
duration of the molecules of the present invention in the human
circulation, and can be adjusted by one of skill in the art
depending upon the condition being treated and the general health
of the patient. It is envisaged that repeated dosing (e.g. once a
week or once every two weeks) over an extended time period (e.g.
four to six months) maybe required to achieve maximal therapeutic
efficacy.
[0184] The mode of administration of the therapeutic agent of the
invention may be any suitable route which delivers the agent to the
host. The antigen binding constructs, and pharmaceutical
compositions of the invention are particularly useful for
parenteral administration, i.e., subcutaneously (s.c.),
intrathecally, intraperitoneally, intramuscularly (i.m.),
intravenously (i.v.), or intranasally.
[0185] In one aspect the administration is for an ocular indication
and the administration is by local ocular delivery such as
intravitreal, (direct injection into the vitreous of the eye) or is
periocular, such as for example is trans-scleral, subconjunctival,
sub-tenon, peribulbar, topical, retrobulbar or is delivered to the
inferior, superior or lateral rectus muscle. In one aspect the
administration is by trans-scleral or topical ocular delivery.
[0186] For local administration to the eye, for example by
intravitreal injection, the pharmaceutical preparation could be
administered in a total volume of up to 100 .mu.L, for example,
50-100 .mu.L, administered by a single injection by a standard
syringe with a needle gauge of 25-30 g, such as a 50 .mu.l volume
administered with a 30 g needle. Such formulations if prepared for
infrequent administration may contain up to 15% of solid suspension
within the liquid volume. The dose of active pharmaceutical in such
a formulation would vary but in a preferred aspect could include up
to 25-30% of the solid suspension. In a preferred aspect 0.5-2.5 mg
of active pharmaceutical is administered perocular
administration.
[0187] In one aspect the administration uses a sustained or
slow-release delivery system such as microparticles or a gel-based
system, or a liposome based system or any other system known to
those skilled in the art that would allow administration locally to
the eye, suitably at frequency reduced when compared to a monthly
injection regime. Such regimes may allow delivery less frequently
than once a week or once every two weeks, and for example could be
once every 4 weeks, once every 2 months or 8 weeks, every 3 months
or 12 weeks, every 4 months or 16 weeks, every 5 months or 20
weeks, every 6 months or 24 weeks, every 9 months or 36 weeks, or
every 12 months or 52 weeks. A preferred delivery frequency for the
antigen binding constructs, heterodimers and homodimers of the
present invention is once every 6 months or 24 weeks.
[0188] Therapeutic agents of the invention may be prepared as
pharmaceutical compositions containing an effective amount of an
antigen binding construct, homodimer or heterodimer of the
invention as an active ingredient in a pharmaceutically acceptable
carrier. In the prophylactic agent of the invention, an aqueous
suspension or solution containing the antigen binding construct,
preferably buffered at physiological pH, in a form ready for
injection is preferred. The compositions for parenteral
administration will commonly comprise a solution of the antigen
binding construct of the invention or a cocktail thereof dissolved
in a pharmaceutically acceptable carrier, preferably an aqueous
carrier. A variety of aqueous carriers may be employed, e.g., 0.9%
saline, 0.3% glycine, and the like. These solutions may be made
sterile and generally free of particulate matter. These solutions
may be sterilized by conventional, well known sterilization
techniques (e.g., filtration). The compositions may contain
pharmaceutically acceptable auxiliary substances as required to
approximate physiological conditions such as pH adjusting and
buffering agents, etc. The concentration of the antigen binding
construct of the invention in such pharmaceutical formulation can
vary widely, i.e., from less than about 0.5%, usually at or at
least about 1% to as much as 15 or 20% by weight and will be
selected primarily based on fluid volumes, viscosities, etc.,
according to the particular mode of administration selected.
[0189] Thus, a pharmaceutical composition of the invention for
intramuscular injection could be prepared to contain 1 mL sterile
buffered water, and between about 1 ng to about 100 mg, e.g. about
50 ng to about 30 mg or more preferably, about 5 mg to about 25 mg,
of an antigen binding construct of the invention. Similarly, a
pharmaceutical composition of the invention for intravenous
infusion could be made up to contain about 250 ml of sterile
Ringer's solution, and about 1 to about 30 and preferably 5 mg to
about 25 mg of an antigen binding construct of the invention per ml
of Ringer's solution. Actual methods for preparing parenterally
administrable compositions are well known or will be apparent to
those skilled in the art and are described in more detail in, for
example, Remington's Pharmaceutical Science, 15th ed., Mack
Publishing Company, Easton, Pa. For the preparation of
intravenously administrable antigen binding construct formulations
of the invention see Lasmar U and Parkins D "The formulation of
Biopharmaceutical products", Pharma. Sci. Tech. today, page
129-137, Vol. 3 (3.sup.rd April 2000), Wang, W "Instability,
stabilisation and formulation of liquid protein pharmaceuticals",
Int. J. Pharm 185 (1999) 129-188, Stability of Protein
Pharmaceuticals Part A and B ed Ahern T. J., Manning M. C., New
York, N.Y.: Plenum Press (1992), Akers, M. J. "Excipient-Drug
interactions in Parenteral Formulations", J. Pharm Sci 91 (2002)
2283-2300, Imamura, K et al "Effects of types of sugar on
stabilization of Protein in the dried state", J Pharm Sci 92 (2003)
266-274, Izutsu, Kkojima, S. "Excipient crystallinity and its
protein-structure-stabilizing effect during freeze-drying", J
Pharm. Pharmacol, 54 (2002) 1033-1039, Johnson, R,
"Mannitol-sucrose mixtures-versatile formulations for protein
lyophilization", J. Pharm. Sci, 91 (2002) 914-922.
[0190] Ha, E Wang W, Wang Y. j. "Peroxide formation in polysorbate
80 and protein stability", J. Pharm Sci, 91, 2252-2264, (2002) the
entire contents of which are incorporated herein by reference and
to which the reader is specifically referred.
[0191] It is preferred that the therapeutic agent of the invention,
when in a pharmaceutical preparation, be present in unit dose
forms. The appropriate therapeutically effective dose will be
determined readily by those of skill in the art. Suitable doses may
be calculated for patients according to their weight, for example
suitable doses may be in the range of 0.01 to 20 mg/kg, for example
0.1 to 20 mg/kg, for example 1 to 20 mg/kg, for example 10 to 20
mg/kg or for example 1 to 15 mg/kg, for example 10 to 15 mg/kg. To
effectively treat conditions of use in the present invention in a
human, suitable doses may be within the range of 0.01 to 1000 mg,
for example 0.1 to 1000 mg, for example 0.1 to 500 mg, for example
500 mg, for example 0.1 to 100 mg, or 0.1 to 80 mg, or 0.1 to 60
mg, or 0.1 to 40 mg, or for example 1 to 100 mg, or 1 to 50 mg, of
an antigen binding construct of this invention, which may be
administered parenterally, for example subcutaneously,
intravenously or intramuscularly. Such dose may, if necessary, be
repeated at appropriate time intervals selected as appropriate by a
physician.
[0192] The antigen binding constructs described herein can be
lyophilized for storage and reconstituted in a suitable carrier
prior to use. This technique has been shown to be effective with
conventional immunoglobulins and art-known lyophilization and
reconstitution techniques can be employed.
[0193] There are several methods known in the art which can be used
to generate epitope-binding domains of use in the present
invention.
[0194] In one example, the methods employ a display system that
links the coding function of a nucleic acid and physical, chemical
and/or functional characteristics of the polypeptide encoded by the
nucleic acid. Such a display system can comprise a plurality of
replicable genetic packages, such as bacteriophage or cells
(bacteria). The display system may comprise a library, such as a
bacteriophage display library. Bacteriophage display is an example
of a display system.
[0195] The term "library" refers to a mixture of heterogeneous
polypeptides or nucleic acids. The library is composed of members,
each of which has a single polypeptide or nucleic acid sequence. To
this extent, "library" is synonymous with "repertoire." Sequence
differences between library members are responsible for the
diversity present in the library. The library may take the form of
a simple mixture of polypeptides or nucleic acids, or may be in the
form of organisms or cells, for example bacteria, viruses, animal
or plant cells and the like, transformed with a library of nucleic
acids. In one example, each individual organism or cell contains
only one or a limited number of library members.
[0196] Advantageously, the nucleic acids are incorporated into
expression vectors, in order to allow expression of the
polypeptides encoded by the nucleic acids. In a one aspect,
therefore, a library may take the form of a population of host
organisms, each organism containing one or more copies of an
expression vector containing a single member of the library in
nucleic acid form which can be expressed to produce its
corresponding polypeptide member. Thus, the population of host
organisms has the potential to encode a large repertoire of diverse
polypeptides.
[0197] A number of suitable bacteriophage display systems (e.g.,
monovalent display and multivalent display systems) have been
described. (See, e.g., Griffiths et al., U.S. Pat. No. 6,555,313 B1
(incorporated herein by reference); Johnson et al., U.S. Pat. No.
5,733,743 (incorporated herein by reference); McCafferty et al.,
U.S. Pat. No. 5,969,108 (incorporated herein by reference);
Mulligan-Kehoe, U.S. Pat. No. 5,702,892 (Incorporated herein by
reference); Winter, G. et al., Annu. Rev. Immunol. 12:433-455
(1994); Soumillion, P. et al., Appl. Biochem. Biotechnol.
47(2-3):175-189 (1994); Castagnoli, L. et al., Comb. Chem. High
Throughput Screen, 4(2):121-133 (2001).) The peptides or
polypeptides displayed in a bacteriophage display system can be
displayed on any suitable bacteriophage, such as a filamentous
phage (e.g., fd, M13, F1), a lytic phage (e.g., T4, T7, lambda), or
an RNA phage (e.g., MS2), for example.
[0198] When a display system (e.g., a system that links coding
function of a nucleic acid and functional characteristics of the
peptide or polypeptide encoded by the nucleic acid), such as phage
display, is used in the methods described herein, eg in the
selection of a dAb or other epitope binding domain, it is
frequently advantageous to amplify or increase the copy number of
the nucleic acids that encode the selected peptides or
polypeptides. This provides an efficient way of obtaining
sufficient quantities of nucleic acids and/or peptides or
polypeptides for additional rounds of selection, using the methods
described herein or other suitable methods, or for preparing
additional repertoires (e.g., affinity maturation repertoires).
Nucleic acids can be amplified using any suitable methods, such as
by phage amplification, cell growth or polymerase chain
reaction.
[0199] Generally, a library of phage that displays a repertoire of
peptides or phage polypeptides, as fusion proteins with a suitable
phage coat protein (e.g., fd pill protein), is produced or
provided. The fusion protein can display the peptides or
polypeptides at the tip of the phage coat protein, or if desired at
an internal position. For example, the displayed peptide or
polypeptide can be present at a position that is amino-terminal to
domain 1 of pill. (Domain 1 of pill is also referred to as N1.) The
displayed polypeptide can be directly fused to pill (e.g., the
N-terminus of domain 1 of pill) or fused to pill using a linker. If
desired, the fusion can further comprise a tag (e.g., myc epitope,
His tag). Libraries that comprise a repertoire of peptides or
polypeptides that are displayed as fusion proteins with a phage
coat protein, can be produced using any suitable methods, such as
by introducing a library of phage vectors or phagemid vectors
encoding the displayed peptides or polypeptides into suitable host
bacteria, and culturing the resulting bacteria to produce phage
(e.g., using a suitable helper phage or complementing plasmid if
desired). The library of phage can be recovered from the culture
using any suitable method, such as precipitation and
centrifugation.
[0200] The display system can comprise a repertoire of peptides or
polypeptides that contains any desired amount of diversity. For
example, the repertoire can contain peptides or polypeptides that
have amino acid sequences that correspond to naturally occurring
polypeptides expressed by an organism, group of organisms, desired
tissue or desired cell type, or can contain peptides or
polypeptides that have random or randomized amino acid sequences.
If desired, the polypeptides can share a common core or scaffold.
For example, all polypeptides in the repertoire or library can be
based on a scaffold selected from protein A, protein L, protein G,
a fibronectin domain, an anticalin, CTLA4, a desired enzyme (e.g.,
a polymerase, a cellulase), or a polypeptide from the
immunoglobulin superfamily, such as an antibody or antibody
fragment (e.g., an antibody variable domain). The polypeptides in
such a repertoire or library can comprise defined regions of random
or randomized amino acid sequence and regions of common amino acid
sequence. In certain embodiments, all or substantially all
polypeptides in a repertoire are of a desired type, such as a
desired enzyme (e.g., a polymerase) or a desired antigen-binding
fragment of an antibody (e.g., human V.sub.H or human V.sub.L). In
some embodiments, the polypeptide display system comprises a
repertoire of polypeptides wherein each polypeptide comprises an
antibody variable domain. For example, each polypeptide in the
repertoire can contain a V.sub.H, a V.sub.L or an Fv (e.g., a
single chain Fv).
[0201] Amino acid sequence diversity can be introduced into any
desired region of a peptide or polypeptide or scaffold using any
suitable method. For example, amino acid sequence diversity can be
introduced into a target region, such as a complementarity
determining region of an antibody variable domain or a hydrophobic
domain, by preparing a library of nucleic acids that encode the
diversified polypeptides using any suitable mutagenesis methods
(e.g., low fidelity PCR, oligonucleotide-mediated or site directed
mutagenesis, diversification using NNK codons) or any other
suitable method. If desired, a region of a polypeptide to be
diversified can be randomized.
[0202] The size of the polypeptides that make up the repertoire is
largely a matter of choice and uniform polypeptide size is not
required. The polypeptides in the repertoire may have at least
tertiary structure (form at least one domain).
[0203] An epitope binding domain or population of domains can be
selected, isolated and/or recovered from a repertoire or library
(e.g., in a display system) using any suitable method. For example,
a domain is selected or isolated based on a selectable
characteristic (e.g., physical characteristic, chemical
characteristic, functional characteristic). Suitable selectable
functional characteristics include biological activities of the
peptides or polypeptides in the repertoire, for example, binding to
a generic ligand (e.g., a superantigen), binding to a target ligand
(e.g., an antigen, an epitope, a substrate), binding to an antibody
(e.g., through an epitope expressed on a peptide or polypeptide),
and catalytic activity. (See, e.g., Tomlinson et al., WO 99/20749;
WO 01/57065; WO 99/58655.)
[0204] The members of the immunoglobulin superfamily all share a
similar fold for their polypeptide chain. For example, although
antibodies are highly diverse in terms of their primary sequence,
comparison of sequences and crystallographic structures has
revealed that, contrary to expectation, five of the six antigen
binding loops of antibodies (H1, H2, L1, L2, L3) adopt a limited
number of main-chain conformations, or canonical structures
(Chothia and Lesk (1987) J. Mol. Biol., 196: 901; Chothia et al.
(1989) Nature, 342: 877). Analysis of loop lengths and key residues
has therefore enabled prediction of the main-chain conformations of
H1, H2, L1, L2 and L3 found in the majority of human antibodies
(Chothia et al. (1992) J. Mol. Biol., 227: 799; Tomlinson et al.
(1995) EMBO J., 14: 4628; Williams et al. (1996) J. Mol. Biol.,
264: 220). Although the H3 region is much more diverse in terms of
sequence, length and structure (due to the use of D segments), it
also forms a limited number of main-chain conformations for short
loop lengths which depend on the length and the presence of
particular residues, or types of residue, at key positions in the
loop and the antibody framework (Martin et al. (1996) J. Mol.
Biol., 263: 800; Shirai et al. (1996) FEBS Letters, 399: 1).
[0205] The dAbs are advantageously assembled from libraries of
domains, such as libraries of V.sub.H domains and/or libraries of
V.sub.L domains. In one aspect, libraries of domains are designed
in which certain loop lengths and key residues have been chosen to
ensure that the main-chain conformation of the members is known.
Advantageously, these are real conformations of immunoglobulin
superfamily molecules found in nature, to minimise the chances that
they are non-functional, as discussed above. Variations may occur
at a low frequency, such that a small number of functional members
may possess an altered main-chain conformation, which does not
affect its function.
[0206] Where several known main-chain conformations or a single
known main-chain conformation has been selected, dAbs may be
constructed by varying the binding site of the molecule in order to
generate a repertoire with structural and/or functional diversity.
This means that variants are generated such that they possess
sufficient diversity in their structure and/or in their function so
that they are capable of providing a range of activities.
[0207] In one aspect, the present invention include sequences which
are substantially identical, for example sequences which are at
least 90% identical, for example which are at least 91%, or at
least 92%, or at least 93%, or at least 94% or at least 95%, or at
least 96%, or at least 97% or at least 98%, or at least 99%
identical to the sequences described herein.
[0208] For nucleic acids, the term "substantial identity" indicates
that two nucleic acids, or designated sequences thereof, when
optimally aligned and compared, are identical, with appropriate
nucleotide insertions or deletions, in at least about 80% of the
nucleotides, usually at least about 90% to 95%, and more preferably
at least about 98% to 99.5% of the nucleotides. Alternatively,
substantial identity exists when the segments will hybridize under
selective hybridization conditions, to the complement of the
strand.
[0209] For nucleotide and amino acid sequences, the term
"identical" indicates the degree of identity between two nucleic
acid or amino acid sequences when optimally aligned and compared
with appropriate insertions or deletions. Alternatively,
substantial identity exists when the DNA segments will hybridize
under selective hybridization conditions, to the complement of the
strand.
[0210] The percent identity between two sequences is a function of
the number of identical positions shared by the sequences (i.e., %
identity=no. of identical positions/total no. of positions times
100), taking into account the number of gaps, and the length of
each gap, which need to be introduced for optimal alignment of the
two sequences. The comparison of sequences and determination of
percent identity between two sequences can be accomplished using a
mathematical algorithm, as described in the non-limiting examples
below.
[0211] The percent identity between two nucleotide sequences can be
determined using the GAP program in the GCG software package, using
a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80
and a length weight of 1, 2, 3, 4, 5, or 6. The percent identity
between two nucleotide or amino acid sequences can also be
determined using the algorithm of E. Meyers and W. Miller (Comput.
Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the
ALIGN program (version 2.0), using a PAM120 weight residue table, a
gap length penalty of 12 and a gap penalty of 4. In addition, the
percent identity between two amino acid sequences can be determined
using the Needleman and Wunsch (J. Mol. Biol. 48:444-453 (1970))
algorithm which has been incorporated into the GAP program in the
GCG software package, using either a Blossum 62 matrix or a PAM250
matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length
weight of 1, 2, 3, 4, 5, or 6.
[0212] By way of example, a polynucleotide sequence of the present
invention may be identical to a reference sequence, that is be 100%
identical, or it may include up to a certain integer number of
nucleotide alterations as compared to the reference sequence. Such
alterations are selected from the group consisting of at least one
nucleotide deletion, substitution, including transition and
transversion, or insertion, and wherein said alterations may occur
at the 5 or 3' terminal positions of the reference nucleotide
sequence or anywhere between those terminal positions, interspersed
either individually among the nucleotides in the reference sequence
or in one or more contiguous groups within the reference sequence.
The number of nucleotide alterations is determined by multiplying
the total number of nucleotides in the reference sequence by the
numerical percent of the respective percent identity (divided by
100) and subtracting that product from said total number of
nucleotides in the reference sequence, or:
[0213] nn.ltoreq.xn-(xny), wherein nn is the number of nucleotide
alterations, xn is the total number of nucleotides in the reference
sequence, and y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.80
for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%, 0.97 for 97% or
1.00 for 100% identity, and wherein any non-integer product of xn
and y is rounded down to the nearest integer prior to subtracting
it from xn. Alterations of the polynucleotide sequence of the
reference sequence may create nonsense, missense or frameshift
mutations in this coding sequence and thereby alter the polypeptide
encoded by the polynucleotide following such alterations.
[0214] Similarly, in another example, a polypeptide sequence of the
present invention may be identical to a reference sequence, that is
be 100% identical, or it may include up to a certain integer number
of amino acid alterations as compared to the reference sequence
such that the % identity is less than 100%. Such alterations are
selected from the group consisting of at least one amino acid
deletion, substitution, including conservative and non-conservative
substitution, or insertion, and wherein said alterations may occur
at the amino- or carboxy-terminal positions of the reference
polypeptide sequence or anywhere between those terminal positions,
interspersed either individually among the amino acids in the
reference sequence or in one or more contiguous groups within the
reference sequence. The number of amino acid alterations for a
given % identity is determined by multiplying the total number of
amino acids in the polypeptide sequence encoded by the reference
sequence by the numerical percent of the respective percent
identity (divided by 100) and then subtracting that product from
said total number of amino acids in the polypeptide reference
sequence or:
na.ltoreq.xa-(xay),
[0215] wherein na is the number of amino acid alterations, xa is
the total number of amino acids in the polypeptide sequence and y
is, for instance, 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc.,
and wherein any non-integer product of xa and y is rounded down to
the nearest integer prior to subtracting it from xa.
[0216] The principal features of this invention can be employed in
various embodiments without departing from the scope of the
invention. Those skilled in the art will recognize, or be able to
ascertain using no more than routine study, numerous equivalents to
the specific procedures described herein. Such equivalents are
considered to be within the scope of this invention and are covered
by the claims. All publications and patent applications mentioned
in the specification are indicative of the level of skill of those
skilled in the art to which this invention pertains. All
publications and patent applications are herein incorporated by
reference to the same extent as if each individual publication or
patent application was specifically and individually indicated to
be incorporated by reference. The use of the word "a" or an when
used in conjunction with the term "comprising" in the claims and/or
the specification may mean "one," but it is also consistent with
the meaning of "one or more," "at least one," and "one or more than
one." The use of the term or in the claims is used to mean "and/or"
unless explicitly indicated to refer to alternatives only or the
alternatives are mutually exclusive, although the disclosure
supports a definition that refers to only alternatives and
"and/or." Throughout this application, the term "about" is used to
indicate that a value includes the inherent variation of error for
the device, the method being employed to determine the value, or
the variation that exists among the study subjects.
[0217] The term "or combinations thereof" as used herein refers to
all permutations and combinations of the listed items preceding the
term. For example, "A, B, C, or combinations thereof is intended to
include at least one of: A, B, C, AB, AC, BC, or ABC, and if order
is important in a particular context, also BA, CA, CB, CBA, BCA,
ACB, BAC, or CAB.
EXAMPLES
[0218] It will be understood that particular embodiments described
herein are shown by way of illustration and not as limitations of
the invention.
[0219] Throughout the examples references are made to dAb-Fc,
Fc-dAb and dAb-Fc-dAb molecules. The terms "dAb-Fc" and "Fc-dAb"
are simple references to dimers comprising two antigen binding
constructs wherein each antigen binding construct has a dAb
attached to either the N-terminus (dAb-Fc) or C-terminus (Fc-dAb),
directly or indirectly through a linker.
[0220] Similarly, the term "dAb-Fc-dAb" refers to dimers comprising
two antigen binding constructs wherein each antigen binding
construct has a dAb attached to the N-terminus and a dAb attached
to the C-terminus; directly or indirectly through a linker.
Example 1
Expression of Vh dAb-Fc Molecules
[0221] DMS1529, (SEQ ID NO:1 & 29), has been described in
WO2008/149150/A20. DMS1576, (SEQ ID NO:2 & 30), was generated
by site directed mutagenesis from DMS1529 converting amino acid 56
from Y to N. DMS1529 and DMS1576 were manufactured from either
CHROMOS pooled (or bulk) transfections or stable polyclonal or
monoclonal CHO cell lines using GlaxoSmithKline's generic
monoclonal antibody production process platform using a combination
of shake flask and stirred tank suspension culture. Bioreactors are
monitored and maintained at controlled conditions for agitation
speed, dissolved oxygen concentration, pH and temperature.
Dissolved oxygen is maintained through the addition of 40% O.sub.2
in N.sub.2 while pH is controlled via automated addition of sodium
carbonate and CO.sub.2. The production culture duration is
determined from a combination of cell viability and minimum
antibody titre. At the end of the production period, the culture in
the bioreactor is clarified by depth filtration and sterile
filtration to generate a batch of clarified unprocessed bulk
(CUB).
Example 2
Purification of Vh dAb-Fc Molecules
[0222] DMS1529 and DMS1576 were captured from clarified cell
culture supernatant (CUB, Example 1) using affinity chromatography
and an automated FPLC purification system. Once loaded, the bound
product was washed using a combination of pH neutral aqueous
buffers to remove non-specifically bound impurities followed by a
low pH elution. Over 90% of bound product was recovered and the pH
of the elution pool then adjusted to pH 3.5 for 30 minutes to
achieve virus neutralisation after which time the pH was adjusted
to pH 4.5. If further purification was required, a further pH
adjustment was performed in order to achieve binding on the second
column. Following binding, the product was washed in a low
conductivity buffer at equivalent pH to further remove
non-specifically bound impurities. The purified dAb-Fc was then
eluted using a pH and salt shift and collected as a pool before 0.2
um filtration and storage. Unless otherwise stated, protein
prepared using only the first, affinity column was analysed for
VEGF binding in the in vitro assays described in the following
examples, however reference will be made when the test material was
further purified, i.e. using the 2.sup.nd column.
Example 3
Molecular Analysis by SDS-PAGE and Size-Exclusion Chromatography
(SEC)
[0223] The molecular integrity, homogeneity and percentage (%)
purity of DMS1529 and DMS1576 were analysed by SDS-PAGE, under both
reducing and non-reducing conditions, and analytical size-exclusion
chromatography (SEC). SDS-PAGE analysis was carried out according
to the manufacturer's instructions using the Novex "NuPAGE" system
and gels were stained with Instant Blue Protein Stain Solution
(Triple Red Ltd). The gels showed band sizes consistent with the
predicted molecular mass of the intact mature proteins
(.about.76-79 kDa) allowing for the presence of the predicted
glycan chains per monomer chain. SEC was carried out using a TSK
gel G2000SWXL column (TOSOH, BioScience). A sodium phosphate/sodium
chloride based mobile phase at neutral pH was used at a flow rate
of 0.5 ml/min. The standard sample injection volume of purified
protein (at approximately 1 mg/ml) was 10 ul. The UV absorbance of
the column effluent was monitored at 214 & 280 nm. The area of
all protein related peaks were integrated to determine the purity
of the peak relating to the molecules. The proteins were confirmed
to be >95% pure target protein by SDS-PAGE and SEC prior to
further analysis in biology assays, (data not shown).
Example 4
VEGF Binding ELISA
[0224] The ability of DMS1529 and DMS1576 to bind specifically to
VEGF.sub.165 was determined and compared to that of Bevacizumab
(Avastin, clinical drug product sourced from Phillip Chapper &
Co. Ltd., UK) by ELISA. An F96 Maxisorp 96 well flat bottom
immunoplate (Nunc, Cat No: 439454) was coated with 100 ul of 25
ug/ml of hVEGF165 (GSK `in house` source of VEGF made from HEK293
mammalian cells) and incubated at 4.degree. C. overnight. The plate
was washed six times with PBS containing 0.05% of Tween-20, 200
.quadrature.l of blocking solution (1% BSA in PBS) was added to
each well and the plate was incubated for 1 h at room temperature.
The plate was then washed with 0.05% Tween-20/PBS. 90 .quadrature.l
of assay diluents (0.1% BSA, 0.05% Tween-20 in PBS) was added to
each well, 10 .quadrature.l of each sample or control (successively
diluted, two-fold over a concentration range from 80-0.08 ng/ml)
were then added across the plate in blocking solution and incubated
for 1 hr at room temperature. The plate was then washed 0.05%
Tween-20/PBS. 100 .quadrature.l of anti-human IgG (Fc specific) HRP
(Sigma, Cat No: A0170) diluted at 1:10,000 in 0.1% BSA, 0.05%
Tween-20 in PBS was added to appropriate wells. The plate was
incubated for 1 hr at room temperature and washed with 0.05%
Tween-20/PBS. 100 .quadrature.l of 3,3',5,5'-Tetramethylbenzidine
(TMB) liquid substrate system (Sigma T0440) was added to each well.
Once sufficient blue colour has developed (expected OD450 of
>2.0), the reaction was stopped 15 minutes later by addition of
100 .mu.L of 0.25M sulphuric acid (Fisher Scientific J/8410/17).
Absorbance was read at 450 nm using the SpectraMax Plus384
Microplate Reader (Molecular Devices) using a basic endpoint
protocol.
[0225] Both DMS1529 and DMS1576 were found to bind specifically in
a similar manner to VEGF.sub.165, and both molecules were shown to
be more potent than Bevacizumab (Avastin) as shown by a reduced
IC50 value, (FIG. 1).
Example 5
VEGF Binding MSD
[0226] The ability of DMS1529 and DMS1576 to bind specifically to
VEGF.sub.165 was determined by MSD (Meso Scale Discovery) assay.
The MSD data show equivalent binding of DMS1529 and DMS1576 to
hVEGF165 after detection with either anti-Vh or anti-Fc
reagents.
Example 6
Binding of DMS1529 and DMS1576 to VEGF Using Surface Plasmon
Resonance
[0227] The binding affinity of the DMS1529 and DMS1576 molecules
for VEGF.sub.165 was determined by surface Plasmon resonance (SPR)
using a Biacore T100 (GE Healthcare), Example 6A, and ProteOn XPR36
protein interaction array system (BioRad) (data not shown).
Example 6A
Binding of DMS1529 and DMS1576 to VEGF Using Biacore
[0228] Protein A was immobilised on a C1 chip by primary amine
coupling and this surface was then used to capture the anti-VEGF
constructs. Human recombinant VEGF (sourced `in house` from
transient transfection of HEK293 cells) was used as the analyte at
256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM and 0.0625 nM. All
binding curves were double referenced with a buffer injection (i.e.
0 nM) and the data was fitted both to the 1:1 model (and to the
bivalent model (inherent to the T100. Regeneration was carried out
using 100 mM H.sub.3PO.sub.4. The run was carried out at room
temperature, using HBS-EP as the running buffer. For the DMS1529
and DMS1576 reliable kinetics could not be obtained due to the poor
fitting of the analysis model to the experimental data, (but
estimates could be made for association and dissociation constants
and these are summarized in Table 2A.
[0229] Both Biacore and ProteOn data show that DMS1529 and DMS1576
have comparable binding kinetics to VEGF.sub.165 using Surface
Plasmon Resonance.
TABLE-US-00008 TABLE 2A Biacore analysis of the binding kinetics of
DMS1529 and DMS1576 to human VEGF.sub.165 to determine ka, kd and
KD 1:1 binding model Bivalent analyte model ka (M-1.s-1) kd (s-1)
KD (M) ka (M-1.s-1) kd (s-1) KD (M) DMS1529 5.23E+05 3.13E-04
5.99E-10 4.89E+05 4.94E-04 1.01E-09 DMS1576 4.60E+05 3.82E-04
8.30E-10 7.95E+05 6.50E-04 8.17E-10
Example 7
VEGF R1 & R2 Receptor Binding Assay
[0230] The potencies of DMS1529 and DMS1576 were analysed in the
VEGF receptor binding assay in comparison to that of Bevacizumab
(Avastin). This assay measures the binding of VEGF165 to either
VEGF R1 or VEGF R2 and the ability of the test molecules to block
this interaction. A MSD standard bind 96 well plate (L11XA-3) was
coated with 0.25 .mu.g/ml VEGF R1 (R&D Systems 321-FL) or VEGF
R2 (R&D 357-KD) in bicarbonate buffer (50 .mu.l/well), covered
with a plate sealer and incubated overnight at 4.degree. C. The
next day the MSD plate was washed 3.times.300 .mu.l/well with Tris
wash buffer and blotted over a pad of tissue to remove excess wash
buffer from the wells. The MSD plate was then blocked with 3% BSA
in PBS (250 .mu.l/well) and incubated shaking (750 RPM) at room
temperature for 1 hour. The MSD plate was washed again before the
addition of a 2.times. concentration of anti-VEGF molecule (25
.mu.l/well) and incubated with shaking (750 RPM) at room
temperature for 10 minutes before the addition of a 2.times.
concentration of rhVEGF, 25 .mu.l/well, R&D Systems (293-VE/CF,
made in insect cells using Baculovirus) or a GSK `in house` source
of VEGF (made from HEK293 mammalian cells, latter data not shown
except Table 3A). The anti-VEGF molecules and the VEGF were
prepared using 0.1% BSA in PBS. The initial assay was performed
with a step in which the anti-VEGF molecule was pre-incubated with
VEGF. The pre-incubations were prepared by adding an equal volume
of a 2.times. concentration of anti-VEGF molecule to an equal
volume of a 2.times. concentration of VEGF (R&D, 293-VE/CF) for
30 minutes at room temperature. The final VEGF concentration used
was long/ml. No VEGF and VEGF alone controls were also included.
The MSD plate was incubated with shaking (750 RPM) at room
temperature for 2 hours after which it was washed again before the
addition of the detection reagent (50 .mu.L/well, goat anti-human
VEGF biotinylated antibody--R&D Systems BAF293) at 0.25
.mu.g/ml in 1% BSA in PBS and incubated with shaking (750 RPM) at
room temperature for 1 hour. The MSD plate was washed again before
the addition of the streptavidin sulfo-TAG (50 .mu.l/well, MSD
R32AD-1) at 2 .mu.g/ml in 1% BSA in PBS and incubated with shaking
(750 RPM) at room temperature for 30 minutes. Prior to measurement
of the electrochemiluminescence in a MSD Sector Imager 6000, the
MSD plate was washed and 150 .mu.l/well of 2.times. Read Buffer T
(MSD R92TC-1) was added. Curve fitting and EC50 calculations were
performed using GraphPad Prism. The ability of DMS1529, DMS1576 and
Bevacizumab (Avastin) to inhibit VEGF binding to VEGFR1 and VEGFR2
was determined as described. The EC50 values are listed in Table
3A.
[0231] A second assay was performed whereby the anti-VEGF agent and
the VEGF were not pre-incubated prior to the addition to the VEGF
Receptor coated MSD plate. This assay was carried out just
comparing DMS1576 and Bevacizumab (Avastin) and only used VEGF
sourced from R&D Systems, (293-VE/CF). The ability of DMS1576
and Bevacizumab (Avastin) to inhibit VEGF binding to VEGFR1 and
VEGFR2 was determined as described above but without the
pre-incubation step. The EC50 values are listed in Table 3B.
[0232] From the data in Table 3A, both DMS1529 and DMS1576 appear
to have similar EC50 values and these are almost ten-fold lower
(i.e. greater potency) than the EC50 values for Bevacizumab
(Avastin) against both VEGF binding to VEGFR1 and VEGFR2. All
anti-VEGF molecules are more potent at binding R&D Systems VEGF
compared to `in-house` HEK293 produced VEGF for both VEGFR1 and
VEGFR2 binding assays and are more potent in the assays where
pre-incubation with VEGF occurs. Since DMS1576 maintained the
relative EC50 value compared to that for Bevacizumab (Avastin)
against both VEGFR1 and VEGFR2 in the absence of pre-incubation
with VEGF, this simplified assay type was taken forward for the
analysis of new molecules. Note that in all RBA assays although
both DMS1529 and DMS1576 appear more potent than Bevacizumab
(Avastin), unlike Bevacizumab (Avastin) neither DMS1529 nor DMS1576
seem to quite reach 100% inhibition in these assays, (data not
shown).
TABLE-US-00009 TABLE 3 EC50 values from VEGFR RBAs (A) RBA with
pre-incubation of anti-VEGF & VEGF reagent In-house VEGF and
VEGF sourced from R&D Systems (Baculovirus produced) EC50s
(g/mL) EC50s (nM) VEGF DMS1529 DMS1576 DMS1529 DMS1576 Receptor
Source Avastin Lead NTY Avastin Lead NTY VEGFR1 R&D 1.12E-07
5.09E-09 7.01E-09 0.747 0.068 0.093 VEGFR1 GSK 3.07E-07 4.97E-08
5.91E-08 2.048 0.663 0.789 VEGFR2 R&D 1.06E-07 4.65E-09
5.70E-09 0.706 0.062 0.076 VEGFR2 GSK 2.35E-07 3.64E-08 4.38E-08
1.569 0.486 0.583 (B) Modified RBA (without pre-incubation with
anti-VEGF agent) VEGF sourced from R&D Systems (Baculovirus
produced). EC50 (nM) VEGF R1 Avastin 3.173 DMS1576 0.389 VEGF R2
Avastin 5.607 DMS1576 0.263
Example 8
Human Umbilical Cord Endothelial Cell (HUVEC) Proliferation
Assay
[0233] DMS1529 and DMS1576 were assayed for their ability to
suppress proliferation of human umbilical vein endothelial cells
compared to that of Bevacizumab (Avastin). The assay measures the
extent of endothelial cell proliferation induced by a defined
concentration of VEGF.sub.165 and the ability of VEGF antagonists
to block this effect. HUVECs were seeded at 5000 cells per well in
96-well gelatine-coated plates, leaving outer wells free of cells,
and incubated for several hours to permit adherence. Test molecules
were assayed at equimolar concentrations (max
3.33.times.10.sup.-08M) with a 2-fold serial dilution, each in
triplicate. The VEGF.sub.165 was prepared in basal medium to
achieve 75 ng/ml final concentration. Medium was removed manually
from the cell monolayers and 50 .mu.l basal media was added to
prevent the cells from drying out. 25 .mu.l VEGF.sub.165-containing
medium and 25 .mu.l basal medium or test antibody-containing medium
was added as appropriate. Cells were incubated for 72 hrs, after
which time the total number of cells was determined using Cell
Titre Glo. Treatment of HUVECs with VEGF.sub.165 resulted in the
expected increase in the total number of cells after 72 hrs, when
compared with VEGF.sub.165-untreated cells (data not shown). This
VEGF-mediated increase is interpreted as representing the
cumulative effects of VEGF on both HUVEC proliferation and
prevention of HUVEC cell death. The test compounds were
independently assessed on individual plates against the comparator
molecule, Bevacizumab (Avastin).
[0234] DMS1529 was evaluated in a two separate assays. The data
suggest that DMS1529 is only able to inhibit HUVEC proliferation by
.about.50%, cf.about.100% for Bevacizumab (Avastin) and the best
fit curve suggests that DMS1529 has a higher IC50 (i.e. is less
potent) than Bevacizumab (Avastin) in this assay. DMS1576 has been
evaluated on several occasions in the HUVEC assay. In one sample
data set, the data suggest that similar to DMS1529, DMS1576 is only
able to inhibit HUVEC proliferation by .about.50%, cf.about.100%
for Bevacizumab (Avastin); and the best fit curve suggests that
DMS1576 has a higher IC50 (i.e. is less potent) than Bevacizumab
(Avastin) in this assay. However, two other data sets suggest a
smaller shortfall in % maximum inhibition and IC50 of DMS1576 cf
Bevacizumab (Avastin), (data not shown).
Example 9
Performance in VEGF Induced Blood-Retinal Breakdown: Rabbit Retinal
Leaked Model
[0235] DMS1529 and DMS1576 were tested in a human VEGF.sub.165
(R&D Systems), induced blood-retinal breakdown, (BRB), model in
the rabbit eye and compared against Bevacizumab (Avastin),
Ranibizumab (Lucentis), and Kenacort (Tramcinalone). All sources of
Bevacizumab, Ranibizumab and Kenacort were obtained from clinical
sources as described previously, Phillip Chapper & Co. Ltd, UK.
The model has been described in some detail in the literature and
is also known as the `Edelman model` (Edelman J L, Lutz D, Castro M
R, Corticosteroids inhibit VEGF-induced vascular leakage in a
rabbit model of blood-retinal and blood-aqueous barrier breakdown,
Exp Eye Res. 2005 February; 80(2):249-58).
[0236] The aim of this study was to evaluate the potency of DMS1529
and DMS1576, at two doses: High, (H), and Low, (L), in reducing the
retinal vascular leakage in a recombinant humanVEGF165-induced
blood retinal barrier breakdown model in rabbits. The high (H) and
low (L) doses were based upon a molar equivalent dosing to
Ranibizumab (Lucentis). The low dose, (L), was one third of the
high dose. Bevacizumab (Avastin) was also dosed at a scaled down
dose from the dose used in the clinic for ocular indications. The
dosing and injection schedule is shown in Table 4A.
[0237] In brief, all molecules were buffer exchanged using PD-10
Desalting Columns (GE Healthcare) into 10 mM Histidine HCl, 10% a-a
trehalose dehydrate, 0.01% PolySorbate 80, pH 5.5, and concentrated
to the desired concentration using Vivaspin 20, molecular weight
cut off 5000 Da, spin concentrations (Sartorius Stedim Biotech),
both were used according to manufacturer's instructions. Samples
were frozen at -80.degree. C., and shipped on dry ice, after
testing to confirm stability, functional activity and uniformity
after this process as described in the aforementioned examples
(data not shown).
[0238] Ninety-eight (98) GD79B pigmented rabbits were randomly
divided into nine (9) groups of ten (10) animals and one (1) group
of eight (8) animals (used for Kenacort control). Each group was
subdivided into 2 groups corresponding to 2 experimental sets. Test
items, reference or control items were administered by intravitreal
injection (IVT, 50 .mu.L) into the right eyes on Day -7. Left eyes
remained untreated and served as a negative control. On Day 0,
right eyes were induced for blood retinal barrier (BRB) breakdown
with a single intravitreal injection of 500 ng rhVEGF.sub.165
(vascular permeability inducer). Sodium fluorescein was
intravenously injected to all groups 47 h after the VEGF challenge
(Day 2). Within 10 min after the injection of the tracer a retinal
angiography was performed on right eye and pictures were taken.
Ocular fluorescein contents in the vitreoretinal compartment were
measured 1 h later using non-invasive scanning ocular
fluorophotometry. A right eye/left eye fluorescein content (AUC) Rt
ratio was determined for retinal permeability evaluation. At the
end of the evaluation period (Day 2), animals were euthanized and
right eyes of all animals were enucleated. Snap-frozen eyeballs and
aqueous humor samples were stored at -80.degree. C. until shipment
to the sponsor, GSK. Fluorescein angiograms were collected for
qualitative assessment. The compounds remained masked upon GSK's
request. The administration schedule for this is summarised in
Table 4A.
[0239] Intravitreally injected VEGF induced a breakdown of the BRB,
which was blocked by treatment with compounds masked labelled E:
Bevacizumab (Avastin), H: Ranibizumab (Lucentis, high dose) and I:
Ranibizumab (Lucentis, low dose), 9 days post injection, with an
efficacy similar to that of the marketed reference (Kenacort.RTM.).
Low values of Rt ratio of vitreoretinal fluorescein contents
between right-induced and left eyes were observed (Rt=1.39.+-.0.77
(n=9) for compound E, Rt=1.05.+-.0.52 (n=10) for compound H and
Rt=1.81.+-.1.76 (n=10) for compound I. Kenacort-treated group
showed a mean Rt ratio close to that of non-induced animals
(Rt=1.15.+-.0.61).
[0240] In the masked study, an important retinal vascular leakage
was noted in right induced eyes after treatment with compounds A:
DMS1576 (high dose), B: DMS1576 (high dose), C: Vehicle, negative
control group D: DMS1576 (low dose), F: DMS1529 (low dose) and G:
DMS1529 (high dose). Without unmasking of the compounds and
comparison to vehicle control compounds A, B, C, D, F and G were
clearly less effective than compounds E, H and I.
[0241] Unmasked data and statistical analysis demonstrating the
inhibition of VEGF induced rabbit retinal leakage is shown in Table
4B. For this analysis the masked groups corresponding to the same
molecule and dose were pooled. For the data in Table 4B: P values
are shown with and without multiple comparison adjustment,
labelled: Dunnett and `unadjusted` p value respectively. Confidence
intervals correspond to unadjusted p value (CI includes ratio of 1
at p>0.05). From the data analysis in Table 4B: DMS1529 (46%)
and DMS1576 (41%) at high dose only partially reduced the degree of
VEGF induced retinal leakage and at low doses the reduction was
even less: DMS1529 (19%) and DMS1576 (25%). Under the same
conditions, compounds E: Bevacizumab (Avastin, 75%), H: Ranibizumab
(Lucentis, high dose, 82%) and I: Ranibizumab (Lucentis, low dose,
78%), suppressed the VEGF-induced retinal vascular leakage, with an
effect similar to the marketed corticoid reference (Kenacort.RTM.
retard, 85%).
TABLE-US-00010 TABLE 4A Dosing and injection schedule for
inhibition of VEGF induced rabbit retinal leakage by DMS1529,
DMS1576 compared to Bevacizumab (Avastin), Ranibizumab (Lucentis)
and Kenacort (Triamcinalone). Treatment/ Numbers compound of Group
dosed Treatment animals No. (right eye) Dose Protocol Set 1 Set 2
Induction Measurements 1 Vehicle -- 50-.mu.L IVT 5 5 Day0, On Day
2: 2 Lucentis high H Day-7 5 5 500 ng/ * Fluorescein dose 50 .mu.L
leakage 3 Lucentis low dose L 5 5 rhVEGF, quantification in 4
Avastin H 5 5 (R&D vitreous/retina 5 DMS1529 high H 5 5 Systems
segment dose (delivered (Fluorotron .RTM. 6 DMS1529 low L 5 5 by
Master). dose intravitreal * Retinal 7 DMS1576 high H 5 5
injection, angiography dose IVT) assessment 8 DMS1576 low H 5 5
using dose Heidelberg's 9 DMS1576 high H 5 5 Retinal dose
Angiograph 10 Kenacort .RTM. Retard 2000 4 4 * Eyeballs .mu.g/eye
sampling (except for Kenacort group)
TABLE-US-00011 TABLE 4B Inhibition of VEGF induced rabbit retinal
leakage by DMS1529, DMS1576 compared to Bevacizumab (Avastin),
Ranibizumab, (Lucentis) and Kenacort (Triamcinalone) % reduction
Ratio vs Lower Upper Unadjusted Dunnett vs vehicle treatment
Vehicle 95% CI 95% CI p value p value 46% DMS1529H 0.54021 0.29596
0.98606 0.0450 0.2234 19% DMS1529L 0.80759 0.44463 1.46685 0.4786
0.9788 41% DMS1576H 0.58638 0.34873 0.98597 0.0442 0.2201 25%
DMS1576L 0.75355 0.41376 1.37237 0.3508 0.9103 75% Avastin 0.25446
0.13782 0.46984 <.0001 0.0002 85% Kenacort 0.14853 0.07769
0.28395 <.0001 <.0001 82% Lucentis H 0.18258 0.10048 0.33175
<.0001 <.0001 78% Lucentis L 0.21876 0.12005 0.39865
<.0001 <.0001
Example 10
Cloning of Anti-VEGF Vk dAb-Fc and Fc-dAb Molecules
[0242] The dAb sequences (SEQ ID NO:97-101, 105-109) were cloned
onto the N- or C-terminus of a generic Fc of the human IgG1 isotype
in a mammalian expression vector. The dAbs were linked to the Fc
using a linker sequence: the N-terminal linker was either AAAS (SEQ
ID NO:57 & 76), or TVAAPS (SEQ ID NO:59 & 78) and the
C-terminal linker was either ((GS(TVAAPSGS).times.3) (SEQ ID NO:66
& 85), or Albumin Domain 3 (SEQ ID NO:71 & 90).
Example 11
Expression of Anti-VEGF Vk dAb-Fc and Fc-dAb Molecules
[0243] Expression plasmids encoding the relevant Vk anti-VEGF
dAb-Fc and Fc-dAb molecules (listed in SEQ ID NO:3-9, 16-24, 31-37
& 44-52, Table 19) were transiently transfected into HEK293 6E
cells and expressed at 500 ml scale to produce the antibody
fragment molecules. 500 ug of plasmid DNA was added to 18 ml of
OptiMEM (Invitrogen) and separately 666 ul of 293fectin was added
to 18 ml OptiMEM. Both tubes were incubated at room temperature for
5 minutes. The DNA/OptiMEM solution was added slowly to the
293fectin/OptiMEM tube with gentle swirling. The DNA/293fectin
transfection complex was then allowed to form for 25 minutes at
room temperature. A HEK293E suspension cell culture was diluted to
give 0.5.times.10.sup.6 cells per ml and the above transfection
complex were added slowly to 500 ml of the diluted cell culture,
with gentle swirling of the culture flask. The flask was then
returned to the 37.degree. C., 5% CO.sub.2 incubator, with shaking
at 135 rpm. 24 hrs post-transfection 12.5 ml of 20% w/v
casein-tryptone was added to the cell culture and incubation was
continued as above. 6 days post-transfection, the culture was
centrifuged at 5,500.times.g for 20 minutes to pellet the cells;
the supernatant was filtered (0.22 um) and analysed for secreted
protein expression. Expression levels of 50-100 mg/L supernatant
were routinely achieved.
Example 12
Purification of Vk Anti-VEGF dAb-Fc and Fc-dAb Molecules
[0244] The Vk anti-VEGF dAb-Fc and Fc-dAb molecules were affinity
purified from the supernatants (see Example 11). 20 ml of suspended
affinity resin in sodium phosphate buffer (50:50 slurry) was added
to 500 ml of filtered supernatant; the supernatant/affinity resin
mix was rolled gently at +4.degree. C. overnight, for .about.3 h at
room temperature, to allow binding to take place. After which time,
the resin was allowed to settle and the supernatant carefully
poured off. The resin was re-suspended in remaining supernatant and
poured into an empty drip column. The supernatant was allowed to
pass out of the column, and the resin was then washed with
3.times.10 column volume washes of PBS followed by 4.times. column
washes of Tris buffer. Elution was carried out using 4.times.
column volumes of low pH buffer and the eluate collected into a
tube containing 1.times. column volume of 1M Tris pH 8.0 to
neutralize the eluted protein.
Example 13
Molecular Analysis by SDS-PAGE and Size-Exclusion Chromatography
(SEC) of Vk Anti-VEGF dAb-Fc and Fc-dAb Molecules
[0245] The molecular integrity, homogeneity and % purity of the
anti-VEGF dAb-Fc and Fc-dAb molecules which had been purified as
described in Example 12 were analysed by SDS-PAGE, following
Example 3. The gels showed band sizes consistent with the predicted
molecular mass of the intact mature protein (from .about.76 kDa to
.about.85 kDa for dAb-Fc and Fc-dAb molecules respectively),
allowing for the presence of the predicted glycan chains per
monomer chain. The proteins were confirmed to be >95% pure
target protein by SDS-PAGE and SEC prior to further analysis in
biology assays. If the dAb-Fc or Fc-dAb molecule was <95% pure a
further SEC purification was carried out (see Example 14).
Example 14
Purification by Size-Exclusion Chromatography (SEC) of Vk Anti-VEGF
dAb-Fc and Fc-dAb Molecules
[0246] If necessary, preparative size-exclusion chromatography
(SEC) was carried out for the Vk dAb-Fc and Fc-dAb molecules using
a HiLoad 16/600 Superdex 200 column (GE Healthcare). The mobile
phase used was phosphate buffered saline at a flow rate of 0.5
ml/min and 0.5-2 ml fractions were collected. The UV absorbance of
the column effluent was monitored at 214 & 280 nm. The
fractions collected for the peak corresponding to the elution of
the dAb-Fc or Fc-dAb molecule were pooled. The molecular integrity,
homogeneity and % purity was again analysed by SDS-PAGE and
analytical SEC as described in Example 13. The proteins were
confirmed to be >95% pure target protein by SDS-PAGE and SEC
prior to further analysis in biology assays.
Example 15
VEGF Binding ELISA of Vk Anti-VEGF dAb-Fc and Fc-dAb Molecules
[0247] The ability of the Vk anti-VEGF dAb-Fc and Fc-dAb molecules
to bind specifically to VEGF.sub.165 was determined by ELISA. This
was performed in a similar manner to Example 4. All of the
anti-VEGF compounds tested were found to bind specifically to
VEGF.sub.165 (data not shown).
Example 16
Binding of Anti-VEGF Vk dAb-Fc and Fc-dAb Molecules to VEGF on
Biacore
[0248] The binding affinity of the anti-VEGF Vk dAb-Fc and Fc-dAb
molecules for VEGF.sub.165 was determined by Surface Plasmon
resonance (SPR) using a Biacore T100 in a similar manner to Example
6, but with minor modifications. Protein A was immobilised on a C1
chip by primary amine coupling and this surface was then used to
capture the anti-VEGF constructs. Human recombinant VEGF.sub.165
(sourced `in house` from transient transfection of HEK293 cells)
was used as the analyte at 64 nM, 16 nM, 4 nM, 2 nM, 1 nM, 0.5 nM
and 0.25 nM. All binding curves were double referenced with a
buffer injection (i.e. 0 nM) and the data was fitted to 1:1 model
inherent to the T100. Regeneration was carried out using 50 mM
NaOH. The run was carried out at 37.degree. C., using HBS-EP as the
running buffer. The Vk dAb-Fc and Fc-dAb molecules were compared to
DMS1576 and Bevacizumab (Avastin). The data shows that the Vk
Fc-dAb molecules (DMS30000, DMS30001, DMS30002, DMS30003 and
DMS30004) are all improved compared to DMS1576 and the Vk dAb-Fc in
terms of binding to VEGF, as determined by Biacore, (see Table
5).
TABLE-US-00012 TABLE 5 Binding of anti-VEGF dAb-Fc and Fc-dAb
molecules and Bevacizumab (Avastin) to VEGF.sub.165 Temp Sample
(.degree. C.) ka kd KD (nM) Bevacizumab 37 Unable to fit data
(Avastin) Kinetic constant kd is outside the limits that can be
measured by the instrument DMS1576 37 Poor fit to 1:1 model
DMS30005 37 Poor fit to 1:1 model DMS30006 37 Poor fit to 1:1 model
DMS30000 37 1.44E+07 3.34E-05 0.002 DMS30001 37 1.62E+07 3.63E-05
0.002 DMS30002 37 1.25E+07 3.63E-05 0.003 DMS30003 37 1.27E+07
3.84E-05 0.003 DMS30004 37 1.28E+07 4.54E-05 0.004
Example 17
VEGF R1 & R2 Receptor Binding Assay of Anti-VEGF Vk dAb-Fc and
Fc-dAb Molecules
[0249] The potencies of the anti-VEGF Vk dAb-Fc and Fc-dAb
molecules were analysed in the VEGF receptor, (R1 and R2), binding
assay using the modified method, i.e. with no pre-incubation,
described in Example 7 and were compared to the Vh dAb-Fc, DMS1576
and Bevacizumab (Avastin). The Vk Fc-dAb molecules (DMS30000,
DMS30003 and DMS30004) were seen to be more potent (i.e. lower EC50
values, see Tables 6A & 6B), than DMS1576 and Bevacizumab
(Avastin) against both VEGFR1 and VEGFR2; whereas the Vk dAb-Fc
molecule (DMS30005) was less potent than DMS1576 and similar to
Bevacizumab (Avastin) against VEGFR1 and more potent than
Bevacizumab (Avastin) against VEGFR2. Against VEGFR1, the data
indicate that the inhibition achieved by the Vk Fc-dAb molecules
(DMS30000, DMS30003 and DMS30004) are slightly reduced at 87-89% cf
the Vh dAb-Fc molecule (DMS1576) and Bevacizumab (Avastin), both
.gtoreq.90%. The Vk dAb-Fc molecule (DMS30005) is further reduced,
82%. Against VEGFR2, the data indicate that the inhibition achieved
by the Vk Fc-dAb molecules (DMS30000, DMS30003 and DMS30004) match
that of the Vh dAb-Fc molecule (DMS1576) and Bevacizumab (Avastin),
all .gtoreq.90%. The Vk dAb-Fc molecule (DMS30005) is slightly
reduced, 86%.
TABLE-US-00013 TABLE 6A EC.sub.50 values of anti-VEGF compounds
compared to Bevacizumab (Avastin) in VEGFR1 Receptor Binding Assay.
Curve fitting and EC.sub.50 calculations were performed using
GraphPad Prism. Max. % EC50 EC50 VEGFR1 Inhibition (g/mL) (pM)
Avastin 91.9 3.24E-07 2,158 DMS1576 93.8 1.51E-08 201 DMS30000 86.7
3.51E-09 47 DMS30003 89.1 4.42E-09 59 DMS30004 87.1 3.80E-09 51
DMS30005 82.2 2.07E-07 2,763
TABLE-US-00014 TABLE 6B EC.sub.50 values of anti-VEGF compounds
compared to Bevacizumab (Avastin) in VEGFR2 Receptor Binding Assay.
Curve fitting and EC.sub.50 calculations were performed using
GraphPad Prism. Max. % EC50 EC50 VEGFR2 Inhibition (g/mL) (pM)
Avastin 94.6 6.29E-07 4,192 DMS1576 92.9 1.80E-08 240 DMS30000 94.5
2.98E-09 40 DMS30003 97.9 2.96E-09 40 DMS30004 91.0 3.12E-09 42
DMS30005 85.8 9.55E-08 1,273
Example 18
Human Umbilical Cord Endothelial Cell (HUVEC) Proliferation Assay:
Inhibition with Anti-VEGF dAb-Fc and Fc-dAb Molecules
[0250] The ability of the Vk dAb-Fc and Fc-dAb molecules to
suppress the VEGF driven proliferation of human umbilical vein
endothelial cells were compared to that of inhibition in this assay
from the Vh dAb-Fc (DMS1576) and Bevacizumab (Avastin) as described
in Example 8. The Vk dAb-Fc molecules (DMS30005 and DMS30006) were
assayed in a single assay, (data not shown). The data indicated
that these molecules were less potent (lower IC50) and less able to
fully inhibit proliferation, .about.70-80%, DMS30005, cf.
.about.100% for Bevacizumab (Avastin). As previously seen in
Example 8, the data suggest that the Vh dAb-Fc molecule (DMS1576)
has a higher IC50 (i.e. is less potent) than Bevacizumab (Avastin).
The Vk Fc-dAb molecules (DMS30000, DMS30003 & DMS30004) were
assayed on several occasions. The data sets indicate that the
inhibition achieved by treatment with the Vk Fc-dAb molecules gave
levels of VEGF-mediated inhibition that matched that achieved with
Bevacizumab (Avastin), i.e .about.100%. In fact, all Vk Fc-dAb
molecules produced best fit curves that overlayed, or were slightly
shifted to the left of the similar Bevacizumab, (Avastin) curve so
were potentially more potent molecules in this assay, (data not
shown).
Example 19
Demonstration of Differential and Non-Interference of Binding of
Anti-VEGF Vh dAb-Fc and Vk Fc-dAb Molecules to Human VEGF
[0251] The ability of the Vh based dAbFc molecules to bind to VEGF
already pre-saturated with Vk based Fc-dAb molecules and,
conversely, the ability of Vk based Fc-dAb molecules to bind to
VEGF already pre-saturated with Vh based dAbFc molecules was
demonstrated in a modified MSD assay using DMS30000 as the Vk based
Fc-dAb molecule and DMS1576 as the Vh based dAb-Fc molecule.
[0252] 19.A--Binding of Vh dAb-Fc DMS1576 to VEGF after
Pre-Saturation with Vk Fc-dAb DMS30000
[0253] A MSD high bind 96 well plate (MSD L11X6-3) was coated with
3 .mu.g/mL rhVEG F.sub.165 (sourced `in house` from transient
transfection of HEK293 cells) in PBS (25 .mu.l/well), covered with
a plate sealer and incubated overnight at 4.degree. C. The next day
the MSD plate was washed 3.times.300 .mu.l/well with Tris wash
buffer and blotted over a pad of tissue to remove excess wash
buffer from the wells. The MSD plate was then blocked with 3% BSA
in PBS (250 .mu.l/well) and incubated shaking (750 RPM) at room
temperature for 1 hour. After washing the MSD plate, saturating
DMS30000 concentrations (.gtoreq.3 .mu.g/ml) were added (25
.mu.l/well) and incubated shaking (750 RPM) at room temperature for
1 hour. The MSD plate was washed again before the addition of
DMS1576 (25 .mu.l/well, 0-100 ng/ml) and incubated shaking (750
RPM) at room temperature for 1 hour. The DMS30000 and DMS1576 were
prepared in 0.1% BSA in PBS. The MSD plate was washed again before
the addition of a detection reagent specific for the Vh dAb
contained in DMS1576 (25 .mu.L/well, in-house sulfo-TAG labelled
anti-Vh mAb) at 1 .mu.g/ml in 1% BSA in PBS and incubated with
shaking (750 RPM) at room temperature for 1 hour. Prior to
measurement of the electrochemiluminescence in a MSD Sector Imager
6000, the MSD plate was washed and 150 .mu.L/well of 2.times. Read
Buffer T (MSD R92TC-1) was added.
[0254] The data in FIG. 2A shows that it is possible for the Vh
based dAb-Fc molecule DMS1576 to bind VEGF.sub.165 which has been
pre-saturated with Vk based Fc-dAb molecule DMS30000.
[0255] 19.6--Binding of Vk Fc-dAb DMS30000 to VEGF after
Pre-Saturation with Vh dAb-Fc DMS1576
[0256] A MSD high bind 96 well plate (MSD L11X6-3) was coated with
3 .mu.g/ml VEGF (sourced `in house` from transient transfection of
HEK293 cells) in PBS (25 .mu.l/well), covered with a plate sealer
and incubated overnight at 4.degree. C. The next day the MSD plate
was washed 3.times.300 .mu.l/well with Tris wash buffer and blotted
over a pad of tissue to remove excess wash buffer from the wells.
The MSD plate was then blocked with 3% BSA in PBS (250 .mu.l/well)
and incubated with shaking (750 RPM) at room temperature for 1
hour. After washing the MSD plate, saturating DMS1576
concentrations (.gtoreq.3 .mu.g/mL) were added (25 .mu.L/well) and
incubated shaking (750 RPM) at room temperature for 1 hour. The MSD
plate was washed again before the addition of DMS30000 (25
.mu.L/well, 0-100 ng/mL) and incubated shaking (750 RPM) at room
temperature for 1 hour. The DMS30000 and DMS1576 were prepared in
0.1% BSA in PBS. The MSD plate was washed again before the addition
of a detection reagent specific for the Vk dAb contained in
DMS30000 (25 .mu.L/well, in-house sulfo-TAG labelled anti-Vk mAb)
at 1 .mu.g/ml in 1% BSA in PBS and incubated with shaking (750 RPM)
at room temperature for 1 hour. Prior to measurement of the
electrochemiluminescence in a MSD Sector Imager 6000, the MSD plate
was washed and 150 .mu.L/well of 2.times. Read Buffer T (MSD
R92TC-1) was added.
[0257] The data in FIG. 2B demonstrates that it is possible for the
Vk based Fc-dAb molecule DMS30000 to bind VEGF.sub.165 which has
been pre-saturated with Vh based dAb-Fc molecule DMS1576.
[0258] Both sets of data in Example 19 show that it is possible for
both the Vk Fc-dAb (DMS30000) and Vh dAb-Fc, (DMS1576) to bind
VEGF.sub.165 in the presence of the other molecule. The experiments
described in Example 19 suggest that the two lineages of dAb, Vk
and Vh derived, may bind to different epitopes on the VEGF
homodimer.
Example 20
Cloning of Anti-VEGF dAb-Fc-dAb Molecules
[0259] The Vh-Vk dAb-Fc-dAbs (SEQ ID NO: 10-11, 25, 38-39 &53)
were engineered by cloning the Vk dAb sequences (DT02-K-044-085
(SEQ ID NO: 97 & 105) or DT02-K-044-251 (SEQ ID NO: 100 &
108) onto the C-terminus of the Vh dAb-Fc (DMS1576, SEQ ID NO:2
& 30) in a mammalian expression vector. The C-terminal dAbs
were linked to the C-terminus of Fc using a either the
((GS(TVAAPSGS).times.3) (SEQ ID NO:66 & 85), or Albumin Domain
3 (SEQ ID NO:71 & 90) linker sequence. The Vk-Vk dAb-Fc-dAbs
(SEQ ID NO:12-15, 26-28, 40-43 & 54-56) were engineered by
cloning the Vk dAb sequences (DT02-K-044-085 (SEQ ID NO: 97 &
105) or DT02-K-044-251 (SEQ ID NO:100 & 108) onto the
C-terminus of the corresponding Vk dAb-Fc (i.e. either DMS30000
(SEQ ID NO:3 & 31) or DMS30003 (SEQ ID NO:6 & 34) or
DMS30013 (SEQ ID NO:16 & 44)) in a mammalian expression vector.
The N-terminal dAbs were linked to the N-terminus of Fc using
either the AS (SEQ ID NO:58 & 77), or Hinge IgG1 (SEQ ID NO:60
& 79). Site directed mutagenesis was carried out within the Fc
region with the following changes for example His 2 Ala or Thr 3
Pro to produce SEQ ID NO: 27 and 28 respectively.
Example 21
Expression of Anti-VEGF dAb-Fc-dAb Molecules
[0260] Expression plasmids encoding the relevant anti-VEGF
dAb-Fc-dAb molecules (listed in SEQ ID NO:10-15, 25-28, 38-43 &
53-56) were transiently transfected into HEK293 6E cells and
expressed at 500 ml scale to produce the antibody fragment
molecules using the method described in Example 11. Expression
levels of 50-100 mg/L supernatant were routinely achieved.
Example 22
Purification of Anti-VEGF dAb-Fc-dAb Molecules
[0261] The dAb-Fc-dAb molecules were affinity purified from the
supernatants (Example 21). 2 ml of suspended affinity resin in
phosphate buffered saline (50:50 slurry) was added to 500 ml of
filtered supernatant; the supernatant/affinity resin mix was rolled
gently at +4.degree. C. overnight to allow binding to take place.
After which time, the resin was allowed to settle and the
supernatant carefully poured off. The resin was re-suspended in
remaining supernatant and poured into an empty drip column and the
supernatant was allowed to pass out of the column. The bound
product was washed using a combination of pH neutral aqueous
buffers to remove non-specifically bound impurities followed by a
low pH elution. Over 90% of bound product was recovered and the pH
of the elution pool then adjusted to pH 3.5 for 30 minutes to
achieve virus neutralisation after which time the pH was adjusted
to pH 4.5.
Example 23
Molecular Analysis by Size-Exclusion Chromatography (SEC) of
Anti-VEGF dAb-Fc-dAb Molecules
[0262] The molecular integrity, homogeneity and % purity of the
anti-VEGF dAb-Fc-dAb molecules which had been purified as described
in Example 22 were analysed by SDS-PAGE and analytical
size-exclusion chromatography (SEC) as described in Example 3. The
proteins were confirmed to be >95% pure target protein by
SDS-PAGE and SEC prior to further analysis in biology assays.
Example 24
VEGF Binding ELISA of Anti-VEGF dAb-Fc-dAb Molecules
[0263] The ability of the anti-VEGF dAb-Fc-dAb molecules to bind
specifically to VEGF.sub.165 was determined by ELISA as described
in Examples 4 & 15. All of the anti-VEGF dAb-Fc-dAbs tested
were found to bind specifically to VEGF.sub.165 (data not
shown).
Example 25
Binding of Anti-VEGF dAb-Fc-dAb Molecules to VEGF on Biacore
[0264] The binding affinity of the anti-VEGF dAb-Fc-dAb molecules
for VEGF.sub.165 was determined by Surface Plasmon resonance (SPR)
using a Biacore T100 in a similar manner to Example 6, but with
minor modifications. Protein A was immobilised on a C1 chip by
primary amine coupling and this surface was then used to capture
the anti-VEGF constructs. Human recombinant VEGF.sub.165 (sourced
`in house` from transient transfection of HEK293 cells) was used as
the analyte at 75 nM, 15 nM, 3 nM and 0.6 nM. All binding curves
were double referenced with a buffer injection (i.e. 0 nM) and the
data was fitted to 1:1 model inherent to the T100. Regeneration was
carried out using 50 mM NaOH. The run was carried out at 37.degree.
C., using HBS-EP as the running buffer.
[0265] The dAb-Fc-dAb molecules were compared to their
corresponding Vk Fc-dAb and Vh dAb-Fc molecules. The data for this
assay format may suggest that the dAb-Fc-dAb molecules do not
appear to be better than the corresponding Vk Fc-dAb. The Vk
Fc-dAbs appear to have superior off-rates cf corresponding
dAb-Fc-dAbs. However, the traces, (data not shown), may not tell
the full story since the dAb-Fc-dAb "affinities" are a mix of two
different binding events to VEGF, i.e. the binding of the
N-terminal dAbs and the C-terminal Vk dAbs. It is to be expected
that the Vk dAb in the dAb-Fc-dAb, i.e. in the same orientation as
in the C-terminal Vk Fc-dAb, will have the same affinity, and this
data confirms that previously described in Example 16. Positioning
of either the Vh or Vk dAb at the N-terminal of the Fc leads to a
poorer affinity (see Example 16), therefore making the overall
affinity of the combined molecule appear worse. The apparent
affinities (see Table 7) show the following potency on the Biacore
for these molecules: the Vh-Vk dAb-Fc-dAbs (DMS30007 and DMS30008)
have the poorest affinities, the Vk-Vk dAb-Fc-dAbs (DMS30009,
DMS30010, DMS30011 and DMS30012) have the best of the dAb-Fc-dAb
affinities and appear to be very similar to one another.
TABLE-US-00015 TABLE 7 Binding of anti-VEGF dAb-Fc-dAb molecules
and corresponding dAb-Fc- and Fc-dAb molecules to VEGF.sub.165
Construct Model ka kd KD (pM) DMS1576 1:1 Binding 3.04E+06 4.24E-04
139.5 DMS30000 1:1 Binding 2.28E+07 1.60E-05 0.7 DMS30007 1:1
Binding 2.82E+06 1.22E-04 43.3 DMS30009 1:1 Binding 2.96E+07
6.92E-05 2.3 DMS30010 1:1 Binding 2.64E+07 8.08E-05 3.1 DMS30003
1:1 Binding 1.81E+07 1.37E-05 0.8 DMS30008 1:1 Binding 2.56E+06
1.15E-04 44.9 DMS30011 1:1 Binding 1.77E+07 8.07E-05 4.6 DMS30012
1:1 Binding 1.61E+07 7.39E-05 4.6
Example 26
VEGF R1 & R2 Receptor Binding Assay of Anti-VEGF dAb-Fc-dAb
Molecules
[0266] The potencies of the anti-VEGF Vh-Vk and Vk-Vk dAb-Fc-dAb
molecules were analysed in the VEGF receptor, R1 and R2, binding
assay. The potencies (EC50) against both VEGFR1 and VEGFR2 of the
dAb-Fc-dAbs was seen to match that of the Vk Fc-dAb molecule
(DMS30000) and seen to be more potent (i.e. lower EC50 values) than
both the Vh dAb-Fc molecule (DMS1576) and Bevacizumab (Avastin),
see Table 8 A and B. Against VEGFR1, the data indicate that the
inhibition achieved by both Vh-Vk dAb-Fc-dAbs (DMS30007 and
DMS30008) and the Vk-Vk dAb-Fc-dAb (DMS30009) matched that achieved
with the Vh dAb-Fc molecule (DMS1576), the Vk Fc-dAb molecule
(DMS30000) and Bevacizumab (Avastin) all .gtoreq.90%, (Table 8A).
Against VEGFR2, the data indicate that the inhibition achieved by
the Vh-Vk (DMS30022) dAb-Fc-dAb matched that achieved with the Vh
dAb-Fc molecule (DMS1576), the Vk Fc-dAb molecules (DMS30000 and
DMS30003) and Bevacizumab (Avastin), all achieved .gtoreq.90%;
whereas the inhibition achieved by Vh-Vk dAb-Fc-dAbs (DMS30007 and
DMS30008) and the Vk-Vk dAb-Fc-dAb molecules (DMS30009, DMS30023
and DMS30025) was lower at .about.75-87%, (Table 8B).
TABLE-US-00016 TABLE 8A EC.sub.50 values of anti-VEGF dAb-Fc-dAb
molecules compared to Bevacizumab (Avastin) in VEGFR1 Receptor
Binding Assay. Curve fitting and EC.sub.50 calculations were
performed using GraphPad Prism. Max. % EC50 EC50 VEGFR1 Inhibition
(g/mL) (pM) Avastin 92.0 3.45E-07 2,297 DMS1576 95.8 2.15E-08 287
DMS30000 89.5 5.09E-09 68 DMS30003 92.0 5.94E-09 79 DMS30007 92.8
5.90E-09 59 DMS30008 92.0 6.00E-09 60 DMS30009 92.6 4.17E-09 42
TABLE-US-00017 TABLE 8B EC.sub.50 values of anti-VEGF dAb-Fc-dAb
molecules compared to Bevacizumab, (Avastin), in VEGFR2 Receptor
Binding Assay. (i) Curve fitting and EC.sub.50 calculations were
performed using GraphPad Prism. Max. % EC50 EC50 VEGFR2 Inhibition
(g/mL) (pM) Avastin 94.3 5.52E-07 3,679 DMS1576 96.7 3.30E-08 439
DMS30000 93.6 5.01E-09 67 DMS30003 98.3 4.56E-09 61 DMS30007 81.3
8.02E-09 80 DMS30008 83.0 7.20E-09 72 DMS30009 86.6 5.52E-09 55
Max. % EC50 EC50 VEGFR2 RBA Inhibition (g/mL) (pM) Avastin 93.6
4.67E-07 3113 DMS1576 95.9 6.72E-08 896 DMS30000 (Batch 1) 89.8
4.22E-09 56 DMS30000 (Batch 2) 97.7 3.30E-09 44 DMS30022 95.0
8.17E-09 82 DMS30023 74.7 5.20E-09 52 DMS30025 82.4 4.86E-09 49
Example 27
Human Umbilical Cord Endothelial Cell (HUVEC) Proliferation Assay
of Anti-VEGF dAb-Fc-dAb Molecules
[0267] The abilities of the Vh-Vk (DMS30022) and Vk-Vk (DMS30023
and DMS30025) dAb-Fc-dAb molecules to suppress proliferation of
human umbilical vein endothelial cells were compared to the Vh
dAb-Fc molecule (DMS1576), the Vk Fc-dAb molecule (DMS30000) and
Bevacizumab (Avastin) using the method described in Examples 8
& 18 with the following deviations (i) rather than leaving the
outer wells free of cells, the whole 96 well plate was used and
(ii) the data was analysed using GraphPad Prism using a Sigmodial
curve fit, variable slope cf a non-linear regression (variable
slope). The data suggest that, as previously seen in Examples 8 and
18, the Vh dAb-Fc molecule (DMS1576) has a higher EC50 (i.e. is
less potent) than Bevacizumab (Avastin); on average, it was seen
that the Vk Fc-dAb molecule (DMS30000) was similar in terms of EC50
to Bevacizumab (Avastin); whereas all the Vh-Vk and Vk-Vk
dAb-Fc-dAb molecules (DMS300022, DMS300023, DMS300024 and
DMS300025) were all seen to be improved over Bevacizumab (Avastin)
in terms of EC50.
Example 28
Performance of dAb-Fc-dAb and dAb-Fc and Fc-dAb Formats in VEGF
Binding Assays Measured in Solution by Isothermal Calorimetry
(ITC)
[0268] The solution equilibrium binding affinity (K.sub.D),
stoichiometry (N) and thermodynamics (.quadrature.H, enthalpy and
PS, entropy) of the anti-VEGF dAb-Fc-dAbs, dAb-Fcs and Fc-dAbs
binding to VEGF.sub.165 was determined by isothermal titration
calorimetry (ITC) using a Microcal VP-ITC and compared to that of
the monoclonal antibody Bevacizumab (Avastin). The main aim of the
experiment was to compare the relative stoichiometry of binding to
VEGF of the different molecular formats. VEGF.sub.165 was titrated
into antibody solutions at 25.degree. C. until there was greater
than 3 fold concentration excess of VEGF.sub.165 and saturation was
achieved. All titrations used the same batch of VEGF.sub.165 to
ensure consistency. The integrated binding isotherms were fitted
within the Origin software (Microcal version) using a standard 1:1
binding model as there were no signs of multiphasic behavior. The
results are summarised in Table 10.
TABLE-US-00018 TABLE 10 Binding of anti-VEGF dAb-Fc-dAb molecules,
dAb-Fcs and Fc-dAb molecules to VEGF.sub.165 N (VEGF165 (monomer)/
.DELTA.H .DELTA.S Construct antibody) K.sub.A M.sup.-1 (cal/mol)
(cal/mol/deg) Avastin 1.5 4.96E+07 -1.59E+04 -18.1 DMS30000 1.2
8.00E+07 -1.95E+04 -29.3 (Fc-dAb) DMS30023 2.1 3.78E+07 -1.93E+04
-29.9 (dAb-Fc-dAb) DMS30022 1.9 1.08E+08 -2.20E+04 -37.0
(dAb-Fc-dAb) DMS30028 1.3 1.45E+07 -1.73E+04 -25.4 (dAb-Fc)
DMS51576 0.95 1.18E+08 -2.08E+04 -32.9 (dAb-Fc) Avastin 1.5
5.36E+07 -1.82E+04 -25.6
[0269] All antibodies have enthalpically favourable and
entropically unfavourable binding at 25.degree. C. There is a clear
distinction in the stoichiometry between the dAb-Fc, Fc-dAb and
dAb-Fc-dAb dAb formats, with a larger capacity on for the dual dAb
formats. The dAb-Fc-dAb formats also show a higher capacity than
Avastin when VEGF.sub.165 is present in excess. The affinities
measured are in same rank order and consistent with those measured
by other methods.
Example 29
Cloning of Anti-VEGF Vh dAb-Fc, Vk dAb-Fc and Vk Fc-dAb Molecules
with Various Linker Modifications
[0270] The dAb sequences (SEQ ID NO: 96-97, 104-105, see Table 19)
were cloned onto the N- or C-terminus of a generic Fc of the human
IgG1 isotype in a mammalian expression vector. The dAbs were linked
to the Fc using a variety of linker sequences (see Table 19, SEQ ID
Nos 57-75 & 76-94): For the Vh dAb-Fc the dAb was DOM15-26-597;
the N-terminal linkers were either AS (SEQ ID NO:58 & 77), or
TVAAPS (SEQ ID NO:59 & 78), or Hinge IgG1 linker (SEQ ID NO:60
& 79), or Hinge IgG3 linker (SEQ ID NO:61 & 80) or
Fibronectin.times.3 linker (SEQ ID NO:62 & 81) or
Fibronectin.times.4 linker (SEQ ID NO:63 & 82); For the Vk
dAb-Fc the dAb was DT02-K-044-085; the N-terminal linkers were
either AS with a H2A IgG1 Fc point mutation (SEQ ID NO:64 &
83), AS with a T3P IgG1Fc point mutation (SEQ ID NO:65 & 84),
or TVAAPS (SEQ ID NO:59 & 78), or Hinge IgG1 linker (SEQ ID
NO:60 & 79), or Hinge IgG3 linker (SEQ ID NO:61 & 80) or
Fibronectin.times.3 linker (SEQ ID NO:62 & 81) or
Fibronectin.times.4 linker (SEQ ID NO:63 & 82); and the Vk
Fc-dAb was DT02-K-044-085; the C-terminal linkers were either
(GS(TVAAPSGS).times.3 (SEQ ID NO:66 & 85), or
Fibronectin.times.3 linker (SEQ ID NO:67 & 86) or
Fibronectin.times.4 linker (SEQ ID NO:68 & 87) or Albumin
Domain 1 (SEQ ID NO:69 & 88), Albumin Domain 2 (SEQ ID NO:70
& 89), Truncated Albumin Domain 3 linker, (Alb Dom 3-TFHAD, SEQ
ID NO:72 & 91) or Gly4Ser 3.times. Linker, (SEQ ID NO:73 &
92), Gly4Ser 4.times. Linker, (SEQ ID NO:74 & 93) or Helical
Linker, (SEQ ID NO:75 & 94).
Example 30
Expression of Anti-VEGF Vh dAb-Fc, Vk dAb-Fc and Vk Fc-dAb
Molecules with Various Linker Modifications
[0271] Expression plasmids encoding the relevant Vh anti-VEGF
dAb-Fc, Vk anti-VEGF dAb-Fc and Vk anti-VEGF Fc-dAb molecules
(described in Example 29 SEQ ID NO: 132-134 and 155-176, Table 19)
transiently transfected into HEK293 6E cells and expressed at 500
ml scale to produce the antibody fragment molecules, as described
in Example 11.
Example 31
Purification of Anti-VEGF Vh dAb-Fc, Vk dAb-Fc and Vk Fc-dAb
Molecules with Various Linker Modifications
[0272] The Vh anti-VEGF dAb-Fc, Vk anti-VEGF dAb-Fc and Vk
anti-VEGF Fc-dAb molecules described in Example 30 were affinity
purified from the supernatants (see Example 12).
Example 32
Molecular Analysis by SDS-PAGE and Size-Exclusion Chromatography
(SEC) of Anti-VEGF Vh dAb-Fc, Vk dAb-Fc and Fc-dAb Molecules with
Various Linker Modifications
[0273] The molecular integrity, homogeneity and % purity of the
anti-VEGF Vh dAb-Fc, anti-VEGF Vk dAb-Fc and anti-VEGF Vk Fc-dAb
molecules which had been purified as described in Example 31 were
analysed by SDS-PAGE, as described in Example 3, The gels showed
band sizes consistent with the predicted molecular mass of the
intact mature protein (from .about.76 kDa to .about.85 kDa for
dAb-Fc and Fc-dAb molecules), allowing for the presence of the
predicted glycan chains per monomer chain. The proteins were
confirmed to be >95% pure target protein by SDS-PAGE and SEC
prior to further analysis in biology assays. If the dAb-Fc or
Fc-dAb molecule was <95% pure a further SEC purification was
carried out (see Example 14 & 33).
Example 33
Purification by Size-Exclusion Chromatography (SEC) of Anti-VEGF Vh
dAb-Fc, Vk dAb-Fc and Vk Fc-dAb Molecules with Various Linker
Modifications
[0274] If necessary, preparative size-exclusion chromatography
(SEC) was carried out for the Vh dAb-Fc, Vk dAb-Fc and Vk Fc-dAb
molecules.
Example 34
Binding of Anti-VEGF Vh dAb-Fc, Vk dAb-Fc and Fc-dAb Molecules with
Various Linker Modifications to VEGF on Biacore
[0275] The binding affinity of the anti-VEGF Vh dAb-Fc, Vk dAb-Fc
and Fc-dAb molecules for VEGF.sub.165 was determined by Surface
Plasmon resonance (SPR) using a Biacore T100 in a similar manner to
Example 16, but with minor modifications. Protein A was immobilised
on a C1 chip by primary amine coupling and this surface was then
used to capture the anti-VEGF constructs. Human recombinant
VEGF.sub.165 (sourced `in house` from transient transfection of
HEK293 cells) was used as the analyte over a varying range of
dilution series detailed below. All binding curves were double
referenced with a buffer injection (i.e. 0 nM) and the data was
fitted to 1:1 model inherent to the T100. Regeneration was carried
out using 50 mM NaOH. The run was carried out at 37.degree. C.,
using HBS-EP as the running buffer.
[0276] The Vk Fc-dAb molecules were compared to DMS30000 and
Bevacizumab (Avastin) over a concentration range of 16 nM, 4 nM, 2
nM, 1 nM, 0.5 nM and 0.25 nM. From the data it was concluded that
the Vk Fc-dAb molecules with the DT02-K-085 dAb linked to the IgG1
Fc by C-terminal linkers Albumin domain 2 and Fibronectin.times.4
behaved similarly in th Biacore to DMS30000, (Table 11A). Use of
the albumin 2 linker was not preferred from biophysical studies,
(data not shown), so the Fibronectin 4 (fib4) was the preferred
C-terminal linker to replace the (GS(TVAAPSGS).times.3 linker in
DMS3000, the latter linker contributing many glycosylated isoforms
making molecule development problematic, (data not shown). A
further anti-VEGF VkFc-dAb data set was generated by similar
Biacore experiments, over a concentration range of 128 nM to
0.03125 nM in a 4 fold dilution series, and is shown in Table 11B.
The data compares the fib4 linker (DMS30026) with helical linker
(DMS30027) as the C-terminal to attach the DT02-K-085 dAb to the
IgG1Fc. The fib4 linker is preferred.
TABLE-US-00019 TABLE 11A Binding of anti-VEGF Vk dAb-Fc and Fc-dAb
molecules to VEGF.sub.165 and comparison to DMS1576, DMS30000,
anti-VEGF dAb-Fc-dAbs and Bevacizumab (Avastin) Ka sample (M - 1 s
- 1) Kd (s - 1) KD (M) fit C085 Alb DOM1 4.15E+06 1.12E-04 2.70E-11
ok C085 Alb DOM2 7.52E+06 Too tight na ok C085 Alb DOM3 6.17E+06
8.12E-05 1.32E-11 ok C085 Fibrx4 7.72E+06 At the na ok limit of
measurement C085 G4Sx3 6.19E+06 1.80E-04 2.91E-11 ok C085 G2Sx4
6.11E+06 1.41E-04 2.31E-11 ok DMS1576 3.48E+06 3.05E-04 8.77E-11
not ideal/ doesn't look lie 1:1 interaction DMS30000 8.96E+06 Too
tight na ok DMS30013 8.74E+06 Too tight na ok DMS30014 8.68E+06 At
the na ok limit of measurement N085 Fibrx4 6.76E+06 4.83E-05
7.15E-12 Not ideal/ doesn't look like 1:1 interaction N085 TVAAPS
8.07E+06 Too tight na Not ideal/ doesn't look like 1:1 interaction
C085 Alb DOM1 4.15E+06 1.12E-04 2.70E-11 ok avastin run failed na
bad
TABLE-US-00020 TABLE 11B Binding of anti-VEGF Vh dAb-Fc, Vk dAb-Fc
and Vk Fc-dAb molecules to VEGF.sub.165 and comparison to DMS1576
and Bevacizumab (Avastin) Ka Sample (M - 1 s - 1) Kd (s - 1) KD (M)
Comment Avastin 3.18E+05 na na Off-rate value outside the range and
thus not reported C085 1.00E+07 6.23E-05 6.21E-12 Good fit to the
1:1 Helical binding model N085 extg1 1.03E+07 6.60E-05 6.43E-12
Biphasic curves C085 Fibr4 8.12E+06 1.29E-05 1.59E-12 Good fit to
the 1:1 binding model Off-rate value approching the limit of
measurement: caution! N597 Fibr3 1.88E+06 1.31E-05 6.96E-12
Off-rate value approching the limit of measurement: caution! N085
T2P 9.40E+06 7.57E-05 8.06E-12 Biphasic curves DMS1576 1.60E+06
2.09E-04 1.30E-10 Biphasic curves
[0277] The Vk dAb-Fc molecules were compared to DMS1576 and
Bevacizumab (Avastin) over a concentration range of 16 nM, 4 nM, 2
nM, 1 nM, 0.5 nM and 0.25 nMm, where Vk dAbFc molecules with the
DT02-K-085 dAb linked to the IgG1Fc by N-terminal linkers N085
Fibronectin 4 and 1.times.TVAAAPS were compared. The data suggests
that the 1.times.TVAPPS is the preferred of the two linkers to
attach the DT02-K-085 dAb to the N-terminus of the IgG1Fc. Further
examples of Vk dAb-Fc molecules are shown in Tables 11B and 11C.
The data was generated over a concentration range of 128 nM to
0.03125 nM in a 4 fold dilution series and the Vk dAb-Fc proteins
with the DT02-K-085 dAb attached to the N-terminus of the IgG1Fc by
N085 T113P (T2P) or ASTHP linker (DMS30029), N085 extg1 or IgG1
Hinge linker (DMS30028) compared to DMS1576. From the data in Table
11B, the IgG1 Hinge linker, (N085extg1), was taken as the preferred
linker for the DT02-K-085 dAb attachment to the N-terminus of the
IgG1Fc, ahead of the 1.times.TVAAPS.
[0278] The Vh dAb-Fc molecules were compared to DMS1576 and
Bevacizumab (Avastin) over a concentration range of 128 nM to
0.03125 nM in a 4 fold dilution series. Data from Table 11B suggest
that the preferred linker for attachment of the 15-26-597 Vh dAb to
the N-terminus of the dAb-Fc is that based upon 3 copies of the
Fibronectin repeat. Further data, shown in Table 11C suggest that
when other linkers are used to N-terminally attach the 15-26-597
dAb to the Fc, the resultant dAb-Fc proteins generated are biphasic
nature in anti VEGF Biacore. From the shape of the Biacore curves
the N597extg1 (IgG1 Hinge) linker was taken to be the next best
from this data set.
TABLE-US-00021 TABLE 11C Binding of anti-VEGF VhdAb-Fc, Vk dAb-Fc
molecules to VEGF.sub.165 and comparison to DMS1576 and Bevacizumab
(Avastin) Sample Ka (M - 1 s - 1) Kd (s - 1) KD (M) comment Avastin
3.24E+05 na na Kd is out of the range (run at 60 ul/min) Avastin
new 2.85E+05 1.92E-05 6.74E-11 Kd is approching the limit of
detection. Caution! Avastin new 3.14E+05 na na Kd is out of the
range (run at 60 ul/min) DMS1576 7.57E+05 2.10E-04 2.77E-10
Biphasic curves. Doesn't look like a 1:1 binding N085 1.16E+07
9.08E-05 7.86E-12 Biphasic curves. TVAAPS Doesn't look like a 1:1
binding Molecule better DMS1576 than mainly due to a better on-rate
N597 extg1 1.22E+06 1.79E-04 1.47E-10 Biphasic curves. Doesn't look
like a 1:1 binding Molecule quite similar to DMS1576 N597 extg3
1.33E+06 1.70E-04 1.28E-10 Biphasic curves. Doesn't look like a 1:1
binding Molecule quite similar to DMS1576
[0279] The behaviour in anti-VEGF Biacore of the Vh dAb-Fc
molecules containing the linkers Fib3 or Fib4 for the N-terminal
coupling of the 15-26-597 dAb to the Fc with DMS1576 were compared
over a concentration range of VEGF 32 nM to 0.03125 nM in a 4 fold
dilution series. The data is shown in Table 11D. The data suggest
that there is no advantage to using the Fib4 linker over the Fib3
linker but that when the linker is lengthened from the `AS` present
in DMS1576 for the N-terminal attachment of the 15-26-597 dAb to
the Fc with the sequences of the Fib3 or Fib4 linker the Vh dAb-Fc
shows more optimal binding kinetics by anti VEGF Biacore.
[0280] The overall data set suggested that to build the most
optimal anti-VEGF dAb-Fc-dAb using the novel linkers to improve
potency but also reduce the number of glycosylated isoforms then
for: [0281] (i) the C-terminal addition of the DT-02-K44-085 Vk dAb
to the Fc; the Fibronectin.times.4 and helical linkers were
preferred; [0282] (ii) the N-terminal addition of the DT-02-K44-085
Vk dAb to the Fc; the IgG1 Hinge, ASTHP and 1.times.TVAAPs linkers
were preferred; [0283] (iii) the N-terminal addition of the
15-26-597 Vh dAb to the Fc; the Fibronectin 3 linker was preferred,
but the IgG1 Hinge and AS linkers were additionally pursued
TABLE-US-00022 [0283] TABLE 11D Binding of anti-VEGF VhdAb-Fc
molecules with Fibr4 and Fibr3 N-terminal linkers to VEGF.sub.165
and comparison to DMS1576. Ligand Ka (M - 1 s - 1) Kd (s - 1) KD
(M) comments N597 Fibr4 2.20E+06 7.03E-05 3.19E-11 Good fit N597
Fibr3 2.13E+06 7.83E-05 3.67E-11 Good fit DMS1576 1.87E+06 1.77E-04
9.43E-11 Decent fit
Example 35
Cloning of Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules with
Modified Linkers
[0284] The Vk-Vk dAb-Fc-dAbs: DMS30034 and DMS30035 (SEQ ID NO:
135-136, 177-178, Table 19) and the Vh-Vk dAb-Fc-dAbs:
DMS30036-DMS30041 (SEQ ID NO: 137-142, 179-184, Table 19 were
engineered by cloning the Vk dAb sequence (DT02-K-044-085 (SEQ ID
NO: 97 & 105) or the Vh dAb sequence, DOM15-26-597 (SEQ ID: 96
& 104) from the Vh-dAb-Fc fusion vector (DMS1576, SEQ ID NO: 2
& 30) onto the N-terminus or C-terminus of the Fc IgG1 sequence
(SEQ ID: 102 & 110). The Fc IgG1 was linked at the C-terminus
to the N-terminus of the Vk dAb (DT02-K-044-085 (SEQ ID NO: 97
& 105)) by a Fibronectin.times.4 linker (SEQ ID: 63 & 82,
see Table 19) in a mammalian expression vector. The N-terminal Vh
dAbs were linked to the N-terminus of Fc using either the AS (SEQ
ID NO:58 & 77, Table 19): DMS30038 (SEQ ID NO:139, 181, Table
19), or Hinge IgG1 (SEQ ID NO:60 & 79, Table 19): DMS30037 (SEQ
ID NO:138, 180, Table 19) or Fibronectin 3 (SEQ ID NO:67 & 86,
Table 19): DMS30036 (SEQ ID NO:137, 179, Table 19) and DMS30040
(SEQ ID NO:141, 183, Table 19) or Fibronectin 4 (SEQ ID NO:60 &
79, Table 19): DMS30039 (SEQ ID NO:140, 182, Table 19) and DMS30041
(SEQ ID NO:142, 184, Table 19-). The N-terminal Vk dAbs were linked
to the N-terminus of Fc using either the Hinge IgG1 (SEQ ID NO:60
&79, Table 19): DMS30034 (SEQ ID NO:135, 177, Table 19) or
ASTHP, (H2A IgG1Fc, SEQ ID NO: 58 &65; 77 &84, Table 19):
DMS30035 (SEQ ID NO:136, 178, Table 19) or Hinge IgG1 (SEQ ID NO:60
& 79, Table 19-): DMS30043 (SEQ ID NO: 143, 177, Table 19). In
sequences DMS 30035, 30040 and 30041 (SEQ IDs 136 & 178; 141
& 183; and 142 & 148 respectively) the Fc contained proline
instead of threonine at position 3 of the Fc.
[0285] The fibronectin.times.4 linker sequence and C-terminal Vk
dAb were codon optimised to raise the overall dAb-Fc-dAb codon
adaptation index (human) to >0.95, for stable expression in
mammalian cells. This fragment was generated by oligonucleotide
assembly and cloned into DMS30034 (SEQ ID 135 & 177), DMS30036
(SEQ ID 137 & 179), DMS30037, (SEQ ID 138 & 180) and
DMS30038 (SEQ ID 139 & 181) to generate DMS30043 (SEQ ID 143
& 177), DMS30044 (SEQ ID 144 & 179), DMS30045 (SEQ ID 145
& 180) and DMS30046 (SEQ ID 146 & 181), respectively. For
clarification, the protein amino acid sequences remained the same
only the DNA sequence was altered.
Example 36
Expression of Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules with
Modified Linkers
[0286] Expression plasmids encoding the relevant anti-VEGF
dAb-Fc-dAb molecules (listed in SEQ ID NO:135, 137-139 and 177,
179-181) were transiently transfected into HEK293 6E cells and
expressed at 500 ml scale to produce the antibody fragment
molecules using the method described in Examples 10 and 21.
Expression levels of >30 mg/L supernatant were routinely
achieved.
Example 37
Purification of Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules
with Modified Linkers
[0287] The dAb-Fc-dAb molecules were affinity purified from the
supernatants (Example 36). 2 ml of suspended affinity resin in
phosphate buffered saline (50:50 slurry) was added to 500 ml of
filtered supernatant; the supernatant/affinity resin mix was rolled
gently at +4.degree. C. overnight to allow binding to take place.
After which time, the resin was allowed to settle and the
supernatant carefully poured off. The resin was re-suspended in
remaining supernatant and poured into an empty drip column and the
supernatant was allowed to pass out of the column. The bound
product was washed using a combination of pH neutral aqueous
buffers to remove non-specifically bound impurities followed by a
low pH elution. Over 90% of bound product was recovered and the pH
of the elution pool then adjusted to pH 3.5 for 30 minutes to
achieve virus neutralisation after which time the pH was adjusted
to pH 4.5.
Example 38
Molecular Analysis by Size-Exclusion Chromatography (SEC) of
Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules with Modified
Linkers
[0288] The molecular integrity, homogeneity and % purity of the
anti-VEGF dAb-Fc-dAb molecules which had been purified as described
in Example 38 were analysed by SDS-PAGE and analytical
size-exclusion chromatography (SEC) as described in Examples 3, 13
& 24. The proteins were confirmed to be >95% pure target
protein by SDS-PAGE and SEC prior to further analysis in biology
assays.
Example 39
Binding of Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules with
Modified Linkers to VEGF and Comparison to Vh and Vk dAb-Fcs and Vk
Fc-dAbs on Biacore
[0289] The binding affinity of the anti-VEGF dAb-Fc-dAb molecules
for VEGF.sub.165 was determined by Surface Plasmon resonance (SPR)
using a Biacore T100 in a similar manner to Examples 25 & 34,
but with minor modifications. Protein A was immobilised on a C1
chip by primary amine coupling and this surface was then used to
capture the anti-VEGF constructs. Human recombinant VEGF.sub.165
(sourced `in house` from transient transfection of HEK293 cells)
was used as the analyte at 32 nM to 0.03125 nM in a 4 fold dilution
series. All binding curves were double referenced with a buffer
injection (i.e. 0 nM) and the data was fitted to 1:1 model inherent
to the T100. Regeneration was carried out using 50 mM NaOH. The run
was carried out at 37.degree. C., using HBS-EP as the running
buffer. The dAb-Fc-dAb molecules were compared to their
corresponding Vk Fc-dAb and Vk dAb-Fc and Vh dAb-Fc molecules, the
data is shown in Table 12A. Some of these Vh/Vk dAb-Fc-dAbs:
DMS30037 and DMS30022, (see Table 12A), performed unexpectedly well
in the Biacore and had good on and off rates suggesting highly
potent molecules.
TABLE-US-00023 TABLE 12A Binding of anti-VEGF dAb-Fc-dAb molecules
and corresponding dAb- Fc-and Fc-dAb molecules to VEGF.sub.165
Ligand Ka (M-1 s-1) Kd (s-1) KD (M) DMS30036 4.01E+06 1.49E-05
3.70E-12 Avastin 5.40E+05 Out of the range Out of the range
DMS30030 2.45E+06 Out of the range Out of the range DMS30037
4.35E+06 1.57E-05 3.61E-12 DMS30034 1.18E+07 8.11E-05 6.90E-12
DMS30026 8.49E+06 Out of the range Out of the range DMS30000ITC
1.31E+07 2.29E-05 1.74E-12 DMS30028ITC 1.04E+07 1.07E-04 1.03E-11
DMS30022ITC 6.93E+06 1.27E-05 1.83E-12 DMS30023ITC 1.33E+07
9.13E-05 6.85E-12 DMS1576ITC 2.70E+06 1.96E-04 7.24E-11 AvastinITC
4.60E+05 Out of the range Out of the range
[0290] Further Biacore data sets were obtained comparing the most
potent looking dAb-Fc-dAbs with DMS1576 and Avastin and an example
of this is shown in Table 12B. The data sets re-affirm that the
Vh/Vk dAb-Fc-dAbs: DMS30022, DMS30036, DMS30037 and DMS30038 look
similar in potency to Avastin and that the Vk/Vk dAb-Fc-dAb
DMS30034 is overall less potent, (in terms of off-rate Kd s-1
1.04E-04, see Table 12B), though an improvement over DMS1576 in
overall KD, (see Table 12B).
[0291] In contrast to Example 25 the dAb-Fc-dAb molecule to VEGF
binding data which is seen in these results suggests that the
Biacore can be a very informative assay format for analysing the
bivalent anti-VEGF dAb-Fc-dAb molecules, when both VEGF binding
sites are of similar potency (eg. DMS30036, DMS30037 and DMS30038),
and can be used to distinguish from molecules that have one potent
and one less potent binding site, eg DMS30034.
TABLE-US-00024 TABLE 12B Binding of anti-VEGF dAb-Fc-dAb molecules
molecules to VEGF.sub.165 and comparison to DMS1576 and Avastin.
Ligand Ka (M-1 s-1) Kd (s-1) KD (M) DMS30022 1.01E+07 5.10E-05
5.06E-12 Avastin 5.61E+05 Out of the range Out of the range
DMS30034 HEK 2.57E+07 1.04E-04 4.06E-12 DMS30037 HEK 8.01E+06
4.98E-05 6.22E-12 DMS1576 3.62E+06 2.97E-04 8.21E-11 DMS30036 HEK
6.66E+06 4.85E-05 7.28E-12 DMS30038 HEK 7.11E+06 4.74E-05
6.67E-12
Example 40
VEGF R2 Receptor Binding Assay of Anti-VEGF Vh/Vk & Vk/Vk
dAb-Fc-dAb Molecules with Modified Linkers Compared to Most Potent
Vh dAb-Fc and Avastin
[0292] The potencies of some of the anti-VEGF Vh/Vk & Vk/Vk
dAb-Fc-dAb molecules with modified linkers were analysed in the
VEGF receptor 2, (R2), binding assay using the modified method,
i.e. with no pre-incubation, described in Examples 7, 17 & 26
and were compared to the Vh dAb-Fc, DMS30030 and Bevacizumab
(Avastin). The data is shown in Tables 13A and 13B. From the data
in Table 13A all the tested dAb-Fc-dAb molecules: DMS30022,
DMS30023, DMS30034, DMS30036 and DMS30037 appeared to be more
potent by lower EC50 values than DMS30030 and considerably more
potent than Bevacizumab (Avastin). However, there was some
variability in the maximal percentage inhibition achieved by the
molecules in the assay with Avastin, DMS30022 and DMS30030
achieving >94% maximal inhibition and DMS30023, DMS30034,
DMS30036 and DMS30037 achieving 78-84% maximal inhibition, (data
not shown)
[0293] Further data was generated comparing the dAb-Fc-dAbs:
DMS30022 and DMS30038 with the Vh dAb-Fc, DMS30030 and Bevacizumab
(Avastin) and this is shown in Table 13B.
[0294] In summary, DMS30022 and DMS30038 appeared to be comparable
and more potent by lower EC50 values than DMS30030 and considerably
more potent than Bevacizumab (Avastin), Table 13B. Again, there was
some variability in the maximal percentage inhibition achieved by
the molecules in the assay with Avastin, DMS30022 and DMS30030
achieving >95% maximal inhibition and DMS30038 achieving 91%
maximal inhibition, (data not shown).
TABLE-US-00025 TABLE 13A EC.sub.50 values of anti-VEGF dAb-Fc-dAbs
compared to DMS30030 and Bevacizumab (Avastin) in VEGFR2 Receptor
Binding Assay. Curve fitting and EC.sub.50 calculations were
performed using GraphPad Prism. EC50 EC50 VEGFR2 RBA (g/mL) (pM)
Avastin 2.92E-07 1944 DMS30034 (LT111020) 4.93E-09 47 DMS30036
(LT111027) 3.78E-09 36 DMS30037 (LT111020) 3.86E-09 37 DMS30022
(CR290911) 4.04E-09 38 DMS30023 (CR290911) 3.23E-09 31 DMS30030
(MH171011) 4.93E-09 62
TABLE-US-00026 TABLE 13B EC.sub.50 values of anti-VEGF dAb-Fc-dAbs:
DMS30022 and DMS30038 compared to DMS30030 and Bevacizumab
(Avastin) in VEGFR2 Receptor Binding Assay. Curve fitting and
EC.sub.50 calculations were performed using GraphPad Prism. EC50
EC50 VEGF R2 RBA (g/mL) (pM) Avastin 2.9E-07 1933 DMS30022
(CR290911) 4.67E-09 44 DMS30038 (CR291111) 4.12E-09 39 DMS30030
(MH171011) 1.17E-08 146
Example 41
Human Umbilical Vein Endothelial Cell (HUVEC) Proliferation Assay:
Inhibition with Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules
Containing Modified Linkers
[0295] The abilities of the dAb-Fc-dAb molecules with modified
linkers: Vh-Vk (DMS30022, DMS30036, DMS30037) and Vk-Vk (DMS30023,
DMS30034), to suppress proliferation of human umbilical vein
endothelial cells were compared to the Vh dAb-Fc molecule
(DMS30030), the Vk Fc-dAb molecule (DMS30026) and Bevacizumab
(Avastin) using the method described in Examples 8 & 18 &
27 with the following deviations (i) rather than leaving the outer
wells free of cells, the whole 96 well plate was used and (ii) the
data was analysed using GraphPad Prism using a Sigmodial curve fit,
variable slope cf a non-linear regression (variable slope). The
test compounds were independently assessed on individual plates
against the comparator molecule, Bevacizumab (Avastin); the assay
was carried out on at least four separate occasions, with a total
data set per molecule of Bevacizumab (Avastin): 20; DMS30030: 8;
DMS30036: 8; DMS30022: 4; DMS30037: 8; DMS30026: 4; DMS30023: 4;
DMS30034: 4 (data not shown). The focus was upon analysing both the
degree of maximum inhibition and the relative EC50 values in the
assay generated by certain molecules compared to that of
Bevacizumab (Avastin).
[0296] The data was analysed using GraphPad Prism using a Sigmodial
curve fit, variable slope cf a non-linear regression (variable
slope). Individual curve fits were fitted for each molecule and at
each day. Due to some poor fitting, it was decided to introduce
constraints for the curve where a plateau was not observed at the
lower concentration. This constraint would be equal to the mean of
the points at the lowest concentration. Data was manually selected
as to whether the minimum was constrained or not, and the curve fit
and parameters were automatically updated based upon this criteria
selection. Estimates of the curve maxima and the standard error
were analysed using a weighted mixed model analysis of variance,
using 1/(standard error).sup.2, [SE].sup.2, as a weighting. The
analysis adjusted for variability between plates and days using
random effects terms. From this analysis, the predicted means were
estimated and comparisons were made back to Avastin (control)
(Table 14A). The same analysis was then performed on the log 10
scale for the IC50, and the results back transformed. From this,
estimates of the geometric means were generated and comparisons
were made back to Avastin in the form of a ratio to Avastin
(control) i.e. a ratio of 0.5 would indicate a 50% drop from
Avastin (Table 14B).
TABLE-US-00027 TABLE 14A Predicted geometric means of maximum
percentage inhibition of anti- VEGF dAb-Fc-dAbs with 95% confidence
intervals (CI) compared to DMS30026, DMS30030 and Bevacizumab
(Avastin) in the HUVEC Assay. Predicted Means for Max % Inhibition
Lower Upper mAb Estimate 95% CI 95% CI Avastin 73.5423 68.5130
78.5717 DMS30022 80.3745 70.6202 90.1287 DMS30023 69.7258 60.3045
79.1471 DMS30026 70.5232 59.1251 81.9213 DMS30030 64.7441 57.5772
71.9110 DMS30034 85.1436 73.9429 96.3444 DMS30036 79.0377 73.2432
84.8323 DMS30037 77.8069 72.1446 83.4691
[0297] From this analysis molecules DMS30022, DMS30034, DMS30036
and DMS30037 seem to lead to the most maximal inhibition in the
HUVEC assay and although they apparently out-performed the Avastin
group, the confidence interval overlapped the zero reference so
that there was no statistically significant difference from
Avastin, data not shown (Table 14A).
TABLE-US-00028 TABLE 14B Geometric means of IC50 for anti-VEGF
dAb-Fc-dAbs with 95% confidence intervals (CI) compared to
DMS30026, DMS30030 and Bevacizumab (Avastin) in the HUVEC Assay.
Predicted Means for IC50 Lower Upper mAb Estimate 95% CI 95% CI
Avastin 1.773E-9 1.504E-9 2.09E-9 DMS30022 9.03E-10 6.53E-10
1.25E-9 DMS30023 5.98E-10 4.27E-10 8.36E-10 DMS30026 1.675E-9
1.201E-9 2.336E-9 DMS30030 2.405E-9 1.82E-9 3.18E-9 DMS30034
1.216E-9 7.77E-10 1.902E-9 DMS30036 1.052E-9 8.4E-10 1.316E-9
DMS30037 8.04E-10 6.42E-10 1.007E-9
[0298] A similar analysis of the geometric means of the IC50 values
with 95% confidence intervals, (CI), showed that the molecules
DMS30022, DMS30023, DMS30036 and DMS30037 had statistically
significantly lower IC50 values than Avastin, data not shown (Table
14B).
[0299] A separate set of data was generated from HUVEC assays in a
similar format from a different operator. The data focussed upon
comparing the behaviour of two dAb-Fc-dAbs in the HUVEC assay:
DMS30022 and DMS30037 with that of Bevacizumab (Avastin) and was
performed in quadruplicate. The data suggest that both dAb-Fc-dAbs
have very similar IC50 values and levels of maximal inhibition in
the HUVEC assay and appear more potent, though not statistically so
in this particular data set, than Bevacizumab (Avastin), (data not
shown).
Example 42
Performance of Anti-VEGF Vh/Vk & Vk/Vk dAb-Fc-dAb Molecules
with Modified Linkers in VEGF Induced Blood-Retinal Breakdown:
Rabbit Retinal Leaked Model
[0300] DMS30022, DMS30030, DMS30034, DMS30036 and DMS30037 were
tested in a human VEGF165 (R&D Systems), induced blood-retinal
breakdown, (BRB), model in the rabbit eye and compared against
Bevacizumab (Avastin), and Kenacort (Tramcinalone) as described in
Example 9.
[0301] The aim of this study and method were similar to those
outlined for Example 9 above. The dosing and injection schedule is
shown in Table 15A.
[0302] All molecules were buffer exchanged into 50 mM sodium
acetate buffer pH5.5, 104 mM NaCl, 0.02 mM EDTA following the
method of Example 9 above.
[0303] One hundred and forty (140) HY79B pigmented rabbits were
randomly divided into eleven (11) groups of twelve (12) animals and
one (1) group of eight animals, each group was sub-divided into 4
experimental sets of 3 animals, bar the Kenacort treated group, (4
sets of 2 animals), (see Table 15A).
[0304] Mean intravitreal levels of some of the dosed molecules,
(DMS30036, DMS30037 and DMS30022), were determined by an MSD,
(Mesoscale Discovery), based functional VEGF binding assay, (data
not shown). For the molecules measured, levels were similar to that
expected from the injected levels and the likely half life range
for the molecules in the rabbit vitreous, (data not shown).
Fluorescein angiograms were collected for qualitative
assessment.
TABLE-US-00029 TABLE 15A Dosing and injection schedule for
inhibition of VEGF induced rabbit retinal leakage by DMS30022,
DMS30030, DMS30034, DMS30036 and DMS30037 compared to Bevacizumab
(Avastin) and Kenacort (Triamcinalone). Treatment Dose Treatment
Number of animals (right eye) eye Protocol Set 1 Set 2 Set 3 Set 4
Induction Measurements Vehicle -- 50-.mu.L 3 3 3 3 Day 0 On Day 2:
Avastin H IVT Day-7 3 3 3 3 500 ng/50 * Retinal angiography Avastin
L 3 3 3 3 .mu.L rhVEGF assessment using Avastin L/3 3 3 3 3 (IVT)
Heidelberg's Retinal DMS30030 L 3 3 3 3 Angiograph DMS30030 L/3 3 3
3 3 * Fluorescein leakage DMS30034 L/3 3 3 3 3 quantification in
DMS30036 L/3 3 3 3 3 vitreous/retina segment DMS30037 L 3 3 3 3
(Fluorotron .RTM. Master) DMS30037 L/3 3 3 3 3 * Eyeballs sampling
DMS30022 L/3 3 3 3 3 (except for Kenacort Kenacort .RTM. 2000 2 2 2
2 group) Retard .mu.g/eye
[0305] Intravitreally injected VEGF induced a breakdown of the BRB,
which was blocked by treatment with the following compounds when
un-masked: Bevacizumab (Avastin), at all three doses; DMS30030, (L
and L/3 doses); DMS30022 (L/3 dose), DMS30034, (L/3 dose), DMS30036
(L dose), and DMS30037 (L and L/3 dose), 9 days post injection,
with an efficacy similar to that of the marketed reference
(Kenacort.RTM.). In the masked study, an important retinal vascular
leakage was noted in right induced eyes after treatment with
Vehicle, negative control, and DMS30036 at L/3 dose, although the
classification was influenced by the presence of a single
significant outling data point, (data not shown). Note than one
data point (rabbit 134) was excluded from further analysis from the
DMS30037 L/3 dosed group due to a abnormality scoring for
fluorescence.
[0306] The raw data was subject to further statistical analysis:
the masked groups corresponding to the same molecule and dose were
pooled and geometric mean values were determined with 95%
confidence intervals (CI). The geometric mean data is shown Table
15B (i) and the ratio to vehicle values and variance with 95% CI
are shown in Table 15B (ii). From the data analysis in Tables 15B
(i) and (ii) the marketed corticoid reference (Kenacort.RTM.
retard) reduced the degree of VEGF induced retinal leakage by 80%),
the three different doses of Bevacizumab (Avastin), were effective
by 71.4-76.4%, with no evidence of a dose response, DMS30022 (L/3)
was effective by 74.6%, DMS30037 (L) by 74.2% and (L/3) by 67.4%;
DMS30036 L/3 by 63.7%; DMS30034 L/3 by 59.5% and DMS 30030 (L) by
65.5% and L/3 by 70.5%. It was concluded that Vh/Vk dAb-Fc-dAbs
such as DMS30022 and DMS30037 were the most potent format in this
model.
TABLE-US-00030 TABLE 15B Inhibition of VEGF induced rabbit retinal
leakage by DMS30022, DMS30030, DMS30034, DMS30036 and DMS30037
compared to Bevacizumab (Avastin) and Kenacort (Triamcinalone)
Analysis of log10 right values (RE) adjusted for log10 left eye
values (LE), (excluding rabbit 134 opaque lens in group 5: DMS30037
L/3) (i) Geometric means Geometric grpno group mean lower upper 1
DMS30030 L/3 15070.42 10613.18 21399.57 2 Avastin L/3 14592.62
10277.06 20720.37 3 Avastin H 12332.94 8673.32 17536.69 4 DMS30036
L/3 18539.81 13041.82 26355.55 5 DMS30037 L/3 16602.99 11620.75
23721.32 6 Vehicle 51006.20 35920.69 72427.12 7 DMS30022 L/3
12975.83 9135.26 18431.04 8 DMS30037 L 13159.70 9257.22 18707.31 9
Avastin L 12037.98 8470.04 17108.87 10 DMS30030 L 17586.48 12379.27
24984.06 11 DMS30034 L3 20632.66 14441.37 29478.27 12 Kenacort
10205.21 6929.09 15030.31 (ii) Ratio to vehicle and percentade
reduction. grpno group ratio lower upper P value % reduction 1
DMS30030 L/3 0.29546 0.20895 0.41779 <.0001 70.4537 2 Avastin
L/3 0.28609 0.20235 0.40449 <.0001 71.3905 3 Avastin H 0.24179
0.17060 0.34269 <.0001 75.8207 4 DMS30036 L/3 0.36348 0.25683
0.51442 <.0001 63.6519 5 DMS30037 L/3 0.32551 0.22839 0.46394
<.0001 67.4491 7 DMS30022 L/3 0.25440 0.17990 0.35973 <.0001
74.5603 8 DMS30037 L 0.25800 0.18230 0.36514 <.0001 74.1998 9
Avastin L 0.23601 0.16665 0.33424 <.0001 76.3990 10 DMS30030 L
0.34479 0.24379 0.48763 <.0001 65.5209 11 DMS30034 L/3 0.40451
0.28368 0.57680 <.0001 59.5487 12 Kenacort 0.20008 0.13518
0.29612 <.0001 79.9922
Example 43
Larger Scale Purification of Vh/Vk dAb-Fc-dAb Molecules from
Chinese Hamster Ovary (CHO) Cells
[0307] For example, DMS30037 was captured from clarified cell
culture supernatant using affinity chromatography and an automated
FPLC purification system. Once loaded, the bound product was washed
using a combination of pH neutral aqueous buffers to remove
non-specifically bound impurities followed by a low pH elution from
which over 90% of bound product was recovered. After storage at
-40.degree. C. the elution pool was thawed then adjusted to pH 3.6
for 30 minutes to achieve virus neutralisation after which time the
pH was adjusted to pH6.0. The pH adjusted pool was further purified
on a second column whereby product was loaded under non-product
binding conditions that promote removal of process impurities. The
purified DMS30037 was then collected as a pool before 0.2 .mu.m
filtration and storage. Additionally, DMS30037 affinity column
eluates were pH adjusted to 7.5 in low salt buffer, filtered and
then concentrated and diafiltered into a suitable formulation
buffer using a tangential flow filtration system. Recovered product
was 0.2 .mu.m sterile filtered and stored.
Example 44
Cloning of Anti-VEGF Vh/Vk dAb-Fc-dAb Molecules with Modified
C-Termini
[0308] The Vh-Vk dAb-Fc-dAbs with modifications to the C-terminus
of the Vk dAb: DMS30047-30054 (SEQ ID NO:147-154 & 185-192,
Table 19) were engineered by generating the variant Vk dAb
sequences by PCR and then by re-cloning into DMS30045 and DMS30046,
respectively to generate the modified mammalian expression vectors.
From DMS30045: (i) the C-terminal arginine residue was removed to
generate DMS30047 (DMS30037-R), (ii) a C-terminal alanine was added
to generate DMS30048, (DMS30037+A), (iii) three C-terminal alanines
were added to generate DMS30049, (DMS30037+AAA) and a C-terminal
threonine was added to generate DMS30050 (DMS30037+T). From
DMS30046: (i) the C-terminal arginine residue was removed to
generate DMS30051 (DMS30038-R), (ii) a C-terminal alanine was added
to generate DMS30052, (DMS30038+A), (iii) three C-terminal alanines
were added to generate DMS30053, (DMS30038+AAA) and a C-terminal
threonine was added to generate DMS30054 (DMS30038+T).
Example 45
Expression of Anti-VEGF Vh/Vk dAb-Fc-dAb Molecules with Modified
C-Termini (DMS30047-30054)
[0309] Expression plasmids encoding the relevant anti-VEGF
dAb-Fc-dAb molecules (listed in SEQ ID NO:147-154, and 185-192,
Table 19) were transiently transfected into HEK293 6E cells and
expressed at 500 ml scale to produce the antibody fragment
molecules using the method described in Examples 10, 21 and 36.
Expression levels of >30 mg/L supernatant were routinely
achieved.
Example 46
Purification of Anti-VEGF Vh/Vk dAb-Fc-dAb Molecules with Modified
C-Termini
[0310] The dAb-Fc-dAb molecules were affinity purified from the
supernatants (Example 45), as described for Example 37 above.
Example 47
Molecular Analysis by Size-Exclusion Chromatography (SEC) of
Anti-VEGF Vh/Vk dAb-Fc-dAb Molecules with Modified C-Termini
[0311] The molecular integrity, homogeneity and % purity of the
anti-VEGF dAb-Fc-dAb molecules which had been purified as described
in Example 46 were analysed by SDS-PAGE and analytical
size-exclusion chromatography (SEC) as described in Examples 3
& 13. The proteins were confirmed to be >95% pure target
protein by SDS-PAGE and SEC prior to further analysis in biology
assays.
Example 48
Binding of Anti-VEGF Vh/Vk dAb-Fc-dAb Molecules with Modified
C-Termini to VEGF on Biacore
[0312] The binding affinity of certain anti-VEGF dAb-Fc-dAb
molecules, (with small C-terminal modifications), for VEGF.sub.165
was determined by Surface Plasmon resonance (SPR) using a Biacore
T100 in a similar manner to Examples 34 and 40, but with minor
modifications. Protein A was immobilised on a C1 chip by primary
amine coupling and this surface was then used to capture the
anti-VEGF constructs. Human recombinant VEGF.sub.165 (sourced `in
house` from transient transfection of HEK293 cells) was used as the
analyte at 32 nM to 0.03125 nM in a 4 fold dilution series. All
binding curves were double referenced with a buffer injection (i.e.
0 nM) and the data was fitted to 1:1 model inherent to the T100.
Regeneration was carried out using 50 mM NaOH. The run was carried
out at 37.degree. C., using HBS-EP as the running buffer. The data
obtained is shown in Tables 16A, 16B & 16C. From the data in
Table 16A, the behaviour of DMS30037 and several variants modified
at the C-terminus: DMS30037+A (DMS30048), DMS30037+AAA (DMS30049),
and DMS30037+T (DMS30050) seem comparable on Biacore and the
C-terminal modifications do not appear to reduce potency over
parental.
[0313] A further data set is shown in Table 16B where the
performance of both DMS30037 and DMS30038 were compared with
variants modified at the C-terminus: DMS30037-R, (labelled as +R
(DMS30047), DMS30037+T (DMS30050) and DMS30038-R, (labelled as +R
(DMS30051) and Bevacizumab (Avastin) in the Biacore. In this data
set again the behaviour of all the molecules seems comparable on
Biacore and the C-terminal modifications do not appear to reduce
potency over parental. Meaningful data could not be captured other
than to view the curve for Avastin. A further data set is displayed
in Table 16C where the molecules DMS30037 and DMS30038 were
compared with variants modified at the C-terminus: DMS30037-R,
(DMS30047), DMS30037+T (DMS30050), DMS30038-R, (DMS30051) and
DMS30038+T (DMS30054) and Bevacizumab (Avastin). Again the
behaviour of all the dAb-Fc-dAb molecules seem comparable on
Biacore and the C-terminal modifications do not appear to reduce
potency over parental. In this data set, see Table 16C, the
Bevacizumab (Avastin) data could not be properly measured due to
the off-rate being too tight.
TABLE-US-00031 TABLE 16A Binding of the anti-VEGF dAb-Fc-dAb
molecule: DMS30037 with C-terminal modifications to VEGF.sub.165
and comparison to DMS30037. Ligand Ka (M-1 s-1) Kd (s-1) KD (M)
DMS30037 8.18E+06 4.34E-05 5.30E-12 DMS30037 + A 8.25E+06 5.21E-05
6.32E-12 DMS30037 + AAA 7.74E+06 5.37E-05 6.94E-12 DMS30037 + T
8.03E+06 4.21E-05 5.24E-12
TABLE-US-00032 TABLE 16B Binding of the anti-VEGF dAb-Fc-dAb
molecules: DMS30037 and DMS30038 with C-terminal modifications to
VEGF.sub.165 and comparison to parental dAb-Fc-dAb and
Bevacizumab(Avastin). Ligand Ka (M-1 s-1) Kd (s-1) KD (M) DMS30037
L04E+07 439E-05 4.22E-12 DMS30037 + R 1.07E+07 4.22E-05 3.94E-12
DMS30037 + T 1.10E+07 4.27E-05 3.90E-12 DMS30038 1.03E+07 4.79E-05
4.64E-12 DMS30038 + R 1.23E+07 5.31E-05 4.31E-12 avastin 8.39E+05
Out of range Out of range
TABLE-US-00033 TABLE 16C Binding of the anti-VEGF dAb-Fc-dAb
molecules: DMS30037 and DMS30038 with C-terminal modifications to
VEGF.sub.165 and comparison to parental dAb-Fc-dAb and
Bevacizumab(Avastin). Ligand ka kd KD DMS30037 5.60E+06 1.46E-04
2.61E-11 DMS30037 + T 5.38E+06 1.42E-04 2.64E-11 DMS30037 - R
6.97E+06 1.55E-04 2.22E-11 DMS30038 5.69E+06 1.55E-04 2.73E-11
DMS30038 - R 5.90E+06 1.58E-04 2.68E-11 DMS30038 + T 8.28E+06
1.22E-04 1.47E-11 Avastin 1.24E+06 Out of range Out of range
Example 49
VEGF R2 Receptor Binding Assay of Anti-VEGF Vh/Vk dAb-Fc-dAb
Molecules with Modified C-Termini
[0314] The potencies of anti-VEGF_Vh/Vk dAb-Fc-dAb molecules based
upon DMS30037 and DMS30038, but with C-terminal modifications, were
compared both to the wild type molecule and Bevacizumab (Avastin),
in the VEGF receptor 2, (R2), binding assay using the modified
method, i.e. with no pre-incubation, described in Examples 7, 17
& 26 & 40. The data is shown in Table 17A, all the tested
dAb-Fc-dAb molecules: DMS30037, DMS30037+T (DMS30050), DMS30037-R
(DMS30047), DMS30038, DMS30038-R (DMS30051), appeared to be of
comparable potency and considerably more potent than Bevacizumab
(Avastin), Table 17A. There was little variation in the maximal
percentage inhibition achieved by the molecules in the assay with
all molecules achieving >93-98% maximal inhibition, (data not
shown).
[0315] Further data was generated comparing the dAb-Fc-dAbs:
DMS30038, DMS30038+T, (DMS30050) and DMS30038-R, (DMS30051) with
Bevacizumab (Avastin), in the same assay format, the data is
displayed in Table 17B. From the data DMS30038 and its C-terminal
variants, (Table 17B), have similar potencies judged by EC50 values
in the RBA assay and appear to be considerably more potent than
Bevacizumab (Avastin) by this criteria. There was little variation
in the maximal percentage inhibition achieved by the molecules in
the assay with all molecules achieving >94% maximal inhibition,
(data not shown)
TABLE-US-00034 TABLE 17A EC.sub.50 values of anti-VEGF dAb-Fc-dAbs
with C-terminal modifications compared to Bevacizumab (Avastin) in
VEGFR2 Receptor Binding Assay. Curve fitting and EC.sub.50
calculations were performed using GraphPad Prism. EC50 EC50 VEGFR2
RBA (g/mL) (pM) Avastin 1.21E-07 806 DMS30037 2.99E-09 28 DMS30037
+ T 2.98E-09 28 DMS30037 - R 2.66E-09 25 DMS30038 3.37E-09 32
DMS30038 - R 3.84E-09 37
TABLE-US-00035 TABLE 17B EC.sub.50 values of anti-VEGF dAb-Fc-dAbs
with C-terminal modifications compared to Bevacizumab (Avastin) in
VEGFR2 Receptor Binding Assay. Curve fitting and EC.sub.50
calculations were performed using GraphPad Prism. EC50 EC50 VEGF R2
RBA (g/mL) (pM) Avastin 3.4E-07 2266 DMS30038 5.28E-09 50 DMS30038
+ T 4.31E-09 41 DMS30038 - R 4.53E-09 43
Example 49
Human Umbilical Vein Endothelial Cell (HUVEC) Proliferation Assay:
Inhibition with Anti-VEGF Vh/Vk dAb-Fc-dAb Molecules Containing
C-Terminal Modifications
[0316] The abilities of dAb-Fc-dAb molecules based upon DMS30037
and DMS30038 but with C-terminal modifications: DMS30037-R
(DMS30047) & DMS30037+T (DMS30050), DMS30038-R (DMS30051) &
DMS30038+T (DMS30054) to suppress proliferation of human umbilical
vein endothelial cells were compared to Bevacizumab (Avastin) using
the method described in Examples 8, 18, 27 & 41 with the
following deviations (i) rather than leaving the outer wells free
of cells, the whole 96 well plate was used and (ii) the data was
analysed using GraphPad Prism using a Sigmodial curve fit, variable
slope cf a non-linear regression (variable slope). The test
compounds were independently assessed on individual plates against
the comparator molecule, Bevacizumab (Avastin); the assay was
carried out on at least three separate occasions, with a total data
set per molecule of Bevacizumab (Avastin): 15; DMS30037: 7;
DMS30038: 8; DMS30037-R (DMS30047): 3; DMS30037+T (DMS30050): 4;
DMS30038-R (DMS30051): 4 & DMS30038+T (DMS30054): 4, (data not
shown). The focus was upon analysing both the degree of maximum
inhibition and the relative EC50 values in the assay generated by
certain molecules compared to that of Bevacizumab (Avastin).
[0317] The data was analysed using GraphPad Prism using a Sigmodial
curve fit, variable slope cf a non-linear regression (variable
slope). Individual curve fits were fitted for each molecule and at
each day. Due to some poor fitting, it was decided to introduce
constraints for the curve where a plateau was not observed at the
lower concentration. One plate was excluded from the analysis due
to poor curve fitting despite constraints. This constraint would be
equal to the mean of the points at the lowest concentration. Data
was manually selected as to whether the minimum was constrained or
not, and the curve fit and parameters were automatically updated
based upon this criteria selection. Estimates of the curve maxima
and the standard error were analysed using a weighted mixed model
analysis of variance, using 1/(standard error).sup.2, [SE].sup.2,
as a weighting. The analysis adjusted for variability between
plates and days using random effects terms. From this analysis, the
predicted means were estimated and comparisons were made back to
Bevacizumab (Avastin, control) (See Table 18A). The same analysis
was then performed on the log 10 scale for the IC50, and the
results back transformed. From this, estimates of the geometric
means were generated and comparisons were made back to Bevacizumab
(Avastin) in the form of a ratio to Bevacizumab (Avastin control)
i.e. a ratio of 0.5 would indicate a 50% drop from Bevacizumab,
(Avastin, see Table 18B).
TABLE-US-00036 TABLE 18A Predicted geometric means of maximum
percentage inhibition of C-terminally modified anti-VEGF
dAb-Fc-dAbs with 95% confidence intervals (CI) compared to parental
and Bevacizumab (Avastin) in the HUVEC Assay. Predicted Means for
Max % Inhibition Lower Upper mAb Estimate 95% CI 95% CI Avastin
71.0316 61.6741 80.3891 DMS30037 85.4759 74.9164 96.0354 DMS30037 +
T 89.9852 78.2698 101.70 DMS30037 - R 82.2693 69.9929 94.5457
DMS30038 73.5602 63.7180 83.4023 DMS30038 + T 79.0343 67.1904
90.8782 DMS30038 - R 77.6519 65.5487 89.7550
[0318] From this analysis, molecules DMS30037, DMS30037+T and
DMS30037-R seem to lead to the most maximal inhibition in the HUVEC
assay and they out-performed the Avastin group, the confidence
interval did not overlap the zero reference so the data was
statistically significant from that of Avastin, data not shown (see
Table 18A).
TABLE-US-00037 TABLE 18B Geometric means of IC50 for C-terminally
modified anti-VEGF dAb-Fc- dAbs with 95% confidence intervals (CI)
compared to parental and Bevacizumab (Avastin) in the HUVEC Assay.
Geometric Means for IC50 Lower Upper mAb Estimate 95% CI 95% CI
Avastin 3.829E-9 3.119E-9 4.7E-9 DMS30037 1.903E-9 1.473E-9 2.46E-9
DMS30037 + T 2.332E-9 1.758E-9 3.092E-9 DMS30037 - R 7.365E-9
2.06E-10 2.639E-7 DMS30038 2.163E-9 1.723E-9 2.715E-9 DMS30038 + T
2.649E-9 1.877E-9 3.738E-9 DMS30038 - R 2.234E-9 1.699E-9
2.936E-9
[0319] A similar analysis of the geometric means of the IC50 values
with 95% confidence intervals, (CI), showed that almost all the
dAb-Fc-dAb molecules DMS30037, DMS30037+T, DMS30038, DMS30038+T and
DMS30038-R had statistically significantly lower IC50 values than
Bevacizumab (Avastin), data not shown (see Table 18B). The data set
from DMS30037-R was highly variable with a low n number (3).
[0320] Overall the data suggest that C-terminal modifications to
both dAb-Fc-dAbs: DMS30037 & DMS30038 have very similar IC50
values and levels of maximal inhibition in the HUVEC assay to
parental molecules and appear more potent, than Bevacizumab
(Avastin), both interms of maximal percentage inhibition and lower
IC50, (see Tables 18A and 18B).
Example 50
Cross-Reactivity of Vh dAb-Fc (DMS1529) and Vk Fc-dAb (DMS30000) to
Murine VEGF.sub.164
[0321] A MSD, (MesoScale Discovery), high bind 96 well plate (MSD
L11X6-3) was coated with 1 or 2 .mu.g/mL mVEGF.sub.164 (R&D
493-MV/CF) (25 .mu.L/well), sealed and incubated overnight at
4.degree. C. Next day the MSD plate was washed 3.times.300
.mu.L/well with Tris wash buffer and blocked with 3% BSA in PBS
(250 .mu.L/well) and incubated shaking (750 RPM) at room
temperature for 1 hour. The MSD plate was washed again before the
addition of the DMS1529, DMS30000 or mVEGF R2 Fc (R&D
443-KD/CF) standard curves (25 .mu.L/well) and incubated shaking
(750 RPM) at room temperature for 2 hours. The standards were
diluted using 0.1% BSA in PBS. The MSD plate was washed again
before the addition of the detection reagent (25 .mu.L/well,
in-house sulfo-TAG labelled goat anti-human IgG, Fc specific--Sigma
I2136) at 1 .mu.g/mL in 1% BSA in PBS and incubated shaking (750
RPM) at room temperature for 1 hour. Prior to measuring the
electrochemical luminescence in a MSD Sector Imager 6000, the MSD
plate was washed again and 150 .mu.L/well of 2.times. Read Buffer T
(MSD R92TC-1) was added. Excel was used for data analysis and graph
plotting.
[0322] An example data set is shown in FIG. 4 where the MSD signal
is plotted against antibody concentration for DMS1529, DMS3000 and
a mouse VEGF R2 Fc control protein.
[0323] There is clear binding of all 3 proteins to mouse
VEGF.sub.164 in a concentration dependent manner indicating that
the dAbs cross-react with mouse VEGF.sub.164.
TABLE-US-00038 TABLE 19 DNA and Amino Acid Sequence ID table Amino
Acid DNA Sequence Sequence Molecule ID Molecule Description SEQ ID
No. SEQ ID No. Vh dAb-Fc Sequences DMS1529 DOM15-26-593-Fc dAb-Fc 1
29 Also see FIG. Also see FIG. 52C in 52A in WO2008/149150/
WO2008/149150/ A2. A2. SEQ ID1 DMS1576 DOM15-26-597-Fc dAb-Fc 2 30
Vk dAb-Fc and Fc- dAb Sequences DMS30000 C-terminal Fc fusion of
K-044- 3 31 085 dAb (GS(TVAAPSGS)x3 Linker) Fc-dAb DMS30001
C-terminal Fc fusion of K-044- 4 32 232 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb DMS30002 C-terminal Fc fusion of K-044- 5 33 236 dAb
(GS(TVAAPSGS)x3 Linker) Fc-dAb DMS30003 C-terminal Fc fusion of
K-044- 6 34 251 dAb (GS(TVAAPSGS)x3 Linker) Fc-dAb DMS30004
C-terminal Fc fusion of K-044- 7 35 255 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb DMS30005 N-terminal Fc fusion of K-044- 8 36 251 dAb (AAAS
Linker) dAb-Fc DMS30006 N-terminal Fc fusion of K-044- 9 37 255 dAb
(AAAS Linker) dAb-Fc DMS30013 C-terminal Fc fusion of K-044-16 44
085 dAb (Albumin Domain 3 Linker) Fc-dAb DMS30014 C-terminal Fc
fusion of K-044- 17 45 085 dAb (Albumin Domain 3 Linker) Fc-dAb
DMS30015 C-terminal Fc fusion of K-044- 18 46 251 dAb (Albumin
Domain 3 Linker) Fc-dAb DMS30016 C-terminal Fc fusion of K-044- 19
47 251 dAb (Albumin Domain 3 Linker) Fc-dAb DMS30017 N-terminal Fc
fusion of K-044- 20 48 085 dAb (TVAAPS Linker) dAb- Fc DMS30018
N-terminal Fc fusion of K-044- 21 49 232 dAb (TVAAPS Linker) dAb-
Fc DMS30019 N-terminal Fc fusion of K-044- 22 50 236 dAb (TVAAPS
Linker) dAb- Fc DMS30020 N-terminal Fc fusion of K-044- 23 51 251
dAb (TVAAPS Linker) dAb- Fc DMS30021 N-terminal Fc fusion of K-044-
24 52 255 dAb (TVAAPS Linker) dAb- Fc Vh-Vk and Vk-Vk DAb-Fc-dAb
Sequences DMS30007 DOM15-26-597-AS Linker-Fc- 10 38 Albumin Domain
3 Linker-DT02- K-044-085 Vh-Vk DAb-Fc-dAb DMS30008 DOM15-26-597-AS
Linker-Fc- 11 39 Albumin Domain 3 Linker-DT02- K-044-251 Vh-Vk
DAb-Fc-dAb DMS30009 DT02-K-044-085-AS Linker-Fc- 12 40 Albumin
Domain 3 Linker-DT02- K-044-085 Vk-Vk DAb-Fc-dAb DMS30010
DT02-K-044-085-AAAS Linker- 13 41 Fc-Albumin Domain 3 Linker-
DT02-K-044-085 Vk-Vk DAb-Fc- dAb DMS30011 DT02-K-044-251-AS
Linker-Fc- 14 42 Albumin Domain 3 Linker-DT02- K-044-251 Vk-Vk
DAb-Fc-dAb DMS30012 DT02-K-044-251-AAAS Linker- 15 43 Fc-Albumin
Domain 3 Linker- DT02-K-044-251 Vk-Vk DAb-Fc- dAb DMS30022
DOM15-26-597-AS Linker-Fc- 25 53 GS(TVAAPSGS)x3 Linker-
DT02-K-044-085 Vh-Vk DAb-Fc- dAb DMS30023 DT02-K-044-085- 26 54
HingeIgG1Linker-Fc- GS(TVAAPSGS)x3 Linker- DT02-K-044-085 Vh-Vk
DAb-Fc- dAb DMS30024 DT02-K-044-085-AS-Fc 27 55
(H112A)-GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk DAb-Fc-dAb
DMS30025 DT02-K-044-085-AS-Fc 28 56 (T113P)-GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk DAb-Fc-dAb Linker Sequences AAAS Linker
N-terminal Linker 57 76 AS Linker N-terminal Linker 58 77 TVAAPS
Linker N-terminal Linker 59 78 Hinge IgG1 Linker N-terminal Linker
60 79 Hinge IgG3 Linker N-terminal Linker 61 80 Fibronectin x3
Linker N-terminal Linker 62 81 Fibronectin x4 Linker N-terminal
Linker 63 82 ((GS(TVAAPSGS)x3)) C-terminal Linker 66 85 Linker
Fibronectin x3 Linker C-terminal Linker 67 86 Fibronectin x4 Linker
C-terminal Linker 68 87 Albumin Domain 1 C-terminal Linker 69 88
Linker Albumin Domain 2 C-terminal Linker 70 89 Linker Albumin
Domain 3 C-terminal Linker 71 90 Linker Truncated Albumin
C-terminal Linker 72 91 Domain3 Linker; Alb Dom 3-TFHAD Gly4Ser 3x
Linker C-terminal Linker 73 92 Gly4Ser 4x Linker C-terminal Linker
74 93 Helical Linker C-terminal Linker 75 94 dAb Sequences
DOM15-26-593 95 103 DOM15-26-597 96 104 DT02-K-044-085 97 105
DT02-K-044-232 98 106 DT02-K-044-236 99 107 DT02-K-044-251 100 108
DT02-K-044-255 101 109 Fc Sequences Fc IgG1 102 110 H2A IgG1 Fc 64
83 T3P IgG1 Fc 65 84 CDR Sequences (According to Kabat)
DOM15-26-593 CDR1 111 DOM15-26-593 CDR2 112 DOM15-26-593 CDR3 113
DOM15-26-597 CDR1 114 DOM15-26-597 CDR2 115 DOM15-26-597 CDR3 116
DT02-K-044-085 117 CDR1 DT02-K-044-085 118 CDR2 DT02-K-044-085 119
CDR3 DT02-K-044-232 120 CDR1 DT02-K-044-232 121 CDR2 DT02-K-044-232
122 CDR3 DT02-K-044-236 123 CDR1 DT02-K-044-236 124 CDR2
DT02-K-044-236 125 CDR3 DT02-K-044-251 126 CDR1 DT02-K-044-251 127
CDR2 DT02-K-044-251 128 CDR3 DT02-K-044-255 129 CDR1 DT02-K-044-255
130 CDR2 DT02-K-044-255 131 CDR3 Vh dAb-Fc Sequences DMS30030
N-terminal Fc fusion of DOM15- 132 155 26-597 dAb ((TGLDSP)x3)
DMS30031 N-terminal Fc fusion of DOM15- 156 26-597 dAb ((TGLDSP)x4)
DMS30032 N-terminal Fc fusion of DOM15- 133 157 26-597 dAb
((TGLDSP)x3 T113P mutation Fc) DMS30033 N-terminal Fc fusion of
DOM15- 134 158 26-597 dAb ((TGLDSP)x4 T113P mutation Fc) DMS30042
N-terminal Fc fusion of DOM15- 159 26-597 dAb (IgG1 Hinge) N597
IgG3 N-terminal Fc fusion of 15-26- 160 597 dAb (IgG3 Hinge) N597
TVAAPS N-terminal Fc fusion of 15-26- 161 597 dAb (TVAAPS) Vk
dAb-Fc and Fc- dAb Sequences DMS30026 C-terminal Fc fusion of
K-044- 162 085 dAb ((TGLDSP)x4) DMS30027 C-terminal Fc fusion of
K-044- 163 085 dAb (Helical Linker) DMS30028 N-terminal Fc fusion
of K-044- 164 085 dAb (IgG1 Hinge) DMS30029 N-terminal Fc fusion of
K-044- 165 085 dAb (ASTHP linker) N085 fib x4 N-terminal Fc fusion
of K-044- 166 085 dAb ((TGLDSP)x4) N085 TVAAPS N-terminal Fc fusion
of K-044- 167 085 dAb (TVAAPS) N085 fib x3 N-terminal Fc fusion of
K-044- 168 085 dAb ((TGLDSP)x3) N085 IgG3 N-terminal Fc fusion of
K-044- 169 085 dAb (IgG3 Hinge) N085 H2A N-terminal Fc fusion of
K-044- 170 085-AS-Fc (H112A) C085 fib x3 C-terminal Fc fusion of
K-044- 171 085 dAb ((TGLDSP)x3) C085 alb d 1 C-terminal Fc fusion
of K-044- 172 085 dAb (Albumin Domain 1) C085 alb d 2 C-terminal Fc
fusion of K-044- 173 085 dAb (Albumin Domain 2) 0085 alb d 3-TFHAD
C-terminal Fc fusion of K-044- 174 085 dAb (Albumin Domain 3-
TFHAD) C085 G4Sx3 C-terminal Fc fusion of K-044- 175 085 dAb
((Gly4Ser)x3) C085 G4Sx4 C-terminal Fc fusion of K-044- 176 085 dAb
((Gly4Ser)x4) Vh-Vk and Vk-Vk DAb-Fc-dAb Sequences DMS30034
K-044-085 dAb N-(VEPKSSDK 135 177 linker) & C-terminal
((TGLDSP)x4) DMS30035 K-044-085 dAb N-(ASTHP 136 178 linker) &
C-terminal ((TGLDSP)x4) DMS30036 DOM15-26-597 dAb N- 137 179
((TGLDSP)x3) & C-terminal K- 044-085 dAb ((TGLDSP)x4) DMS30037
DOM15-26-597 dAb N- 138 180 (VEPKSSDK linker) & C- terminal
K-044-085 dAb ((TGLDSP)x4) DMS30038 DMS1576 with C-terminal K- 139
181 044-085 dAb ((TGLDSP)x4) DMS30039 DOM15-26-597 dAb N- 140 182
((TGLDSP)x4) & C-terminal K- 044-085 dAb ((TGLDSP)x4)
DMS30040 DOM15-26-597 dAb N- 141 183 ((TGLDSP)x3 T113P mutation Fc)
& C-terminal K-044-085 dAb ((TGLDSP)x4) DMS30041 DOM15-26-597
dAb N- 142 184 ((TGLDSP)x4 T113P mutation Fc) & C-terminal
K-044-085 dAb ((TGLDSP)x4) DMS30043 K-044-085 dAb N-(VEPKSSDK 143
177 linker) & C-terminal ((TGLDSP)x4) Codon optimised DMS30044
DOM15-26-597 dAb N- 144 179 ((TGLDSP)x3) & C-terminal K-
044-085 dAb ((TGLDSP)x4) Codon optimised DMS30045 DOM15-26-597 dAb
N- 145 180 (VEPKSSDK linker) & C- terminal K-044-085 dAb
((TGLDSP)x4) Codon optimised DMS30046 DMS1576 with C-terminal K-
146 181 044-085 dAb ((TGLDSP)x4) Codon optimised DMS30047
DOM15-26-597 dAb N- 147 185 (VEPKSSDK linker) & C- terminal
K-044-085 dAb minus C-term R ((TGLDSP)x4) Codon optimised DMS30048
DOM15-26-597 dAb N- 148 186 (VEPKSSDK linker) & C- terminal
K-044-085 dAb + A ((TGLDSP)x4) Codon optimised DMS30049
DOM15-26-597 dAb N- 149 187 (VEPKSSDK linker) & C- terminal
K-044-085 dAb + AAA ((TGLDSP)x4) Codon optimised DMS30050
DOM15-26-597 dAb N- 150 188 (VEPKSSDK linker) & C- terminal
K-044-085 dAb + T ((TGLDSP)x4) Codon optimised DMS30051 DMS1576
with C-terminal K- 151 189 044-085 dAb minus C-term R ((TGLDSP)x4)
Codon optimised DMS30052 DMS1576 with C-terminal K- 152 190 044-085
dAb + A ((TGLDSP)x4) Codon optimised DMS30053 DMS1576 with
C-terminal K- 153 191 044-085 dAb + AAA ((TGLDSP)x4) Codon
optimised DMS30054 DMS1576 with C-terminal K- 154 192 044-085 dAb +
T ((TGLDSP)x4) Codon optimised
TABLE-US-00039 SEQUENCE LISTING SEQ ID NO: 1 DMS1529
(DOM15-26-593-Fc dAb-Fc)
GAGGTGCAGCTGTTGGTGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTG
CGTCTCTCCTGTGCAGCCTCCGGATTCACCTTTAAGGCTTATCCGATGATGTGGGT
CCGCCAGGCTCCAGGGAAGGGTCTAGAGTGGGTTTCAGAGATTTCGCCTTCGGGT
TCTTATACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCCGCGACAA
TTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGCGTGCCGAGGACACCGCG
GTATATTACTGTGCGAAAGATCCTCGGAAGTTAGACTACTGGGGTCAGGGAACCCT
GGTCACCGTCTCGAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAG
CTGCTGGGCGGACCTAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGA
TGATCAGCAGGACCCCCGAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGA
CCCTGAAGTGAAGTTCAACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAG
ACCAAGCCCAGAGAGGAGCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGA
CCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAA
CAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCT
AGAGAGCCCCAGGTCTACACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACC
AGGTGTCCCTGACCTGTCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGA
GTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTG
GACAGCGATGGCAGCTTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATG
GCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCAC
TACACCCAGAAGAGTCTGAGCCTGTCCCCTGGCAAG SEQ ID NO: 2 DMS1576
(DOM15-26-597-Fc dAb-Fc)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTG
AGACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGG
TGCGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCG
GCAGCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGA
CAACAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACC
GCCGTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGC
ACCCTGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCC
CTGAGCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACAC
CCTGATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCAC
GAGGACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACG
CCAAGACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGT
GCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTG
TCCAACAAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCC
AGCCCAGGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCA
AGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGC
CGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCT
GTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGA
GCCGGTGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGC
ACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCCCGGCAAG SEQ ID NO: 3 DMS30000
(C-terminal Fc fusion of K-044-085 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb) CAGGCTAGCTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGC
TGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGAT
CAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCT
GAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCA
AGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGT
GCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAG
GCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAG
AGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGT
GTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGG
GAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACA
GCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCA
GCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTAC
ACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGGATCTACCGTGGCAGCACCAT
CAGGATCTACCGTGGCAGCACCATCAGGTTCAACAGTAGCTGCTCCTTCTGGATCC
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 4 DMS30001
(C-terminal Fc fusion of K-044-232 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb) CAGGCTAGCTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGC
TGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGAT
CAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCT
GAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCA
AGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGT
GCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAG
GCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAG
AGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGT
GTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGG
GAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACA
GCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCA
GCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTAC
ACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGGATCTACCGTGGCAGCACCAT
CAGGATCTACCGTGGCAGCACCATCAGGTTCAACAGTAGCTGCTCCTTCTGGATCC
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAGTTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 5 DMS30002
(C-terminal Fc fusion of K-044-236 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb) CAGGCTAGCTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGC
TGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGAT
CAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCT
GAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCA
AGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGT
GCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAG
GCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAG
AGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGT
GTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGG
GAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACA
GCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCA
GCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTAC
ACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGGATCTACCGTGGCAGCACCAT
CAGGATCTACCGTGGCAGCACCATCAGGTTCAACAGTAGCTGCTCCTTCTGGATCC
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAGTTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 6 DMS30003
(C-terminal Fc fusion of K-044-251 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb) CAGGCTAGCTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGC
TGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGAT
CAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCT
GAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCA
AGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGT
GCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAG
GCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAG
AGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGT
GTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGG
GAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACA
GCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCA
GCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTAC
ACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGGATCTACCGTGGCAGCACCAT
CAGGATCTACCGTGGCAGCACCATCAGGTTCAACAGTAGCTGCTCCTTCTGGATCC
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 7 DMS30004
(C-terminal Fc fusion of K-044-255 dAb (GS(TVAAPSGS)x3 Linker)
Fc-dAb) CAGGCTAGCTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGC
TGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGAT
CAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCT
GAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCA
AGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGT
GCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAG
GCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAG
AGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGT
GTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGG
GAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACA
GCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCA
GCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTAC
ACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGGATCTACCGTGGCAGCACCAT
CAGGATCTACCGTGGCAGCACCATCAGGTTCAACAGTAGCTGCTCCTTCTGGATCC
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 8 DMS30005
(N-terminal Fc fusion of K-044-251 dAb (AAAS Linker) dAb-Fc)
GAGTCGACGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGG
AGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGT
GGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATT
TTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCAC
TCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTA
TATGTATTATCCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGGGCGG
CCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGAC
CTAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACC
CCCGAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGT
TCAACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGA
GGAGCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAG
GATTGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTG
CCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGT
CTACACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCT
GTCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGG
CCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGC
TTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGT
GTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGT
CTGAGCCTGTCCCCTGGCAAG SEQ ID NO: 9 DMS30006 (N-terminal Fc fusion
of K-044-255 dAb (AAAS Linker) dAb-Fc)
GAGTCGACGGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGG
AGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGT
GGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATT
TTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCAC
TCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTA
TATGTATTATCCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGGGCGG
CCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGAC
CTAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACC
CCCGAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGT
TCAACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGA
GGAGCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAG
GATTGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTG
CCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGT
CTACACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCT
GTCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGG
CCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGC
TTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGT
GTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGT
CTGAGCCTGTCCCCTGGCAAG SEQ ID NO: 10 DMS30007 (DOM15-26-597-AS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTG
AGACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGG
TGCGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCG
GCAGCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGA
CAACAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACC
GCCGTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGC
ACCCTGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCC
CCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACAC
CCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCAC
GAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATG
CCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGT
GCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTG
TCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCC
AGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAA
GAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCC
GTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTG
TGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCAC
AATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGAGGTGGACGAGA
CCTACGTGCCCAAGGAGTTCAACGCCGAGACCTTCACCTTCCACGCCGACGACATC
CAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCAT
CACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAAC
CAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTC
CCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAG
TCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTCAT
ACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 11 DMS30008
(DOM15-26-597-AS Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-251
Vh-Vk dAb-Fc-dAb)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTG
AGACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGG
TGCGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCG
GCAGCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGA
CAACAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACC
GCCGTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGC
ACCCTGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCC
CCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACAC
CCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCAC
GAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATG
CCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGT
GCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTG
TCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCC
AGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAA
GAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCC
GTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTG
TGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCAC
AATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGAGGTGGACGAGA
CCTACGTGCCCAAGGAGTTCAACGCCGAGACCTTCACCTTCCACGCCGACGACATC
CAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCAT
CACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAAC
CAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTC
CCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAG
TCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTGAG
ACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 12 DMS30009
(DT02-K-044-085-AS Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-085
Vk-Vk dAb-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTGCTAGCACCCACAC
CTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTC
CCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTG
TGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGA
CGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAG
CACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGC
AAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAAC
CATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCT
AGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCT
TCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAA
CTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCA
AGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGT
GATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCT
GGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCGAGACCTTCA
CCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCT
GTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTT
AAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTT
CCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGAC
TTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAA
CAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID
NO: 13 DMS30010 (DT02-K-044-085-AAAS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTGCCGCTGCTAGCA
CCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTT
CCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTG
ACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGT
ACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGT
ACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCT
GAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCG
AGACCTTCACCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATCCTCCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGG
TCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCT
ATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCT
GGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTA
CTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGGTGGA
AATCAAACGT SEQ ID NO: 14 DMS30011 (DT02-K-044-251-AS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-251 Vk-Vk dAb-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTGCTAGCACCCACA
CCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTT
CCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGT
GTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGG
ACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAG
CACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGC
AAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAAC
CATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCT
AGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCT
TCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAA
CTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCA
AGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGT
GATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCT
GGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCGAGACCTTCA
CCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCT
GTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTT
AAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTT
CCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGAC
TTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAA
CAGTATATGTATTATCCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACG T SEQ ID
NO: 15 DMS30012 (DT02-K-044-251-AAAS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-251 Vk-Vk d-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTGCCGCTGCTAGCA
CCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTT
CCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTG
ACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGT
ACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGT
ACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCT
GAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCG
AGACCTTCACCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATCCTCCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGG
TCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCT
ATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCT
GGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTA
CTACTGTCAACAGTATATGTATTATCCTGAGACGTTCGGCCAAGGGACCAAGGTGG
AAATCAAACGT SEQ ID NO: 16 DMS30013 (C-terminal Fc fusion of
K-044-085 dAb (Albumin Domain 3 Linker) Fc-dAb)
GCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCC
AGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCC
CGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTC
AACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAG
GAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGG
ATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGC
CCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTG
TACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCT
GCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACG
GCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAG
CTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAAC
GTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAG
CCTGAGCCTGTCCCCTGGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTC
AACGCCGAGACCTTCACCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATC
CTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGT
GGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTC
CTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGT
GGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGC
TACGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAA
GGTGGAAATCAAACGT SEQ ID NO: 17 DMS30014 (C-terminal Fc fusion of
K-044-085 dAb (Albumin Domain 3 Linker) Fc-dAb)
ACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTG
TTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGT
GACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGG
TACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAG
TACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGC
TGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCG
AGACCTTCACCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATCCTCCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGG
TCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCT
ATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCT
GGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTA
CTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGGTGGA
AATCAAACGT SEQ ID NO: 18 DMS30015 (C-terminal Fc fusion of
K-044-251 dAb (Albumin Domain 3 Linker) Fc-dAb)
GCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCC
AGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCC
CGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTC
AACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAG
GAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGG
ATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGC
CCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTG
TACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCT
GCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACG
GCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAG
CTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAAC
GTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAG
CCTGAGCCTGTCCCCTGGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTC
AACGCCGAGACCTTCACCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATC
CTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGT
GGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTC
CTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGT
GGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGC
TACGTACTACTGTCAACAGTATATGTATTATCCTGAGACGTTCGGCCAAGGGACCAA
GGTGGAAATCAAACGT SEQ ID NO: 19 DMS30016 (C-terminal Fc fusion of
K-044-251 dAb (Albumin Domain 3 Linker) Fc-dAb)
ACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTG
TTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGT
GACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGG
TACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAG
TACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGC
TGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAGGAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCG
AGACCTTCACCTTCCACGCCGACGACATCCAGATGACCCAGTCTCCATCCTCCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGG
TCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCT
ATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCT
GGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTA
CTACTGTCAACAGTATATGTATTATCCTGAGACGTTCGGCCAAGGGACCAAGGTGG
AAATCAAACGT SEQ ID NO: 20 DMS30017 (N-terminal Fc fusion of
K-044-085 dAb (TVAAPS Linker) dAb-Fc)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTACCGTCGCCGCTC
CTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGACCTAG
CGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACCCCC
GAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGTTCA
ACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGA
GCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAGGAT
TGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTGCCC
CTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGTCTA
CACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTC
TGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCA
GCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTC
TTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGT
TCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGTCT
GAGCCTGTCCCCTGGCAAG SEQ ID NO: 21 DMS30018 (N-terminal Fc fusion of
K-044-232 dAb (TVAAPS Linker) dAb-Fc)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAGTTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTACCGTCGCCGCTC
CTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGACCTAG
CGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACCCCC
GAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGTTCA
ACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGA
GCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAGGAT
TGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTGCCC
CTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGTCTA
CACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTC
TGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCA
GCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTC
TTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGT
TCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGTCT
GAGCCTGTCCCCTGGCAAG SEQ ID NO: 22 DMS30019 (N-terminal Fc fusion of
K-044-236 dAb (TVAAPS Linker) dAb-Fc)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAGTTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTACCGTCGCCGCTC
CTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGACCTAG
CGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACCCCC
GAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGTTCA
ACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGA
GCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAGGAT
TGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTGCCC
CTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGTCTA
CACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTC
TGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCA
GCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTC
TTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGT
TCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGTCT
GAGCCTGTCCCCTGGCAAG SEQ ID NO: 23 DMS30020 (N-terminal Fc fusion of
K-044-251 dAb (TVAAPS Linker) dAb-Fc)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTACCGTCGCCGCTC
CTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGACCTAG
CGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACCCCC
GAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGTTCA
ACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGA
GCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAGGAT
TGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTGCCC
CTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGTCTA
CACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTC
TGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCA
GCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTC
TTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGT
TCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGTCT
GAGCCTGTCCCCTGGCAAG SEQ ID NO: 24 DMS30021 (N-terminal Fc fusion of
K-044-255 dAb (TVAAPS Linker) dAb-Fc)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTACCGTCGCCGCTC
CTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGCGGACCTAG
CGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACCCCC
GAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGTTCA
ACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGA
GCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAGGAT
TGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTGCCC
CTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGTCTA
CACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTC
TGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCA
GCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTC
TTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGT
TCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGTCT
GAGCCTGTCCCCTGGCAAG SEQ ID NO: 25 DMS30022 (DOM15-26-597-AS Lin
ker-Fc-GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTG
AGACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGG
TGCGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCG
GCAGCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGA
CAACAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACC
GCCGTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGC
ACCCTGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCC
CCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACAC
CCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCAC
GAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATG
CCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGT
GCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTG
TCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCC
AGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAA
GAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCC
GTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTG
TGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCAC
AATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGGGATCTACCGTGG
CAGCACCATCAGGATCTACCGTGGCAGCACCATCAGGTTCAACAGTAGCTGCTCCT
TCTGGATCCGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGG
AGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGT
GGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATT
TTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCAC
TCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTA
TATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 26
DMS30023 (DT02-K-044-085-HingeIgG1Linker-Fc- GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTgtggagcctaagtcttctgac
aagACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCG
TGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAG
GTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACT
GGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGC
AGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTG
GCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCT
ATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACA
CCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCT
GGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCA
GCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTC
TTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGT
TCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCT
GAGCCTGTCCCCTGGCAAGGGATCTACCGTGGCAGCACCATCAGGATCTACCGTG
GCAGCACCATCAGGTTCAACAGTAGCTGCTCCTTCTGGATCCGACATCCAGATGAC
CCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCC
GGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAA
AGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCAC
GTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAA
CCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCG
GCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 27 DMS30024
(DT02-K-044-085-AS-Fc (H112A)- GS(TVAAPSGS)x3 Linker-DT02-K-044-085
Vh-Vk dAb-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTGCTAGCACCGCCA
CCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTT
CCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGT
GTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGG
ACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAG
CACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGC
AAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAAC
CATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCT
AGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCT
TCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAA
CTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCA
AGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGT
GATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCT
GGCAAGGGATCTACCGTGGCAGCACCATCAGGATCTACCGTGGCAGCACCATCAG
GTTCAACAGTAGCTGCTCCTTCTGGATCCGACATCCAGATGACCCAGTCTCCATCC
TCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTG
GATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCC
TGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTG
GATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTA
CGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGG
TGGAAATCAAACGT SEQ ID NO: 28 DMS30025 (DT02-K-044-085-AS-Fc
(T113P)- GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTGCTAGCACCCACC
CTTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTT
CCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGT
GTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGG
ACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAG
CACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGC
AAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAAC
CATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCT
AGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCT
TCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAA
CTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCA
AGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGT
GATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCT
GGCAAGGGATCTACCGTGGCAGCACCATCAGGATCTACCGTGGCAGCACCATCAG
GTTCAACAGTAGCTGCTCCTTCTGGATCCGACATCCAGATGACCCAGTCTCCATCC
TCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTG
GATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCC
TGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTG
GATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTA
CGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGG
TGGAAATCAAACGT SEQ ID NO: 29 DMS1529 (DOM15-26-593-Fc dAb-Fc)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSY
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 30
DMS1576 (DOM15-26-597-Fc dAb-Fc)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 31
DMS30000 (C-terminal Fc fusion of K-044-085 dAb (GS(TVAAPSGS)x3
Linker) Fc-dAb)
QASSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKG
STVAAPSGSTVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELK
WYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMY
YPHTFGQGTKVEIKR SEQ ID NO: 32 DMS30001 (C-terminal Fc fusion of
K-044-232 dAb (GS(TVAAPSGS)x3 Linker) Fc-dAb)
QASSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKG
STVAAPSGSTVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELS
WYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMY
YPETFGQGTKVEIKR SEQ ID NO: 33 DMS30002 (C-terminal Fc fusion of
K-044-236 dAb (GS(TVAAPSGS)x3 Linker) Fc-dAb)
QASSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKG
STVAAPSGSTVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELS
WYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMY
YPKTFGQGTKVEIKR SEQ ID NO: 34 DMS30003 (C-terminal Fc fusion of
K-044-251 dAb (GS(TVAAPSGS)x3 Linker) Fc-dAb)
QASSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKG
STVAAPSGSTVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELK
WYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMY
YPETFGQGTKVEIKR
SEQ ID NO: 35 DMS30004 (C-terminal Fc fusion of K-044-255 dAb
(GS(TVAAPSGS)x3 Linker) Fc-dAb)
QASSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKG
STVAAPSGSTVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELK
WYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMY
YPKTFGQGTKVEIKR SEQ ID NO: 36 DMS30005 (N-terminal Fc fusion of
K-044-251 dAb (AAAS Linker) dAb-Fc)
ESTDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKRAAASTHT
CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 37
DMS30006 (N-terminal Fc fusion of K-044-255 dAb (AAAS Linker)
dAb-Fc) ESTDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPKTFGQGTKVEIKRAAASTHT
CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 38
DMS30007 (DOM15-26-597-AS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDET
YVPKEFNAETFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGK
APKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQG TKVEIKR
SEQ ID NO: 39 DMS30008 (DOM15-26-597-AS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-251 Vh-Vk dAb-Fc-dAb)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDET
YVPKEFNAETFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGK
APKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQG TKVEIKR
SEQ ID NO: 40 DMS30009 (DT02-K-044-085-AS Linker-Fc-Albumin Domain
3 Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRASTHTCPPCP
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK
TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYVPKEFNAETFT
FHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQ
SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO: 41
DMS30010 (DT02-K-044-085-AAAS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRAAASTHTCPP
CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE
PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYVPKEFNAE
TFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGS
ILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO:
42 DMS30011 (DT02-K-044-251-AS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-251 Vk-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKRASTHTCPPCP
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK
TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYVPKEFNAETFT
FHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQ
SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKR SEQ ID NO: 43
DMS30012 (DT02-K-044-251-AAAS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-251 Vk-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKRAAASTHTCPP
CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE
PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYVPKEFNAE
TFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGS
ILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKR SEQ ID NO:
44 DMS30013 (C-terminal Fc fusion of K-044-085 dAb (Albumin Domain
3 Linker) Fc-dAb)
ASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK
AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETY
VPKEFNAETFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKA
PKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGT KVEIKR
SEQ ID NO: 45 DMS30014 (C-terminal Fc fusion of K-044-085 dAb
(Albumin Domain 3 Linker) Fc-dAb)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYV
PKEFNAETFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAP
KLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTK VEIKR
SEQ ID NO: 46 DMS30015 (C-terminal Fc fusion of K-044-251 dAb
(Albumin Domain 3 Linker) Fc-dAb)
ASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK
AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETY
VPKEFNAETFTFHADDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKA
PKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGT KVEIKR
SEQ ID NO: 47 DMS30016 (C-terminal Fc fusion of K-044-251 dAb
(Albumin Domain 3 Linker) Fc-dAb)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYV
PKEFNAETFTFHADDIQMTQSPSSLSASVGDRVTI6TCRASQWIGPELKWYQQKPGKAP
KLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTK VEIKR
SEQ ID NO: 48 DMS30017 (N-terminal Fc fusion of K-044-085 dAb
(TVAAPS Linker) dAb-Fc)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRTVAAPSTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 49
DMS30018 (N-terminal Fc fusion of K-044-232 dAb (TVAAPS Linker)
dAb-Fc) DIQMTQSPSSLSASVGDRVTITCRASQWIGPELSWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKRTVAAPSTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 50
DMS30019 (N-terminal Fc fusion of K-044-236 dAb (TVAAPS Linker)
dAb-Fc) DIQMTQSPSSLSASVGDRVTITCRASQWIGPELSWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPKTFGQGTKVEIKRTVAAPSTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 51
DMS30020 (N-terminal Fc fusion of K-044-251 dAb (TVAAPS Linker)
dAb-Fc) DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKRTVAAPSTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 52
DMS30021 (N-terminal Fc fusion of K-044-255 dAb (TVAAPS Linker)
dAb-Fc) DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPKTFGQGTKVEIKRTVAAPSTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 53
DMS30022 (DOM15-26-597-AS Linker-Fc-GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGSTVA
APSGSTVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQ
QKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPH
TFGQGTKVEIKR SEQ ID NO: 54 DMS30023
(DT02-K-044-085-HingelgG1Linker-Fc- GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRVEPKSSDKTH
TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG
QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGSTVAAPSG
STVAAPSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPG
KAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQ
GTKVEIKR SEQ ID NO: 55 DMS30024 (DT02-K-044-085-AS-Fc (H112A)-
GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRASTATCPPCP
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK
TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGSTVAAPSGSTVAAPS
GSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIY
HGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID
NO: 56 DMS30025 (DT02-K-044-085-AS-Fc (T113P)- GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRASTHPCPPC
PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGSTVAAPSGSTVAA
PSGSTVAAPSGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKL
LIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEI KR SEQ
ID NO: 57 AAAS Linker (N-terminal Linker) GCGGCCGCTAGC SEQ ID NO:
58 AS Linker (N-terminal Linker) GCTAGC SEQ ID NO: 59 TVAAPS Linker
(N-terminal Linker) ACCGTCGCCGCTCCTAGC SEQ ID NO: 60 Hinge IgG1
Linker (N-terminal Linker) GTGGAGCCTAAGTCTTCTGACAAG SEQ ID NO: 61
Hinge IgG3 Linker (N-terminal Linker) GAGCTCAAAACCCCACTTGGTGACACA
SEQ ID NO: 62 Fibronectin x3 Linker (N-terminal Linker)
ACCGGATTAGACAGTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCA SEQ ID NO:
63 Fibronectin x4 Linker (N-terminal Linker)
ACCGGATTAGACAGTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCAAC
CGGCCTGGACAGCCCC SEQ ID NO: 64 H2A IgG1 Fc
ACCGCCACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTG
TTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGT
GACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGG
TACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAG
TACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGC
TGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAG SEQ ID NO: 65 T3P IgG1 Fc
ACCCACCCTTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGT
TCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGT
GACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGG
TACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAG
TACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGC
TGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAG SEQ ID NO: 66 ((GS(TVAAPSGS)x3)) Linker (C-terminal
Linker) GGATCTACCGTGGCAGCACCATCAGGATCTACCGTGGCAGCACCATCAGGTTCAAC
AGTAGCTGCTCCTTCTGGATCC SEQ ID NO: 67 Fibronectin x3 Linker
(C-terminal Linker)
ACCGGATTAGACAGTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCA SEQ ID NO:
68 Fibronectin x4 Linker (C-terminal Linker)
ACCGGATTAGACAGTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCAAC
CGGCCTGGACAGCCCC SEQ ID NO: 69 Albumin Domain 1 Linker (C-terminal
Linker) CACAAGGACGACAACCCCAACCTGCCCAGGCTGGTGAGGCCCGAGGTGGACGTG ATG
SEQ ID NO: 70 Albumin Domain 2 Linker (C-terminal Linker)
GAGAACGACGAGATGCCCGCCGACCTGCCCAGCCTGGCCGCCGACTTCGTGGAG AGCAAGGAC
SEQ ID NO: 71 Albumin Domain 3 Linker (C-terminal Linker)
GAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCGAGACCTTCACCTTCC ACGCCGAC
SEQ ID NO: 72 Truncated Albumin Domain3 Linker; Alb Dom 3 -TFHAD
(C- terminal Linker)
GAGGTGGACGAGACCTACGTGCCCAAGGAGTTCAACGCCGAGACCTTC SEQ ID NO: 73
Gly4Ser 3x Linker (C-terminal Linker)
GGTGGAGGCGGTTCAGGCGGAGGTGGCAGCGGCGGTGGCGGGTCG SEQ ID NO: 74 Gly4Ser
4x Linker (C-terminal Linker)
GGTGGAGGCGGTTCAGGCGGAGGTGGCAGCGGCGGTGGCGGGTCGGGTGGAGG CGGTTCA SEQ
ID NO: 75 Helical Linker (C-terminal Linker)
AAAGAAGCGGCGGCGAAAGAAGCGGCGGCGAAAGAAGCGGCCGCCAAGGAGCTG
GCCGCCAAGGAGGCCGCCGCCAAGGAGGCCGCCGCCAAGGAGGCCGCCGCCAA AGAATTGGCCGCA
SEQ ID NO: 76 AAAS Linker (N-terminal Linker) AAAS SEQ ID NO: 77 AS
Linker (N-terminal Linker) AS SEQ ID NO: 78 TVAAPS Linker
(N-terminal Linker) TVAAPS SEQ ID NO: 79 Hinge IgG1 Linker
(N-terminal Linker) VEPKSSDK SEQ ID NO: 80 Hinge IgG3 Linker
(N-terminal Linker) ELKTPLGDT SEQ ID NO: 81 Fibronectin x3 Linker
(N-terminal Linker) TGLDSPTGLDSPTGLDSP SEQ ID NO: 82 Fibronectin x4
Linker (N-terminal Linker) TGLDSPTGLDSPTGLDSPTGLDSP SEQ ID NO: 83
H2A IgG1 Fc
TATCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 84
T3P IgG1 Fc
THPCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 85
((GS(TVAAPSGS)x3)) Linker (C-terminal Linker)
GSTVAAPSGSTVAAPSGSTVAAPSGS SEQ ID NO: 86 Fibronectin x3 Linker
(C-terminal Linker) TGLDSPTGLDSPTGLDSP SEQ ID NO: 87 Fibronectin x4
Linker (C-terminal Linker) TGLDSPTGLDSPTGLDSPTGLDSP SEQ ID NO: 88
Albumin Domain 1 Linker (C-terminal Linker) HKDDNPNLPRLVRPEVDVM SEQ
ID NO: 89 Albumin Domain 2 Linker (C-terminal Linker)
ENDEMPADLPSLAADFVESKD SEQ ID NO: 90 Albumin Domain 3 Linker
(C-terminal Linker) EVDETYVPKEFNAETFTFHAD SEQ ID NO: 91 Truncated
Albumin Domain 3 Linker; Alb Dom 3-0TFHAD (C- terminal Linker)
EVDETYVPKEFNAETF SEQ ID NO: 92 Gly4Ser 3x Linker (C-terminal
Linker) GGGGSGGGGSGGGGS SEQ ID NO: 93 Gly4Ser 4x Linker (C-terminal
Linker) GGGGSGGGGSGGGGSGGGGS SEQ ID NO: 94 Helical Linker
(C-terminal Linker) KEAAAKEAAAKEAAAKELAAKEAAAKEAAAKEAAAKELAA SEQ ID
NO: 95 DOM15-26-593 dAb
GAGGTGCAGCTGTTGGTGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTG
CGTCTCTCCTGTGCAGCCTCCGGATTCACCTTTAAGGCTTATCCGATGATGTGGGT
CCGCCAGGCTCCAGGGAAGGGTCTAGAGTGGGTTTCAGAGATTTCGCCTTCGGGT
TCTTATACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCCGCGACAA
TTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGCGTGCCGAGGACACCGCG
GTATATTACTGTGCGAAAGATCCTCGGAAGTTAGACTACTGGGGTCAGGGAACCCT
GGTCACCGTCTCGAGC SEQ ID NO: 96 DOM15-26-597 dAb
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTG
AGACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGG
TGCGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCG
GCAGCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGA
CAACAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACC
GCCGTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGC
ACCCTGGTGACCGTGAGCAGC SEQ ID NO: 97 DT02-K-044-085 dAb
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 98
DT02-K-044-232 dAb
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAGTTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 99
DT02-K-044-236 dAb
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAGTTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 100
DT02-K-044-251 dAb
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTGAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 101
DT02-K-044-255 dAb
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGT
CACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGC
AGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTG
GGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATC
AGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTAT
CCTAAGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 102 Fc IgG1
ACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTG
TTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGT
GACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGG
TACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAG
TACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGC
TGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATC
GAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCC
TGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC
CGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCC
TGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAG
CTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC
CTGTCCCCTGGCAAG SEQ ID NO: 103 DOM15-26-593 dAb
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSY
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS S SEQ ID
NO: 104 DOM15-26-597 dAb
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS S SEQ ID
NO: 105 DT02-K-044-085 dAb
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO: 106
DT02-K-044-232 dAb
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELSWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKR SEQ ID NO: 107
DT02-K-044-236 dAb
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELSWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPKTFGQGTKVEIKR SEQ ID NO: 108
DT02-K-044-251 dAb
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPETFGQGTKVEIKR SEQ ID NO: 109
DT02-K-044-255 dAb
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVP
SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPKTFGQGTKVEIKR SEQ ID NO: 110 Fc
IgG1 dAb THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 111
DOM15-26-593 CDR1 AYPMM SEQ ID NO: 112 DOM15-26-593 CDR2
EISPSGSYTYYADSVKG SEQ ID NO: 113 DOM15-26-593 CDR3 DPRKLDY SEQ ID
NO: 114 DOM15-26-597 CDR1
AYPMM SEQ ID NO: 115 DOM15-26-597 CDR2 EISPSGSNTYYADSVKG SEQ ID NO:
116 DOM15-26-597 CDR3 DPRKLDY SEQ ID NO: 117 DT02-K-044-085 CDR1
RASQWIGPELK SEQ ID NO: 118 DT02-K-044-085 CDR2 HGSILQS SEQ ID NO:
119 DT02-K-044-085 CDR3 QQYMYYPHT SEQ ID NO: 120 DT02-K-044-232
CDR1 RASQWIGPELS SEQ ID NO: 121 DT02-K-044-232 CDR2 HGSILQS SEQ ID
NO: 122 DT02-K-044-232 CDR3 QQYMYYPET SEQ ID NO: 123 DT02-K-044-236
CDR1 RASQWIGPELS SEQ ID NO: 124 DT02-K-044-236 CDR2 HGSILQS SEQ ID
NO: 125 DT02-K-044-236 CDR3 QQYMYYPKT SEQ ID NO: 126 DT02-K-044-251
CDR1 RASQWIGPELK SEQ ID NO: 127 DT02-K-044-251 CDR2 HGSILQS SEQ ID
NO: 128 DT02-K-044-251 CDR3 QQYMYYPET SEQ ID NO: 129 DT02-K-044-255
CDR1 RASQWIGPELK SEQ ID NO: 130 DT02-K-044-255 CDR2 HGSILQS SEQ ID
NO: 131 DT02-K-044-255 CDR3 QQYMYYPKT SEQ ID NO: 132 N-terminal Fc
fusion of DOM15-26-597 dAb ((TGLDSP)x3).
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCACCGGATTAGACAGTCCCACAGGTCTCGATTCACCTACT
GGCTTAGACTCTCCAACCCACACCTGCCCCCCCTGCCCTGCCCCAGAGCTGCTGGG
CGGACCTAGCGTGTTCCTGTTCCCACCAAAGCCTAAGGACACCCTGATGATCAGCA
GAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGT
GAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCA
GGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCA
CCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGC
CTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCA
GGTGTACACCCTGCCCCCTAGCAGAAATGAGCTGACCAAGAACCAGGTGTCCCTGA
CCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAA
TGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGC
AGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAA
CGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGA
GCCTGAGCCTGTCCCCTGGCAAG SEQ ID NO: 133 N-terminal Fc fusion of
D0M15-26-597 dAb (TGLDSP)x3 T113P mutation Fc).
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCCACCCTTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGG
GAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGC
AGGACCCCCGAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAG
TGAAGTTCAACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCC
AGAGAGGAGCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCA
CCAGGATTGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGC
CTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCA
GGTCTACACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGA
CCTGTCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAA
CGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGC
AGCTTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAA
CGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGA
GCCTGAGCCTGTCCCCCGGCAAG SEQ ID NO: 134 N-terminal Fc fusion of
D0M15-26-597 dAb (TGLDSP)x4 T113P mutation Fc).
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCGGCTTAGATAGCCCGACCCACCCTTGCCCCCCCTGCCC
TGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAG
GACACCCTGATGATCAGCAGGACCCCCGAAGTGACCTGCGTGGTGGTGGATGTGA
GCCACGAGGACCCTGAAGTGAAGTTCAACTGGTACGTGGACGGCGTGGAAGTGCA
CAACGCCAAGACCAAGCCCAGAGAGGAGCAGTACAACAGCACCTACCGCGTGGTG
TCTGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGCAA
AGTGAGCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGG
GCCAGCCTAGAGAGCCCCAGGTCTACACCCTGCCTCCCTCCAGAGATGAGCTGACC
AAGAACCAGGTGTCCCTGACCTGTCTGGTGAAGGGCTTCTACCCCAGCGACATCGC
CGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCT
GTGCTGGACAGCGATGGCAGCTTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCAC
AATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCCGGCAAG SEQ ID NO: 135:
K-044-085 dAb N-(VEPKSSDK linker) & C-terminal ((TGLDSP)x4)
GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGAGACAGGG
TGACTATCACCTGCAGGGCCAGCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAG
CAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGT
CCGGCGTGCCTAGCAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTCAC
CATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTATATGT
ACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGAGGGTGGAGCC
TAAGTCTTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCAGAGCTGCTGG
GAGGACCCAGCGTGTTCCTGTTCCCACCCAAGCCTAAGGACACCCTGATGATCAGC
AGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGG
TGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCC
AGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGC
ACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTG
CCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCC
AGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTG
ACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCA
ATGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGG
CAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCA
ACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAG
AGCCTGAGCCTGTCCCCTGGCAAGACCGGATTAGACAGTCCCACAGGTCTCGATTC
ACCTACTGGCTTAGACTCTCCAACCGGCCTGGACAGCCCCGACATCCAGATGACCC
AGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGG
GCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGC
CCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTT
CAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTG
AAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCA
AGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 136: K-044-085 dAb N-(ASTHP
linker) & C-terminal ((TGLDSP)x4)
GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGAGACAGGG
TGACTATCACCTGCAGGGCCAGCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAG
CAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGT
CCGGCGTGCCTAGCAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTCAC
CATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTATATGT
ACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGAGGGCTAGCAC
CCACCCTTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTC
CTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGGACCCCCGAAGTGAC
CTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAGTGAAGTTCAACTGGTACG
TGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAGCAGTACAA
CAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCACCAGGATTGGCTGAACG
GCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGCCTGCCCCTATCGAGAAA
ACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCAGGTCTACACCCTGCCTC
CCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTGAAGGGC
TTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACA
ACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACTCC
AAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGCG
TGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGTCTGAGCCTGTCCCCT
GGCAAGACCGGATTAGACAGTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCT
CCAACCGGCCTGGACAGCCCCGACATCCAGATGACCCAGTCTCCATCCTCCCTGTC
TGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTC
CTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATC
ATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGA
CAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACT
GTCAACAGTATATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCA AACGT SEQ
ID NO: 137: DOM15-26-597 dAb N-((TGLDSP)x3) & C-terminal
K-044-085 dAb ((TG LDSP)x4)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCCACACCTGCCCCCCCTGCCCTGCCCCTGAGCTGCTGG
GCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGC
CGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGGACCCTGAG
GTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCC
CCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTG
CACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGCCCT
GCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGGGAACCC
CAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCAGGTGTCCC
TGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAG
CAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGAC
GGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGGCAGCAGG
GCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTACACCCAG
AAGAGCCTGAGCCTGTCCCCCGGCAAGACCGGATTAGACAGTCCCACAGGTCTCGA
TTCACCTACTGGCTTAGACTCTCCAACCGGCCTGGACAGCCCCGACATCCAGATGA
CCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCC
GGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAA
GCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGT
TTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCT
GAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCC
AAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 138: DOM15-26-597 dAb
N-(VEPKSSDK linker) & C-terminal K-044-085 dAb ((TGLDSP)x4)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCGTGGAGCCTAAGTCTTCTGACAAGACCCACACCTGCCCA
CCCTGCCCTGCCCCAGAGCTGCTGGGAGGACCCAGCGTGTTCCTGTTCCCACCCAA
GCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTG
GATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCG
GGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTAC
AAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAA
GGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGAT
GAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAG
CGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGT
GGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAG
GCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGG
ATTAGACAGTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCAACCGGCCT
GGACAGCCCCGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAG
GAGACCGTGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAG
TGGTACCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATT
TTGCAAAGTGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCAC
TCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTAT
ATGTATTATCCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 139:
DMS1576 with C-terminal K-044-085 dAb ((TGLDSP)x4)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCTGA
GCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTG
ATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGG
ACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAG
ACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGA
CCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAAC
AAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCA
GGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGA
CAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGG
CAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTA
CACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGATTAGACAGTCCCACAG
GTCTCGATTCACCTACTGGCTTAGACTCTCCAACCGGCCTGGACAGCCCCGACATC
CAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATC
ACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACC
AGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCC
ATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCT
GCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTCATACG
TTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 140: DOM15-26-597 dAb
N-((TGLDSP)x4) & C-terminal K-044-085 dAb ((TGLDSP)x4)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCGGCTTAGATAGCCCGACCCACACCTGCCCCCCCTGCCC
TGCCCCTGAGCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAG
GACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGA
GCCACGAGGACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCA
CAACGCCAAGACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTG
TCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAA
GGTGTCCAACAAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGG
GCCAGCCCAGGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGAC
CAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCG
CCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCC
TGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGA
GCCGGTGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCA
CAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGATTAGACA
GTCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCAACCGGCCTGGACAGC
CCCGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCG
TGTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCA
GCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAG
TGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCA
TCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTA
TCCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 141:
DOM15-26-597 dAb N-((TGLDSP)x3 T113P mutation Fc) & C-terminal
K-044-085 dAb ((TGLDSP)x4)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCCACCCTTGCCCCCCCTGCCCTGCCCCCGAGCTGCTGG
GAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGC
AGGACCCCCGAAGTGACCTGCGTGGTGGTGGATGTGAGCCACGAGGACCCTGAAG
TGAAGTTCAACTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCC
AGAGAGGAGCAGTACAACAGCACCTACCGCGTGGTGTCTGTGCTGACCGTGCTGCA
CCAGGATTGGCTGAACGGCAAGGAGTACAAGTGCAAAGTGAGCAACAAGGCCCTGC
CTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTAGAGAGCCCCA
GGTCTACACCCTGCCTCCCTCCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGA
CCTGTCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAA
CGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGGC
AGCTTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCAA
CGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGA
GTCTGAGCCTGTCCCCTGGCAAGACCGGATTAGACAGTCCCACAGGTCTCGATTCA
CCTACTGGCTTAGACTCTCCAACCGGCCTGGACAGCCCCGACATCCAGATGACCCA
GTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGTGTCACCATCACTTGCCGGG
CAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCAGCAGAAACCAGGGAAAGCC
CCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAGTGGGGTCCCATCACGTTTC
AGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCATCAGCAGTCTGCAACCTGA
AGATTTTGCTACGTACTACTGTCAACAGTATATGTATTATCCTCATACGTTCGGCCAA
GGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 142: DOM15-26-597 dAb
N-((TGLDSP)x4 T113P mutation Fc) & C-terminal K-044-085 dAb
((TGLDSP)x4)
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCGGCTTAGATAGCCCGACCCACCCTTGCCCCCCCTGCCC
TGCCCCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAG
GACACCCTGATGATCAGCAGGACCCCCGAAGTGACCTGCGTGGTGGTGGATGTGA
GCCACGAGGACCCTGAAGTGAAGTTCAACTGGTACGTGGACGGCGTGGAAGTGCA
CAACGCCAAGACCAAGCCCAGAGAGGAGCAGTACAACAGCACCTACCGCGTGGTG
TCTGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGCAA
AGTGAGCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGG
GCCAGCCTAGAGAGCCCCAGGTCTACACCCTGCCTCCCTCCAGAGATGAGCTGACC
AAGAACCAGGTGTCCCTGACCTGTCTGGTGAAGGGCTTCTACCCCAGCGACATCGC
CGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCT
GTGCTGGACAGCGATGGCAGCTTCTTCCTGTACTCCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCAC
AATCACTACACCCAGAAGAGTCTGAGCCTGTCCCCTGGCAAGACCGGATTAGACAG
TCCCACAGGTCTCGATTCACCTACTGGCTTAGACTCTCCAACCGGCCTGGACAGCC
CCGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACCGT
GTCACCATCACTTGCCGGGCAAGTCAGTGGATTGGTCCTGAGTTAAAGTGGTACCA
GCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATCATGGTTCCATTTTGCAAAG
TGGGGTCCCATCACGTTTCAGTGGCAGTGGATCTGGGACAGACTTCACTCTCACCA
TCAGCAGTCTGCAACCTGAAGATTTTGCTACGTACTACTGTCAACAGTATATGTATTA
TCCTCATACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGT SEQ ID NO: 143:
K-044-085 dAb N-(VEPKSSDK linker) & C-terminal ((TGLDSP)x4)
Codon optimised
GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGAGACAGGG
TGACTATCACCTGCAGGGCCAGCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAG
CAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGT
CCGGCGTGCCTAGCAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTCAC
CATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTATATGT
ACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGAGGGTGGAGCC
TAAGTCTTCTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCAGAGCTGCTGG
GAGGACCCAGCGTGTTCCTGTTCCCACCCAAGCCTAAGGACACCCTGATGATCAGC
AGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGG
TGAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCC
AGGGAGGAGCAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGC
ACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTG
CCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCC
AGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTG
ACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCA
ATGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGATGG
CAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGATGGCAGCAGGGCA
ACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAG
AGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACTGGCCTGGACA
GCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACATCCAGATGAC
CCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGACTATCACCTGC
AGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGAAGCCCGGCA
AGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGGCGTGCCCTC
AAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTG
CAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTACCCCCACAC
CTTCGGCCAGGGCACCAAGGTGGAGATCAAAAGG SEQ ID NO: 144: DOM15-26-597 dAb
N-((TGLDSP)x3) & C-terminal K-044-085 dAb ((TGLDSP)x4) Codon
optimised GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCACGGGTCTGGACAGTCCGACTGGTTTAGATTCACCTACG
GGCTTGGACTCCCCAACCCACACCTGCCCCCCCTGCCCTGCCCCTGAGCTGCTGG
GCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGC
CGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGGACCCTGAG
GTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCC
CCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTG
CACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGCCCT
GCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGGGAACCC
CAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCAGGTGTCCC
TGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAG
CAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGAC
GGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGGCAGCAGG
GCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTACACCCAG
AAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACTGGCCTGG
ACAGCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACATCCAGATG
ACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGACTATCACCT
GCAGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGAAGCCCGG
CAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGGCGTGCCC
TCAAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCT
GCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTACCCCCACA
CCTTCGGCCAGGGCACCAAGGTGGAGATCAAAAGG SEQ ID NO: 145: DOM15-26-597
dAb N-(VEPKSSDK linker) & C-terminal K-044-085 dAb ((TGLDSP)x4)
Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCGTGGAGCCTAAGTCTTCTGACAAGACCCACACCTGCCCA
CCCTGCCCTGCCCCAGAGCTGCTGGGAGGACCCAGCGTGTTCCTGTTCCCACCCAA
GCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTG
GATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCG
GGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTAC
AAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAA
GGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGAT
GAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAG
CGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGT
GGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAG
GCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGG
CCTCGACAGCCCCACTGGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGC
CTGGACAGCCCCGACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCG
TGGGGGACAGGGTGACTATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCT
GAAGTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGC
AGCATCCTGCAGAGCGGCGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCG
ACTTCACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGC
CAGCAGTACATGTACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAA AAGG SEQ
ID NO: 146: DMS1576 with C-terminal K-044-085 dAb ((TGLDSP)x4)
Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCTGA
GCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTG
ATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGG
ACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAG
ACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGA
CCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAAC
AAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCA
GGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGA
CAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGG
CAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTA
CACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACT
GGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACA
TCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGAC
TATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGA
AGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGG
CGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCA
GCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTAC
CCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAAAGG SEQ ID NO: 147:
DOM15-26-597 dAb N-(VEPKSSDK linker) & C-terminal K-044-085 dAb
minus C-term R ((TGLDSP)x4) Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCGTGGAGCCTAAGTCTTCTGACAAGACCCACACCTGCCCA
CCCTGCCCTGCCCCAGAGCTGCTGGGAGGACCCAGCGTGTTCCTGTTCCCACCCAA
GCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTG
GATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCG
GGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTAC
AAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAA
GGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGAT
GAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAG
CGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGT
GGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAG
GCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGG
CCTCGACAGCCCCACTGGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGC
CTGGACAGCCCCGACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCG
TGGGGGACAGGGTGACTATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCT
GAAGTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGC
AGCATCCTGCAGAGCGGCGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCG
ACTTCACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGC
CAGCAGTACATGTACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAA A SEQ ID
NO: 148: DOM15-26-597 dAb N-(VEPKSSDK linker) & C-terminal
K-044-085 dAb + A ((TGLDSP)x4) Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCGTGGAGCCTAAGTCTTCTGACAAGACCCACACCTGCCCA
CCCTGCCCTGCCCCAGAGCTGCTGGGAGGACCCAGCGTGTTCCTGTTCCCACCCAA
GCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTG
GATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCG
GGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTAC
AAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAA
GGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGAT
GAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAG
CGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGT
GGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAG
GCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGG
CCTCGACAGCCCCACTGGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGC
CTGGACAGCCCCGACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCG
TGGGGGACAGGGTGACTATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCT
GAAGTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGC
AGCATCCTGCAGAGCGGCGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCG
ACTTCACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGC
CAGCAGTACATGTACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAA AAGGGCC
SEQ ID NO: 149: DOM15-26-597 dAb N-(VEPKSSDK linker) &
C-terminal K-044-085 dAb +30 AAA ((TGLDSP)x4) Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCGTGGAGCCTAAGTCTTCTGACAAGACCCACACCTGCCCA
CCCTGCCCTGCCCCAGAGCTGCTGGGAGGACCCAGCGTGTTCCTGTTCCCACCCAA
GCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTG
GATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCG
GGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTAC
AAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAA
GGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGAT
GAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAG
CGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGT
GGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAG
GCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGG
CCTCGACAGCCCCACTGGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGC
CTGGACAGCCCCGACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCG
TGGGGGACAGGGTGACTATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCT
GAAGTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGC
AGCATCCTGCAGAGCGGCGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCG
ACTTCACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGC
CAGCAGTACATGTACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAA
AAGGGCCGCCGCC SEQ ID NO: 150: DOM15-26-597 dAb N-(VEPKSSDK linker)
& C-terminal K-044-085 dAb +30 T ((TGLDSP)x4) Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCTATGATGTGGGTG
CGGCAGGCCCCTGGTAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCAAGCGGCA
GCAACACCTACTACGCAGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACACTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCA
GTGTACTACTGCGCCAAGGACCCACGGAAGCTGGACTACTGGGGTCAGGGCACCC
TGGTGACCGTGAGCAGCGTGGAGCCTAAGTCTTCTGACAAGACCCACACCTGCCCA
CCCTGCCCTGCCCCAGAGCTGCTGGGAGGACCCAGCGTGTTCCTGTTCCCACCCAA
GCCTAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTG
GATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCG
GGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTAC
AAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAA
GGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACACCCTGCCCCCTAGCAGAGAT
GAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAG
CGACATCGCCGTGGAGTGGGAGAGCAATGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGT
GGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAG
GCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGG
CCTCGACAGCCCCACTGGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGC
CTGGACAGCCCCGACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCG
TGGGGGACAGGGTGACTATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCT
GAAGTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGC
AGCATCCTGCAGAGCGGCGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCG
ACTTCACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGC
CAGCAGTACATGTACTACCCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAA AAGGACC
SEQ ID NO: 151: DMS1576 with C-terminal K-044-085 dAb minus C-term
R ((TGLDSP)x4) Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCTGA
GCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTG
ATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGG
ACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAG
ACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGA
CCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAAC
AAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCA
GGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGA
CAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGG
CAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTA
CACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACT
GGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACA
TCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGAC
TATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGA
AGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGG
CGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCA
GCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTAC
CCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAA SEQ ID NO: 152: DMS1576
with C-terminal K-044-085 dAb + A ((TGLDSP)x4) Codon optimised
GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCTGA
GCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTG
ATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGG
ACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAG
ACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGA
CCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAAC
AAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCA
GGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGA
CAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGG
CAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTA
CACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACT
GGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACA
TCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGAC
TATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGA
AGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGG
CGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCA
GCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTAC
CCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAAAGGGCC SEQ ID NO: 153:
DMS1576 with C-terminal K-044-085 dAb + AAA ((TGLDSP)x4) Codon
optimised GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCTGA
GCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTG
ATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGG
ACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAG
ACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGA
CCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAAC
AAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCA
GGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGA
CAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGG
CAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTA
CACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACT
GGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACA
TCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGAC
TATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGA
AGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGG
CGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCA
GCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTAC
CCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAAAGGGCCGCCGCC SEQ ID NO: 154:
DMS1576 with C-terminal K-044-085 dAb + T ((TGLDSP)x4) Codon
optimised GAGGTGCAGCTGCTGGTGTCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGA
GACTGAGCTGCGCCGCCAGCGGCTTCACCTTCAAGGCCTACCCCATGATGTGGGTG
CGGCAGGCCCCTGGCAAGGGCCTGGAATGGGTGTCCGAGATCAGCCCCAGCGGCA
GCAACACCTACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAGGACACCGCC
GTGTACTACTGCGCCAAGGACCCCCGGAAGCTGGACTACTGGGGCCAGGGCACCC
TGGTGACCGTGAGCAGCGCTAGCACCCACACCTGCCCCCCCTGCCCTGCCCCTGA
GCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTG
ATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGG
ACCCTGAGGTGAAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAG
ACCAAGCCCCGGGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTGA
CCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAAC
AAGGCCCTGCCTGCCCCCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCA
GGGAACCCCAGGTGTACACCCTGCCCCCCAGCCGGGACGAGCTGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGA
CAGCGACGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCCGGTGG
CAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTA
CACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAGACCGGCCTCGACAGCCCCACT
GGCCTGGACAGCCCAACCGGACTGGATTCTCCCACCGGCCTGGACAGCCCCGACA
TCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGGGACAGGGTGAC
TATCACCTGCAGGGCCTCCCAGTGGATTGGCCCCGAGCTGAAGTGGTATCAGCAGA
AGCCCGGCAAGGCCCCCAAGCTGCTGATCTACCACGGCAGCATCCTGCAGAGCGG
CGTGCCCTCAAGGTTCTCAGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCA
GCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGTACATGTACTAC
CCCCACACCTTCGGCCAGGGCACCAAGGTGGAGATCAAAAGGACC SEQ ID NO: 155:
N-terminal Fc fusion of DOM15-26-597 dAb ((TGLDSP)x3)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRNELTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT
QKSLSLSPGK SEQ ID NO: 156: N-terminal Fc fusion of DOM15-26-597 dAb
((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTGLDSPTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL
NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK SEQ ID NO: 157: N-terminal Fc fusion of
D0M15-26-597 dAb ((TGLDSP)x3 T113P mutation Fc)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTHPCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT
QKSLSLSPGK
SEQ ID NO: 158: N-terminal Fc fusion of DOM15-26-597 dAb
((TGLDSP)x4 T113P mutation Fc)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTGLDSPTHPCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL
NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK SEQ ID NO: 159: N-terminal Fc fusion of
DOM15-26-597 dAb (IgG1 Hinge)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID
NO: 160: N-terminal Fc fusion of 15-26-597 dAb (IgG3 Hinge)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SELKTPLGDTTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID
NO: 161: N-terminal Fc fusion of 15-26-597 dAb (TVAAPS)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STVAAPSTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO:
162: C-terminal Fc fusion of K-044-085 dAb ((TGLDSP)x4)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSPTGLD
SPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPK
LLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVE IKR
SEQ ID NO: 163: C-terminal Fc fusion of K-044-085 dAb (Helical
Linker) THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKEAAAKEAAA
KEAAAKELAAKEAAAKEAAAKEAAAKELAADIQMTQSPSSLSASVGDRVTITCRASQWIG
PELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ
YMYYPHTFGQGTKVEIKR SEQ ID NO: 164: N-terminal Fc fusion of
K-044-085 dAb (IgG1 Hinge)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRVEPKSSDKTHT
CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 165:
N-terminal Fc fusion of K-044-085 dAb (ASTHP linker)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRASTHPCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 166: N-terminal
Fc fusion of K-044-085 dAb ((TGLDSP)x4)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRTGLDSPTGLDS
PTGLDSPTGLDSPTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE
DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQ
PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK SEQ
ID NO: 167: N-terminal Fc fusion of K-044-085 dAb (TVAAPS)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRTVAAPSTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE
PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 168:
N-terminal Fc fusion of K-044-085 dAb ((TGLDSP)x3)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRTGLDSPTGLDS
PTGLDSPTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO:
169: N-terminal Fc fusion of K-044-085 dAb (IgG3 Hinge)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRELKTPLGDTTH
TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 170:
N-terminal Fc fusion of K-044-085-AS-Fc (H112A)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRASTATCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 171: C-terminal
Fc fusion of K-044-085 dAb ((TGLDSP)x3)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSPTGLD
SPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHG
SILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID
NO: 172: C-terminal Fc fusion of K-044-085 dAb (Albumin Domain 1)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHKDDNPNLPR
LVRPEVDVMDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYH
GSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID
NO: 173: C-terminal Fc fusion of K-044-085 dAb (Albumin Domain 2)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKENDEMPADLP
SLAADFVESKDDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIY
HGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID
NO: 174: C-terminal Fc fusion of K-044-085 dAb (Albumin Domain
3-TFHAD)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKEVDETYVPKE
FNAETFDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSIL
QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO:
175: C-terminal Fc fusion of K-044-085 dAb ((Gly4Ser)x3)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGG
SGGGGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSI
LQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO:
176: C-terminal Fc fusion of K-044-085 dAb ((Gly4Ser)x4)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGG
SGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLL
IYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIK R SEQ
ID NO: 177: K-044-085 dAb N-(VEPKSSDK linker) & C-terminal
((TGLDSP)x4)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRVEPKSSDKTHT
CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSPTGLDSPT
GLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLI
YHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIK R SEQ
ID NO: 178: K-044-085 dAb N-(ASTHP linker) & C-terminal
((TGLDSP)x4)
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKRASTHPCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSPTGLDSPTGLDSPT
GLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQ
SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO:
179: DOM15-26-597 dAb N-((TGLDSP)x3) & C-terminal K-044-085 dAb
((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT
QKSLSLSPGKTGLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRA
SQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFAT
YYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO: 180: DOM15-26-597 dAb
N-(VEPKSSDK linker) & C-terminal K-044-085 dAb ((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKT
GLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWY
QQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYP
HTFGQGTKVEIKR SEQ ID NO: 181: DMS1576 with C-terminal K-044-085 dAb
((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSP
TGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPG
KAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQG
TKVEIKR SEQ ID NO: 182: DOM15-26-597 dAb N-((TGLDSP)x4) &
C-terminal K-044-085 dAb ((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTGLDSPTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL
NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGKTGLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVT
ITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO: 183: D0M15-26-597 dAb
N-((TGLDSP)x3 T113P mutation Fc) & C-terminal K-044-085 dAb
((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTHPCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT
QKSLSLSPGKTGLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRA
SQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFAT
YYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO: 184: D0M15-26-597 dAb
N-((TGLDSP)x4 T113P mutation Fc) & C-terminal K-044-085 dAb
((TGLDSP)x4)
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
STGLDSPTGLDSPTGLDSPTGLDSPTHPCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL
NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGKTGLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVT
ITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYMYYPHTFGQGTKVEIKR SEQ ID NO: 185: DOM15-26-597 dAb
N-(VEPKSSDK linker) & C-terminal K-044-085 dAb minus C-term R
((TGLDSP)x4) Codon optimised
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKT
GLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWY
QQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYP
HTFGQGTKVEIK SEQ ID NO: 186: DOM15-26-597 dAb N-(VEPKSSDK linker)
& C-terminal K-044-085 dAb + A ((TGLDSP)x4) Codon optimised
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKT
GLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWY
QQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYP
HTFGQGTKVEI KRA SEQ ID NO: 187: DOM15-26-597 dAb N-(VEPKSSDK
linker) & C-terminal K-044-085 dAb + AAA ((TGLDSP)x4) Codon
optimised EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKT
GLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWY
QQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYP
HTFGQGTKVEIKRAAA SEQ ID NO: 188: DOM15-26-597 dAb N-(VEPKSSDK
linker) & C-terminal K-044-085 dAb + T ((TGLDSP)x4) Codon
optimised EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKT
GLDSPTGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWY
QQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYP
HTFGQGTKVEIKRT SEQ ID NO: 189: DMS1576 with C-terminal K-044-085
dAb minus C-term R ((TGLDSP)x4) Codon optimised
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSP
TGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPG
KAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQG TKVEIK
SEQ ID NO: 190: DMS1576 with C-terminal K-044-085 dAb + A
((TGLDSP)x4) Codon optimised
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSP
TGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPG
KAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQG
TKVEIKRA SEQ ID NO: 191: DMS1576 with C-terminal K-044-085 dAb +
AAA ((TGLDSP)x4) Codon optimised
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSP
TGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPG
KAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQG
TKVEIKRAAA SEQ ID NO: 192: DMS1576 with C-terminal K-044-085 dAb +
T ((TGLDSP)x4) Codon optimised
EVQLLVSGGGLVQPGGSLRLSCAASGFTFKAYPMMWVRQAPGKGLEWVSEISPSGSN
TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPRKLDYWGQGTLVTVS
SASTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGLDSP
TGLDSPTGLDSPTGLDSPDIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPG
KAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQG
TKVEIKRT
Sequence CWU 1
1
22011029DNAArtificial SequenceDOM15-26-593-Fc dAb-Fc nucleic acid
sequence identified using molecular biology techniques. 1gaggtgcagc
tgttggtgtc tgggggaggc ttggtacagc ctggggggtc cctgcgtctc 60tcctgtgcag
cctccggatt cacctttaag gcttatccga tgatgtgggt ccgccaggct
120ccagggaagg gtctagagtg ggtttcagag atttcgcctt cgggttctta
tacatactac 180gcagactccg tgaagggccg gttcaccatc tcccgcgaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgcg tgccgaggac
accgcggtat attactgtgc gaaagatcct 300cggaagttag actactgggg
tcagggaacc ctggtcaccg tctcgagcgc tagcacccac 360acctgccccc
cctgccctgc ccccgagctg ctgggcggac ctagcgtgtt cctgttcccc
420cccaagccta aggacaccct gatgatcagc aggacccccg aagtgacctg
cgtggtggtg 480gatgtgagcc acgaggaccc tgaagtgaag ttcaactggt
acgtggacgg cgtggaagtg 540cacaacgcca agaccaagcc cagagaggag
cagtacaaca gcacctaccg cgtggtgtct 600gtgctgaccg tgctgcacca
ggattggctg aacggcaagg agtacaagtg caaagtgagc 660aacaaggccc
tgcctgcccc tatcgagaaa accatcagca aggccaaggg ccagcctaga
720gagccccagg tctacaccct gcctccctcc agagatgagc tgaccaagaa
ccaggtgtcc 780ctgacctgtc tggtgaaggg cttctacccc agcgacatcg
ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta caagaccacc
ccccctgtgc tggacagcga tggcagcttc 900ttcctgtact ccaagctgac
cgtggacaag agcagatggc agcagggcaa cgtgttcagc 960tgcagcgtga
tgcacgaggc cctgcacaat cactacaccc agaagagtct gagcctgtcc
1020cctggcaag 102921029DNAArtificial SequenceDOM15-26-597-Fc dAb-Fc
nucleic acid sequence identified using molecular biology
techniques. 2gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcgc tagcacccac
360acctgccccc cctgccctgc ccctgagctg ctgggcggac ccagcgtgtt
cctgttcccc 420cccaagccca aggacaccct gatgatcagc cggacccccg
aggtgacctg cgtggtggtg 480gacgtgagcc acgaggaccc tgaggtgaag
ttcaattggt acgtggacgg cgtggaggtg 540cacaacgcca agaccaagcc
ccgggaggaa cagtacaaca gcacctaccg ggtggtgtcc 600gtgctgaccg
tgctgcacca ggactggctg aacggcaaag aatacaagtg caaggtgtcc
660aacaaggccc tgcctgcccc catcgagaaa accatcagca aggccaaggg
ccagcccagg 720gaaccccagg tgtacaccct gccccccagc cgggacgagc
tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg cttctacccc
agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta
caagaccacc ccccctgtgc tggacagcga cggcagcttc 900ttcctgtaca
gcaagctgac cgtggacaag agccggtggc agcagggcaa cgtgttcagc
960tgcagcgtga tgcacgaggc cctgcacaac cactacaccc agaagagcct
gagcctgtcc 1020cccggcaag 102931095DNAArtificial SequenceC-terminal
Fc fusion of K-044-085 DAB (GS(TVAAPSGS)x3 Linker) Fc-dAb nucleic
acid sequence identified using molecular biology techniques.
3caggctagct ctgacaagac ccacacctgc cccccctgcc ctgcccccga gctgctggga
60ggccccagcg tgttcctgtt cccccccaag cctaaggaca ccctgatgat cagcagaacc
120cccgaggtga cctgtgtggt ggtggatgtg agccacgagg accctgaggt
gaagttcaac 180tggtacgtgg acggcgtgga ggtgcacaat gccaagacca
agcccaggga ggagcagtac 240aacagcacct accgggtggt gtccgtgctg
accgtgctgc accaggattg gctgaacggc 300aaggagtaca agtgtaaggt
gtccaacaag gccctgcctg cccctatcga gaaaaccatc 360agcaaggcca
agggccagcc cagagagccc caggtgtaca ccctgccccc tagcagagat
420gagctgacca agaaccaggt gtccctgacc tgcctggtga agggcttcta
ccccagcgac 480atcgccgtgg agtgggagag caacggccag cccgagaaca
actacaagac caccccccct 540gtgctggaca gcgatggcag cttcttcctg
tacagcaagc tgaccgtgga caagagcaga 600tggcagcagg gcaacgtgtt
cagctgctcc gtgatgcacg aggccctgca caatcactac 660acccagaaga
gcctgagcct gtcccctggc aagggatcta ccgtggcagc accatcagga
720tctaccgtgg cagcaccatc aggttcaaca gtagctgctc cttctggatc
cgacatccag 780atgacccagt ctccatcctc cctgtctgca tctgtaggag
accgtgtcac catcacttgc 840cgggcaagtc agtggattgg tcctgagtta
aagtggtacc agcagaaacc agggaaagcc 900cctaagctcc tgatctatca
tggttccatt ttgcaaagtg gggtcccatc acgtttcagt 960ggcagtggat
ctgggacaga cttcactctc accatcagca gtctgcaacc tgaagatttt
1020gctacgtact actgtcaaca gtatatgtat tatcctcata cgttcggcca
agggaccaag 1080gtggaaatca aacgt 109541095DNAArtificial
SequenceC-terminal Fc fusion of K-044-232 DAB (GS(TVAAPSGS)x3
Linker) Fc-dAb nucleic acid sequence identified using molecular
biology techniques. 4caggctagct ctgacaagac ccacacctgc cccccctgcc
ctgcccccga gctgctggga 60ggccccagcg tgttcctgtt cccccccaag cctaaggaca
ccctgatgat cagcagaacc 120cccgaggtga cctgtgtggt ggtggatgtg
agccacgagg accctgaggt gaagttcaac 180tggtacgtgg acggcgtgga
ggtgcacaat gccaagacca agcccaggga ggagcagtac 240aacagcacct
accgggtggt gtccgtgctg accgtgctgc accaggattg gctgaacggc
300aaggagtaca agtgtaaggt gtccaacaag gccctgcctg cccctatcga
gaaaaccatc 360agcaaggcca agggccagcc cagagagccc caggtgtaca
ccctgccccc tagcagagat 420gagctgacca agaaccaggt gtccctgacc
tgcctggtga agggcttcta ccccagcgac 480atcgccgtgg agtgggagag
caacggccag cccgagaaca actacaagac caccccccct 540gtgctggaca
gcgatggcag cttcttcctg tacagcaagc tgaccgtgga caagagcaga
600tggcagcagg gcaacgtgtt cagctgctcc gtgatgcacg aggccctgca
caatcactac 660acccagaaga gcctgagcct gtcccctggc aagggatcta
ccgtggcagc accatcagga 720tctaccgtgg cagcaccatc aggttcaaca
gtagctgctc cttctggatc cgacatccag 780atgacccagt ctccatcctc
cctgtctgca tctgtaggag accgtgtcac catcacttgc 840cgggcaagtc
agtggattgg tcctgagtta agttggtacc agcagaaacc agggaaagcc
900cctaagctcc tgatctatca tggttccatt ttgcaaagtg gggtcccatc
acgtttcagt 960ggcagtggat ctgggacaga cttcactctc accatcagca
gtctgcaacc tgaagatttt 1020gctacgtact actgtcaaca gtatatgtat
tatcctgaga cgttcggcca agggaccaag 1080gtggaaatca aacgt
109551095DNAArtificial SequenceC-terminal Fc fusion of K-044-236
DAB (GS(TVAAPSGS)x3 Linker) Fc-dAb nucleic acid sequence identified
using molecular biology techniques. 5caggctagct ctgacaagac
ccacacctgc cccccctgcc ctgcccccga gctgctggga 60ggccccagcg tgttcctgtt
cccccccaag cctaaggaca ccctgatgat cagcagaacc 120cccgaggtga
cctgtgtggt ggtggatgtg agccacgagg accctgaggt gaagttcaac
180tggtacgtgg acggcgtgga ggtgcacaat gccaagacca agcccaggga
ggagcagtac 240aacagcacct accgggtggt gtccgtgctg accgtgctgc
accaggattg gctgaacggc 300aaggagtaca agtgtaaggt gtccaacaag
gccctgcctg cccctatcga gaaaaccatc 360agcaaggcca agggccagcc
cagagagccc caggtgtaca ccctgccccc tagcagagat 420gagctgacca
agaaccaggt gtccctgacc tgcctggtga agggcttcta ccccagcgac
480atcgccgtgg agtgggagag caacggccag cccgagaaca actacaagac
caccccccct 540gtgctggaca gcgatggcag cttcttcctg tacagcaagc
tgaccgtgga caagagcaga 600tggcagcagg gcaacgtgtt cagctgctcc
gtgatgcacg aggccctgca caatcactac 660acccagaaga gcctgagcct
gtcccctggc aagggatcta ccgtggcagc accatcagga 720tctaccgtgg
cagcaccatc aggttcaaca gtagctgctc cttctggatc cgacatccag
780atgacccagt ctccatcctc cctgtctgca tctgtaggag accgtgtcac
catcacttgc 840cgggcaagtc agtggattgg tcctgagtta agttggtacc
agcagaaacc agggaaagcc 900cctaagctcc tgatctatca tggttccatt
ttgcaaagtg gggtcccatc acgtttcagt 960ggcagtggat ctgggacaga
cttcactctc accatcagca gtctgcaacc tgaagatttt 1020gctacgtact
actgtcaaca gtatatgtat tatcctaaga cgttcggcca agggaccaag
1080gtggaaatca aacgt 109561095DNAArtificial SequenceC-terminal Fc
fusion of K-044-251 DAB (GS(TVAAPSGS)x3 Linker) Fc-dAb nucleic acid
sequence identified using molecular biology techniques. 6caggctagct
ctgacaagac ccacacctgc cccccctgcc ctgcccccga gctgctggga 60ggccccagcg
tgttcctgtt cccccccaag cctaaggaca ccctgatgat cagcagaacc
120cccgaggtga cctgtgtggt ggtggatgtg agccacgagg accctgaggt
gaagttcaac 180tggtacgtgg acggcgtgga ggtgcacaat gccaagacca
agcccaggga ggagcagtac 240aacagcacct accgggtggt gtccgtgctg
accgtgctgc accaggattg gctgaacggc 300aaggagtaca agtgtaaggt
gtccaacaag gccctgcctg cccctatcga gaaaaccatc 360agcaaggcca
agggccagcc cagagagccc caggtgtaca ccctgccccc tagcagagat
420gagctgacca agaaccaggt gtccctgacc tgcctggtga agggcttcta
ccccagcgac 480atcgccgtgg agtgggagag caacggccag cccgagaaca
actacaagac caccccccct 540gtgctggaca gcgatggcag cttcttcctg
tacagcaagc tgaccgtgga caagagcaga 600tggcagcagg gcaacgtgtt
cagctgctcc gtgatgcacg aggccctgca caatcactac 660acccagaaga
gcctgagcct gtcccctggc aagggatcta ccgtggcagc accatcagga
720tctaccgtgg cagcaccatc aggttcaaca gtagctgctc cttctggatc
cgacatccag 780atgacccagt ctccatcctc cctgtctgca tctgtaggag
accgtgtcac catcacttgc 840cgggcaagtc agtggattgg tcctgagtta
aagtggtacc agcagaaacc agggaaagcc 900cctaagctcc tgatctatca
tggttccatt ttgcaaagtg gggtcccatc acgtttcagt 960ggcagtggat
ctgggacaga cttcactctc accatcagca gtctgcaacc tgaagatttt
1020gctacgtact actgtcaaca gtatatgtat tatcctgaga cgttcggcca
agggaccaag 1080gtggaaatca aacgt 109571095DNAArtificial
SequenceC-terminal Fc fusion of K-044-255 DAB (GS(TVAAPSGS)x3
Linker) Fc-dAb nucleic acid sequence identified using molecular
biology techniques. 7caggctagct ctgacaagac ccacacctgc cccccctgcc
ctgcccccga gctgctggga 60ggccccagcg tgttcctgtt cccccccaag cctaaggaca
ccctgatgat cagcagaacc 120cccgaggtga cctgtgtggt ggtggatgtg
agccacgagg accctgaggt gaagttcaac 180tggtacgtgg acggcgtgga
ggtgcacaat gccaagacca agcccaggga ggagcagtac 240aacagcacct
accgggtggt gtccgtgctg accgtgctgc accaggattg gctgaacggc
300aaggagtaca agtgtaaggt gtccaacaag gccctgcctg cccctatcga
gaaaaccatc 360agcaaggcca agggccagcc cagagagccc caggtgtaca
ccctgccccc tagcagagat 420gagctgacca agaaccaggt gtccctgacc
tgcctggtga agggcttcta ccccagcgac 480atcgccgtgg agtgggagag
caacggccag cccgagaaca actacaagac caccccccct 540gtgctggaca
gcgatggcag cttcttcctg tacagcaagc tgaccgtgga caagagcaga
600tggcagcagg gcaacgtgtt cagctgctcc gtgatgcacg aggccctgca
caatcactac 660acccagaaga gcctgagcct gtcccctggc aagggatcta
ccgtggcagc accatcagga 720tctaccgtgg cagcaccatc aggttcaaca
gtagctgctc cttctggatc cgacatccag 780atgacccagt ctccatcctc
cctgtctgca tctgtaggag accgtgtcac catcacttgc 840cgggcaagtc
agtggattgg tcctgagtta aagtggtacc agcagaaacc agggaaagcc
900cctaagctcc tgatctatca tggttccatt ttgcaaagtg gggtcccatc
acgtttcagt 960ggcagtggat ctgggacaga cttcactctc accatcagca
gtctgcaacc tgaagatttt 1020gctacgtact actgtcaaca gtatatgtat
tatcctaaga cgttcggcca agggaccaag 1080gtggaaatca aacgt
109581020DNAArtificial SequenceN-terminal Fc fusion of K-044-251
DAB (AAAS Linker) dAb-Fc nucleic acid sequence identified using
molecular biology techniques. 8gagtcgacgg acatccagat gacccagtct
ccatcctccc tgtctgcatc tgtaggagac 60cgtgtcacca tcacttgccg ggcaagtcag
tggattggtc ctgagttaaa gtggtaccag 120cagaaaccag ggaaagcccc
taagctcctg atctatcatg gttccatttt gcaaagtggg 180gtcccatcac
gtttcagtgg cagtggatct gggacagact tcactctcac catcagcagt
240ctgcaacctg aagattttgc tacgtactac tgtcaacagt atatgtatta
tcctgagacg 300ttcggccaag ggaccaaggt ggaaatcaaa cgggcggccg
ctagcaccca cacctgcccc 360ccctgccctg cccccgagct gctgggcgga
cctagcgtgt tcctgttccc ccccaagcct 420aaggacaccc tgatgatcag
caggaccccc gaagtgacct gcgtggtggt ggatgtgagc 480cacgaggacc
ctgaagtgaa gttcaactgg tacgtggacg gcgtggaagt gcacaacgcc
540aagaccaagc ccagagagga gcagtacaac agcacctacc gcgtggtgtc
tgtgctgacc 600gtgctgcacc aggattggct gaacggcaag gagtacaagt
gcaaagtgag caacaaggcc 660ctgcctgccc ctatcgagaa aaccatcagc
aaggccaagg gccagcctag agagccccag 720gtctacaccc tgcctccctc
cagagatgag ctgaccaaga accaggtgtc cctgacctgt 780ctggtgaagg
gcttctaccc cagcgacatc gccgtggagt gggagagcaa cggccagccc
840gagaacaact acaagaccac cccccctgtg ctggacagcg atggcagctt
cttcctgtac 900tccaagctga ccgtggacaa gagcagatgg cagcagggca
acgtgttcag ctgcagcgtg 960atgcacgagg ccctgcacaa tcactacacc
cagaagagtc tgagcctgtc ccctggcaag 102091020DNAArtificial
SequenceN-terminal Fc fusion of K-044-255 DAB (AAAS Linker) dAb-Fc
nucleic acid sequence identified using molecular biology
techniques. 9gagtcgacgg acatccagat gacccagtct ccatcctccc tgtctgcatc
tgtaggagac 60cgtgtcacca tcacttgccg ggcaagtcag tggattggtc ctgagttaaa
gtggtaccag 120cagaaaccag ggaaagcccc taagctcctg atctatcatg
gttccatttt gcaaagtggg 180gtcccatcac gtttcagtgg cagtggatct
gggacagact tcactctcac catcagcagt 240ctgcaacctg aagattttgc
tacgtactac tgtcaacagt atatgtatta tcctaagacg 300ttcggccaag
ggaccaaggt ggaaatcaaa cgggcggccg ctagcaccca cacctgcccc
360ccctgccctg cccccgagct gctgggcgga cctagcgtgt tcctgttccc
ccccaagcct 420aaggacaccc tgatgatcag caggaccccc gaagtgacct
gcgtggtggt ggatgtgagc 480cacgaggacc ctgaagtgaa gttcaactgg
tacgtggacg gcgtggaagt gcacaacgcc 540aagaccaagc ccagagagga
gcagtacaac agcacctacc gcgtggtgtc tgtgctgacc 600gtgctgcacc
aggattggct gaacggcaag gagtacaagt gcaaagtgag caacaaggcc
660ctgcctgccc ctatcgagaa aaccatcagc aaggccaagg gccagcctag
agagccccag 720gtctacaccc tgcctccctc cagagatgag ctgaccaaga
accaggtgtc cctgacctgt 780ctggtgaagg gcttctaccc cagcgacatc
gccgtggagt gggagagcaa cggccagccc 840gagaacaact acaagaccac
cccccctgtg ctggacagcg atggcagctt cttcctgtac 900tccaagctga
ccgtggacaa gagcagatgg cagcagggca acgtgttcag ctgcagcgtg
960atgcacgagg ccctgcacaa tcactacacc cagaagagtc tgagcctgtc
ccctggcaag 1020101416DNAArtificial SequenceDOM15-26-597-AS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb
nucleic acid sequence identified using molecular biology
techniques. 10gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca
tgatgtgggt gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag
atcagcccca gcggcagcaa cacctactac 180gccgacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa caccctgtac 240ctgcagatga
acagcctgcg ggccgaggac accgccgtgt actactgcgc caaggacccc
300cggaagctgg actactgggg ccagggcacc ctggtgaccg tgagcagcgc
tagcacccac 360acctgccccc cctgccctgc ccccgagctg ctgggaggcc
ccagcgtgtt cctgttcccc 420cccaagccta aggacaccct gatgatcagc
agaacccccg aggtgacctg tgtggtggtg 480gatgtgagcc acgaggaccc
tgaggtgaag ttcaactggt acgtggacgg cgtggaggtg 540cacaatgcca
agaccaagcc cagggaggag cagtacaaca gcacctaccg ggtggtgtcc
600gtgctgaccg tgctgcacca ggattggctg aacggcaagg agtacaagtg
taaggtgtcc 660aacaaggccc tgcctgcccc tatcgagaaa accatcagca
aggccaaggg ccagcccaga 720gagccccagg tgtacaccct gccccctagc
agagatgagc tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg
cttctacccc agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg
agaacaacta caagaccacc ccccctgtgc tggacagcga tggcagcttc
900ttcctgtaca gcaagctgac cgtggacaag agcagatggc agcagggcaa
cgtgttcagc 960tgctccgtga tgcacgaggc cctgcacaat cactacaccc
agaagagcct gagcctgtcc 1020cctggcaagg aggtggacga gacctacgtg
cccaaggagt tcaacgccga gaccttcacc 1080ttccacgccg acgacatcca
gatgacccag tctccatcct ccctgtctgc atctgtagga 1140gaccgtgtca
ccatcacttg ccgggcaagt cagtggattg gtcctgagtt aaagtggtac
1200cagcagaaac cagggaaagc ccctaagctc ctgatctatc atggttccat
tttgcaaagt 1260ggggtcccat cacgtttcag tggcagtgga tctgggacag
acttcactct caccatcagc 1320agtctgcaac ctgaagattt tgctacgtac
tactgtcaac agtatatgta ttatcctcat 1380acgttcggcc aagggaccaa
ggtggaaatc aaacgt 1416111416DNAArtificial SequenceDOM15-26-597-AS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-251 Vh-Vk dAb-Fc-dAb
nucleic acid sequence identified using molecular biology
techniques. 11gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca
tgatgtgggt gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag
atcagcccca gcggcagcaa cacctactac 180gccgacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa caccctgtac 240ctgcagatga
acagcctgcg ggccgaggac accgccgtgt actactgcgc caaggacccc
300cggaagctgg actactgggg ccagggcacc ctggtgaccg tgagcagcgc
tagcacccac 360acctgccccc cctgccctgc ccccgagctg ctgggaggcc
ccagcgtgtt cctgttcccc 420cccaagccta aggacaccct gatgatcagc
agaacccccg aggtgacctg tgtggtggtg 480gatgtgagcc acgaggaccc
tgaggtgaag ttcaactggt acgtggacgg cgtggaggtg 540cacaatgcca
agaccaagcc cagggaggag cagtacaaca gcacctaccg ggtggtgtcc
600gtgctgaccg tgctgcacca ggattggctg aacggcaagg agtacaagtg
taaggtgtcc 660aacaaggccc tgcctgcccc tatcgagaaa accatcagca
aggccaaggg ccagcccaga 720gagccccagg tgtacaccct gccccctagc
agagatgagc tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg
cttctacccc agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg
agaacaacta caagaccacc ccccctgtgc tggacagcga tggcagcttc
900ttcctgtaca gcaagctgac cgtggacaag agcagatggc agcagggcaa
cgtgttcagc 960tgctccgtga tgcacgaggc cctgcacaat cactacaccc
agaagagcct gagcctgtcc 1020cctggcaagg aggtggacga gacctacgtg
cccaaggagt tcaacgccga gaccttcacc 1080ttccacgccg acgacatcca
gatgacccag tctccatcct ccctgtctgc atctgtagga 1140gaccgtgtca
ccatcacttg ccgggcaagt cagtggattg gtcctgagtt aaagtggtac
1200cagcagaaac cagggaaagc ccctaagctc ctgatctatc atggttccat
tttgcaaagt 1260ggggtcccat cacgtttcag tggcagtgga tctgggacag
acttcactct caccatcagc 1320agtctgcaac ctgaagattt tgctacgtac
tactgtcaac agtatatgta ttatcctgag 1380acgttcggcc aagggaccaa
ggtggaaatc aaacgt 1416121392DNAArtificial SequenceDT02-K-044-085-AS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb
nucleic acid sequence identified using molecular biology
techniques. 12gacatccaga tgacccagtc tccatcctcc ctgtctgcat
ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa
agtggtacca gcagaaacca 120gggaaagccc ctaagctcct gatctatcat
ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc
tgggacagac ttcactctca ccatcagcag tctgcaacct 240gaagattttg
ctacgtacta ctgtcaacag tatatgtatt atcctcatac gttcggccaa
300gggaccaagg tggaaatcaa acgtgctagc acccacacct gccccccctg
ccctgccccc 360gagctgctgg gaggccccag cgtgttcctg ttccccccca
agcctaagga caccctgatg 420atcagcagaa cccccgaggt
gacctgtgtg gtggtggatg tgagccacga ggaccctgag 480gtgaagttca
actggtacgt ggacggcgtg gaggtgcaca atgccaagac caagcccagg
540gaggagcagt acaacagcac ctaccgggtg gtgtccgtgc tgaccgtgct
gcaccaggat 600tggctgaacg gcaaggagta caagtgtaag gtgtccaaca
aggccctgcc tgcccctatc 660gagaaaacca tcagcaaggc caagggccag
cccagagagc cccaggtgta caccctgccc 720cctagcagag atgagctgac
caagaaccag gtgtccctga cctgcctggt gaagggcttc 780taccccagcg
acatcgccgt ggagtgggag agcaacggcc agcccgagaa caactacaag
840accacccccc ctgtgctgga cagcgatggc agcttcttcc tgtacagcaa
gctgaccgtg 900gacaagagca gatggcagca gggcaacgtg ttcagctgct
ccgtgatgca cgaggccctg 960cacaatcact acacccagaa gagcctgagc
ctgtcccctg gcaaggaggt ggacgagacc 1020tacgtgccca aggagttcaa
cgccgagacc ttcaccttcc acgccgacga catccagatg 1080acccagtctc
catcctccct gtctgcatct gtaggagacc gtgtcaccat cacttgccgg
1140gcaagtcagt ggattggtcc tgagttaaag tggtaccagc agaaaccagg
gaaagcccct 1200aagctcctga tctatcatgg ttccattttg caaagtgggg
tcccatcacg tttcagtggc 1260agtggatctg ggacagactt cactctcacc
atcagcagtc tgcaacctga agattttgct 1320acgtactact gtcaacagta
tatgtattat cctcatacgt tcggccaagg gaccaaggtg 1380gaaatcaaac gt
1392131398DNAArtificial SequenceDT02-K-044-085-AAAS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb
nucleic acid sequence identified using molecular biology
techniques. 13gacatccaga tgacccagtc tccatcctcc ctgtctgcat
ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa
agtggtacca gcagaaacca 120gggaaagccc ctaagctcct gatctatcat
ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc
tgggacagac ttcactctca ccatcagcag tctgcaacct 240gaagattttg
ctacgtacta ctgtcaacag tatatgtatt atcctcatac gttcggccaa
300gggaccaagg tggaaatcaa acgtgccgct gctagcaccc acacctgccc
cccctgccct 360gcccccgagc tgctgggagg ccccagcgtg ttcctgttcc
cccccaagcc taaggacacc 420ctgatgatca gcagaacccc cgaggtgacc
tgtgtggtgg tggatgtgag ccacgaggac 480cctgaggtga agttcaactg
gtacgtggac ggcgtggagg tgcacaatgc caagaccaag 540cccagggagg
agcagtacaa cagcacctac cgggtggtgt ccgtgctgac cgtgctgcac
600caggattggc tgaacggcaa ggagtacaag tgtaaggtgt ccaacaaggc
cctgcctgcc 660cctatcgaga aaaccatcag caaggccaag ggccagccca
gagagcccca ggtgtacacc 720ctgcccccta gcagagatga gctgaccaag
aaccaggtgt ccctgacctg cctggtgaag 780ggcttctacc ccagcgacat
cgccgtggag tgggagagca acggccagcc cgagaacaac 840tacaagacca
ccccccctgt gctggacagc gatggcagct tcttcctgta cagcaagctg
900accgtggaca agagcagatg gcagcagggc aacgtgttca gctgctccgt
gatgcacgag 960gccctgcaca atcactacac ccagaagagc ctgagcctgt
cccctggcaa ggaggtggac 1020gagacctacg tgcccaagga gttcaacgcc
gagaccttca ccttccacgc cgacgacatc 1080cagatgaccc agtctccatc
ctccctgtct gcatctgtag gagaccgtgt caccatcact 1140tgccgggcaa
gtcagtggat tggtcctgag ttaaagtggt accagcagaa accagggaaa
1200gcccctaagc tcctgatcta tcatggttcc attttgcaaa gtggggtccc
atcacgtttc 1260agtggcagtg gatctgggac agacttcact ctcaccatca
gcagtctgca acctgaagat 1320tttgctacgt actactgtca acagtatatg
tattatcctc atacgttcgg ccaagggacc 1380aaggtggaaa tcaaacgt
1398141392DNAArtificial SequenceDT02-K-044-251-AS Linker-Fc-Albumin
Domain 3 Linker-DT02-K-044-251 Vk-Vk dAb-Fc-dAb nucleic acid
sequence identified using molecular biology techniques.
14gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc
60atcacttgcc gggcaagtca gtggattggt cctgagttaa agtggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctgagac gttcggccaa 300gggaccaagg tggaaatcaa
acgtgctagc acccacacct gccccccctg ccctgccccc 360gagctgctgg
gaggccccag cgtgttcctg ttccccccca agcctaagga caccctgatg
420atcagcagaa cccccgaggt gacctgtgtg gtggtggatg tgagccacga
ggaccctgag 480gtgaagttca actggtacgt ggacggcgtg gaggtgcaca
atgccaagac caagcccagg 540gaggagcagt acaacagcac ctaccgggtg
gtgtccgtgc tgaccgtgct gcaccaggat 600tggctgaacg gcaaggagta
caagtgtaag gtgtccaaca aggccctgcc tgcccctatc 660gagaaaacca
tcagcaaggc caagggccag cccagagagc cccaggtgta caccctgccc
720cctagcagag atgagctgac caagaaccag gtgtccctga cctgcctggt
gaagggcttc 780taccccagcg acatcgccgt ggagtgggag agcaacggcc
agcccgagaa caactacaag 840accacccccc ctgtgctgga cagcgatggc
agcttcttcc tgtacagcaa gctgaccgtg 900gacaagagca gatggcagca
gggcaacgtg ttcagctgct ccgtgatgca cgaggccctg 960cacaatcact
acacccagaa gagcctgagc ctgtcccctg gcaaggaggt ggacgagacc
1020tacgtgccca aggagttcaa cgccgagacc ttcaccttcc acgccgacga
catccagatg 1080acccagtctc catcctccct gtctgcatct gtaggagacc
gtgtcaccat cacttgccgg 1140gcaagtcagt ggattggtcc tgagttaaag
tggtaccagc agaaaccagg gaaagcccct 1200aagctcctga tctatcatgg
ttccattttg caaagtgggg tcccatcacg tttcagtggc 1260agtggatctg
ggacagactt cactctcacc atcagcagtc tgcaacctga agattttgct
1320acgtactact gtcaacagta tatgtattat cctgagacgt tcggccaagg
gaccaaggtg 1380gaaatcaaac gt 1392151398DNAArtificial
SequenceDT02-K-044-251-AAAS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-251 Vk-Vk d-Fc-dAb nucleic acid sequence
identified using molecular biology techniques. 15gacatccaga
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc 60atcacttgcc
gggcaagtca gtggattggt cctgagttaa agtggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctgagac gttcggccaa 300gggaccaagg tggaaatcaa
acgtgccgct gctagcaccc acacctgccc cccctgccct 360gcccccgagc
tgctgggagg ccccagcgtg ttcctgttcc cccccaagcc taaggacacc
420ctgatgatca gcagaacccc cgaggtgacc tgtgtggtgg tggatgtgag
ccacgaggac 480cctgaggtga agttcaactg gtacgtggac ggcgtggagg
tgcacaatgc caagaccaag 540cccagggagg agcagtacaa cagcacctac
cgggtggtgt ccgtgctgac cgtgctgcac 600caggattggc tgaacggcaa
ggagtacaag tgtaaggtgt ccaacaaggc cctgcctgcc 660cctatcgaga
aaaccatcag caaggccaag ggccagccca gagagcccca ggtgtacacc
720ctgcccccta gcagagatga gctgaccaag aaccaggtgt ccctgacctg
cctggtgaag 780ggcttctacc ccagcgacat cgccgtggag tgggagagca
acggccagcc cgagaacaac 840tacaagacca ccccccctgt gctggacagc
gatggcagct tcttcctgta cagcaagctg 900accgtggaca agagcagatg
gcagcagggc aacgtgttca gctgctccgt gatgcacgag 960gccctgcaca
atcactacac ccagaagagc ctgagcctgt cccctggcaa ggaggtggac
1020gagacctacg tgcccaagga gttcaacgcc gagaccttca ccttccacgc
cgacgacatc 1080cagatgaccc agtctccatc ctccctgtct gcatctgtag
gagaccgtgt caccatcact 1140tgccgggcaa gtcagtggat tggtcctgag
ttaaagtggt accagcagaa accagggaaa 1200gcccctaagc tcctgatcta
tcatggttcc attttgcaaa gtggggtccc atcacgtttc 1260agtggcagtg
gatctgggac agacttcact ctcaccatca gcagtctgca acctgaagat
1320tttgctacgt actactgtca acagtatatg tattatcctg agacgttcgg
ccaagggacc 1380aaggtggaaa tcaaacgt 1398161068DNAArtificial
SequenceC-terminal Fc fusion of K-044-085 DAB (Albumin Domain 3
Linker) Fc-dAb nucleic acid sequence identified using molecular
biology techniques. 16gctagcaccc acacctgccc cccctgccct gcccccgagc
tgctgggagg ccccagcgtg 60ttcctgttcc cccccaagcc taaggacacc ctgatgatca
gcagaacccc cgaggtgacc 120tgtgtggtgg tggatgtgag ccacgaggac
cctgaggtga agttcaactg gtacgtggac 180ggcgtggagg tgcacaatgc
caagaccaag cccagggagg agcagtacaa cagcacctac 240cgggtggtgt
ccgtgctgac cgtgctgcac caggattggc tgaacggcaa ggagtacaag
300tgtaaggtgt ccaacaaggc cctgcctgcc cctatcgaga aaaccatcag
caaggccaag 360ggccagccca gagagcccca ggtgtacacc ctgcccccta
gcagagatga gctgaccaag 420aaccaggtgt ccctgacctg cctggtgaag
ggcttctacc ccagcgacat cgccgtggag 480tgggagagca acggccagcc
cgagaacaac tacaagacca ccccccctgt gctggacagc 540gatggcagct
tcttcctgta cagcaagctg accgtggaca agagcagatg gcagcagggc
600aacgtgttca gctgctccgt gatgcacgag gccctgcaca atcactacac
ccagaagagc 660ctgagcctgt cccctggcaa ggaggtggac gagacctacg
tgcccaagga gttcaacgcc 720gagaccttca ccttccacgc cgacgacatc
cagatgaccc agtctccatc ctccctgtct 780gcatctgtag gagaccgtgt
caccatcact tgccgggcaa gtcagtggat tggtcctgag 840ttaaagtggt
accagcagaa accagggaaa gcccctaagc tcctgatcta tcatggttcc
900attttgcaaa gtggggtccc atcacgtttc agtggcagtg gatctgggac
agacttcact 960ctcaccatca gcagtctgca acctgaagat tttgctacgt
actactgtca acagtatatg 1020tattatcctc atacgttcgg ccaagggacc
aaggtggaaa tcaaacgt 1068171062DNAArtificial SequenceC-terminal Fc
fusion of K-044-085 DAB (Albumin Domain 3 Linker) Fc-dAb nucleic
acid sequence identified using molecular biology techniques.
17acccacacct gccccccctg ccctgccccc gagctgctgg gaggccccag cgtgttcctg
60ttccccccca agcctaagga caccctgatg atcagcagaa cccccgaggt gacctgtgtg
120gtggtggatg tgagccacga ggaccctgag gtgaagttca actggtacgt
ggacggcgtg 180gaggtgcaca atgccaagac caagcccagg gaggagcagt
acaacagcac ctaccgggtg 240gtgtccgtgc tgaccgtgct gcaccaggat
tggctgaacg gcaaggagta caagtgtaag 300gtgtccaaca aggccctgcc
tgcccctatc gagaaaacca tcagcaaggc caagggccag 360cccagagagc
cccaggtgta caccctgccc cctagcagag atgagctgac caagaaccag
420gtgtccctga cctgcctggt gaagggcttc taccccagcg acatcgccgt
ggagtgggag 480agcaacggcc agcccgagaa caactacaag accacccccc
ctgtgctgga cagcgatggc 540agcttcttcc tgtacagcaa gctgaccgtg
gacaagagca gatggcagca gggcaacgtg 600ttcagctgct ccgtgatgca
cgaggccctg cacaatcact acacccagaa gagcctgagc 660ctgtcccctg
gcaaggaggt ggacgagacc tacgtgccca aggagttcaa cgccgagacc
720ttcaccttcc acgccgacga catccagatg acccagtctc catcctccct
gtctgcatct 780gtaggagacc gtgtcaccat cacttgccgg gcaagtcagt
ggattggtcc tgagttaaag 840tggtaccagc agaaaccagg gaaagcccct
aagctcctga tctatcatgg ttccattttg 900caaagtgggg tcccatcacg
tttcagtggc agtggatctg ggacagactt cactctcacc 960atcagcagtc
tgcaacctga agattttgct acgtactact gtcaacagta tatgtattat
1020cctcatacgt tcggccaagg gaccaaggtg gaaatcaaac gt
1062181068DNAArtificial SequenceC-terminal Fc fusion of K-044-251
DAB (Albumin Domain 3 Linker) Fc-dAb nucleic acid sequence
identified using molecular biology techniques. 18gctagcaccc
acacctgccc cccctgccct gcccccgagc tgctgggagg ccccagcgtg 60ttcctgttcc
cccccaagcc taaggacacc ctgatgatca gcagaacccc cgaggtgacc
120tgtgtggtgg tggatgtgag ccacgaggac cctgaggtga agttcaactg
gtacgtggac 180ggcgtggagg tgcacaatgc caagaccaag cccagggagg
agcagtacaa cagcacctac 240cgggtggtgt ccgtgctgac cgtgctgcac
caggattggc tgaacggcaa ggagtacaag 300tgtaaggtgt ccaacaaggc
cctgcctgcc cctatcgaga aaaccatcag caaggccaag 360ggccagccca
gagagcccca ggtgtacacc ctgcccccta gcagagatga gctgaccaag
420aaccaggtgt ccctgacctg cctggtgaag ggcttctacc ccagcgacat
cgccgtggag 480tgggagagca acggccagcc cgagaacaac tacaagacca
ccccccctgt gctggacagc 540gatggcagct tcttcctgta cagcaagctg
accgtggaca agagcagatg gcagcagggc 600aacgtgttca gctgctccgt
gatgcacgag gccctgcaca atcactacac ccagaagagc 660ctgagcctgt
cccctggcaa ggaggtggac gagacctacg tgcccaagga gttcaacgcc
720gagaccttca ccttccacgc cgacgacatc cagatgaccc agtctccatc
ctccctgtct 780gcatctgtag gagaccgtgt caccatcact tgccgggcaa
gtcagtggat tggtcctgag 840ttaaagtggt accagcagaa accagggaaa
gcccctaagc tcctgatcta tcatggttcc 900attttgcaaa gtggggtccc
atcacgtttc agtggcagtg gatctgggac agacttcact 960ctcaccatca
gcagtctgca acctgaagat tttgctacgt actactgtca acagtatatg
1020tattatcctg agacgttcgg ccaagggacc aaggtggaaa tcaaacgt
1068191062DNAArtificial SequenceC-terminal Fc fusion of K-044-251
DAB (Albumin Domain 3 Linker) Fc-dAb nucleic acid sequence
identified using molecular biology techniques. 19acccacacct
gccccccctg ccctgccccc gagctgctgg gaggccccag cgtgttcctg 60ttccccccca
agcctaagga caccctgatg atcagcagaa cccccgaggt gacctgtgtg
120gtggtggatg tgagccacga ggaccctgag gtgaagttca actggtacgt
ggacggcgtg 180gaggtgcaca atgccaagac caagcccagg gaggagcagt
acaacagcac ctaccgggtg 240gtgtccgtgc tgaccgtgct gcaccaggat
tggctgaacg gcaaggagta caagtgtaag 300gtgtccaaca aggccctgcc
tgcccctatc gagaaaacca tcagcaaggc caagggccag 360cccagagagc
cccaggtgta caccctgccc cctagcagag atgagctgac caagaaccag
420gtgtccctga cctgcctggt gaagggcttc taccccagcg acatcgccgt
ggagtgggag 480agcaacggcc agcccgagaa caactacaag accacccccc
ctgtgctgga cagcgatggc 540agcttcttcc tgtacagcaa gctgaccgtg
gacaagagca gatggcagca gggcaacgtg 600ttcagctgct ccgtgatgca
cgaggccctg cacaatcact acacccagaa gagcctgagc 660ctgtcccctg
gcaaggaggt ggacgagacc tacgtgccca aggagttcaa cgccgagacc
720ttcaccttcc acgccgacga catccagatg acccagtctc catcctccct
gtctgcatct 780gtaggagacc gtgtcaccat cacttgccgg gcaagtcagt
ggattggtcc tgagttaaag 840tggtaccagc agaaaccagg gaaagcccct
aagctcctga tctatcatgg ttccattttg 900caaagtgggg tcccatcacg
tttcagtggc agtggatctg ggacagactt cactctcacc 960atcagcagtc
tgcaacctga agattttgct acgtactact gtcaacagta tatgtattat
1020cctgagacgt tcggccaagg gaccaaggtg gaaatcaaac gt
1062201017DNAArtificial SequenceN-terminal Fc fusion of K-044-085
DAB (TVAAPS Linker) dAb-Fc nucleic acid sequence identified using
molecular biology techniques. 20gacatccaga tgacccagtc tccatcctcc
ctgtctgcat ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt
cctgagttaa agtggtacca gcagaaacca 120gggaaagccc ctaagctcct
gatctatcat ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg
gcagtggatc tgggacagac ttcactctca ccatcagcag tctgcaacct
240gaagattttg ctacgtacta ctgtcaacag tatatgtatt atcctcatac
gttcggccaa 300gggaccaagg tggaaatcaa acgtaccgtc gccgctccta
gcacccacac ctgccccccc 360tgccctgccc ccgagctgct gggcggacct
agcgtgttcc tgttcccccc caagcctaag 420gacaccctga tgatcagcag
gacccccgaa gtgacctgcg tggtggtgga tgtgagccac 480gaggaccctg
aagtgaagtt caactggtac gtggacggcg tggaagtgca caacgccaag
540accaagccca gagaggagca gtacaacagc acctaccgcg tggtgtctgt
gctgaccgtg 600ctgcaccagg attggctgaa cggcaaggag tacaagtgca
aagtgagcaa caaggccctg 660cctgccccta tcgagaaaac catcagcaag
gccaagggcc agcctagaga gccccaggtc 720tacaccctgc ctccctccag
agatgagctg accaagaacc aggtgtccct gacctgtctg 780gtgaagggct
tctaccccag cgacatcgcc gtggagtggg agagcaacgg ccagcccgag
840aacaactaca agaccacccc ccctgtgctg gacagcgatg gcagcttctt
cctgtactcc 900aagctgaccg tggacaagag cagatggcag cagggcaacg
tgttcagctg cagcgtgatg 960cacgaggccc tgcacaatca ctacacccag
aagagtctga gcctgtcccc tggcaag 1017211017DNAArtificial
SequenceN-terminal Fc fusion of K-044-232 DAB (TVAAPS Linker)
dAb-Fc nucleic acid sequence identified using molecular biology
techniques. 21gacatccaga tgacccagtc tccatcctcc ctgtctgcat
ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa
gttggtacca gcagaaacca 120gggaaagccc ctaagctcct gatctatcat
ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc
tgggacagac ttcactctca ccatcagcag tctgcaacct 240gaagattttg
ctacgtacta ctgtcaacag tatatgtatt atcctgagac gttcggccaa
300gggaccaagg tggaaatcaa acgtaccgtc gccgctccta gcacccacac
ctgccccccc 360tgccctgccc ccgagctgct gggcggacct agcgtgttcc
tgttcccccc caagcctaag 420gacaccctga tgatcagcag gacccccgaa
gtgacctgcg tggtggtgga tgtgagccac 480gaggaccctg aagtgaagtt
caactggtac gtggacggcg tggaagtgca caacgccaag 540accaagccca
gagaggagca gtacaacagc acctaccgcg tggtgtctgt gctgaccgtg
600ctgcaccagg attggctgaa cggcaaggag tacaagtgca aagtgagcaa
caaggccctg 660cctgccccta tcgagaaaac catcagcaag gccaagggcc
agcctagaga gccccaggtc 720tacaccctgc ctccctccag agatgagctg
accaagaacc aggtgtccct gacctgtctg 780gtgaagggct tctaccccag
cgacatcgcc gtggagtggg agagcaacgg ccagcccgag 840aacaactaca
agaccacccc ccctgtgctg gacagcgatg gcagcttctt cctgtactcc
900aagctgaccg tggacaagag cagatggcag cagggcaacg tgttcagctg
cagcgtgatg 960cacgaggccc tgcacaatca ctacacccag aagagtctga
gcctgtcccc tggcaag 1017221017DNAArtificial SequenceN-terminal Fc
fusion of K-044-236 DAB(TVAAPS Linker) dAb-Fc nucleic acid sequence
identified using molecular biology techniques. 22gacatccaga
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc 60atcacttgcc
gggcaagtca gtggattggt cctgagttaa gttggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctaagac gttcggccaa 300gggaccaagg tggaaatcaa
acgtaccgtc gccgctccta gcacccacac ctgccccccc 360tgccctgccc
ccgagctgct gggcggacct agcgtgttcc tgttcccccc caagcctaag
420gacaccctga tgatcagcag gacccccgaa gtgacctgcg tggtggtgga
tgtgagccac 480gaggaccctg aagtgaagtt caactggtac gtggacggcg
tggaagtgca caacgccaag 540accaagccca gagaggagca gtacaacagc
acctaccgcg tggtgtctgt gctgaccgtg 600ctgcaccagg attggctgaa
cggcaaggag tacaagtgca aagtgagcaa caaggccctg 660cctgccccta
tcgagaaaac catcagcaag gccaagggcc agcctagaga gccccaggtc
720tacaccctgc ctccctccag agatgagctg accaagaacc aggtgtccct
gacctgtctg 780gtgaagggct tctaccccag cgacatcgcc gtggagtggg
agagcaacgg ccagcccgag 840aacaactaca agaccacccc ccctgtgctg
gacagcgatg gcagcttctt cctgtactcc 900aagctgaccg tggacaagag
cagatggcag cagggcaacg tgttcagctg cagcgtgatg 960cacgaggccc
tgcacaatca ctacacccag aagagtctga gcctgtcccc tggcaag
1017231017DNAArtificial SequenceN-terminal Fc fusion of K-044-251
DAB (TVAAPS Linker) dAb-Fc nucleic acid sequence identified using
molecular biology techniques. 23gacatccaga tgacccagtc tccatcctcc
ctgtctgcat ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt
cctgagttaa agtggtacca gcagaaacca 120gggaaagccc ctaagctcct
gatctatcat ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg
gcagtggatc tgggacagac ttcactctca ccatcagcag tctgcaacct
240gaagattttg ctacgtacta ctgtcaacag tatatgtatt atcctgagac
gttcggccaa 300gggaccaagg tggaaatcaa acgtaccgtc gccgctccta
gcacccacac ctgccccccc 360tgccctgccc ccgagctgct gggcggacct
agcgtgttcc tgttcccccc caagcctaag 420gacaccctga tgatcagcag
gacccccgaa gtgacctgcg tggtggtgga tgtgagccac 480gaggaccctg
aagtgaagtt caactggtac gtggacggcg tggaagtgca caacgccaag
540accaagccca gagaggagca gtacaacagc
acctaccgcg tggtgtctgt gctgaccgtg 600ctgcaccagg attggctgaa
cggcaaggag tacaagtgca aagtgagcaa caaggccctg 660cctgccccta
tcgagaaaac catcagcaag gccaagggcc agcctagaga gccccaggtc
720tacaccctgc ctccctccag agatgagctg accaagaacc aggtgtccct
gacctgtctg 780gtgaagggct tctaccccag cgacatcgcc gtggagtggg
agagcaacgg ccagcccgag 840aacaactaca agaccacccc ccctgtgctg
gacagcgatg gcagcttctt cctgtactcc 900aagctgaccg tggacaagag
cagatggcag cagggcaacg tgttcagctg cagcgtgatg 960cacgaggccc
tgcacaatca ctacacccag aagagtctga gcctgtcccc tggcaag
1017241017DNAArtificial SequenceN-terminal Fc fusion of K-044-255
DAB (TVAAPS Linker) dAb-Fc nucleic acid sequence identified using
molecular biology techniques. 24gacatccaga tgacccagtc tccatcctcc
ctgtctgcat ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt
cctgagttaa agtggtacca gcagaaacca 120gggaaagccc ctaagctcct
gatctatcat ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg
gcagtggatc tgggacagac ttcactctca ccatcagcag tctgcaacct
240gaagattttg ctacgtacta ctgtcaacag tatatgtatt atcctaagac
gttcggccaa 300gggaccaagg tggaaatcaa acgtaccgtc gccgctccta
gcacccacac ctgccccccc 360tgccctgccc ccgagctgct gggcggacct
agcgtgttcc tgttcccccc caagcctaag 420gacaccctga tgatcagcag
gacccccgaa gtgacctgcg tggtggtgga tgtgagccac 480gaggaccctg
aagtgaagtt caactggtac gtggacggcg tggaagtgca caacgccaag
540accaagccca gagaggagca gtacaacagc acctaccgcg tggtgtctgt
gctgaccgtg 600ctgcaccagg attggctgaa cggcaaggag tacaagtgca
aagtgagcaa caaggccctg 660cctgccccta tcgagaaaac catcagcaag
gccaagggcc agcctagaga gccccaggtc 720tacaccctgc ctccctccag
agatgagctg accaagaacc aggtgtccct gacctgtctg 780gtgaagggct
tctaccccag cgacatcgcc gtggagtggg agagcaacgg ccagcccgag
840aacaactaca agaccacccc ccctgtgctg gacagcgatg gcagcttctt
cctgtactcc 900aagctgaccg tggacaagag cagatggcag cagggcaacg
tgttcagctg cagcgtgatg 960cacgaggccc tgcacaatca ctacacccag
aagagtctga gcctgtcccc tggcaag 1017251431DNAArtificial
SequenceDOM15-26-597-AS Linker-Fc-GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb nucleic acid sequence
identified using molecular biology techniques. 25gaggtgcagc
tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg
ccagcggctt caccttcaag gcctacccca tgatgtgggt gcggcaggcc
120cctggcaagg gcctggaatg ggtgtccgag atcagcccca gcggcagcaa
cacctactac 180gccgacagcg tgaagggccg gttcaccatc agccgggaca
acagcaagaa caccctgtac 240ctgcagatga acagcctgcg ggccgaggac
accgccgtgt actactgcgc caaggacccc 300cggaagctgg actactgggg
ccagggcacc ctggtgaccg tgagcagcgc tagcacccac 360acctgccccc
cctgccctgc ccccgagctg ctgggaggcc ccagcgtgtt cctgttcccc
420cccaagccta aggacaccct gatgatcagc agaacccccg aggtgacctg
tgtggtggtg 480gatgtgagcc acgaggaccc tgaggtgaag ttcaactggt
acgtggacgg cgtggaggtg 540cacaatgcca agaccaagcc cagggaggag
cagtacaaca gcacctaccg ggtggtgtcc 600gtgctgaccg tgctgcacca
ggattggctg aacggcaagg agtacaagtg taaggtgtcc 660aacaaggccc
tgcctgcccc tatcgagaaa accatcagca aggccaaggg ccagcccaga
720gagccccagg tgtacaccct gccccctagc agagatgagc tgaccaagaa
ccaggtgtcc 780ctgacctgcc tggtgaaggg cttctacccc agcgacatcg
ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta caagaccacc
ccccctgtgc tggacagcga tggcagcttc 900ttcctgtaca gcaagctgac
cgtggacaag agcagatggc agcagggcaa cgtgttcagc 960tgctccgtga
tgcacgaggc cctgcacaat cactacaccc agaagagcct gagcctgtcc
1020cctggcaagg gatctaccgt ggcagcacca tcaggatcta ccgtggcagc
accatcaggt 1080tcaacagtag ctgctccttc tggatccgac atccagatga
cccagtctcc atcctccctg 1140tctgcatctg taggagaccg tgtcaccatc
acttgccggg caagtcagtg gattggtcct 1200gagttaaagt ggtaccagca
gaaaccaggg aaagccccta agctcctgat ctatcatggt 1260tccattttgc
aaagtggggt cccatcacgt ttcagtggca gtggatctgg gacagacttc
1320actctcacca tcagcagtct gcaacctgaa gattttgcta cgtactactg
tcaacagtat 1380atgtattatc ctcatacgtt cggccaaggg accaaggtgg
aaatcaaacg t 1431261425DNAArtificial Sequence
DT02-K-044-085-HingeIgG1Linker-Fc-GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb nucleic acid sequence
identified using molecular biology techniques. 26gacatccaga
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc 60atcacttgcc
gggcaagtca gtggattggt cctgagttaa agtggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctcatac gttcggccaa 300gggaccaagg tggaaatcaa
acgtgtggag cctaagtctt ctgacaagac ccacacctgc 360cccccctgcc
ctgcccccga gctgctggga ggccccagcg tgttcctgtt cccccccaag
420cctaaggaca ccctgatgat cagcagaacc cccgaggtga cctgtgtggt
ggtggatgtg 480agccacgagg accctgaggt gaagttcaac tggtacgtgg
acggcgtgga ggtgcacaat 540gccaagacca agcccaggga ggagcagtac
aacagcacct accgggtggt gtccgtgctg 600accgtgctgc accaggattg
gctgaacggc aaggagtaca agtgtaaggt gtccaacaag 660gccctgcctg
cccctatcga gaaaaccatc agcaaggcca agggccagcc cagagagccc
720caggtgtaca ccctgccccc tagcagagat gagctgacca agaaccaggt
gtccctgacc 780tgcctggtga agggcttcta ccccagcgac atcgccgtgg
agtgggagag caacggccag 840cccgagaaca actacaagac caccccccct
gtgctggaca gcgatggcag cttcttcctg 900tacagcaagc tgaccgtgga
caagagcaga tggcagcagg gcaacgtgtt cagctgctcc 960gtgatgcacg
aggccctgca caatcactac acccagaaga gcctgagcct gtcccctggc
1020aagggatcta ccgtggcagc accatcagga tctaccgtgg cagcaccatc
aggttcaaca 1080gtagctgctc cttctggatc cgacatccag atgacccagt
ctccatcctc cctgtctgca 1140tctgtaggag accgtgtcac catcacttgc
cgggcaagtc agtggattgg tcctgagtta 1200aagtggtacc agcagaaacc
agggaaagcc cctaagctcc tgatctatca tggttccatt 1260ttgcaaagtg
gggtcccatc acgtttcagt ggcagtggat ctgggacaga cttcactctc
1320accatcagca gtctgcaacc tgaagatttt gctacgtact actgtcaaca
gtatatgtat 1380tatcctcata cgttcggcca agggaccaag gtggaaatca aacgt
1425271407DNAArtificial SequenceDT02-K-044-085-AS-Fc
(H112A)-GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb
nucleic acid sequence identified using molecular biology
techniques. 27gacatccaga tgacccagtc tccatcctcc ctgtctgcat
ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa
agtggtacca gcagaaacca 120gggaaagccc ctaagctcct gatctatcat
ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc
tgggacagac ttcactctca ccatcagcag tctgcaacct 240gaagattttg
ctacgtacta ctgtcaacag tatatgtatt atcctcatac gttcggccaa
300gggaccaagg tggaaatcaa acgtgctagc accgccacct gccccccctg
ccctgccccc 360gagctgctgg gaggccccag cgtgttcctg ttccccccca
agcctaagga caccctgatg 420atcagcagaa cccccgaggt gacctgtgtg
gtggtggatg tgagccacga ggaccctgag 480gtgaagttca actggtacgt
ggacggcgtg gaggtgcaca atgccaagac caagcccagg 540gaggagcagt
acaacagcac ctaccgggtg gtgtccgtgc tgaccgtgct gcaccaggat
600tggctgaacg gcaaggagta caagtgtaag gtgtccaaca aggccctgcc
tgcccctatc 660gagaaaacca tcagcaaggc caagggccag cccagagagc
cccaggtgta caccctgccc 720cctagcagag atgagctgac caagaaccag
gtgtccctga cctgcctggt gaagggcttc 780taccccagcg acatcgccgt
ggagtgggag agcaacggcc agcccgagaa caactacaag 840accacccccc
ctgtgctgga cagcgatggc agcttcttcc tgtacagcaa gctgaccgtg
900gacaagagca gatggcagca gggcaacgtg ttcagctgct ccgtgatgca
cgaggccctg 960cacaatcact acacccagaa gagcctgagc ctgtcccctg
gcaagggatc taccgtggca 1020gcaccatcag gatctaccgt ggcagcacca
tcaggttcaa cagtagctgc tccttctgga 1080tccgacatcc agatgaccca
gtctccatcc tccctgtctg catctgtagg agaccgtgtc 1140accatcactt
gccgggcaag tcagtggatt ggtcctgagt taaagtggta ccagcagaaa
1200ccagggaaag cccctaagct cctgatctat catggttcca ttttgcaaag
tggggtccca 1260tcacgtttca gtggcagtgg atctgggaca gacttcactc
tcaccatcag cagtctgcaa 1320cctgaagatt ttgctacgta ctactgtcaa
cagtatatgt attatcctca tacgttcggc 1380caagggacca aggtggaaat caaacgt
1407281407DNAArtificial SequenceDT02-K-044-085-AS-Fc
(T113P)-GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb
nucleic acid sequence identified using molecular biology
techniques. 28gacatccaga tgacccagtc tccatcctcc ctgtctgcat
ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa
agtggtacca gcagaaacca 120gggaaagccc ctaagctcct gatctatcat
ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc
tgggacagac ttcactctca ccatcagcag tctgcaacct 240gaagattttg
ctacgtacta ctgtcaacag tatatgtatt atcctcatac gttcggccaa
300gggaccaagg tggaaatcaa acgtgctagc acccaccctt gccccccctg
ccctgccccc 360gagctgctgg gaggccccag cgtgttcctg ttccccccca
agcctaagga caccctgatg 420atcagcagaa cccccgaggt gacctgtgtg
gtggtggatg tgagccacga ggaccctgag 480gtgaagttca actggtacgt
ggacggcgtg gaggtgcaca atgccaagac caagcccagg 540gaggagcagt
acaacagcac ctaccgggtg gtgtccgtgc tgaccgtgct gcaccaggat
600tggctgaacg gcaaggagta caagtgtaag gtgtccaaca aggccctgcc
tgcccctatc 660gagaaaacca tcagcaaggc caagggccag cccagagagc
cccaggtgta caccctgccc 720cctagcagag atgagctgac caagaaccag
gtgtccctga cctgcctggt gaagggcttc 780taccccagcg acatcgccgt
ggagtgggag agcaacggcc agcccgagaa caactacaag 840accacccccc
ctgtgctgga cagcgatggc agcttcttcc tgtacagcaa gctgaccgtg
900gacaagagca gatggcagca gggcaacgtg ttcagctgct ccgtgatgca
cgaggccctg 960cacaatcact acacccagaa gagcctgagc ctgtcccctg
gcaagggatc taccgtggca 1020gcaccatcag gatctaccgt ggcagcacca
tcaggttcaa cagtagctgc tccttctgga 1080tccgacatcc agatgaccca
gtctccatcc tccctgtctg catctgtagg agaccgtgtc 1140accatcactt
gccgggcaag tcagtggatt ggtcctgagt taaagtggta ccagcagaaa
1200ccagggaaag cccctaagct cctgatctat catggttcca ttttgcaaag
tggggtccca 1260tcacgtttca gtggcagtgg atctgggaca gacttcactc
tcaccatcag cagtctgcaa 1320cctgaagatt ttgctacgta ctactgtcaa
cagtatatgt attatcctca tacgttcggc 1380caagggacca aggtggaaat caaacgt
140729343PRTArtificial SequenceDOM15-26-593-Fc dAb-Fc amino acid
sequence identified using molecular biology techniques. 29Glu Val
Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20
25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Tyr Thr Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu
Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Ala
Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140 Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145 150
155 160 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp 165 170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265 270
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 275
280 285 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser 290 295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys 340
30343PRTArtificial SequenceDOM15-26-597-Fc dAb-Fc amino acid
sequence identified using molecular biology techniques. 30Glu Val
Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20
25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu
Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Ala
Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140 Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145 150
155 160 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp 165 170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265 270
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 275
280 285 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser 290 295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys 340
31365PRTArtificial SequenceC-terminal Fc fusion of K-044-085 DAB
(GS(TVAAPSGS)x3 Linker) Fc-dAb amino acid sequence identified using
molecular biology techniques. 31Gln Ala Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala Pro 1 5 10 15 Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys 20 25 30 Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 35 40 45 Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 50 55 60 Gly
Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr65 70 75
80 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
85 90 95 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu 100 105 110 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg 115 120 125 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys 130 135 140 Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp145 150 155 160 Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 165 170 175 Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 180 185 190 Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 195 200
205 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
210 215 220 Leu Ser Leu Ser Pro Gly Lys Gly Ser Thr Val Ala Ala Pro
Ser Gly225 230 235 240 Ser Thr Val Ala Ala Pro Ser Gly Ser Thr Val
Ala Ala Pro Ser Gly 245 250 255 Ser Asp Ile Gln Met Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val 260 265 270 Gly Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser Gln Trp Ile Gly Pro 275 280 285 Glu Leu Lys Trp Tyr
Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu 290 295 300 Ile Tyr His
Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser305 310 315 320
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
325 330 335 Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro 340 345 350 His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
Arg 355 360 365 32365PRTArtificial SequenceC-terminal Fc fusion of
K-044-232 DAB (GS(TVAAPSGS)x3 Linker) Fc-dAb amino acid sequence
identified using molecular biology techniques. 32Gln Ala Ser Ser
Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro 1 5 10 15 Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 20 25 30
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 35
40 45 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp 50 55 60 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr65 70 75 80 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp 85 90 95 Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu 100 105 110 Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg 115 120 125 Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 130 135 140 Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp145 150 155 160
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 165
170 175 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser 180 185 190 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser 195 200 205 Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser 210 215 220 Leu Ser Leu Ser Pro Gly Lys Gly Ser
Thr Val Ala Ala Pro Ser Gly225 230 235 240 Ser Thr Val Ala Ala Pro
Ser Gly Ser Thr Val Ala Ala Pro Ser Gly 245 250 255 Ser Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val 260 265 270 Gly Asp
Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro 275 280 285
Glu Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu 290
295 300 Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe
Ser305 310 315 320 Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Gln 325 330 335 Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
Gln Tyr Met Tyr Tyr Pro 340 345 350 Glu Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys Arg 355 360 365 33365PRTArtificial
SequenceC-terminal Fc fusion of K-044-236 DAB (GS(TVAAPSGS)x3
Linker) Fc-dAb amino acid sequence identified using molecular
biology techniques. 33Gln Ala Ser Ser Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro 1 5 10 15 Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys 20 25 30 Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 35 40 45 Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 50 55 60 Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr65 70 75 80 Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp 85 90
95 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
100 105 110 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
Pro Arg 115 120 125 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
Glu Leu Thr Lys 130 135 140 Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp145 150 155 160 Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys 165 170 175 Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 180 185 190 Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 195 200 205 Cys
Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser 210 215
220 Leu Ser Leu Ser Pro Gly Lys Gly Ser Thr Val Ala Ala Pro Ser
Gly225 230 235 240 Ser Thr Val Ala Ala Pro Ser Gly Ser Thr Val Ala
Ala Pro Ser Gly 245 250 255 Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val 260 265 270 Gly Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Trp Ile Gly Pro 275 280 285 Glu Leu Ser Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu 290 295 300 Ile Tyr His Gly
Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser305 310 315 320 Gly
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln 325 330
335 Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro
340 345 350 Lys Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg 355
360 365 34365PRTArtificial SequenceC-terminal Fc fusion of
K-044-251 DAB (GS(TVAAPSGS)x3 Linker) Fc-dAb amino acid sequence
identified using molecular biology techniques. 34Gln Ala Ser Ser
Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro 1 5 10 15 Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 20 25 30
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 35
40 45 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp 50 55 60 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr65 70 75 80 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp 85 90 95 Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu 100 105 110 Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg 115 120 125 Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 130 135 140 Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp145 150 155 160
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 165
170 175 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser 180 185 190 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser 195 200 205 Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser 210 215 220 Leu Ser Leu Ser Pro Gly Lys Gly Ser
Thr Val Ala Ala Pro Ser Gly225 230 235 240 Ser Thr Val Ala Ala Pro
Ser Gly Ser Thr Val Ala Ala Pro Ser Gly 245 250 255 Ser Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val 260 265 270 Gly Asp
Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro 275 280 285
Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu 290
295 300 Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe
Ser305 310 315 320 Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Gln 325 330 335 Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
Gln Tyr Met Tyr Tyr Pro 340 345 350 Glu Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys Arg 355 360 365 35365PRTArtificial
SequenceC-terminal Fc fusion of K-044-255 DAB (GS(TVAAPSGS)x3
Linker) Fc-dAb amino acid sequence identified using molecular
biology techniques. 35Gln Ala Ser Ser Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro 1 5 10 15 Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys 20 25 30 Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 35 40 45 Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 50 55 60 Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr65 70 75 80 Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp 85 90
95 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
100 105 110 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
Pro Arg 115 120 125 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
Glu Leu Thr Lys 130 135 140 Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp145 150 155 160 Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys 165 170 175 Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 180 185 190 Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 195 200 205 Cys
Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser 210 215
220 Leu Ser Leu Ser Pro Gly Lys Gly Ser Thr Val Ala Ala Pro Ser
Gly225 230 235 240 Ser Thr Val Ala Ala Pro Ser Gly Ser Thr Val Ala
Ala Pro Ser Gly 245 250 255 Ser Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val 260 265 270 Gly Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Trp Ile Gly Pro 275 280 285 Glu Leu Lys Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu 290 295 300 Ile Tyr His Gly
Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser305 310 315 320 Gly
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln 325 330
335 Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro
340 345 350 Lys Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg 355
360 365 36340PRTArtificial SequenceN-terminal Fc fusion of
K-044-251 DAB (AAAS Linker) dAb-Fc amino acid sequence identified
using molecular biology techniques. 36Glu Ser Thr Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala 1 5 10 15 Ser Val Gly Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile 20 25 30 Gly Pro Glu
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys 35 40 45 Leu
Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg 50 55
60 Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser65 70 75 80 Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Tyr Met Tyr 85 90 95 Tyr Pro Glu Thr Phe Gly Gln Gly Thr Lys Val
Glu Ile Lys Arg Ala 100 105 110 Ala Ala Ser Thr His Thr Cys Pro Pro
Cys Pro Ala Pro Glu Leu Leu 115 120 125 Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu 130 135 140 Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser145 150 155 160 His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 165 170 175
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr 180
185 190 Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn 195 200 205 Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala Pro 210 215 220 Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
Pro Arg Glu Pro Gln225 230 235 240 Val Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val 245 250 255 Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 260 265 270 Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 275 280 285 Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr 290 295 300
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val305
310 315 320 Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu 325 330 335 Ser Pro Gly Lys 340 37340PRTArtificial
SequenceN-terminal Fc fusion of K-044-255 DAB (AAAS Linker) dAb-Fc
amino acid sequence identified using molecular biology techniques.
37Glu Ser Thr Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala 1
5 10 15 Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp
Ile 20 25 30 Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys
Ala Pro Lys 35 40 45 Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser
Gly Val Pro Ser Arg 50 55 60 Phe Ser Gly Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser65 70 75 80 Leu Gln Pro Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr 85 90 95 Tyr Pro Lys Thr Phe
Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Ala 100 105 110 Ala Ala Ser
Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 115 120 125 Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 130 135
140 Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
Ser145 150 155 160 His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu 165 170 175 Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr Asn Ser Thr 180 185 190 Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn 195 200 205 Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 210 215 220 Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln225 230 235 240 Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 245 250
255 Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
260 265 270 Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro 275 280 285 Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser Lys Leu Thr 290 295 300 Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys Ser Val305 310 315 320 Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu 325 330 335 Ser Pro Gly Lys 340
38472PRTArtificial
SequenceDOM15-26-597-AS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 38Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Ala Ser Thr
His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140 Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145 150 155 160
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 165
170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265 270 Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 275 280 285
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 290
295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys Glu Val Asp
Glu Thr Tyr Val Pro Lys 340 345 350 Glu Phe Asn Ala Glu Thr Phe Thr
Phe His Ala Asp Asp Ile Gln Met 355 360 365 Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly Asp Arg Val Thr 370 375 380 Ile Thr Cys Arg
Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys Trp Tyr385 390 395 400 Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr His Gly Ser 405 410
415 Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly
420 425 430 Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
Phe Ala 435 440 445 Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His
Thr Phe Gly Gln 450 455 460 Gly Thr Lys Val Glu Ile Lys Arg465 470
39472PRTArtificial SequenceDOM15-26-597-AS Linker-Fc-Albumin Domain
3 Linker-DT02-K-044-251 Vh-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 39Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Ala Ser Thr
His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140 Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145 150 155 160
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 165
170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265 270 Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 275 280 285
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 290
295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys Glu Val Asp
Glu Thr Tyr Val Pro Lys 340 345 350 Glu Phe Asn Ala Glu Thr Phe Thr
Phe His Ala Asp Asp Ile Gln Met 355 360 365 Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly Asp Arg Val Thr 370 375 380 Ile Thr Cys Arg
Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys Trp Tyr385 390 395 400 Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr His Gly Ser 405 410
415 Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly
420 425 430 Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
Phe Ala 435 440 445 Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro Glu
Thr Phe Gly Gln 450 455 460 Gly Thr Lys Val Glu Ile Lys Arg465 470
40464PRTArtificial SequenceDT02-K-044-085-AS Linker-Fc-Albumin
Domain 3 Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 40Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Ala Ser Thr His 100 105 110 Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 115 120 125 Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 130 135 140 Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu145 150 155 160
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 165
170 175 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser 180 185 190 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys 195 200 205 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile 210 215 220 Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro225 230 235 240 Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 245 250 255 Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 260 265 270 Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 275 280 285
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 290
295 300 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu305 310 315 320 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys Glu 325 330 335 Val Asp Glu Thr Tyr Val Pro Lys Glu Phe
Asn Ala Glu Thr Phe Thr 340 345 350 Phe His Ala Asp Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser 355 360 365 Ala Ser Val Gly Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp 370 375 380 Ile Gly Pro Glu
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro385 390 395 400 Lys
Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser 405 410
415 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
420 425 430 Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Tyr Met 435 440 445 Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val
Glu Ile Lys Arg 450 455 460 41466PRTArtificial
SequenceDT02-K-044-085-AAAS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-085 Vk-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 41Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Ala Ala Ala Ser 100 105 110 Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro 115 120 125 Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 130 135 140 Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp145 150 155 160
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 165
170 175 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val 180 185 190 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu 195 200 205 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys 210 215 220 Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr225 230 235 240 Leu Pro Pro Ser Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 245 250 255 Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 260 265 270 Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 275 280 285
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 290
295 300 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu305 310 315 320 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly 325 330 335 Lys Glu Val Asp Glu Thr Tyr Val Pro Lys
Glu Phe Asn Ala Glu Thr 340 345 350 Phe Thr Phe His Ala Asp Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser 355 360 365 Leu Ser Ala Ser Val Gly
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser 370 375 380 Gln Trp Ile Gly
Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys385 390 395 400 Ala
Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val 405 410
415 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
420 425 430 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln 435 440 445 Tyr Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile 450 455 460 Lys Arg465 42464PRTArtificial
SequenceDT02-K-044-251-AS Linker-Fc-Albumin Domain 3
Linker-DT02-K-044-251 Vk-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 42Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro Glu 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Ala Ser Thr His 100 105 110 Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 115 120 125 Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 130 135 140 Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu145 150 155 160
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 165
170 175 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser 180 185 190 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys 195 200 205 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile 210 215 220 Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro225 230 235 240 Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 245 250 255 Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 260 265 270 Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 275 280 285
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 290
295 300 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu305
310 315 320 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys Glu 325 330 335 Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala
Glu Thr Phe Thr 340 345 350 Phe His Ala Asp Asp Ile Gln Met Thr Gln
Ser Pro Ser Ser Leu Ser 355 360 365 Ala Ser Val Gly Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser Gln Trp 370 375 380 Ile Gly Pro Glu Leu Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro385 390 395 400 Lys Leu Leu
Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser 405 410 415 Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 420 425
430 Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met
435 440 445 Tyr Tyr Pro Glu Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
Lys Arg 450 455 460 43466PRTArtificial SequenceDT02-K-044-251-AAAS
Linker-Fc-Albumin Domain 3 Linker-DT02-K-044-251 Vk-Vk dAb-Fc-dAb
amino acid sequence identified using molecular biology techniques.
43Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1
5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro
Glu 20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu
Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr
Cys Gln Gln Tyr Met Tyr Tyr Pro Glu 85 90 95 Thr Phe Gly Gln Gly
Thr Lys Val Glu Ile Lys Arg Ala Ala Ala Ser 100 105 110 Thr His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 115 120 125 Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 130 135
140 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
Asp145 150 155 160 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn 165 170 175 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr Tyr Arg Val 180 185 190 Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu 195 200 205 Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 210 215 220 Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr225 230 235 240 Leu
Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 245 250
255 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
260 265 270 Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro
Val Leu 275 280 285 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys 290 295 300 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met His Glu305 310 315 320 Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly 325 330 335 Lys Glu Val Asp Glu
Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr 340 345 350 Phe Thr Phe
His Ala Asp Asp Ile Gln Met Thr Gln Ser Pro Ser Ser 355 360 365 Leu
Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser 370 375
380 Gln Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly
Lys385 390 395 400 Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu
Gln Ser Gly Val 405 410 415 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Thr 420 425 430 Ile Ser Ser Leu Gln Pro Glu Asp
Phe Ala Thr Tyr Tyr Cys Gln Gln 435 440 445 Tyr Met Tyr Tyr Pro Glu
Thr Phe Gly Gln Gly Thr Lys Val Glu Ile 450 455 460 Lys Arg465
44356PRTArtificial SequenceC-terminal Fc fusion of K-044-085
DAB(Albumin Domain 3 Linker) Fc-dAb amino acid sequence identified
using molecular biology techniques. 44Ala Ser Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly 1 5 10 15 Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 20 25 30 Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His 35 40 45 Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 50 55
60 His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr65 70 75 80 Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly 85 90 95 Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile 100 105 110 Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val 115 120 125 Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser 130 135 140 Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu145 150 155 160 Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 165 170 175
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 180
185 190 Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met 195 200 205 His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser 210 215 220 Pro Gly Lys Glu Val Asp Glu Thr Tyr Val Pro
Lys Glu Phe Asn Ala225 230 235 240 Glu Thr Phe Thr Phe His Ala Asp
Asp Ile Gln Met Thr Gln Ser Pro 245 250 255 Ser Ser Leu Ser Ala Ser
Val Gly Asp Arg Val Thr Ile Thr Cys Arg 260 265 270 Ala Ser Gln Trp
Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro 275 280 285 Gly Lys
Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser 290 295 300
Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr305
310 315 320 Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr
Tyr Cys 325 330 335 Gln Gln Tyr Met Tyr Tyr Pro His Thr Phe Gly Gln
Gly Thr Lys Val 340 345 350 Glu Ile Lys Arg 355 45354PRTArtificial
SequenceC-terminal Fc fusion of K-044-085 DAB(Albumin Domain 3
Linker) Fc-dAb amino acid sequence identified using molecular
biology techniques. 45Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60 Ala Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65 70 75 80 Val
Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 85 90
95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185 190 Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215
220 Lys Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu
Thr225 230 235 240 Phe Thr Phe His Ala Asp Asp Ile Gln Met Thr Gln
Ser Pro Ser Ser 245 250 255 Leu Ser Ala Ser Val Gly Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser 260 265 270 Gln Trp Ile Gly Pro Glu Leu Lys
Trp Tyr Gln Gln Lys Pro Gly Lys 275 280 285 Ala Pro Lys Leu Leu Ile
Tyr His Gly Ser Ile Leu Gln Ser Gly Val 290 295 300 Pro Ser Arg Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr305 310 315 320 Ile
Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 325 330
335 Tyr Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
340 345 350 Lys Arg 46356PRTArtificial SequenceC-terminal Fc fusion
of K-044-251 DAB (Albumin Domain 3 Linker) Fc-dAb amino acid
sequence identified using molecular biology techniques. 46Ala Ser
Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly 1 5 10 15
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 20
25 30 Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His 35 40 45 Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val 50 55 60 His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr65 70 75 80 Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly 85 90 95 Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile 100 105 110 Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 115 120 125 Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 130 135 140 Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu145 150
155 160 Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro 165 170 175 Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val 180 185 190 Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met 195 200 205 His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser 210 215 220 Pro Gly Lys Glu Val Asp Glu
Thr Tyr Val Pro Lys Glu Phe Asn Ala225 230 235 240 Glu Thr Phe Thr
Phe His Ala Asp Asp Ile Gln Met Thr Gln Ser Pro 245 250 255 Ser Ser
Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg 260 265 270
Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro 275
280 285 Gly Lys Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln
Ser 290 295 300 Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp Phe Thr305 310 315 320 Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
Phe Ala Thr Tyr Tyr Cys 325 330 335 Gln Gln Tyr Met Tyr Tyr Pro Glu
Thr Phe Gly Gln Gly Thr Lys Val 340 345 350 Glu Ile Lys Arg 355
47354PRTArtificial SequenceC-terminal Fc fusion of K-044-251
DAB(Albumin Domain 3 Linker) Fc-dAb amino acid sequence identified
using molecular biology techniques. 47Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro1 5 10 15 Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55
60 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val65 70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180
185 190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu 195 200 205 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly 210 215 220 Lys Glu Val Asp Glu Thr Tyr Val Pro Lys Glu
Phe Asn Ala Glu Thr225 230 235 240 Phe Thr Phe His Ala Asp Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser 245 250 255 Leu Ser Ala Ser Val Gly
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser 260 265 270 Gln Trp Ile Gly
Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys 275 280 285 Ala Pro
Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val 290 295 300
Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr305
310 315 320 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln 325 330 335 Tyr Met Tyr Tyr Pro Glu Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile 340 345 350 Lys Arg48339PRTArtificial
SequenceN-terminal Fc fusion of K-044-085 DAB (TVAAPS Linker)
dAb-Fc amino acid sequence identified using molecular biology
techniques. 48Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln
Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe
Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His 85 90 95 Thr
Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105
110 Pro Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
115 120 125 Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met 130
135 140 Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His145 150 155 160 Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val Glu Val 165 170 175 His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr 180 185 190 Arg Val Val Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly 195 200 205 Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 210 215 220 Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val225 230 235 240 Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 245 250
255 Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu
260 265 270 Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro 275 280 285 Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val 290 295 300 Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Met305 310 315 320 His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser 325 330 335 Pro Gly
Lys49339PRTArtificial SequenceN-terminal Fc fusion of K-044-232
DAB(TVAAPS Linker) dAb-Fc amino acid sequence identified using
molecular biology techniques. 49Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Ser Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His Gly
Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75
80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro Glu
85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val
Ala Ala 100 105 110 Pro Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly 115 120 125 Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met 130 135 140 Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His145 150 155 160 Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 165 170 175 His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 180 185 190 Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 195 200
205 Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
210 215 220 Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val225 230 235 240 Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser 245 250 255 Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu 260 265 270 Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro 275 280 285 Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 290 295 300 Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met305 310 315 320
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 325
330 335 Pro Gly Lys50339PRTArtificial SequenceN-terminal Fc fusion
of K-044-236 DAB(TVAAPS Linker) dAb-Fc amino acid sequence
identified using molecular biology techniques. 50Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro Lys 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly 115 120 125 Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 130 135 140 Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His145 150 155 160
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 165
170 175 His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr 180 185 190 Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly 195 200 205 Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile 210 215 220 Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val225 230 235 240 Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 245 250 255 Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 260 265 270 Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 275 280 285
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 290
295 300 Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met305 310 315 320 His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser 325 330 335 Pro Gly Lys51339PRTArtificial
SequenceN-terminal Fc fusion of K-044-251 DAB (TVAAPS Linker)
dAb-Fc amino acid sequence identified using molecular biology
techniques. 51Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln
Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe
Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro Glu 85 90 95 Thr
Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105
110 Pro Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
115 120 125 Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met 130 135 140 Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His145 150 155 160 Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val Glu Val 165 170 175 His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 180 185 190 Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 195 200 205 Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 210 215 220 Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val225 230
235 240 Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val
Ser 245 250 255 Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu 260 265 270 Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro 275 280 285 Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val 290 295 300 Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met305 310 315 320 His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 325 330 335 Pro Gly
Lys52339PRTArtificial SequenceN-terminal Fc fusion of K-044-255 DAB
(TVAAPS Linker) dAb-Fc amino acid sequence identified using
molecular biology techniques. 52Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His Gly
Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75
80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro Lys
85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val
Ala Ala 100 105 110 Pro Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly 115 120 125 Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met 130 135 140 Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His145 150 155 160 Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 165 170 175 His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 180 185 190 Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 195 200
205 Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
210 215 220 Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val225 230 235 240 Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser 245 250 255 Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu 260 265 270 Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro 275 280 285 Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 290 295 300 Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met305 310 315 320
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 325
330 335 Pro Gly Lys53477PRTArtificial SequenceDOM15-26-597-AS
Linker-Fc-GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb
amino acid sequence identified using molecular biology techniques.
53Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala
Tyr 20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr
Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg
Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg
Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser
Ser Ala Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135
140 Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val145 150 155 160 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp 165 170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser
Val Leu Thr Val Leu His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250
255 Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
260 265 270 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys 275 280 285 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser 290 295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser305 310 315 320 Cys Ser Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro
Gly Lys Gly Ser Thr Val Ala Ala Pro Ser Gly 340 345 350 Ser Thr Val
Ala Ala Pro Ser Gly Ser Thr Val Ala Ala Pro Ser Gly 355 360 365 Ser
Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val 370 375
380 Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly
Pro385 390 395 400 Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala
Pro Lys Leu Leu 405 410 415 Ile Tyr His Gly Ser Ile Leu Gln Ser Gly
Val Pro Ser Arg Phe Ser 420 425 430 Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile Ser Ser Leu Gln 435 440 445 Pro Glu Asp Phe Ala Thr
Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro 450 455 460 His Thr Phe Gly
Gln Gly Thr Lys Val Glu Ile Lys Arg465 470 475 54475PRTArtificial
Sequence DT02-K-044-085-HingeIgG1Linker-Fc-GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 54Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Val Glu Pro Lys 100 105 110 Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu 115 120 125 Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 130 135
140 Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp
Val145 150 155 160 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val 165 170 175 Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser 180 185 190 Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu 195 200 205 Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 210 215 220 Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro225 230 235 240 Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln 245 250
255 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
260 265 270 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr 275 280 285 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu 290 295 300 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser305 310 315 320 Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser 325 330 335 Leu Ser Pro Gly Lys
Gly Ser Thr Val Ala Ala Pro Ser Gly Ser Thr 340 345 350 Val Ala Ala
Pro Ser Gly Ser Thr Val Ala Ala Pro Ser Gly Ser Asp 355 360 365 Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp 370 375
380 Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu
Leu385 390 395 400 Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile Tyr 405 410 415 His Gly Ser Ile Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly Ser 420 425 430 Gly Ser Gly Thr Asp Phe Thr Leu
Thr Ile Ser Ser Leu Gln Pro Glu 435 440 445 Asp Phe Ala Thr Tyr Tyr
Cys Gln Gln Tyr Met Tyr Tyr Pro His Thr 450 455 460 Phe Gly Gln Gly
Thr Lys Val Glu Ile Lys Arg465 470 475 55469PRTArtificial
SequenceDT02-K-044-085-AS-Fc (H112A)-GS(TVAAPSGS)x3
Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb amino acid sequence
identified using molecular biology techniques. 55Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Ala Ser Thr Ala 100 105 110 Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 115 120 125 Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 130 135 140 Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu145 150 155 160
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 165
170 175 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser 180 185 190 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys 195 200 205 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile 210 215 220 Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro225 230 235 240 Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 245 250 255 Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 260 265 270 Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 275 280 285
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 290
295 300 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu305 310 315 320 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys Gly 325 330 335 Ser Thr Val Ala Ala Pro Ser Gly Ser Thr
Val Ala Ala Pro Ser Gly 340 345 350 Ser Thr Val Ala Ala Pro Ser Gly
Ser Asp Ile Gln Met Thr Gln Ser 355 360 365 Pro Ser Ser Leu Ser Ala
Ser Val Gly Asp Arg Val Thr Ile Thr Cys 370 375 380 Arg Ala Ser Gln
Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys385 390 395 400 Pro
Gly Lys Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln 405 410
415 Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
420 425 430 Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr
Tyr Tyr 435 440 445 Cys Gln Gln Tyr Met Tyr Tyr Pro His Thr Phe Gly
Gln Gly Thr Lys 450 455 460 Val Glu Ile Lys Arg465
56469PRTArtificial SequenceDT02-K-044-085-AS-Fc
(T113P)-GS(TVAAPSGS)x3 Linker-DT02-K-044-085 Vh-Vk dAb-Fc-dAb amino
acid sequence identified using molecular biology techniques. 56Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10
15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu
20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser
Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Tyr Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg Ala Ser Thr His 100 105 110 Pro Cys Pro Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 115 120 125 Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 130 135 140
Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu145
150 155 160 Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys 165 170 175 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser 180 185 190 Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys 195 200 205 Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile 210 215 220 Ser Lys Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro225 230 235 240 Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 245 250 255 Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 260 265
270 Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
275 280 285 Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg 290 295 300 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu Ala Leu305 310 315 320 His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys Gly 325 330 335 Ser Thr Val Ala Ala Pro Ser
Gly Ser Thr Val Ala Ala Pro Ser Gly 340 345 350 Ser Thr Val Ala Ala
Pro Ser Gly Ser Asp Ile Gln Met Thr Gln Ser 355 360 365 Pro Ser Ser
Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys 370 375 380 Arg
Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys385 390
395 400 Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu
Gln 405 410 415 Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe 420 425 430 Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp
Phe Ala Thr Tyr Tyr 435 440 445 Cys Gln Gln Tyr Met Tyr Tyr Pro His
Thr Phe Gly Gln Gly Thr Lys 450 455 460 Val Glu Ile Lys Arg465
5712DNAArtificial SequenceAAAS Linker (N-terminal Linker) nucleic
acid sequence identified using molecular biology techniques.
57gcggccgcta gc 12586DNAHomo sapiens 58gctagc 65918DNAHomo sapiens
59accgtcgccg ctcctagc 186024DNAHomo sapiens 60gtggagccta agtcttctga
caag 246127DNAHomo sapiens 61gagctcaaaa ccccacttgg tgacaca
276254DNAArtificial SequenceFibronectin x3 Linker (N-terminal
Linker) nucleic acid sequence identified using molecular biology
techniques. 62accggattag acagtcccac aggtctcgat tcacctactg
gcttagactc tcca 546372DNAArtificial SequenceFibronectin x4 Linker
(N-terminal Linker) nucleic acid sequence identified using
molecular biology techniques. 63accggattag acagtcccac aggtctcgat
tcacctactg gcttagactc tccaaccggc 60ctggacagcc cc
7264675DNAArtificial SequenceH2A IgG1 Fc nucleic acid sequence
identified using molecular biology techniques. 64accgccacct
gccccccctg ccctgccccc gagctgctgg gaggccccag cgtgttcctg 60ttccccccca
agcctaagga caccctgatg atcagcagaa cccccgaggt gacctgtgtg
120gtggtggatg tgagccacga ggaccctgag gtgaagttca actggtacgt
ggacggcgtg 180gaggtgcaca atgccaagac caagcccagg gaggagcagt
acaacagcac ctaccgggtg 240gtgtccgtgc tgaccgtgct gcaccaggat
tggctgaacg gcaaggagta caagtgtaag 300gtgtccaaca aggccctgcc
tgcccctatc gagaaaacca tcagcaaggc caagggccag 360cccagagagc
cccaggtgta caccctgccc cctagcagag atgagctgac caagaaccag
420gtgtccctga cctgcctggt gaagggcttc taccccagcg acatcgccgt
ggagtgggag 480agcaacggcc agcccgagaa caactacaag accacccccc
ctgtgctgga cagcgatggc 540agcttcttcc tgtacagcaa gctgaccgtg
gacaagagca gatggcagca gggcaacgtg 600ttcagctgct ccgtgatgca
cgaggccctg cacaatcact acacccagaa gagcctgagc 660ctgtcccctg gcaag
67565675DNAArtificial SequenceT3P IgG1 Fc nucleic acid sequence
identified using molecular biology techniques. 65acccaccctt
gccccccctg ccctgccccc gagctgctgg gaggccccag cgtgttcctg 60ttccccccca
agcctaagga caccctgatg atcagcagaa cccccgaggt gacctgtgtg
120gtggtggatg tgagccacga ggaccctgag gtgaagttca actggtacgt
ggacggcgtg 180gaggtgcaca atgccaagac caagcccagg gaggagcagt
acaacagcac ctaccgggtg 240gtgtccgtgc tgaccgtgct gcaccaggat
tggctgaacg gcaaggagta caagtgtaag 300gtgtccaaca aggccctgcc
tgcccctatc gagaaaacca tcagcaaggc caagggccag 360cccagagagc
cccaggtgta caccctgccc cctagcagag atgagctgac caagaaccag
420gtgtccctga cctgcctggt gaagggcttc taccccagcg acatcgccgt
ggagtgggag 480agcaacggcc agcccgagaa caactacaag accacccccc
ctgtgctgga cagcgatggc 540agcttcttcc tgtacagcaa gctgaccgtg
gacaagagca gatggcagca gggcaacgtg 600ttcagctgct ccgtgatgca
cgaggccctg cacaatcact acacccagaa gagcctgagc 660ctgtcccctg gcaag
6756678DNAArtificial Sequence((GS(TVAAPSGS)x3)) Linker (C-terminal
Linker) nucleic acid sequence identified using molecular biology
techniques. 66ggatctaccg tggcagcacc atcaggatct accgtggcag
caccatcagg ttcaacagta 60gctgctcctt ctggatcc 786754DNAArtificial
SequenceFibronectin x3 Linker (C-terminal Linker) nucleic acid
sequence identified using molecular biology techniques.
67accggattag acagtcccac aggtctcgat tcacctactg gcttagactc tcca
546872DNAArtificial SequenceFibronectin x4 Linker (C-terminal
Linker) nucleic acid sequence identified using molecular biology
techniques. 68accggattag acagtcccac aggtctcgat tcacctactg
gcttagactc tccaaccggc 60ctggacagcc cc 726957DNAHomo sapiens
69cacaaggacg acaaccccaa cctgcccagg ctggtgaggc ccgaggtgga cgtgatg
577063DNAHomo sapiens 70gagaacgacg agatgcccgc cgacctgccc agcctggccg
ccgacttcgt ggagagcaag 60gac 637163DNAHomo sapiens 71gaggtggacg
agacctacgt gcccaaggag ttcaacgccg agaccttcac cttccacgcc 60gac
637248DNAHomo sapiens 72gaggtggacg agacctacgt gcccaaggag ttcaacgccg
agaccttc 487345DNAArtificial SequenceGly4Ser 3x Linker (C-terminal
Linker) nucleic acid sequence identified using molecular biology
techniques. 73ggtggaggcg gttcaggcgg aggtggcagc ggcggtggcg ggtcg
457460DNAArtificial SequenceGly4Ser 4x Linker (C-terminal Linker)
nucleic acid sequence identified using molecular biology
techniques. 74ggtggaggcg gttcaggcgg aggtggcagc ggcggtggcg
ggtcgggtgg aggcggttca 6075120DNAHomo sapiens 75aaagaagcgg
cggcgaaaga agcggcggcg aaagaagcgg ccgccaagga gctggccgcc 60aaggaggccg
ccgccaagga ggccgccgcc aaggaggccg ccgccaaaga attggccgca
120764PRTArtificial SequenceAAAS Linker (N-terminal Linker) amino
acid sequence identified using molecular biology techniques. 76Ala
Ala Ala Ser1 772PRTHomo sapiens 77Ala Ser1 786PRTHomo sapiens 78Thr
Val Ala Ala Pro Ser1 5 798PRTHomo sapiens 79Val Glu Pro Lys Ser Ser
Asp Lys1 5 809PRTHomo sapiens 80Glu Leu Lys Thr Pro Leu Gly Asp
Thr1 5 8118PRTArtificial SequenceFibronectin x3 Linker (N-terminal
Linker) amino acid sequence identified using molecular biology
techniques. 81Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr
Gly Leu Asp 1 5 10 15 Ser Pro8224PRTArtificial SequenceFibronectin
x4 Linker (N-terminal Linker) amino acid sequence identified using
molecular biology techniques. 82Thr Gly Leu Asp Ser Pro Thr Gly Leu
Asp Ser Pro Thr Gly Leu Asp 1 5 10 15 Ser Pro Thr Gly Leu Asp Ser
Pro 20 83225PRTArtificial SequenceH2A IgG1 Fc amino acid sequence
identified using molecular biology techniques. 83Thr Ala Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35
40 45 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn 50 55 60 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val65 70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165
170 175 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys
180 185 190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 195 200 205 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly 210 215 220 Lys225 84225PRTArtificial SequenceT3P
IgG1 Fc amino acid sequence identified using molecular biology
techniques. 84Thr His Pro Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val Glu Val His Asn 50 55 60 Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65 70 75 80 Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 85 90 95 Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 100 105
110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu145 150 155 160 Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185 190 Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215 220
Lys225 8526PRTArtificial Sequence((GS(TVAAPSGS)x3)) Linker
(C-terminal Linker) amino acid sequence identified using molecular
biology techniques. 85Gly Ser Thr Val Ala Ala Pro Ser Gly Ser Thr
Val Ala Ala Pro Ser 1 5 10 15 Gly Ser Thr Val Ala Ala Pro Ser Gly
Ser 20 25 8618PRTArtificial SequenceFibronectin x3 Linker
(C-terminal Linker) amino acid sequence identified using molecular
biology techniques. 86Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp 1 5 10 15 Ser Pro8724PRTArtificial
SequenceFibronectin x4 Linker (C-terminal Linker) amino acid
sequence identified using molecular biology techniques. 87Thr Gly
Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp 1 5 10 15
Ser Pro Thr Gly Leu Asp Ser Pro 20 8819PRTHomo sapiens 88His Lys
Asp Asp Asn Pro Asn Leu Pro Arg Leu Val Arg Pro Glu Val 1 5 10 15
Asp Val Met 8921PRTHomo sapiens 89Glu Asn Asp Glu Met Pro Ala Asp
Leu Pro Ser Leu Ala Ala Asp Phe1 5 10 15 Val Glu Ser Lys Asp 20
9021PRTHomo sapiens 90Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe
Asn Ala Glu Thr Phe 1 5 10 15 Thr Phe His Ala Asp 20 9116PRTHomo
sapiens 91Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu
Thr Phe 1 5 10 15 9215PRTArtificial SequenceGly4Ser 3x Linker
(C-terminal Linker) amino acid sequence identified using molecular
biology techniques. 92Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser 1 5 10 15 9320PRTArtificial SequenceGly4Ser 4x
Linker (C-terminal Linker) amino acid sequence identified using
molecular biology techniques. 93Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly 1 5 10 15 Gly Gly Gly Ser 20
9440PRTHomo sapiens 94Lys Glu Ala Ala Ala Lys Glu Ala Ala Ala Lys
Glu Ala Ala Ala Lys 1 5 10 15 Glu Leu Ala Ala Lys Glu Ala Ala Ala
Lys Glu Ala Ala Ala Lys Glu 20 25 30 Ala Ala Ala Lys Glu Leu Ala
Ala 35 40 95348DNAArtificial SequenceDOM15-26-593 DAB nucleic acid
sequence identified using molecular biology techniques.
95gaggtgcagc tgttggtgtc tgggggaggc ttggtacagc ctggggggtc cctgcgtctc
60tcctgtgcag cctccggatt cacctttaag gcttatccga tgatgtgggt ccgccaggct
120ccagggaagg gtctagagtg ggtttcagag atttcgcctt cgggttctta
tacatactac 180gcagactccg tgaagggccg gttcaccatc tcccgcgaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgcg tgccgaggac
accgcggtat attactgtgc gaaagatcct 300cggaagttag actactgggg
tcagggaacc ctggtcaccg tctcgagc 34896348DNAArtificial
SequenceDOM15-26-597 DAB nucleic acid sequence identified using
molecular biology techniques. 96gaggtgcagc tgctggtgtc tggcggcgga
ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag
gcctacccca tgatgtgggt gcggcaggcc 120cctggcaagg gcctggaatg
ggtgtccgag atcagcccca gcggcagcaa cacctactac 180gccgacagcg
tgaagggccg gttcaccatc agccgggaca acagcaagaa caccctgtac
240ctgcagatga acagcctgcg ggccgaggac accgccgtgt actactgcgc
caaggacccc 300cggaagctgg actactgggg ccagggcacc ctggtgaccg tgagcagc
34897324DNAArtificial SequenceDT02-K-044-085 DAB nucleic acid
sequence identified using molecular biology techniques.
97gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc
60atcacttgcc gggcaagtca gtggattggt cctgagttaa agtggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctcatac gttcggccaa 300gggaccaagg tggaaatcaa acgt
32498324DNAArtificial SequenceDT02-K-044-232 DAB nucleic acid
sequence identified using molecular biology techniques.
98gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc
60atcacttgcc gggcaagtca gtggattggt cctgagttaa gttggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctgagac gttcggccaa 300gggaccaagg tggaaatcaa acgt
32499324DNAArtificial SequenceDT02-K-044-236 DAB nucleic acid
sequence identified using molecular biology techniques.
99gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga ccgtgtcacc
60atcacttgcc gggcaagtca gtggattggt cctgagttaa gttggtacca gcagaaacca
120gggaaagccc ctaagctcct gatctatcat ggttccattt tgcaaagtgg
ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac ttcactctca
ccatcagcag tctgcaacct 240gaagattttg ctacgtacta ctgtcaacag
tatatgtatt atcctaagac gttcggccaa 300gggaccaagg tggaaatcaa acgt
324100324DNAArtificial SequenceDT02-K-044-251 DAB nucleic acid
sequence identified using molecular biology techniques.
100gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa agtggtacca
gcagaaacca 120gggaaagccc ctaagctcct gatctatcat ggttccattt
tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc tgggacagac
ttcactctca ccatcagcag tctgcaacct 240gaagattttg ctacgtacta
ctgtcaacag tatatgtatt atcctgagac gttcggccaa 300gggaccaagg
tggaaatcaa acgt 324101324DNAArtificial SequenceDT02-K-044-255 DAB
nucleic acid sequence identified using molecular biology
techniques. 101gacatccaga tgacccagtc tccatcctcc ctgtctgcat
ctgtaggaga ccgtgtcacc 60atcacttgcc gggcaagtca gtggattggt cctgagttaa
agtggtacca gcagaaacca 120gggaaagccc ctaagctcct gatctatcat
ggttccattt tgcaaagtgg ggtcccatca 180cgtttcagtg gcagtggatc
tgggacagac ttcactctca ccatcagcag tctgcaacct 240gaagattttg
ctacgtacta ctgtcaacag tatatgtatt atcctaagac gttcggccaa
300gggaccaagg tggaaatcaa acgt 324102675DNAArtificial SequenceFc
IgG1 nucleic acid sequence identified using molecular biology
techniques. 102acccacacct gccccccctg ccctgccccc gagctgctgg
gaggccccag cgtgttcctg 60ttccccccca agcctaagga caccctgatg atcagcagaa
cccccgaggt gacctgtgtg 120gtggtggatg tgagccacga ggaccctgag
gtgaagttca actggtacgt ggacggcgtg 180gaggtgcaca atgccaagac
caagcccagg gaggagcagt acaacagcac ctaccgggtg 240gtgtccgtgc
tgaccgtgct gcaccaggat tggctgaacg gcaaggagta caagtgtaag
300gtgtccaaca aggccctgcc tgcccctatc gagaaaacca tcagcaaggc
caagggccag 360cccagagagc cccaggtgta caccctgccc cctagcagag
atgagctgac caagaaccag 420gtgtccctga cctgcctggt gaagggcttc
taccccagcg acatcgccgt ggagtgggag 480agcaacggcc agcccgagaa
caactacaag accacccccc ctgtgctgga cagcgatggc 540agcttcttcc
tgtacagcaa gctgaccgtg gacaagagca gatggcagca gggcaacgtg
600ttcagctgct ccgtgatgca cgaggccctg cacaatcact acacccagaa
gagcctgagc 660ctgtcccctg gcaag 675103116PRTArtificial
SequenceDOM15-26-593 DAB amino acid sequence identified using
molecular biology techniques. 103Glu Val Gln Leu Leu Val Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu
Ile Ser Pro Ser Gly Ser Tyr Thr Tyr Tyr Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln
Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 104116PRTArtificial
SequenceDOM15-26-597 DAB amino acid sequence identified using
molecular biology techniques. 104Glu Val Gln Leu Leu Val Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu
Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln
Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 105108PRTArtificial
SequenceDT02-K-044-085 DAB amino acid sequence identified using
molecular biology techniques. 105Asp Ile Gln Met Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr
Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His
Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr
Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg
100 105 106108PRTArtificial SequenceDT02-K-044-232 DAB amino acid
sequence identified using molecular biology techniques. 106Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20
25 30 Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu
Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
Gln Tyr Met Tyr Tyr Pro Glu 85 90 95 Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys Arg 100 105 107108PRTArtificial
SequenceDT02-K-044-236 DAB amino acid sequence identified using
molecular biology techniques. 107Asp Ile Gln Met Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Ser Trp Tyr
Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His
Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr
Pro Lys 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg
100 105 108108PRTArtificial SequenceDT02-K-044-251 DAB amino acid
sequence identified using molecular biology techniques. 108Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20
25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu
Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
Gln Tyr Met Tyr Tyr Pro Glu 85 90 95 Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys Arg 100 105 109108PRTArtificial
SequenceDT02-K-044-255 DAB amino acid sequence identified using
molecular biology techniques. 109Asp Ile Gln Met Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr
Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His
Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr
Pro Lys 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg
100 105 110225PRTArtificial SequenceFc IgG1 DAB amino acid sequence
identified using molecular biology techniques. 110Thr His Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35
40 45 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn 50 55 60 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val65 70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
165 170 175 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys 180 185 190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu 195 200 205 Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly 210 215 220 Lys225 1115PRTArtificial
SequenceDOM15-26-593 CDR1 amino acid sequence identified using
molecular biology techniques. 111Ala Tyr Pro Met Met1 5
11217PRTArtificial SequenceDOM15-26-593 CDR2 amino acid sequence
identified using molecular biology techniques. 112Glu Ile Ser Pro
Ser Gly Ser Tyr Thr Tyr Tyr Ala Asp Ser Val Lys 1 5 10 15
Gly1137PRTArtificial SequenceDOM15-26-593 CDR3 amino acid sequence
identified using molecular biology techniques. 113Asp Pro Arg Lys
Leu Asp Tyr1 5 1145PRTArtificial SequenceDOM15-26-597 CDR1 amino
acid sequence identified using molecular biology techniques. 114Ala
Tyr Pro Met Met1 5 11517PRTArtificial SequenceDOM15-26-597 CDR2
amino acid sequence identified using molecular biology techniques.
115Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val Lys
1 5 10 15 Gly1167PRTArtificial SequenceDOM15-26-597 CDR3 amino acid
sequence identified using molecular biology techniques. 116Asp Pro
Arg Lys Leu Asp Tyr1 5 11711PRTArtificial SequenceDT02-K-044-085
CDR1 amino acid sequence identified using molecular biology
techniques. 117Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys 1 5 10
1187PRTArtificial SequenceDT02-K-044-085 CDR2 amino acid sequence
identified using molecular biology techniques. 118His Gly Ser Ile
Leu Gln Ser1 5 1199PRTArtificial SequenceDT02-K-044-085 CDR3 amino
acid sequence identified using molecular biology techniques. 119Gln
Gln Tyr Met Tyr Tyr Pro His Thr1 5 12011PRTArtificial
SequenceDT02-K-044-232 CDR1 amino acid sequence identified using
molecular biology techniques. 120Arg Ala Ser Gln Trp Ile Gly Pro
Glu Leu Ser 1 5 10 1217PRTArtificial SequenceDT02-K-044-232 CDR2
amino acid sequence identified using molecular biology techniques.
121His Gly Ser Ile Leu Gln Ser1 5 1229PRTArtificial
SequenceDT02-K-044-232 CDR3 amino acid sequence identified using
molecular biology techniques. 122Gln Gln Tyr Met Tyr Tyr Pro Glu
Thr1 5 12311PRTArtificial SequenceDT02-K-044-236 CDR1 amino acid
sequence identified using molecular biology techniques. 123Arg Ala
Ser Gln Trp Ile Gly Pro Glu Leu Ser 1 5 10 1247PRTArtificial
SequenceDT02-K-044-236 CDR2 amino acid sequence identified using
molecular biology techniques. 124His Gly Ser Ile Leu Gln Ser1 5
1259PRTArtificial SequenceDT02-K-044-236 CDR3 amino acid sequence
identified using molecular biology techniques. 125Gln Gln Tyr Met
Tyr Tyr Pro Lys Thr1 5 12611PRTArtificial SequenceDT02-K-044-251
CDR1 amino acid sequence identified using molecular biology
techniques. 126Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys 1 5 10
1277PRTArtificial SequenceDT02-K-044-251 CDR2 amino acid sequence
identified using molecular biology techniques. 127His Gly Ser Ile
Leu Gln Ser1 5 1289PRTArtificial SequenceDT02-K-044-251 CDR3 amino
acid sequence identified using molecular biology techniques. 128Gln
Gln Tyr Met Tyr Tyr Pro Glu Thr1 5 12911PRTArtificial
SequenceDT02-K-044-255 CDR1 amino acid sequence identified using
molecular biology techniques. 129Arg Ala Ser Gln Trp Ile Gly Pro
Glu Leu Lys 1 5 10 1307PRTArtificial SequenceDT02-K-044-255 CDR2
amino acid sequence identified using molecular biology techniques.
130His Gly Ser Ile Leu Gln Ser1 5 1319PRTArtificial
SequenceDT02-K-044-255 CDR3 amino acid sequence identified using
molecular biology techniques. 131Gln Gln Tyr Met Tyr Tyr Pro Lys
Thr1 5 1321077DNAArtificial SequenceN-terminal Fc fusion of
DOM15-26-597 DAB ((TGLDSP)x3) nucleic acid sequence identified
using molecular biology techniques. 132gaggtgcagc tgctggtgtc
tggcggcgga ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg ccagcggctt
caccttcaag gcctacccta tgatgtgggt gcggcaggcc 120cctggtaagg
gcctggaatg ggtgtccgag atcagcccaa gcggcagcaa cacctactac
180gcagacagcg tgaagggccg gttcaccatc agccgggaca acagcaagaa
cacactgtac 240ctgcagatga acagcctgcg ggccgaggac accgcagtgt
actactgcgc caaggaccca 300cggaagctgg actactgggg tcagggcacc
ctggtgaccg tgagcagcac cggattagac 360agtcccacag gtctcgattc
acctactggc ttagactctc caacccacac ctgccccccc 420tgccctgccc
cagagctgct gggcggacct agcgtgttcc tgttcccacc aaagcctaag
480gacaccctga tgatcagcag aacccccgag gtgacctgtg tggtggtgga
tgtgagccac 540gaggaccctg aggtgaagtt caactggtac gtggacggcg
tggaggtgca caatgccaag 600accaagccca gggaggagca gtacaacagc
acctaccggg tggtgtccgt gctgaccgtg 660ctgcaccagg attggctgaa
cggcaaggag tacaagtgta aggtgtccaa caaggccctg 720cctgccccta
tcgagaaaac catcagcaag gccaagggcc agcccagaga gccccaggtg
780tacaccctgc cccctagcag aaatgagctg accaagaacc aggtgtccct
gacctgcctg 840gtgaagggct tctaccccag cgacatcgcc gtggagtggg
agagcaatgg ccagcccgag 900aacaactaca agaccacccc ccctgtgctg
gacagcgatg gcagcttctt cctgtacagc 960aagctgaccg tggacaagag
cagatggcag cagggcaacg tgttcagctg ctccgtgatg 1020cacgaggccc
tgcacaatca ctacacccag aagagcctga gcctgtcccc tggcaag
10771331077DNAArtificial SequenceN-terminal Fc fusion of
DOM15-26-597 DAB (TGLDSP)x3 T113P mutation Fc) nucleic acid
sequence identified using molecular biology techniques.
133gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcac gggtctggac
360agtccgactg gtttagattc acctacgggc ttggactccc caacccaccc
ttgccccccc 420tgccctgccc ccgagctgct gggaggcccc agcgtgttcc
tgttcccccc caagcctaag 480gacaccctga tgatcagcag gacccccgaa
gtgacctgcg tggtggtgga tgtgagccac 540gaggaccctg aagtgaagtt
caactggtac gtggacggcg tggaagtgca caacgccaag 600accaagccca
gagaggagca gtacaacagc acctaccgcg tggtgtctgt gctgaccgtg
660ctgcaccagg attggctgaa cggcaaggag tacaagtgca aagtgagcaa
caaggccctg 720cctgccccta tcgagaaaac catcagcaag gccaagggcc
agcctagaga gccccaggtc 780tacaccctgc ctccctccag agatgagctg
accaagaacc aggtgtccct gacctgtctg 840gtgaagggct tctaccccag
cgacatcgcc gtggagtggg agagcaacgg ccagcccgag 900aacaactaca
agaccacccc ccctgtgctg gacagcgatg gcagcttctt cctgtactcc
960aagctgaccg tggacaagag cagatggcag cagggcaacg tgttcagctg
cagcgtgatg 1020cacgaggccc tgcacaatca ctacacccag aagagcctga
gcctgtcccc cggcaag 10771341095DNAArtificial SequenceN-terminal Fc
fusion of DOM15-26-597 DAB (TGLDSP)x4 T113P mutation Fc) nucleic
acid sequence identified using molecular biology techniques.
134gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcac gggtctggac
360agtccgactg gtttagattc acctacgggc ttggactccc caaccggctt
agatagcccg 420acccaccctt gccccccctg ccctgccccc gagctgctgg
gaggccccag cgtgttcctg 480ttccccccca agcctaagga caccctgatg
atcagcagga cccccgaagt gacctgcgtg 540gtggtggatg tgagccacga
ggaccctgaa gtgaagttca actggtacgt ggacggcgtg 600gaagtgcaca
acgccaagac caagcccaga gaggagcagt acaacagcac ctaccgcgtg
660gtgtctgtgc tgaccgtgct gcaccaggat tggctgaacg gcaaggagta
caagtgcaaa 720gtgagcaaca aggccctgcc tgcccctatc gagaaaacca
tcagcaaggc caagggccag 780cctagagagc cccaggtcta caccctgcct
ccctccagag atgagctgac caagaaccag 840gtgtccctga cctgtctggt
gaagggcttc taccccagcg acatcgccgt ggagtgggag 900agcaacggcc
agcccgagaa caactacaag accacccccc ctgtgctgga cagcgatggc
960agcttcttcc tgtactccaa gctgaccgtg gacaagagca gatggcagca
gggcaacgtg 1020ttcagctgca gcgtgatgca cgaggccctg cacaatcact
acacccagaa gagcctgagc 1080ctgtcccccg gcaag 10951351419DNAArtificial
SequenceK-044-085 DAB N-(VEPKSSDK linker) & C-terminal
((TGLDSP)x4) nucleic acid sequence identified using molecular
biology techniques. 135gacatccaga tgacccagag ccccagcagc ctgagcgcct
ctgtgggaga cagggtgact 60atcacctgca gggccagcca gtggattggc cccgagctga
agtggtatca gcagaagccc 120ggcaaggccc ccaagctgct gatctaccac
ggcagcatcc tgcagtccgg cgtgcctagc 180aggttctcag gcagcggcag
cggcaccgac ttcaccctca ccatcagcag cctgcagccc 240gaggacttcg
ccacctacta ctgccagcag tatatgtact acccccacac cttcggccag
300ggcaccaagg tggagatcaa gagggtggag cctaagtctt ctgacaagac
ccacacctgc 360cccccctgcc ctgccccaga gctgctggga ggacccagcg
tgttcctgtt cccacccaag 420cctaaggaca ccctgatgat cagcagaacc
cccgaggtga cctgtgtggt ggtggatgtg 480agccacgagg accctgaggt
gaagttcaac tggtacgtgg acggcgtgga ggtgcacaat 540gccaagacca
agcccaggga ggagcagtac aacagcacct accgggtggt gtccgtgctg
600accgtgctgc accaggattg gctgaacggc aaggagtaca agtgtaaggt
gtccaacaag 660gccctgcctg cccctatcga gaaaaccatc agcaaggcca
agggccagcc cagagagccc 720caggtgtaca ccctgccccc tagcagagat
gagctgacca agaaccaggt gtccctgacc 780tgcctggtga agggcttcta
ccccagcgac atcgccgtgg agtgggagag caatggccag 840cccgagaaca
actacaagac caccccccct gtgctggaca gcgatggcag cttcttcctg
900tacagcaagc tgaccgtgga caagagcaga tggcagcagg gcaacgtgtt
cagctgctcc 960gtgatgcacg aggccctgca caatcactac acccagaaga
gcctgagcct gtcccctggc 1020aagaccggat tagacagtcc cacaggtctc
gattcaccta ctggcttaga ctctccaacc 1080ggcctggaca gccccgacat
ccagatgacc cagtctccat cctccctgtc tgcatctgta 1140ggagaccgtg
tcaccatcac ttgccgggca agtcagtgga ttggtcctga gttaaagtgg
1200taccagcaga aaccagggaa agcccctaag ctcctgatct atcatggttc
cattttgcaa 1260agtggggtcc catcacgttt cagtggcagt ggatctggga
cagacttcac tctcaccatc 1320agcagtctgc aacctgaaga ttttgctacg
tactactgtc aacagtatat gtattatcct 1380catacgttcg gccaagggac
caaggtggaa atcaaacgt 14191361401DNAArtificial SequenceK-044-085 DAB
N-(ASTHP linker) & C-terminal ((TGLDSP)x4) nucleic acid
sequence identified using molecular biology techniques.
136gacatccaga tgacccagag ccccagcagc ctgagcgcct ctgtgggaga
cagggtgact 60atcacctgca gggccagcca gtggattggc cccgagctga agtggtatca
gcagaagccc 120ggcaaggccc ccaagctgct gatctaccac ggcagcatcc
tgcagtccgg cgtgcctagc 180aggttctcag gcagcggcag cggcaccgac
ttcaccctca ccatcagcag cctgcagccc 240gaggacttcg ccacctacta
ctgccagcag tatatgtact acccccacac cttcggccag 300ggcaccaagg
tggagatcaa gagggctagc acccaccctt gccccccctg ccctgccccc
360gagctgctgg gaggccccag cgtgttcctg ttccccccca agcctaagga
caccctgatg 420atcagcagga cccccgaagt gacctgcgtg gtggtggatg
tgagccacga ggaccctgaa 480gtgaagttca actggtacgt ggacggcgtg
gaagtgcaca acgccaagac caagcccaga 540gaggagcagt acaacagcac
ctaccgcgtg gtgtctgtgc tgaccgtgct gcaccaggat 600tggctgaacg
gcaaggagta caagtgcaaa gtgagcaaca aggccctgcc tgcccctatc
660gagaaaacca tcagcaaggc caagggccag cctagagagc cccaggtcta
caccctgcct 720ccctccagag atgagctgac caagaaccag gtgtccctga
cctgtctggt gaagggcttc 780taccccagcg acatcgccgt ggagtgggag
agcaacggcc agcccgagaa caactacaag 840accacccccc ctgtgctgga
cagcgatggc agcttcttcc tgtactccaa gctgaccgtg 900gacaagagca
gatggcagca gggcaacgtg ttcagctgca gcgtgatgca cgaggccctg
960cacaatcact acacccagaa gagtctgagc ctgtcccctg gcaagaccgg
attagacagt 1020cccacaggtc tcgattcacc tactggctta gactctccaa
ccggcctgga cagccccgac 1080atccagatga cccagtctcc atcctccctg
tctgcatctg taggagaccg tgtcaccatc 1140acttgccggg caagtcagtg
gattggtcct gagttaaagt ggtaccagca gaaaccaggg 1200aaagccccta
agctcctgat ctatcatggt tccattttgc aaagtggggt cccatcacgt
1260ttcagtggca gtggatctgg gacagacttc actctcacca tcagcagtct
gcaacctgaa 1320gattttgcta cgtactactg tcaacagtat atgtattatc
ctcatacgtt cggccaaggg 1380accaaggtgg aaatcaaacg t
14011371473DNAArtificial SequenceDOM15-26-597 DAB N-((TGLDSP)x3)
& C-terminal K-044-085 DAB ((TGLDSP)x4) nucleic acid sequence
identified using molecular biology techniques. 137gaggtgcagc
tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg
ccagcggctt caccttcaag gcctacccca tgatgtgggt gcggcaggcc
120cctggcaagg gcctggaatg ggtgtccgag atcagcccca gcggcagcaa
cacctactac 180gccgacagcg tgaagggccg gttcaccatc agccgggaca
acagcaagaa caccctgtac 240ctgcagatga acagcctgcg ggccgaggac
accgccgtgt actactgcgc caaggacccc 300cggaagctgg actactgggg
ccagggcacc ctggtgaccg tgagcagcac gggtctggac 360agtccgactg
gtttagattc acctacgggc ttggactccc caacccacac ctgccccccc
420tgccctgccc ctgagctgct gggcggaccc agcgtgttcc tgttcccccc
caagcccaag 480gacaccctga tgatcagccg gacccccgag gtgacctgcg
tggtggtgga cgtgagccac 540gaggaccctg aggtgaagtt caattggtac
gtggacggcg tggaggtgca caacgccaag 600accaagcccc gggaggaaca
gtacaacagc acctaccggg tggtgtccgt gctgaccgtg 660ctgcaccagg
actggctgaa cggcaaagaa tacaagtgca aggtgtccaa caaggccctg
720cctgccccca tcgagaaaac catcagcaag gccaagggcc agcccaggga
accccaggtg 780tacaccctgc cccccagccg ggacgagctg accaagaacc
aggtgtccct gacctgcctg 840gtgaagggct tctaccccag cgacatcgcc
gtggagtggg agagcaacgg ccagcccgag 900aacaactaca agaccacccc
ccctgtgctg gacagcgacg gcagcttctt cctgtacagc 960aagctgaccg
tggacaagag ccggtggcag cagggcaacg tgttcagctg cagcgtgatg
1020cacgaggccc tgcacaacca ctacacccag aagagcctga gcctgtcccc
cggcaagacc 1080ggattagaca gtcccacagg tctcgattca cctactggct
tagactctcc aaccggcctg 1140gacagccccg acatccagat gacccagtct
ccatcctccc tgtctgcatc tgtaggagac 1200cgtgtcacca tcacttgccg
ggcaagtcag tggattggtc ctgagttaaa gtggtaccag 1260cagaaaccag
ggaaagcccc taagctcctg atctatcatg gttccatttt gcaaagtggg
1320gtcccatcac gtttcagtgg cagtggatct gggacagact tcactctcac
catcagcagt 1380ctgcaacctg aagattttgc tacgtactac tgtcaacagt
atatgtatta tcctcatacg 1440ttcggccaag ggaccaaggt ggaaatcaaa cgt
14731381443DNAArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB ((TGLDSP)x4) nucleic acid
sequence identified using molecular biology techniques.
138gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccta tgatgtgggt
gcggcaggcc 120cctggtaagg gcctggaatg ggtgtccgag atcagcccaa
gcggcagcaa cacctactac 180gcagacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa cacactgtac 240ctgcagatga acagcctgcg
ggccgaggac accgcagtgt actactgcgc caaggaccca 300cggaagctgg
actactgggg tcagggcacc ctggtgaccg tgagcagcgt ggagcctaag
360tcttctgaca agacccacac ctgcccaccc tgccctgccc cagagctgct
gggaggaccc 420agcgtgttcc tgttcccacc caagcctaag gacaccctga
tgatcagcag aacccccgag 480gtgacctgtg tggtggtgga tgtgagccac
gaggaccctg aggtgaagtt caactggtac 540gtggacggcg tggaggtgca
caatgccaag accaagccca gggaggagca gtacaacagc 600acctaccggg
tggtgtccgt gctgaccgtg ctgcaccagg attggctgaa cggcaaggag
660tacaagtgta aggtgtccaa caaggccctg cctgccccta tcgagaaaac
catcagcaag 720gccaagggcc agcccagaga gccccaggtg tacaccctgc
cccctagcag agatgagctg 780accaagaacc aggtgtccct gacctgcctg
gtgaagggct tctaccccag cgacatcgcc 840gtggagtggg agagcaatgg
ccagcccgag aacaactaca agaccacccc ccctgtgctg 900gacagcgatg
gcagcttctt cctgtacagc aagctgaccg tggacaagag cagatggcag
960cagggcaacg tgttcagctg ctccgtgatg cacgaggccc tgcacaatca
ctacacccag 1020aagagcctga gcctgtcccc tggcaagacc ggattagaca
gtcccacagg tctcgattca 1080cctactggct tagactctcc aaccggcctg
gacagccccg acatccagat gacccagtct 1140ccatcctccc tgtctgcatc
tgtaggagac cgtgtcacca tcacttgccg ggcaagtcag 1200tggattggtc
ctgagttaaa gtggtaccag cagaaaccag ggaaagcccc taagctcctg
1260atctatcatg gttccatttt gcaaagtggg gtcccatcac gtttcagtgg
cagtggatct 1320gggacagact tcactctcac catcagcagt ctgcaacctg
aagattttgc tacgtactac 1380tgtcaacagt atatgtatta tcctcatacg
ttcggccaag ggaccaaggt ggaaatcaaa 1440cgt 14431391425DNAArtificial
SequenceDMS1576 with C-terminal K-044-085 DAB ((TGLDSP)x4) nucleic
acid sequence identified using molecular biology techniques.
139gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcgc tagcacccac
360acctgccccc cctgccctgc ccctgagctg ctgggcggac ccagcgtgtt
cctgttcccc 420cccaagccca aggacaccct gatgatcagc cggacccccg
aggtgacctg cgtggtggtg 480gacgtgagcc acgaggaccc tgaggtgaag
ttcaattggt acgtggacgg cgtggaggtg 540cacaacgcca agaccaagcc
ccgggaggaa cagtacaaca gcacctaccg ggtggtgtcc 600gtgctgaccg
tgctgcacca ggactggctg aacggcaaag aatacaagtg caaggtgtcc
660aacaaggccc tgcctgcccc catcgagaaa accatcagca aggccaaggg
ccagcccagg 720gaaccccagg tgtacaccct gccccccagc cgggacgagc
tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg cttctacccc
agcgacatcg
ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta caagaccacc
ccccctgtgc tggacagcga cggcagcttc 900ttcctgtaca gcaagctgac
cgtggacaag agccggtggc agcagggcaa cgtgttcagc 960tgcagcgtga
tgcacgaggc cctgcacaac cactacaccc agaagagcct gagcctgtcc
1020cctggcaaga ccggattaga cagtcccaca ggtctcgatt cacctactgg
cttagactct 1080ccaaccggcc tggacagccc cgacatccag atgacccagt
ctccatcctc cctgtctgca 1140tctgtaggag accgtgtcac catcacttgc
cgggcaagtc agtggattgg tcctgagtta 1200aagtggtacc agcagaaacc
agggaaagcc cctaagctcc tgatctatca tggttccatt 1260ttgcaaagtg
gggtcccatc acgtttcagt ggcagtggat ctgggacaga cttcactctc
1320accatcagca gtctgcaacc tgaagatttt gctacgtact actgtcaaca
gtatatgtat 1380tatcctcata cgttcggcca agggaccaag gtggaaatca aacgt
14251401491DNAArtificial SequenceDOM15-26-597 DAB N-((TGLDSP)x4)
& C-terminal K-044-085 DAB ((TGLDSP)x4) nucleic acid sequence
identified using molecular biology techniques. 140gaggtgcagc
tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg
ccagcggctt caccttcaag gcctacccca tgatgtgggt gcggcaggcc
120cctggcaagg gcctggaatg ggtgtccgag atcagcccca gcggcagcaa
cacctactac 180gccgacagcg tgaagggccg gttcaccatc agccgggaca
acagcaagaa caccctgtac 240ctgcagatga acagcctgcg ggccgaggac
accgccgtgt actactgcgc caaggacccc 300cggaagctgg actactgggg
ccagggcacc ctggtgaccg tgagcagcac gggtctggac 360agtccgactg
gtttagattc acctacgggc ttggactccc caaccggctt agatagcccg
420acccacacct gccccccctg ccctgcccct gagctgctgg gcggacccag
cgtgttcctg 480ttccccccca agcccaagga caccctgatg atcagccgga
cccccgaggt gacctgcgtg 540gtggtggacg tgagccacga ggaccctgag
gtgaagttca attggtacgt ggacggcgtg 600gaggtgcaca acgccaagac
caagccccgg gaggaacagt acaacagcac ctaccgggtg 660gtgtccgtgc
tgaccgtgct gcaccaggac tggctgaacg gcaaagaata caagtgcaag
720gtgtccaaca aggccctgcc tgcccccatc gagaaaacca tcagcaaggc
caagggccag 780cccagggaac cccaggtgta caccctgccc cccagccggg
acgagctgac caagaaccag 840gtgtccctga cctgcctggt gaagggcttc
taccccagcg acatcgccgt ggagtgggag 900agcaacggcc agcccgagaa
caactacaag accacccccc ctgtgctgga cagcgacggc 960agcttcttcc
tgtacagcaa gctgaccgtg gacaagagcc ggtggcagca gggcaacgtg
1020ttcagctgca gcgtgatgca cgaggccctg cacaaccact acacccagaa
gagcctgagc 1080ctgtcccctg gcaagaccgg attagacagt cccacaggtc
tcgattcacc tactggctta 1140gactctccaa ccggcctgga cagccccgac
atccagatga cccagtctcc atcctccctg 1200tctgcatctg taggagaccg
tgtcaccatc acttgccggg caagtcagtg gattggtcct 1260gagttaaagt
ggtaccagca gaaaccaggg aaagccccta agctcctgat ctatcatggt
1320tccattttgc aaagtggggt cccatcacgt ttcagtggca gtggatctgg
gacagacttc 1380actctcacca tcagcagtct gcaacctgaa gattttgcta
cgtactactg tcaacagtat 1440atgtattatc ctcatacgtt cggccaaggg
accaaggtgg aaatcaaacg t 14911411473DNAArtificial
SequenceDOM15-26-597 DAB N-((TGLDSP)x3 T113P mutation Fc) &
C-terminal K-044-085 DAB ((TGLDSP)x4) nucleic acid sequence
identified using molecular biology techniques. 141gaggtgcagc
tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg
ccagcggctt caccttcaag gcctacccca tgatgtgggt gcggcaggcc
120cctggcaagg gcctggaatg ggtgtccgag atcagcccca gcggcagcaa
cacctactac 180gccgacagcg tgaagggccg gttcaccatc agccgggaca
acagcaagaa caccctgtac 240ctgcagatga acagcctgcg ggccgaggac
accgccgtgt actactgcgc caaggacccc 300cggaagctgg actactgggg
ccagggcacc ctggtgaccg tgagcagcac gggtctggac 360agtccgactg
gtttagattc acctacgggc ttggactccc caacccaccc ttgccccccc
420tgccctgccc ccgagctgct gggaggcccc agcgtgttcc tgttcccccc
caagcctaag 480gacaccctga tgatcagcag gacccccgaa gtgacctgcg
tggtggtgga tgtgagccac 540gaggaccctg aagtgaagtt caactggtac
gtggacggcg tggaagtgca caacgccaag 600accaagccca gagaggagca
gtacaacagc acctaccgcg tggtgtctgt gctgaccgtg 660ctgcaccagg
attggctgaa cggcaaggag tacaagtgca aagtgagcaa caaggccctg
720cctgccccta tcgagaaaac catcagcaag gccaagggcc agcctagaga
gccccaggtc 780tacaccctgc ctccctccag agatgagctg accaagaacc
aggtgtccct gacctgtctg 840gtgaagggct tctaccccag cgacatcgcc
gtggagtggg agagcaacgg ccagcccgag 900aacaactaca agaccacccc
ccctgtgctg gacagcgatg gcagcttctt cctgtactcc 960aagctgaccg
tggacaagag cagatggcag cagggcaacg tgttcagctg cagcgtgatg
1020cacgaggccc tgcacaatca ctacacccag aagagtctga gcctgtcccc
tggcaagacc 1080ggattagaca gtcccacagg tctcgattca cctactggct
tagactctcc aaccggcctg 1140gacagccccg acatccagat gacccagtct
ccatcctccc tgtctgcatc tgtaggagac 1200cgtgtcacca tcacttgccg
ggcaagtcag tggattggtc ctgagttaaa gtggtaccag 1260cagaaaccag
ggaaagcccc taagctcctg atctatcatg gttccatttt gcaaagtggg
1320gtcccatcac gtttcagtgg cagtggatct gggacagact tcactctcac
catcagcagt 1380ctgcaacctg aagattttgc tacgtactac tgtcaacagt
atatgtatta tcctcatacg 1440ttcggccaag ggaccaaggt ggaaatcaaa cgt
14731421491DNAArtificial SequenceDOM15-26-597 DAB N-((TGLDSP)x4
T113P mutation Fc) & C-terminal K-044-085 DAB ((TGLDSP)x4)
nucleic acid sequence identified using molecular biology
techniques. 142gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca
tgatgtgggt gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag
atcagcccca gcggcagcaa cacctactac 180gccgacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa caccctgtac 240ctgcagatga
acagcctgcg ggccgaggac accgccgtgt actactgcgc caaggacccc
300cggaagctgg actactgggg ccagggcacc ctggtgaccg tgagcagcac
gggtctggac 360agtccgactg gtttagattc acctacgggc ttggactccc
caaccggctt agatagcccg 420acccaccctt gccccccctg ccctgccccc
gagctgctgg gaggccccag cgtgttcctg 480ttccccccca agcctaagga
caccctgatg atcagcagga cccccgaagt gacctgcgtg 540gtggtggatg
tgagccacga ggaccctgaa gtgaagttca actggtacgt ggacggcgtg
600gaagtgcaca acgccaagac caagcccaga gaggagcagt acaacagcac
ctaccgcgtg 660gtgtctgtgc tgaccgtgct gcaccaggat tggctgaacg
gcaaggagta caagtgcaaa 720gtgagcaaca aggccctgcc tgcccctatc
gagaaaacca tcagcaaggc caagggccag 780cctagagagc cccaggtcta
caccctgcct ccctccagag atgagctgac caagaaccag 840gtgtccctga
cctgtctggt gaagggcttc taccccagcg acatcgccgt ggagtgggag
900agcaacggcc agcccgagaa caactacaag accacccccc ctgtgctgga
cagcgatggc 960agcttcttcc tgtactccaa gctgaccgtg gacaagagca
gatggcagca gggcaacgtg 1020ttcagctgca gcgtgatgca cgaggccctg
cacaatcact acacccagaa gagtctgagc 1080ctgtcccctg gcaagaccgg
attagacagt cccacaggtc tcgattcacc tactggctta 1140gactctccaa
ccggcctgga cagccccgac atccagatga cccagtctcc atcctccctg
1200tctgcatctg taggagaccg tgtcaccatc acttgccggg caagtcagtg
gattggtcct 1260gagttaaagt ggtaccagca gaaaccaggg aaagccccta
agctcctgat ctatcatggt 1320tccattttgc aaagtggggt cccatcacgt
ttcagtggca gtggatctgg gacagacttc 1380actctcacca tcagcagtct
gcaacctgaa gattttgcta cgtactactg tcaacagtat 1440atgtattatc
ctcatacgtt cggccaaggg accaaggtgg aaatcaaacg t
14911431419DNAArtificial SequenceK-044-085 DAB N-(VEPKSSDK linker)
& C-terminal ((TGLDSP)x4) Codon optimised nucleic acid sequence
identified using molecular biology techniques. 143gacatccaga
tgacccagag ccccagcagc ctgagcgcct ctgtgggaga cagggtgact 60atcacctgca
gggccagcca gtggattggc cccgagctga agtggtatca gcagaagccc
120ggcaaggccc ccaagctgct gatctaccac ggcagcatcc tgcagtccgg
cgtgcctagc 180aggttctcag gcagcggcag cggcaccgac ttcaccctca
ccatcagcag cctgcagccc 240gaggacttcg ccacctacta ctgccagcag
tatatgtact acccccacac cttcggccag 300ggcaccaagg tggagatcaa
gagggtggag cctaagtctt ctgacaagac ccacacctgc 360cccccctgcc
ctgccccaga gctgctggga ggacccagcg tgttcctgtt cccacccaag
420cctaaggaca ccctgatgat cagcagaacc cccgaggtga cctgtgtggt
ggtggatgtg 480agccacgagg accctgaggt gaagttcaac tggtacgtgg
acggcgtgga ggtgcacaat 540gccaagacca agcccaggga ggagcagtac
aacagcacct accgggtggt gtccgtgctg 600accgtgctgc accaggattg
gctgaacggc aaggagtaca agtgtaaggt gtccaacaag 660gccctgcctg
cccctatcga gaaaaccatc agcaaggcca agggccagcc cagagagccc
720caggtgtaca ccctgccccc tagcagagat gagctgacca agaaccaggt
gtccctgacc 780tgcctggtga agggcttcta ccccagcgac atcgccgtgg
agtgggagag caatggccag 840cccgagaaca actacaagac caccccccct
gtgctggaca gcgatggcag cttcttcctg 900tacagcaagc tgaccgtgga
caagagcaga tggcagcagg gcaacgtgtt cagctgctcc 960gtgatgcacg
aggccctgca caatcactac acccagaaga gcctgagcct gtcccctggc
1020aagaccggcc tcgacagccc cactggcctg gacagcccaa ccggactgga
ttctcccacc 1080ggcctggaca gccccgacat ccagatgacc cagagcccca
gcagcctgag cgccagcgtg 1140ggggacaggg tgactatcac ctgcagggcc
tcccagtgga ttggccccga gctgaagtgg 1200tatcagcaga agcccggcaa
ggcccccaag ctgctgatct accacggcag catcctgcag 1260agcggcgtgc
cctcaaggtt ctcaggcagc ggcagcggca ccgacttcac cctgaccatc
1320agcagcctgc agcccgagga cttcgccacc tactactgcc agcagtacat
gtactacccc 1380cacaccttcg gccagggcac caaggtggag atcaaaagg
14191441473DNAArtificial SequenceDOM15-26-597 DAB N-((TGLDSP)x3)
& C-terminal K-044-085 DAB ((TGLDSP)x4) Codon optimised nucleic
acid sequence identified using molecular biology techniques.
144gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcac gggtctggac
360agtccgactg gtttagattc acctacgggc ttggactccc caacccacac
ctgccccccc 420tgccctgccc ctgagctgct gggcggaccc agcgtgttcc
tgttcccccc caagcccaag 480gacaccctga tgatcagccg gacccccgag
gtgacctgcg tggtggtgga cgtgagccac 540gaggaccctg aggtgaagtt
caattggtac gtggacggcg tggaggtgca caacgccaag 600accaagcccc
gggaggaaca gtacaacagc acctaccggg tggtgtccgt gctgaccgtg
660ctgcaccagg actggctgaa cggcaaagaa tacaagtgca aggtgtccaa
caaggccctg 720cctgccccca tcgagaaaac catcagcaag gccaagggcc
agcccaggga accccaggtg 780tacaccctgc cccccagccg ggacgagctg
accaagaacc aggtgtccct gacctgcctg 840gtgaagggct tctaccccag
cgacatcgcc gtggagtggg agagcaacgg ccagcccgag 900aacaactaca
agaccacccc ccctgtgctg gacagcgacg gcagcttctt cctgtacagc
960aagctgaccg tggacaagag ccggtggcag cagggcaacg tgttcagctg
cagcgtgatg 1020cacgaggccc tgcacaacca ctacacccag aagagcctga
gcctgtcccc tggcaagacc 1080ggcctcgaca gccccactgg cctggacagc
ccaaccggac tggattctcc caccggcctg 1140gacagccccg acatccagat
gacccagagc cccagcagcc tgagcgccag cgtgggggac 1200agggtgacta
tcacctgcag ggcctcccag tggattggcc ccgagctgaa gtggtatcag
1260cagaagcccg gcaaggcccc caagctgctg atctaccacg gcagcatcct
gcagagcggc 1320gtgccctcaa ggttctcagg cagcggcagc ggcaccgact
tcaccctgac catcagcagc 1380ctgcagcccg aggacttcgc cacctactac
tgccagcagt acatgtacta cccccacacc 1440ttcggccagg gcaccaaggt
ggagatcaaa agg 14731451443DNAArtificial SequenceDOM15-26-597 DAB
N-(VEPKSSDK linker) & C-terminal K-044-085 DAB ((TGLDSP)x4)
Codon optimised nucleic acid sequence identified using molecular
biology techniques. 145gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccta
tgatgtgggt gcggcaggcc 120cctggtaagg gcctggaatg ggtgtccgag
atcagcccaa gcggcagcaa cacctactac 180gcagacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa cacactgtac 240ctgcagatga
acagcctgcg ggccgaggac accgcagtgt actactgcgc caaggaccca
300cggaagctgg actactgggg tcagggcacc ctggtgaccg tgagcagcgt
ggagcctaag 360tcttctgaca agacccacac ctgcccaccc tgccctgccc
cagagctgct gggaggaccc 420agcgtgttcc tgttcccacc caagcctaag
gacaccctga tgatcagcag aacccccgag 480gtgacctgtg tggtggtgga
tgtgagccac gaggaccctg aggtgaagtt caactggtac 540gtggacggcg
tggaggtgca caatgccaag accaagccca gggaggagca gtacaacagc
600acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg attggctgaa
cggcaaggag 660tacaagtgta aggtgtccaa caaggccctg cctgccccta
tcgagaaaac catcagcaag 720gccaagggcc agcccagaga gccccaggtg
tacaccctgc cccctagcag agatgagctg 780accaagaacc aggtgtccct
gacctgcctg gtgaagggct tctaccccag cgacatcgcc 840gtggagtggg
agagcaatgg ccagcccgag aacaactaca agaccacccc ccctgtgctg
900gacagcgatg gcagcttctt cctgtacagc aagctgaccg tggacaagag
cagatggcag 960cagggcaacg tgttcagctg ctccgtgatg cacgaggccc
tgcacaatca ctacacccag 1020aagagcctga gcctgtcccc tggcaagacc
ggcctcgaca gccccactgg cctggacagc 1080ccaaccggac tggattctcc
caccggcctg gacagccccg acatccagat gacccagagc 1140cccagcagcc
tgagcgccag cgtgggggac agggtgacta tcacctgcag ggcctcccag
1200tggattggcc ccgagctgaa gtggtatcag cagaagcccg gcaaggcccc
caagctgctg 1260atctaccacg gcagcatcct gcagagcggc gtgccctcaa
ggttctcagg cagcggcagc 1320ggcaccgact tcaccctgac catcagcagc
ctgcagcccg aggacttcgc cacctactac 1380tgccagcagt acatgtacta
cccccacacc ttcggccagg gcaccaaggt ggagatcaaa 1440agg
14431461425DNAArtificial SequenceDMS1576 with C-terminal K-044-085
DAB ((TGLDSP)x4) Codon optimised nucleic acid sequence identified
using molecular biology techniques. 146gaggtgcagc tgctggtgtc
tggcggcgga ctggtgcagc ctggcggcag cctgagactg 60agctgcgccg ccagcggctt
caccttcaag gcctacccca tgatgtgggt gcggcaggcc 120cctggcaagg
gcctggaatg ggtgtccgag atcagcccca gcggcagcaa cacctactac
180gccgacagcg tgaagggccg gttcaccatc agccgggaca acagcaagaa
caccctgtac 240ctgcagatga acagcctgcg ggccgaggac accgccgtgt
actactgcgc caaggacccc 300cggaagctgg actactgggg ccagggcacc
ctggtgaccg tgagcagcgc tagcacccac 360acctgccccc cctgccctgc
ccctgagctg ctgggcggac ccagcgtgtt cctgttcccc 420cccaagccca
aggacaccct gatgatcagc cggacccccg aggtgacctg cgtggtggtg
480gacgtgagcc acgaggaccc tgaggtgaag ttcaattggt acgtggacgg
cgtggaggtg 540cacaacgcca agaccaagcc ccgggaggaa cagtacaaca
gcacctaccg ggtggtgtcc 600gtgctgaccg tgctgcacca ggactggctg
aacggcaaag aatacaagtg caaggtgtcc 660aacaaggccc tgcctgcccc
catcgagaaa accatcagca aggccaaggg ccagcccagg 720gaaccccagg
tgtacaccct gccccccagc cgggacgagc tgaccaagaa ccaggtgtcc
780ctgacctgcc tggtgaaggg cttctacccc agcgacatcg ccgtggagtg
ggagagcaac 840ggccagcccg agaacaacta caagaccacc ccccctgtgc
tggacagcga cggcagcttc 900ttcctgtaca gcaagctgac cgtggacaag
agccggtggc agcagggcaa cgtgttcagc 960tgcagcgtga tgcacgaggc
cctgcacaac cactacaccc agaagagcct gagcctgtcc 1020cctggcaaga
ccggcctcga cagccccact ggcctggaca gcccaaccgg actggattct
1080cccaccggcc tggacagccc cgacatccag atgacccaga gccccagcag
cctgagcgcc 1140agcgtggggg acagggtgac tatcacctgc agggcctccc
agtggattgg ccccgagctg 1200aagtggtatc agcagaagcc cggcaaggcc
cccaagctgc tgatctacca cggcagcatc 1260ctgcagagcg gcgtgccctc
aaggttctca ggcagcggca gcggcaccga cttcaccctg 1320accatcagca
gcctgcagcc cgaggacttc gccacctact actgccagca gtacatgtac
1380tacccccaca ccttcggcca gggcaccaag gtggagatca aaagg
14251471440DNAArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB minus C-term R ((TGLDSP)x4)
Codon optimised nucleic acid sequence identified using molecular
biology techniques. 147gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccta
tgatgtgggt gcggcaggcc 120cctggtaagg gcctggaatg ggtgtccgag
atcagcccaa gcggcagcaa cacctactac 180gcagacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa cacactgtac 240ctgcagatga
acagcctgcg ggccgaggac accgcagtgt actactgcgc caaggaccca
300cggaagctgg actactgggg tcagggcacc ctggtgaccg tgagcagcgt
ggagcctaag 360tcttctgaca agacccacac ctgcccaccc tgccctgccc
cagagctgct gggaggaccc 420agcgtgttcc tgttcccacc caagcctaag
gacaccctga tgatcagcag aacccccgag 480gtgacctgtg tggtggtgga
tgtgagccac gaggaccctg aggtgaagtt caactggtac 540gtggacggcg
tggaggtgca caatgccaag accaagccca gggaggagca gtacaacagc
600acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg attggctgaa
cggcaaggag 660tacaagtgta aggtgtccaa caaggccctg cctgccccta
tcgagaaaac catcagcaag 720gccaagggcc agcccagaga gccccaggtg
tacaccctgc cccctagcag agatgagctg 780accaagaacc aggtgtccct
gacctgcctg gtgaagggct tctaccccag cgacatcgcc 840gtggagtggg
agagcaatgg ccagcccgag aacaactaca agaccacccc ccctgtgctg
900gacagcgatg gcagcttctt cctgtacagc aagctgaccg tggacaagag
cagatggcag 960cagggcaacg tgttcagctg ctccgtgatg cacgaggccc
tgcacaatca ctacacccag 1020aagagcctga gcctgtcccc tggcaagacc
ggcctcgaca gccccactgg cctggacagc 1080ccaaccggac tggattctcc
caccggcctg gacagccccg acatccagat gacccagagc 1140cccagcagcc
tgagcgccag cgtgggggac agggtgacta tcacctgcag ggcctcccag
1200tggattggcc ccgagctgaa gtggtatcag cagaagcccg gcaaggcccc
caagctgctg 1260atctaccacg gcagcatcct gcagagcggc gtgccctcaa
ggttctcagg cagcggcagc 1320ggcaccgact tcaccctgac catcagcagc
ctgcagcccg aggacttcgc cacctactac 1380tgccagcagt acatgtacta
cccccacacc ttcggccagg gcaccaaggt ggagatcaaa
14401481446DNAArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB + A ((TGLDSP)x4) Codon
optimised nucleic acid sequence identified using molecular biology
techniques. 148gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccta
tgatgtgggt gcggcaggcc 120cctggtaagg gcctggaatg ggtgtccgag
atcagcccaa gcggcagcaa cacctactac 180gcagacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa cacactgtac 240ctgcagatga
acagcctgcg ggccgaggac accgcagtgt actactgcgc caaggaccca
300cggaagctgg actactgggg tcagggcacc ctggtgaccg tgagcagcgt
ggagcctaag 360tcttctgaca agacccacac ctgcccaccc tgccctgccc
cagagctgct gggaggaccc 420agcgtgttcc tgttcccacc caagcctaag
gacaccctga tgatcagcag aacccccgag 480gtgacctgtg tggtggtgga
tgtgagccac gaggaccctg aggtgaagtt caactggtac 540gtggacggcg
tggaggtgca caatgccaag accaagccca gggaggagca gtacaacagc
600acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg attggctgaa
cggcaaggag 660tacaagtgta aggtgtccaa caaggccctg cctgccccta
tcgagaaaac catcagcaag 720gccaagggcc agcccagaga gccccaggtg
tacaccctgc cccctagcag agatgagctg 780accaagaacc aggtgtccct
gacctgcctg gtgaagggct tctaccccag cgacatcgcc 840gtggagtggg
agagcaatgg ccagcccgag aacaactaca agaccacccc ccctgtgctg
900gacagcgatg gcagcttctt cctgtacagc aagctgaccg tggacaagag
cagatggcag 960cagggcaacg tgttcagctg ctccgtgatg cacgaggccc
tgcacaatca ctacacccag 1020aagagcctga gcctgtcccc tggcaagacc
ggcctcgaca gccccactgg cctggacagc 1080ccaaccggac tggattctcc
caccggcctg gacagccccg acatccagat gacccagagc 1140cccagcagcc
tgagcgccag cgtgggggac agggtgacta tcacctgcag ggcctcccag
1200tggattggcc ccgagctgaa gtggtatcag cagaagcccg gcaaggcccc
caagctgctg 1260atctaccacg gcagcatcct gcagagcggc gtgccctcaa
ggttctcagg cagcggcagc 1320ggcaccgact tcaccctgac catcagcagc
ctgcagcccg aggacttcgc cacctactac 1380tgccagcagt acatgtacta
cccccacacc ttcggccagg gcaccaaggt ggagatcaaa 1440agggcc
14461491452DNAArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB +AAA ((TGLDSP)x4) Codon
optimised nucleic acid sequence identified using molecular biology
techniques. 149gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccta
tgatgtgggt gcggcaggcc 120cctggtaagg gcctggaatg ggtgtccgag
atcagcccaa gcggcagcaa cacctactac 180gcagacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa cacactgtac 240ctgcagatga
acagcctgcg ggccgaggac accgcagtgt actactgcgc caaggaccca
300cggaagctgg actactgggg tcagggcacc ctggtgaccg tgagcagcgt
ggagcctaag 360tcttctgaca agacccacac ctgcccaccc tgccctgccc
cagagctgct gggaggaccc 420agcgtgttcc tgttcccacc caagcctaag
gacaccctga tgatcagcag aacccccgag 480gtgacctgtg tggtggtgga
tgtgagccac gaggaccctg aggtgaagtt caactggtac 540gtggacggcg
tggaggtgca caatgccaag accaagccca gggaggagca gtacaacagc
600acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg attggctgaa
cggcaaggag 660tacaagtgta aggtgtccaa caaggccctg cctgccccta
tcgagaaaac catcagcaag 720gccaagggcc agcccagaga gccccaggtg
tacaccctgc cccctagcag agatgagctg 780accaagaacc aggtgtccct
gacctgcctg gtgaagggct tctaccccag cgacatcgcc 840gtggagtggg
agagcaatgg ccagcccgag aacaactaca agaccacccc ccctgtgctg
900gacagcgatg gcagcttctt cctgtacagc aagctgaccg tggacaagag
cagatggcag 960cagggcaacg tgttcagctg ctccgtgatg cacgaggccc
tgcacaatca ctacacccag 1020aagagcctga gcctgtcccc tggcaagacc
ggcctcgaca gccccactgg cctggacagc 1080ccaaccggac tggattctcc
caccggcctg gacagccccg acatccagat gacccagagc 1140cccagcagcc
tgagcgccag cgtgggggac agggtgacta tcacctgcag ggcctcccag
1200tggattggcc ccgagctgaa gtggtatcag cagaagcccg gcaaggcccc
caagctgctg 1260atctaccacg gcagcatcct gcagagcggc gtgccctcaa
ggttctcagg cagcggcagc 1320ggcaccgact tcaccctgac catcagcagc
ctgcagcccg aggacttcgc cacctactac 1380tgccagcagt acatgtacta
cccccacacc ttcggccagg gcaccaaggt ggagatcaaa 1440agggccgccg cc
14521501446DNAArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB +T ((TGLDSP)x4) Codon
optimised nucleic acid sequence identified using molecular biology
techniques. 150gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccta
tgatgtgggt gcggcaggcc 120cctggtaagg gcctggaatg ggtgtccgag
atcagcccaa gcggcagcaa cacctactac 180gcagacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa cacactgtac 240ctgcagatga
acagcctgcg ggccgaggac accgcagtgt actactgcgc caaggaccca
300cggaagctgg actactgggg tcagggcacc ctggtgaccg tgagcagcgt
ggagcctaag 360tcttctgaca agacccacac ctgcccaccc tgccctgccc
cagagctgct gggaggaccc 420agcgtgttcc tgttcccacc caagcctaag
gacaccctga tgatcagcag aacccccgag 480gtgacctgtg tggtggtgga
tgtgagccac gaggaccctg aggtgaagtt caactggtac 540gtggacggcg
tggaggtgca caatgccaag accaagccca gggaggagca gtacaacagc
600acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg attggctgaa
cggcaaggag 660tacaagtgta aggtgtccaa caaggccctg cctgccccta
tcgagaaaac catcagcaag 720gccaagggcc agcccagaga gccccaggtg
tacaccctgc cccctagcag agatgagctg 780accaagaacc aggtgtccct
gacctgcctg gtgaagggct tctaccccag cgacatcgcc 840gtggagtggg
agagcaatgg ccagcccgag aacaactaca agaccacccc ccctgtgctg
900gacagcgatg gcagcttctt cctgtacagc aagctgaccg tggacaagag
cagatggcag 960cagggcaacg tgttcagctg ctccgtgatg cacgaggccc
tgcacaatca ctacacccag 1020aagagcctga gcctgtcccc tggcaagacc
ggcctcgaca gccccactgg cctggacagc 1080ccaaccggac tggattctcc
caccggcctg gacagccccg acatccagat gacccagagc 1140cccagcagcc
tgagcgccag cgtgggggac agggtgacta tcacctgcag ggcctcccag
1200tggattggcc ccgagctgaa gtggtatcag cagaagcccg gcaaggcccc
caagctgctg 1260atctaccacg gcagcatcct gcagagcggc gtgccctcaa
ggttctcagg cagcggcagc 1320ggcaccgact tcaccctgac catcagcagc
ctgcagcccg aggacttcgc cacctactac 1380tgccagcagt acatgtacta
cccccacacc ttcggccagg gcaccaaggt ggagatcaaa 1440aggacc
14461511422DNAArtificial SequenceDMS1576 with C-terminal K-044-085
DAB minus C-term R ((TGLDSP)x4) Codon optimised nucleic acid
sequence identified using molecular biology techniques.
151gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcgc tagcacccac
360acctgccccc cctgccctgc ccctgagctg ctgggcggac ccagcgtgtt
cctgttcccc 420cccaagccca aggacaccct gatgatcagc cggacccccg
aggtgacctg cgtggtggtg 480gacgtgagcc acgaggaccc tgaggtgaag
ttcaattggt acgtggacgg cgtggaggtg 540cacaacgcca agaccaagcc
ccgggaggaa cagtacaaca gcacctaccg ggtggtgtcc 600gtgctgaccg
tgctgcacca ggactggctg aacggcaaag aatacaagtg caaggtgtcc
660aacaaggccc tgcctgcccc catcgagaaa accatcagca aggccaaggg
ccagcccagg 720gaaccccagg tgtacaccct gccccccagc cgggacgagc
tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg cttctacccc
agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta
caagaccacc ccccctgtgc tggacagcga cggcagcttc 900ttcctgtaca
gcaagctgac cgtggacaag agccggtggc agcagggcaa cgtgttcagc
960tgcagcgtga tgcacgaggc cctgcacaac cactacaccc agaagagcct
gagcctgtcc 1020cctggcaaga ccggcctcga cagccccact ggcctggaca
gcccaaccgg actggattct 1080cccaccggcc tggacagccc cgacatccag
atgacccaga gccccagcag cctgagcgcc 1140agcgtggggg acagggtgac
tatcacctgc agggcctccc agtggattgg ccccgagctg 1200aagtggtatc
agcagaagcc cggcaaggcc cccaagctgc tgatctacca cggcagcatc
1260ctgcagagcg gcgtgccctc aaggttctca ggcagcggca gcggcaccga
cttcaccctg 1320accatcagca gcctgcagcc cgaggacttc gccacctact
actgccagca gtacatgtac 1380tacccccaca ccttcggcca gggcaccaag
gtggagatca aa 14221521428DNAArtificial SequenceDMS1576 with
C-terminal K-044-085 DAB +A ((TGLDSP)x4) Codon optimised nucleic
acid sequence identified using molecular biology techniques.
152gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcgc tagcacccac
360acctgccccc cctgccctgc ccctgagctg ctgggcggac ccagcgtgtt
cctgttcccc 420cccaagccca aggacaccct gatgatcagc cggacccccg
aggtgacctg cgtggtggtg 480gacgtgagcc acgaggaccc tgaggtgaag
ttcaattggt acgtggacgg cgtggaggtg 540cacaacgcca agaccaagcc
ccgggaggaa cagtacaaca gcacctaccg ggtggtgtcc 600gtgctgaccg
tgctgcacca ggactggctg aacggcaaag aatacaagtg caaggtgtcc
660aacaaggccc tgcctgcccc catcgagaaa accatcagca aggccaaggg
ccagcccagg 720gaaccccagg tgtacaccct gccccccagc cgggacgagc
tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg cttctacccc
agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta
caagaccacc ccccctgtgc tggacagcga cggcagcttc 900ttcctgtaca
gcaagctgac cgtggacaag agccggtggc agcagggcaa cgtgttcagc
960tgcagcgtga tgcacgaggc cctgcacaac cactacaccc agaagagcct
gagcctgtcc 1020cctggcaaga ccggcctcga cagccccact ggcctggaca
gcccaaccgg actggattct 1080cccaccggcc tggacagccc cgacatccag
atgacccaga gccccagcag cctgagcgcc 1140agcgtggggg acagggtgac
tatcacctgc agggcctccc agtggattgg ccccgagctg 1200aagtggtatc
agcagaagcc cggcaaggcc cccaagctgc tgatctacca cggcagcatc
1260ctgcagagcg gcgtgccctc aaggttctca ggcagcggca gcggcaccga
cttcaccctg 1320accatcagca gcctgcagcc cgaggacttc gccacctact
actgccagca gtacatgtac 1380tacccccaca ccttcggcca gggcaccaag
gtggagatca aaagggcc 14281531434DNAArtificial SequenceDMS1576 with
C-terminal K-044-085 DAB +AAA ((TGLDSP)x4) Codon optimised nucleic
acid sequence identified using molecular biology techniques.
153gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc ctggcggcag
cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca tgatgtgggt
gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag atcagcccca
gcggcagcaa cacctactac 180gccgacagcg tgaagggccg gttcaccatc
agccgggaca acagcaagaa caccctgtac 240ctgcagatga acagcctgcg
ggccgaggac accgccgtgt actactgcgc caaggacccc 300cggaagctgg
actactgggg ccagggcacc ctggtgaccg tgagcagcgc tagcacccac
360acctgccccc cctgccctgc ccctgagctg ctgggcggac ccagcgtgtt
cctgttcccc 420cccaagccca aggacaccct gatgatcagc cggacccccg
aggtgacctg cgtggtggtg 480gacgtgagcc acgaggaccc tgaggtgaag
ttcaattggt acgtggacgg cgtggaggtg 540cacaacgcca agaccaagcc
ccgggaggaa cagtacaaca gcacctaccg ggtggtgtcc 600gtgctgaccg
tgctgcacca ggactggctg aacggcaaag aatacaagtg caaggtgtcc
660aacaaggccc tgcctgcccc catcgagaaa accatcagca aggccaaggg
ccagcccagg 720gaaccccagg tgtacaccct gccccccagc cgggacgagc
tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg cttctacccc
agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg agaacaacta
caagaccacc ccccctgtgc tggacagcga cggcagcttc 900ttcctgtaca
gcaagctgac cgtggacaag agccggtggc agcagggcaa cgtgttcagc
960tgcagcgtga tgcacgaggc cctgcacaac cactacaccc agaagagcct
gagcctgtcc 1020cctggcaaga ccggcctcga cagccccact ggcctggaca
gcccaaccgg actggattct 1080cccaccggcc tggacagccc cgacatccag
atgacccaga gccccagcag cctgagcgcc 1140agcgtggggg acagggtgac
tatcacctgc agggcctccc agtggattgg ccccgagctg 1200aagtggtatc
agcagaagcc cggcaaggcc cccaagctgc tgatctacca cggcagcatc
1260ctgcagagcg gcgtgccctc aaggttctca ggcagcggca gcggcaccga
cttcaccctg 1320accatcagca gcctgcagcc cgaggacttc gccacctact
actgccagca gtacatgtac 1380tacccccaca ccttcggcca gggcaccaag
gtggagatca aaagggccgc cgcc 14341541428DNAArtificial SequenceDMS1576
with C-terminal K-044-085 DAB +T ((TGLDSP)x4) Codon optimised
nucleic acid sequence identified using molecular biology
techniques. 154gaggtgcagc tgctggtgtc tggcggcgga ctggtgcagc
ctggcggcag cctgagactg 60agctgcgccg ccagcggctt caccttcaag gcctacccca
tgatgtgggt gcggcaggcc 120cctggcaagg gcctggaatg ggtgtccgag
atcagcccca gcggcagcaa cacctactac 180gccgacagcg tgaagggccg
gttcaccatc agccgggaca acagcaagaa caccctgtac 240ctgcagatga
acagcctgcg ggccgaggac accgccgtgt actactgcgc caaggacccc
300cggaagctgg actactgggg ccagggcacc ctggtgaccg tgagcagcgc
tagcacccac 360acctgccccc cctgccctgc ccctgagctg ctgggcggac
ccagcgtgtt cctgttcccc 420cccaagccca aggacaccct gatgatcagc
cggacccccg aggtgacctg cgtggtggtg 480gacgtgagcc acgaggaccc
tgaggtgaag ttcaattggt acgtggacgg cgtggaggtg 540cacaacgcca
agaccaagcc ccgggaggaa cagtacaaca gcacctaccg ggtggtgtcc
600gtgctgaccg tgctgcacca ggactggctg aacggcaaag aatacaagtg
caaggtgtcc 660aacaaggccc tgcctgcccc catcgagaaa accatcagca
aggccaaggg ccagcccagg 720gaaccccagg tgtacaccct gccccccagc
cgggacgagc tgaccaagaa ccaggtgtcc 780ctgacctgcc tggtgaaggg
cttctacccc agcgacatcg ccgtggagtg ggagagcaac 840ggccagcccg
agaacaacta caagaccacc ccccctgtgc tggacagcga cggcagcttc
900ttcctgtaca gcaagctgac cgtggacaag agccggtggc agcagggcaa
cgtgttcagc 960tgcagcgtga tgcacgaggc cctgcacaac cactacaccc
agaagagcct gagcctgtcc 1020cctggcaaga ccggcctcga cagccccact
ggcctggaca gcccaaccgg actggattct 1080cccaccggcc tggacagccc
cgacatccag atgacccaga gccccagcag cctgagcgcc 1140agcgtggggg
acagggtgac tatcacctgc agggcctccc agtggattgg ccccgagctg
1200aagtggtatc agcagaagcc cggcaaggcc cccaagctgc tgatctacca
cggcagcatc 1260ctgcagagcg gcgtgccctc aaggttctca ggcagcggca
gcggcaccga cttcaccctg 1320accatcagca gcctgcagcc cgaggacttc
gccacctact actgccagca gtacatgtac 1380tacccccaca ccttcggcca
gggcaccaag gtggagatca aaaggacc 1428155359PRTArtificial
SequenceN-terminal Fc fusion of DOM15-26-597 DAB ((TGLDSP)x3) amino
acid sequence identified using molecular biology techniques. 155Glu
Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr
20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr
Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys
Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser
Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly
Leu Asp Ser Pro Thr His Thr Cys Pro Pro Cys Pro Ala Pro 130 135 140
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys145
150 155 160 Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val 165 170 175 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp 180 185 190 Gly Val Glu Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr 195 200 205 Asn Ser Thr Tyr Arg Val Val Ser
Val Leu Thr Val Leu His Gln Asp 210 215 220 Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu225 230 235 240 Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 245 250 255 Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asn Glu Leu Thr Lys 260 265
270 Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
275 280 285 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys 290 295 300 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser305 310 315 320 Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser 325 330 335 Cys Ser Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser 340 345 350 Leu Ser Leu Ser Pro
Gly Lys 355 156365PRTArtificial SequenceN-terminal Fc fusion of
DOM15-26-597 DAB ((TGLDSP)x4) amino acid sequence identified using
molecular biology techniques. 156Glu Val Gln Leu Leu Val Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu
Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln
Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Thr Gly Leu Asp Ser Pro
Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly Leu Asp Ser Pro Thr Gly
Leu Asp Ser Pro Thr His Thr Cys 130 135 140 Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu145 150 155 160 Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 165 170 175 Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 180 185
190 Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
195 200 205 Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
Val Leu 210 215 220 Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys225 230 235 240 Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys 245 250 255 Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser 260 265 270 Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 275 280 285 Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 290 295 300 Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly305 310
315 320 Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln 325 330
335 Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
340 345 350 His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 355
360 365 157359PRTArtificial SequenceN-terminal Fc fusion of
DOM15-26-597 DAB ((TGLDSP)x3 T113P mutation Fc) amino acid sequence
identified using molecular biology techniques. 157Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Thr Gly Leu
Asp Ser Pro Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly Leu Asp Ser
Pro Thr His Pro Cys Pro Pro Cys Pro Ala Pro 130 135 140 Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys145 150 155 160
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 165
170 175 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp 180 185 190 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln Tyr 195 200 205 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp 210 215 220 Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu225 230 235 240 Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 245 250 255 Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 260 265 270 Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 275 280 285
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 290
295 300 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser305 310 315 320 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser 325 330 335 Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser 340 345 350 Leu Ser Leu Ser Pro Gly Lys 355
158365PRTArtificial SequenceN-terminal Fc fusion of DOM15-26-597
DAB ((TGLDSP)x4 T113P mutation Fc) amino acid sequence identified
using molecular biology techniques. 158Glu Val Gln Leu Leu Val Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly
Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly Leu Asp Ser Pro Thr
Gly Leu Asp Ser Pro Thr His Pro Cys 130 135 140 Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu145 150 155 160 Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 165 170 175
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 180
185 190 Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys 195 200 205 Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu 210 215 220 Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys225 230 235 240 Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys 245 250 255 Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 260 265 270 Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 275 280 285 Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 290 295 300
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly305
310 315 320 Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln 325 330 335 Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn 340 345 350 His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys 355 360 365 159349PRTArtificial SequenceN-terminal Fc
fusion of DOM15-26-597 DAB (IgG1 Hinge) amino acid sequence
identified using molecular biology techniques. 159Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Val Glu Pro
Lys Ser Ser Asp Lys Thr His Thr Cys 115 120 125 Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu 130 135 140 Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu145 150 155 160
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 165
170 175 Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys 180 185 190 Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu 195 200 205 Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys 210 215 220 Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys225 230 235 240 Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 245 250 255 Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 260 265 270 Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 275 280 285
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 290
295 300 Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln305 310 315 320 Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn 325 330 335 His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys 340 345 160350PRTArtificial SequenceN-terminal Fc
fusion of 15-26-597 DAB (IgG3 Hinge) amino acid sequence identified
using molecular biology techniques. 160Glu Val Gln Leu Leu Val Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly
Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Glu Leu Lys Thr Pro
Leu Gly Asp Thr Thr His Thr 115 120 125 Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe 130 135 140 Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro145 150 155 160 Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val 165 170 175
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 180
185 190 Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
Val 195 200 205 Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys 210 215 220 Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser225 230 235 240 Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro 245 250 255 Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val 260 265 270 Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly 275 280 285 Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp 290 295 300
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp305
310 315 320 Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu His 325 330 335 Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 340 345 350 161347PRTArtificial SequenceN-terminal Fc
fusion of 15-26-597 DAB (TVAAPS) amino acid sequence identified
using molecular biology techniques. 161Glu Val Gln Leu Leu Val Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly
Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Thr Val Ala Ala Pro
Ser Thr His Thr Cys Pro Pro 115 120 125 Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro 130 135 140 Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr145 150 155 160 Cys Val
Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 165 170 175
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 180
185 190 Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val 195 200 205 Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser 210 215 220 Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys225 230 235 240 Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp 245 250 255 Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe 260 265 270 Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 275 280 285 Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 290 295 300
Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly305
310 315 320 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr 325 330 335 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 340
345 162357PRTArtificial SequenceC-terminal Fc fusion of K-044-085
DAB ((TGLDSP)x4) amino acid sequence identified using molecular
biology techniques. 162Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60 Ala Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65 70 75 80 Val
Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 85 90
95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185 190 Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215
220 Lys Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly
Leu225 230 235 240 Asp Ser Pro Thr Gly Leu Asp Ser Pro Asp Ile Gln
Met Thr Gln Ser 245 250 255 Pro Ser Ser Leu Ser Ala Ser Val Gly Asp
Arg Val Thr Ile Thr Cys 260 265 270 Arg Ala Ser Gln Trp Ile Gly Pro
Glu Leu Lys Trp Tyr Gln Gln Lys 275 280 285 Pro Gly Lys Ala Pro Lys
Leu Leu Ile Tyr His Gly Ser Ile Leu Gln 290 295 300 Ser Gly Val Pro
Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe305 310 315 320 Thr
Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr 325 330
335 Cys Gln Gln Tyr Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys
340 345 350 Val Glu Ile Lys Arg 355 163373PRTArtificial
SequenceC-terminal Fc fusion of K-044-085 DAB (Helical Linker)
amino acid sequence identified using molecular biology techniques.
163Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60 Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65 70 75 80 Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 85 90 95
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 100
105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val
Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185 190 Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215 220
Lys Lys Glu Ala Ala Ala Lys Glu Ala Ala Ala Lys Glu Ala Ala Ala225
230 235 240 Lys Glu Leu Ala Ala Lys Glu Ala Ala Ala Lys Glu Ala Ala
Ala Lys 245 250 255 Glu Ala Ala Ala Lys Glu Leu Ala Ala Asp Ile Gln
Met Thr Gln Ser 260 265 270 Pro Ser Ser Leu Ser Ala Ser Val Gly Asp
Arg Val Thr Ile Thr Cys 275 280 285 Arg Ala Ser Gln Trp Ile Gly Pro
Glu Leu Lys Trp Tyr Gln Gln Lys 290 295 300 Pro Gly Lys Ala Pro Lys
Leu Leu Ile Tyr His Gly Ser Ile Leu Gln305 310 315 320 Ser Gly Val
Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 325 330 335 Thr
Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr 340 345
350 Cys Gln Gln Tyr Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys
355 360 365 Val Glu Ile Lys Arg 370 164341PRTArtificial
SequenceN-terminal Fc fusion of K-044-085 DAB (IgG1 Hinge) amino
acid sequence identified using molecular biology techniques. 164Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10
15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu
20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser
Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Tyr Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg Val Glu Pro Lys 100 105 110 Ser Ser Asp Lys
Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 115 120 125 Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 130 135 140
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val145
150 155 160 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val 165 170 175 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser 180 185 190 Thr Tyr Arg Val Val Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu 195 200 205 Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala 210 215 220 Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro225 230 235 240 Gln Val Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln 245 250 255 Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 260 265
270 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
275 280 285 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu 290 295 300 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser305 310 315 320 Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser 325 330 335 Leu Ser Pro Gly Lys 340
165335PRTArtificial SequenceN-terminal Fc fusion of K-044-085 DAB
(ASTHP linker) amino acid sequence identified using molecular
biology techniques. 165Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr Gln Gln Lys
Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His Gly Ser Ile
Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser
Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu
Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His 85 90
95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Ala Ser Thr His
100 105 110 Pro Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val 115 120 125 Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr 130 135 140 Pro Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro Glu145 150 155 160 Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys 165 170 175 Thr Lys Pro Arg Glu
Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 180 185 190 Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 195 200 205 Cys
Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile 210 215
220 Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro225 230 235 240 Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu 245 250 255 Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn 260 265 270 Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser 275 280 285 Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 290 295 300 Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu305 310 315 320 His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 330 335
166357PRTArtificial SequenceN-terminal Fc fusion of K-044-085 DAB
((TGLDSP)x4) amino acid sequence identified using molecular biology
techniques. 166Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln
Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe
Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His 85 90 95 Thr
Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Gly Leu Asp 100 105
110 Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly
115 120 125 Leu Asp Ser Pro Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu 130 135 140 Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr145 150 155 160 Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val 165 170 175 Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val 180 185 190 Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 195 200 205 Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 210 215 220 Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala225 230
235 240 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro 245 250 255 Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln 260 265 270 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala 275 280 285 Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr 290 295 300 Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu305 310 315 320 Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 325 330 335 Val Met
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 340 345 350
Leu Ser Pro Gly Lys 355 167339PRTArtificial SequenceN-terminal Fc
fusion of K-044-085 DAB (TVAAPS) amino acid sequence identified
using molecular biology techniques. 167Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr
His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
Arg Thr Val Ala Ala 100 105 110 Pro Ser Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly 115 120 125 Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met 130 135 140 Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His145 150 155 160 Glu Asp
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 165 170 175
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 180
185 190 Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly 195 200 205 Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile 210 215 220 Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val225 230 235 240 Tyr Thr Leu Pro Pro Ser Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser 245 250 255 Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 260 265 270 Trp Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 275 280 285 Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 290 295 300
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met305
310 315 320 His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser 325 330 335 Pro Gly Lys168351PRTArtificial
SequenceN-terminal Fc fusion of K-044-085 DAB ((TGLDSP)x3) amino
acid sequence identified using molecular biology techniques. 168Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10
15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu
20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser
Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Tyr Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg Thr Gly Leu Asp 100 105 110 Ser Pro Thr Gly
Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr His 115 120 125 Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 130 135 140
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr145
150 155 160 Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro Glu 165 170 175 Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys 180 185 190 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser 195 200 205 Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys 210 215 220 Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile225 230 235 240 Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 245 250 255 Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 260 265
270 Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
275 280 285 Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser 290 295 300 Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg305 310 315 320 Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu 325 330 335 His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 340 345 350 169342PRTArtificial
SequenceN-terminal Fc fusion of K-044-085 DAB (IgG3 Hinge) amino
acid sequence identified using molecular biology techniques. 169Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10
15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu
20 25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser
Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Tyr Met Tyr Tyr Pro His 85 90 95
Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Glu Leu Lys Thr 100
105 110 Pro Leu Gly Asp Thr Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu 115 120 125 Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp 130 135 140 Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp145 150 155 160 Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly 165 170 175 Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 180 185 190 Ser Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp 195 200 205 Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro 210 215 220
Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu225
230 235 240 Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn 245 250 255 Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile 260 265 270 Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr 275 280 285 Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys 290 295 300 Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys305 310 315 320 Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 325 330 335 Ser
Leu Ser Pro Gly Lys 340 170335PRTArtificial SequenceN-terminal Fc
fusion of K-044-085-AS-Fc (H112A) amino acid sequence identified
using molecular biology techniques. 170Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30 Leu Lys Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr
His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
Arg Ala Ser Thr Ala 100 105 110 Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val 115 120 125 Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr 130 135 140 Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu145 150 155 160 Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 165 170 175
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 180
185 190 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys 195 200 205 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile 210 215 220 Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro225 230 235 240 Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu 245 250 255 Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 260 265 270 Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 275 280 285 Asp Gly
Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 290 295 300
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu305
310 315 320 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 325 330 335 171351PRTArtificial SequenceC-terminal Fc fusion of
K-044-085 DAB ((TGLDSP)x3) amino acid sequence identified using
molecular biology techniques. 171Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65
70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185
190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
195 200 205 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly 210 215 220 Lys Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu225 230 235 240 Asp Ser Pro Asp Ile Gln Met Thr Gln
Ser Pro Ser Ser Leu Ser Ala 245 250 255 Ser Val Gly Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser Gln Trp Ile 260 265 270 Gly Pro Glu Leu Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys 275 280 285 Leu Leu Ile
Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg 290 295 300 Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser305 310
315 320 Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met
Tyr 325 330 335 Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
Lys Arg 340 345 350 172352PRTArtificial SequenceC-terminal Fc
fusion of K-044-085 DAB (Albumin Domain 1) amino acid sequence
identified using molecular biology techniques. 172Thr His Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35
40 45 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn 50 55 60 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val65 70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165
170 175 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys 180 185 190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met His Glu 195 200 205 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly 210 215 220 Lys His Lys Asp Asp Asn Pro Asn Leu
Pro Arg Leu Val Arg Pro Glu225 230 235 240 Val Asp Val Met Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser 245 250 255 Ala Ser Val Gly
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp 260 265 270 Ile Gly
Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro 275 280 285
Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser 290
295 300 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser305 310 315 320 Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Tyr Met 325 330 335 Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg 340 345 350 173354PRTArtificial
SequenceC-terminal Fc fusion of K-044-085 DAB (Albumin Domain 2)
amino acid sequence identified using molecular biology techniques.
173Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
1 5 10 15 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser 20 25 30 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp 35 40 45 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val Glu Val His Asn 50 55 60 Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val65 70 75 80 Val Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu 85 90 95 Tyr Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 100 105 110 Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 115 120 125
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 130
135 140 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu145 150 155 160 Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu 165 170 175 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys 180 185 190 Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215 220 Lys Glu Asn Asp
Glu Met Pro Ala Asp Leu Pro Ser Leu Ala Ala Asp225 230 235 240 Phe
Val Glu Ser Lys Asp Asp Ile Gln Met Thr Gln Ser Pro Ser Ser 245 250
255 Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser
260 265 270 Gln Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro
Gly Lys 275 280 285 Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu
Gln Ser Gly Val 290 295 300 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Thr305 310 315 320 Ile Ser Ser Leu Gln Pro Glu
Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 325 330 335 Tyr Met Tyr Tyr Pro
His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile 340 345 350 Lys
Arg174349PRTArtificial SequenceC-terminal Fc fusion of K-044-085
DAB (Albumin Domain 3-TFHAD) amino acid sequence identified using
molecular biology techniques. 174Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65
70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185
190 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
195 200 205 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly 210 215 220 Lys Glu Val Asp Glu Thr Tyr Val Pro Lys Glu Phe
Asn Ala Glu Thr225 230 235 240 Phe Asp Ile Gln Met Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val 245 250 255 Gly Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser Gln Trp Ile Gly Pro 260 265 270 Glu Leu Lys Trp Tyr
Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu 275 280 285 Ile Tyr His
Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser 290 295 300 Gly
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln305 310
315 320 Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr
Pro 325 330 335 His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg
340 345 175348PRTArtificial SequenceC-terminal Fc fusion of
K-044-085 DAB ((Gly4Ser)x3) amino acid sequence identified using
molecular biology techniques. 175Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65
70 75 80 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu 85 90 95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys 100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185
190 Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215
220 Lys Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser225 230 235 240 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser
Ala Ser Val Gly 245 250 255 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser
Gln Trp Ile Gly Pro Glu 260 265 270 Leu Lys Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 275 280 285 Tyr His Gly Ser Ile Leu
Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 290 295 300 Ser Gly Ser Gly
Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro305 310 315 320 Glu
Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His 325 330
335 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg 340 345
176353PRTArtificial SequenceC-terminal Fc fusion of K-044-085 DAB
((Gly4Ser)x4) amino acid sequence identified using molecular
biology techniques. 176Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro 1 5 10 15 Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser 20 25 30 Arg Thr Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp 35 40 45 Pro Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 50 55 60 Ala Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val65 70 75 80 Val
Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 85 90
95 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
100 105 110 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr 115 120 125 Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr 130 135 140 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu145 150 155 160 Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu 165 170 175 Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 180 185 190 Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 195 200 205 Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 210 215
220 Lys Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser225 230 235 240 Gly Gly Gly Gly Ser Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu 245 250 255 Ser Ala Ser Val Gly Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln 260 265 270 Trp Ile Gly Pro Glu Leu Lys Trp
Tyr Gln Gln Lys Pro Gly Lys Ala 275 280 285 Pro Lys Leu Leu Ile Tyr
His Gly Ser Ile Leu Gln Ser Gly Val Pro 290 295 300 Ser Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile305 310 315 320 Ser
Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr 325 330
335 Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
340 345 350 Arg177473PRTArtificial SequenceK-044-085 DAB
N-(VEPKSSDK linker) & C-terminal ((TGLDSP)x4) amino acid
sequence identified using molecular biology techniques. 177Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20
25 30 Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu
Ile 35 40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln
Gln Tyr Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys Arg Val Glu Pro Lys 100 105 110 Ser Ser Asp Lys Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 115 120 125 Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 130 135 140 Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val145 150
155 160 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val 165 170 175 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser 180 185 190 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu 195 200 205 Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala 210 215 220 Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro225 230 235 240 Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln 245 250 255 Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 260 265 270
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 275
280 285 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu 290 295 300 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser305 310 315 320 Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser 325 330 335 Leu Ser Pro Gly Lys Thr Gly Leu
Asp Ser Pro Thr Gly Leu Asp Ser 340 345 350 Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser Pro Asp Ile Gln 355 360 365 Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val 370 375 380 Thr Ile
Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu Lys Trp385 390 395
400 Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr His Gly
405 410 415 Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser
Gly Ser 420 425 430 Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro Glu Asp Phe 435 440 445 Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro His Thr Phe Gly 450 455 460 Gln Gly Thr Lys Val Glu Ile Lys
Arg465 470 178467PRTArtificial SequenceK-044-085 DAB N-(ASTHP
linker) & C-terminal ((TGLDSP)x4) amino acid sequence
identified using molecular biology techniques. 178Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu 20 25 30
Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr
Met Tyr Tyr Pro His 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys Arg Ala Ser Thr His 100 105 110 Pro Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 115 120 125 Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 130 135 140 Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu145 150 155 160
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 165
170 175 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser 180 185 190 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys 195 200 205 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile 210 215 220 Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro225 230 235 240 Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 245 250 255 Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 260 265 270 Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 275 280 285
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 290
295 300 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu305 310 315 320 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys Thr 325 330 335 Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser 340 345 350 Pro Thr Gly Leu Asp Ser Pro Asp
Ile Gln Met Thr Gln Ser Pro Ser 355 360 365 Ser Leu Ser Ala Ser Val
Gly Asp Arg Val Thr Ile Thr Cys Arg Ala 370 375 380 Ser Gln Trp Ile
Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly385 390 395 400 Lys
Ala Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly 405 410
415 Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
420 425 430 Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr
Cys Gln 435 440 445 Gln Tyr Met Tyr Tyr Pro His Thr Phe Gly Gln Gly
Thr Lys Val Glu 450 455 460 Ile Lys Arg465 179491PRTArtificial
SequenceDOM15-26-597 DAB N-((TGLDSP)x3) & C-terminal K-044-085
DAB ((TGLDSP)x4) amino acid sequence identified using molecular
biology techniques. 179Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro
Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val
100 105 110 Thr Val Ser Ser Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp
Ser Pro 115 120 125 Thr Gly Leu Asp Ser Pro Thr His Thr Cys Pro Pro
Cys Pro Ala Pro 130 135 140 Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys145 150 155 160 Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 165 170 175 Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 180 185 190 Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr 195 200 205 Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp 210 215
220 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu225 230 235 240 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg 245 250 255 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys 260 265 270 Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp 275 280 285 Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 290 295 300 Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser305 310 315 320 Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 325 330
335 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
340 345 350 Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu Asp Ser Pro Thr
Gly Leu 355 360 365 Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu
Asp Ser Pro Asp 370 375 380 Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
Ser Ala Ser Val Gly Asp385 390 395 400 Arg Val Thr Ile Thr Cys Arg
Ala Ser Gln Trp Ile Gly Pro Glu Leu 405 410 415 Lys Trp Tyr Gln Gln
Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr 420 425 430 His Gly Ser
Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser 435 440 445 Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu 450 455
460 Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His
Thr465 470 475 480 Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg 485
490 180481PRTArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB ((TGLDSP)x4) amino acid
sequence identified using molecular biology techniques. 180Glu Val
Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20
25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu
Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Val
Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys 115 120 125 Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu 130 135 140 Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu145 150
155 160 Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val
Lys 165 170 175 Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys 180 185 190 Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val Val Ser Val Leu 195 200 205 Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys 210 215 220 Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr Ile Ser Lys225 230 235 240 Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 245 250 255 Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys 260 265 270 Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln 275 280 285 Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 290 295 300 Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln305 310 315 320 Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 325 330
335 His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu
340 345 350 Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr 355 360 365 Gly Leu Asp Ser Pro Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu 370 375 380 Ser Ala Ser Val Gly Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln385 390 395 400 Trp Ile Gly Pro Glu Leu Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala 405 410 415 Pro Lys Leu Leu Ile
Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro 420 425 430 Ser Arg Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 435 440 445 Ser
Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr 450 455
460 Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
Lys465 470 475 480 Arg181475PRTArtificial SequenceDMS1576 with
C-terminal K-044-085 DAB ((TGLDSP)x4) amino acid sequence
identified using molecular biology techniques. 181Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Ala Ser Thr
His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140 Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145 150 155 160
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 165
170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265 270 Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 275 280 285
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 290
295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu
Asp Ser Pro Thr Gly Leu 340 345 350 Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser Pro Asp 355 360 365 Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly Asp 370 375 380 Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu385 390 395 400 Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr 405 410
415 His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser
420 425 430 Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro Glu 435 440 445 Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro His Thr 450 455 460 Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
Arg465 470 475 182497PRTArtificial SequenceDOM15-26-597 DAB
N-((TGLDSP)x4) & C-terminal K-044-085 DAB ((TGLDSP)x4) amino
acid sequence identified using molecular biology techniques. 182Glu
Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr
20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr
Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys
Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser
Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly
Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr His Thr Cys 130 135 140
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu145
150 155 160 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu 165 170 175 Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro Glu Val Lys 180 185 190 Phe Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys 195 200 205 Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu 210 215 220 Thr Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys225 230 235 240 Val Ser Asn
Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 245 250 255 Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 260 265
270 Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
275 280 285 Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly Gln 290 295 300 Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly305 310 315 320 Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln 325 330 335 Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn 340 345 350 His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu 355 360 365 Asp Ser Pro
Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr 370 375 380 Gly
Leu Asp Ser Pro Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu385 390
395 400 Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser
Gln 405 410 415 Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro
Gly Lys Ala 420 425 430 Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu
Gln Ser Gly Val Pro 435 440 445 Ser Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Thr Ile 450 455 460 Ser Ser Leu Gln Pro Glu Asp
Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr465 470 475 480 Met Tyr Tyr Pro
His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 485 490 495
Arg183491PRTArtificial SequenceDOM15-26-597 DAB N-((TGLDSP)x3 T113P
mutation Fc) & C-terminal K-044-085 DAB ((TGLDSP)x4) amino acid
sequence identified using molecular biology techniques. 183Glu Val
Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20
25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu
Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Thr
Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly Leu
Asp Ser Pro Thr His Pro Cys Pro Pro Cys Pro Ala Pro 130 135 140 Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys145 150
155 160 Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val 165 170 175 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp 180 185 190 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr 195 200 205 Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp 210 215 220 Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu225 230 235 240 Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 245 250 255 Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 260 265 270
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 275
280 285 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys 290 295 300 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser305 310 315 320 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser 325 330 335 Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser 340 345 350 Leu Ser Leu Ser Pro Gly
Lys Thr Gly Leu Asp Ser Pro Thr Gly Leu 355 360 365 Asp Ser Pro Thr
Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Asp 370 375 380 Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp385 390 395
400 Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu
405 410 415 Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu
Ile Tyr 420 425 430 His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly Ser 435 440 445 Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro Glu 450 455 460 Asp Phe Ala Thr Tyr Tyr Cys Gln
Gln Tyr Met Tyr Tyr Pro His Thr465 470 475 480 Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg 485 490 184497PRTArtificial
SequenceDOM15-26-597 DAB N-((TGLDSP)x4 T113P mutation Fc) &
C-terminal K-044-085 DAB ((TGLDSP)x4) amino acid sequence
identified using molecular biology techniques. 184Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Thr Gly Leu
Asp Ser Pro Thr Gly Leu Asp Ser Pro 115 120 125 Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser Pro Thr His Pro Cys 130 135 140 Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu145 150 155 160
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 165
170 175 Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val
Lys 180 185 190 Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys 195 200 205 Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val Val Ser Val Leu 210 215 220 Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys225 230 235 240 Val Ser Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 245 250 255 Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 260 265 270 Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 275 280 285
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 290
295 300 Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly305 310 315 320 Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln 325 330 335 Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn 340 345 350 His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys Thr Gly Leu 355 360 365 Asp Ser Pro Thr Gly Leu
Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr 370 375 380 Gly Leu Asp Ser
Pro Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu385 390 395 400 Ser
Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln 405 410
415 Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala
420 425 430 Pro Lys Leu Leu Ile Tyr His Gly Ser Ile Leu Gln Ser Gly
Val Pro 435 440 445 Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile 450 455 460 Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr
Tyr Tyr Cys Gln Gln Tyr465 470 475 480 Met Tyr Tyr Pro His Thr Phe
Gly Gln Gly Thr Lys Val Glu Ile Lys 485 490 495
Arg185480PRTArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK linker)
& C-terminal K-044-085 DAB minus C-term R ((TGLDSP)x4) Codon
optimised amino acid sequence identified using molecular biology
techniques. 185Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val
Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser
Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln
Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95
Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100
105 110 Thr Val Ser Ser Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr
Cys 115 120 125 Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu 130 135 140 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu145 150 155 160 Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro Glu Val Lys 165 170 175 Phe Asn Trp Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys 180 185 190 Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu 195 200 205 Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 210 215 220
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys225
230 235 240 Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser 245 250 255 Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys 260 265 270 Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln 275 280 285 Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly 290 295 300 Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln305 310 315 320 Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 325 330 335 His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu 340 345
350 Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr
355 360 365 Gly Leu Asp Ser Pro Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu 370 375 380 Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln385 390 395 400 Trp Ile Gly Pro Glu Leu Lys Trp Tyr
Gln Gln Lys Pro Gly Lys Ala 405 410 415 Pro Lys Leu Leu Ile Tyr His
Gly Ser Ile Leu Gln Ser Gly Val Pro 420 425 430 Ser Arg Phe Ser Gly
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 435 440 445 Ser Ser Leu
Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr 450 455 460 Met
Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys465 470
475 480 186482PRTArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB + A ((TGLDSP)x4) Codon
optimised amino acid sequence identified using molecular biology
techniques. 186Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly
Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala
Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105
110 Thr Val Ser Ser Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys
115 120 125 Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val
Phe Leu 130 135 140 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu145 150 155 160 Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro Glu Val Lys 165 170 175 Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys Thr Lys 180 185 190 Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu 195 200 205 Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 210 215 220 Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys225 230
235 240 Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser 245 250 255 Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val Lys 260 265 270 Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln 275 280 285 Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly 290 295 300 Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln305 310 315 320 Gln Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 325 330 335 His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu 340 345 350
Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr 355
360 365 Gly Leu Asp Ser Pro Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu 370 375 380 Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg
Ala Ser Gln385 390 395 400 Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln
Gln Lys Pro Gly Lys Ala 405 410 415 Pro Lys Leu Leu Ile Tyr His Gly
Ser Ile Leu Gln Ser Gly Val Pro 420 425 430 Ser Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 435 440 445 Ser Ser Leu Gln
Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr 450 455 460 Met Tyr
Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys465 470 475
480 Arg Ala187484PRTArtificial SequenceDOM15-26-597 DAB N-(VEPKSSDK
linker) & C-terminal K-044-085 DAB +AAA ((TGLDSP)x4) Codon
optimised amino acid sequence identified using molecular biology
techniques. 187Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly
Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala
Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105
110 Thr Val Ser Ser Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys
115 120 125 Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val
Phe Leu 130 135 140 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu145 150 155 160 Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro Glu Val Lys 165 170 175 Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys Thr Lys 180 185 190 Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu 195 200 205 Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 210 215 220 Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys225 230
235 240 Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser 245 250 255 Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val Lys 260 265 270 Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln 275 280 285 Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly 290 295 300 Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln305 310 315 320 Gln Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 325 330 335 His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu 340 345 350
Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr 355
360 365 Gly Leu Asp Ser Pro Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu 370 375 380 Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg
Ala Ser Gln385 390 395 400 Trp Ile Gly Pro Glu Leu Lys Trp Tyr Gln
Gln Lys Pro Gly Lys Ala 405 410 415 Pro Lys Leu Leu Ile Tyr His Gly
Ser Ile Leu Gln Ser Gly Val Pro 420 425 430 Ser Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 435 440 445 Ser Ser Leu Gln
Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr 450 455 460 Met Tyr
Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys465 470 475
480 Arg Ala Ala Ala188482PRTArtificial SequenceDOM15-26-597 DAB
N-(VEPKSSDK linker) & C-terminal K-044-085 DAB +T ((TGLDSP)x4)
Codon optimised amino acid sequence identified using molecular
biology techniques. 188Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro
Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val
100 105 110 Thr Val Ser Ser Val Glu Pro Lys Ser Ser Asp Lys Thr His
Thr Cys 115 120 125 Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu 130 135 140 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu145 150 155 160 Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys 165 170 175 Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 180 185 190 Pro Arg Glu
Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu 195 200 205 Thr
Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 210 215
220 Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys225 230 235 240 Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser 245 250 255 Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys 260 265 270 Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln 275 280 285 Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 290 295 300 Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln305 310 315 320 Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 325 330
335 His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu
340 345 350 Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr 355 360 365 Gly Leu Asp Ser Pro Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu 370 375 380 Ser Ala Ser Val Gly Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln385 390 395 400 Trp Ile Gly Pro Glu Leu Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala 405 410 415 Pro Lys Leu Leu Ile
Tyr His Gly Ser Ile Leu Gln Ser Gly Val Pro 420 425 430 Ser Arg Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 435 440 445 Ser
Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr 450 455
460 Met Tyr Tyr Pro His Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
Lys465 470 475 480 Arg Thr189474PRTArtificial SequenceDMS1576 with
C-terminal K-044-085 DAB minus C-term R ((TGLDSP)x4) Codon
optimised amino acid sequence identified using molecular biology
techniques. 189Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly
Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala
Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105
110 Thr Val Ser Ser Ala Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro
115 120 125 Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys 130 135 140 Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val145 150 155 160 Asp Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp 165 170 175 Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr 180 185 190 Asn Ser Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp 195 200 205 Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 210 215 220 Pro
Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg225 230
235 240 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys 245 250 255 Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp 260 265 270 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys 275 280 285 Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 290 295
300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu
Asp Ser Pro Thr Gly Leu 340 345 350 Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser Pro Asp 355 360 365 Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly Asp 370 375 380 Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu385 390 395 400 Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr 405 410
415 His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser
420 425 430 Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro Glu 435 440 445 Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro His Thr 450 455 460 Phe Gly Gln Gly Thr Lys Val Glu Ile
Lys465 470 190476PRTArtificial SequenceDMS1576 with C-terminal
K-044-085 DAB +A ((TGLDSP)x4) Codon optimised amino acid sequence
identified using molecular biology techniques. 190Glu Val Gln Leu
Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr 20 25 30
Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr Ala Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Ala Ser Thr
His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140 Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145 150 155 160
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 165
170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265 270 Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 275 280 285
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 290
295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys Thr Gly Leu
Asp Ser Pro Thr Gly Leu 340 345 350 Asp Ser Pro Thr Gly Leu Asp Ser
Pro Thr Gly Leu Asp Ser Pro Asp 355 360 365 Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly Asp 370 375 380 Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu385 390 395 400 Lys
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr 405 410
415 His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser
420 425 430 Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro Glu 435 440 445 Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Met Tyr
Tyr Pro His Thr 450 455 460 Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
Arg Ala465 470 475 191478PRTArtificial SequenceDMS1576 with
C-terminal K-044-085 DAB +AAA ((TGLDSP)x4) Codon optimised amino
acid sequence identified using molecular biology techniques. 191Glu
Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Lys Ala Tyr
20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly Ser Asn Thr Tyr Tyr
Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Pro Arg Lys
Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser
Ala Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro 115 120 125 Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 130 135 140
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val145
150 155 160 Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp 165 170 175 Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr 180 185 190 Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln Asp 195 200 205 Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu 210 215 220 Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg225 230 235 240 Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 245 250 255 Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 260 265
270 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
275 280 285 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser 290 295 300 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser305 310 315 320 Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln Lys Ser 325 330 335 Leu Ser Leu Ser Pro Gly Lys
Thr Gly Leu Asp Ser Pro Thr Gly Leu 340 345 350 Asp Ser Pro Thr Gly
Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Asp 355 360 365 Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp 370 375 380 Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly Pro Glu Leu385 390
395 400 Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile
Tyr 405 410 415 His Gly Ser Ile Leu Gln Ser Gly Val Pro Ser Arg Phe
Ser Gly Ser 420 425 430 Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser Leu Gln Pro Glu 435 440 445 Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Tyr Met Tyr Tyr Pro His Thr 450 455 460 Phe Gly Gln Gly Thr Lys Val
Glu Ile Lys Arg Ala Ala Ala465 470 475 192476PRTArtificial
SequenceDMS1576 with C-terminal K-044-085 DAB +T ((TGLDSP)x4) Codon
optimised amino acid sequence identified using molecular biology
techniques. 192Glu Val Gln Leu Leu Val Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Lys Ala Tyr 20 25 30 Pro Met Met Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Glu Ile Ser Pro Ser Gly
Ser Asn Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala
Lys Asp Pro Arg Lys Leu Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105
110 Thr Val Ser Ser Ala Ser Thr His Thr Cys Pro Pro Cys Pro Ala Pro
115 120 125 Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys 130 135 140 Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val145 150 155 160 Asp Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp 165 170 175 Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr 180 185 190 Asn Ser Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp 195 200 205 Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 210 215 220 Pro
Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg225 230
235 240 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys 245 250 255 Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp 260 265 270 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys 275 280 285 Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser 290 295 300 Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser305 310 315 320 Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser 325 330 335 Leu Ser
Leu Ser Pro Gly Lys Thr Gly Leu Asp Ser Pro Thr Gly Leu 340 345 350
Asp Ser Pro Thr Gly Leu Asp Ser Pro Thr Gly Leu Asp Ser Pro Asp 355
360 365 Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly
Asp 370 375 380 Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Trp Ile Gly
Pro Glu Leu385 390 395 400 Lys Trp Tyr Gln Gln Lys Pro Gly Lys Ala
Pro Lys Leu Leu Ile Tyr 405 410 415 His Gly Ser Ile Leu Gln Ser Gly
Val Pro Ser Arg Phe Ser Gly Ser 420 425 430 Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu 435 440 445 Asp Phe Ala Thr
Tyr Tyr Cys Gln Gln Tyr Met Tyr Tyr Pro His Thr 450 455 460 Phe Gly
Gln Gly Thr Lys Val Glu Ile Lys Arg Thr465 470 475
193231PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 193Gln Ala Ser Ser Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro 1 5 10 15 Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 20 25 30 Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 35 40 45 Asp Val
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 50 55 60
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr65
70 75 80 Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp 85 90 95 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu 100 105 110 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg 115 120 125 Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser Arg Asp Glu Leu Thr Lys 130 135 140 Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp145 150 155 160 Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 165 170 175 Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 180 185
190 Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
195 200 205 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser 210 215 220 Leu Ser Leu Ser Pro Gly Lys225 230
1949PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 194Ala Ser Thr His Thr Cys Pro Pro
Cys1 5 1957PRTArtificial SequenceAmino acid sequence identified
using molecular biology techniques. 195Thr His Thr Cys Pro Pro Cys1
5 1967PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 196Thr Ala Thr Cys Pro Pro Cys1 5
1978PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 197Gly Ser Thr Val Ala Ala Pro Ser1 5
1988PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 198Thr Val Ala Ala Pro Ser Gly Ser1 5
19910PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 199Gly Ser Thr Val Ala Ala Pro Ser
Gly Ser 1 5 10 2005PRTArtificial SequenceAmino acid sequence
identified using molecular biology techniques. 200Gly Gly Gly Gly
Ser1 5 2016PRTArtificial SequenceAmino acid sequence identified
using molecular biology techniques. 201Thr Val Ala Ala Pro Ser1 5
2028PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 202Thr Val Ala Ala Pro Ser Gly Ser1 5
2036PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 203Pro Ala Val Pro Pro Pro1 5
2046PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 204Thr Val Ser Asp Val Pro1 5
2056PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 205Thr Gly Leu Asp Ser Pro1 5
20616PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 206Asp Glu Thr Tyr Val Pro Lys Glu
Phe Asn Ala Glu Thr Phe Gly Ser 1 5 10 15 20714PRTArtificial
SequenceAmino acid sequence identified using molecular biology
techniques. 207Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr
Phe 1 5 10 20823PRTArtificial SequenceAmino acid sequence
identified using molecular biology techniques. 208Glu Val Asp Glu
Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe 1 5 10 15 Thr Phe
His Ala Asp Gly Ser 20 20921PRTArtificial SequenceAmino acid
sequence identified using molecular biology techniques. 209Glu Val
Asp Glu Thr Tyr Val Pro Lys Glu Phe Asn Ala Glu Thr Phe 1 5 10 15
Thr Phe His Ala Asp 20 21013PRTArtificial SequenceAmino acid
sequence identified using
molecular biology techniques. 210Asp Asp Asn Pro Asn Leu Pro Arg
Leu Val Arg Pro Glu 1 5 10 21114PRTArtificial SequenceAmino acid
sequence identified using molecular biology techniques. 211Asp Glu
Met Pro Ala Asp Leu Pro Ser Leu Ala Ala Asp Phe 1 5 10
21219PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 212His Lys Asp Asp Asn Pro Asn Leu
Pro Arg Leu Val Arg Pro Glu Val 1 5 10 15 Asp Val
Met21321PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 213Glu Asn Asp Glu Met Pro Ala Asp
Leu Pro Ser Leu Ala Ala Asp Phe 1 5 10 15 Val Glu Ser Lys Asp 20
2144PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 214Ala Ser Thr Lys1 2155PRTArtificial
SequenceAmino acid sequence identified using molecular biology
techniques. 215Ala Ser Thr Lys Gly1 5 2166PRTArtificial
SequenceAmino acid sequence identified using molecular biology
techniques. 216Ala Ser Thr Lys Gly Pro1 5 21710PRTArtificial
SequenceAmino acid sequence identified using molecular biology
techniques. 217Gly Ser Thr Val Ala Ala Pro Ser Gly Ser 1 5 10
2185PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 218Ala Ser Thr His Pro1 5
2196PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 219Val Thr Val Ser Ser Xaa 1 5
2206PRTArtificial SequenceAmino acid sequence identified using
molecular biology techniques. 220Val Glu Ile Lys Arg Xaa 1 5
* * * * *