U.S. patent application number 15/159535 was filed with the patent office on 2016-11-10 for recombinant n-glycosylated proteins from procaryotic cells.
This patent application is currently assigned to ETH ZURICH. The applicant listed for this patent is ETH ZURICH. Invention is credited to Markus Aebi, Umesh Ahuja, Michael Kowarik.
Application Number | 20160326563 15/159535 |
Document ID | / |
Family ID | 37396912 |
Filed Date | 2016-11-10 |
United States Patent
Application |
20160326563 |
Kind Code |
A1 |
Aebi; Markus ; et
al. |
November 10, 2016 |
RECOMBINANT N-GLYCOSYLATED PROTEINS FROM PROCARYOTIC CELLS
Abstract
The present invention relates to recombinant N-glycosylated
proteins, comprising one or more introduced N-glycosylated
optimized amino acid sequence(s), nucleic acids encoding these
proteins as well as corresponding vectors and host cells. In
addition, the present invention is directed to the use of said
proteins, nucleic acids, vectors and host cells for preparing
medicaments. Furthermore, the present invention provides methods
for producing said proteins.
Inventors: |
Aebi; Markus; (Wettingen,
CH) ; Kowarik; Michael; (Zurich, CH) ; Ahuja;
Umesh; (Los Angeles, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ETH ZURICH |
Zurich |
|
CH |
|
|
Assignee: |
ETH ZURICH
Zurich
CH
|
Family ID: |
37396912 |
Appl. No.: |
15/159535 |
Filed: |
May 19, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14174742 |
Feb 6, 2014 |
|
|
|
15159535 |
|
|
|
|
11920175 |
Oct 21, 2009 |
8753864 |
|
|
PCT/EP06/04397 |
May 10, 2006 |
|
|
|
14174742 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 31/00 20180101;
C12N 15/70 20130101; C07K 14/25 20130101; C07K 2319/034 20130101;
C12N 9/1051 20130101; C12Y 204/01 20130101; C12P 21/005 20130101;
C07K 14/205 20130101; A61P 43/00 20180101 |
International
Class: |
C12P 21/00 20060101
C12P021/00; C12N 9/10 20060101 C12N009/10 |
Foreign Application Data
Date |
Code |
Application Number |
May 11, 2005 |
EP |
05010276.3 |
Claims
1-27. (canceled)
28. A method for producing N-linked glycosylated proteins,
comprising: a) providing a recombinant prokaryotic organism
comprising nucleic acids coding for i) a functional pgl operon from
Campylobacter jejuni, and ii) at least one recombinant target
protein comprising one or more of the following N-glycosylated
optimized amino acid consensus sequence(s): D/E-X-N-Z-S/T, wherein
X and Z may be any natural amino acid except Pro, and wherein at
least one of said N-glycosylated optimized amino acid consensus
sequence(s) is introduced, and b) culturing the recombinant
organism in a manner suitable for the production and
N-glycosylation of the target protein(s).
29. The method of claim 28, wherein the recombinant prokaryotic
organism is selected from the group of bacteria consisting of
Escherichia ssp., Campylobacter ssp., Salmonella ssp., Shigella
ssp., Helicobacter ssp., Pseudomonas ssp., and Bacillus ssp.
30. The method of claim 28, wherein the functional pgl operon from
Campylobacter jejuni comprises nucleic acids coding for i)
recombinant oligosaccharyl transferase (OTase) from Campylobacter
jejuni, and ii) recombinant or natural specific
glycosyltransferases from (a) Campylobacter jejuni, or (b) species
other than Campylobacter spp., or (c) both (a) and (b), for the
assembly of an oligosaccharide on a lipid carrier to be transferred
to the target protein by the OTase.
31. A method for preparing a host cell, comprising the steps of: i)
providing a Gram-negative bacterium, ii) introducing into said
bacterium at least one nucleotide sequence encoding for a) at least
one recombinant specific glycosyltransferase for the assembly of an
oligosaccharide on a lipid carrier, b) at least one recombinant
oligosaccharyl transferase (OTase) from Campylobacter jejuni,
and/or c) at least one recombinant protein comprising one or more
of the following N-glycosylated optimized amino acid consensus
sequence(s): D/E-X-N-Z-S/T, wherein X and Z may be any natural
amino acid except Pro, and wherein at least one of said
N-glycosylated optimized amino acid consensus sequence(s) is
introduced, and iii) culturing said bacterium until at least one
recombinant N-glycosylated protein coded by the nucleotide sequence
of c) is located in or on the outer membrane of the Gram-negative
bacterium.
32. The method of claim 31, wherein the host cell is selected from
the group of bacteria consisting of Escherichia ssp., Campylobacter
ssp., Salmonella ssp., Shigella ssp., Helicobacter ssp.,
Pseudomonas ssp., and Bacillus ssp.
33. (canceled)
Description
[0001] The present invention relates to recombinant N-glycosylated
proteins, comprising one or more introduced N-glycosylated
optimized amino acid consensus sequence(s), nucleic acids encoding
these proteins as well as corresponding vectors and host cells. In
addition, the present invention is directed to the use of said
proteins, nucleic acids, vectors and host cells for preparing
medicaments. Furthermore, the present invention provides methods
for producing said proteins.
BACKGROUND OF THE INVENTION
[0002] N-linked protein glycosylation is an essential and conserved
process occurring in the endoplasmic reticulum of eukaryotic
organisms. It is important for protein folding, oligomerization,
stability, quality control, sorting and transport of secretory and
membrane proteins (Helenius, A., and Aebi, M. (2004). Roles of
N-linked glycans in the endoplasmic reticulum. Annu. Rev. Biochem.
73, 1019-1049).
[0003] Protein glycosylation has a profound influence on the
antigenicity, the stability and the half-life of a protein. In
addition, glycosylation can assist the purification of proteins by
chromatography, e.g. affinity chromatography with lectin ligands
bound to a solid phase interacting with glycosylated moieties of
the protein. It is therefore established practice to produce many
glycosylated proteins recombinantly in eukaryotic cells to provide
biologically and pharmaceutically useful glycosylation
patterns.
[0004] Only within recent years it was demonstrated that a
bacterium, the food-borne pathogen Campylobacter jejuni, can also
N-glycosylate its proteins (Szymanski, et al. (1999). Evidence for
a system of general protein glycosylation in Campylobacter jejuni.
Mol. Microbiol. 32, 1022-1030). The machinery required for
glycosylation is encoded by 12 genes that are clustered in the
so-called pgl locus. Disruption of N-glycosylation affects invasion
and pathogenesis of C. jejuni but is not lethal as in most
eukaryotic organisms (Burda P. and M. Aebi, (1999). The dolichol
pathway of N-linked glycosylation. Biochim Biophys Acta
1426(2):239-57). It is possible to reconstitute the N-glycosylation
of C. jejuni proteins by recombinantly expressing the pgl locus and
acceptor glycoprotein in E. coli at the same time (Wacker et al.
(2002). N-linked glycosylation in Campylobacter jejuni and its
functional transfer into E. coli. Science 298, 1790-1793).
[0005] European Patent Application No. 03 702 276.1 (European
Patent 1 481 057), an earlier invention of the present inventors,
teaches a procaryotic organism into which is introduced a nucleic
acid encoding for (i) specific glycosyltransferases for the
assembly of an oligosaccharide on a lipid carrier, (ii) a
recombinant target protein comprising a consensus sequence
"N-X-S/T", wherein X can be any amino acid except proline, and
(iii) an oligosaccharyl transferase of C. jejuni (OTase) that
covalently links said oligosaccharide to the consensus sequence of
the target protein. Said procaryotic organism produces N-glycans
with a specific structure which is defined by the type of the
specific glycosyltransferases.
[0006] Even though the presence of the known N-glycosylation
consensus sequence in a protein does allow for the N-glycosylation
of recombinant target proteins in procaryotic organisms comprising
the oligosaccharyl transferase (OTase) of C. jejuni, the
N-glycosylation of some target proteins is often inefficient.
[0007] The object of the present invention is to provide proteins
as well as means and methods for producing such proteins having an
optimized efficiency for N-glycosylation that can be produced in
procaryotic organisms in vivo. Another object of the present
invention aims at the more efficient introduction of N-glycans into
recombinant proteins for modifying antigenicity, stability,
biological, prophylactic and/or therapeutic activity of said
proteins. A further object is the provision of a host cell that
efficiently displays recombinant N-glycosylated proteins of the
present invention on its surface.
[0008] In a first aspect the present invention provides a
recombinant N-glycosylated protein, comprising one or more of the
following N-glycosylated optimized amino acid sequence(s):
D/E-X-N-Z-S/T, (optimized consensus sequence)
wherein X and Z may be any natural amino acid except Pro, and
wherein at least one of said N-glycosylated partial amino acid
sequence(s) is introduced.
[0009] It was surprisingly found that the introduction of specific
partial amino acid sequence(s) (optimized consensus sequence(s))
into proteins leads to proteins that are efficiently N-glycosylated
by the oligosaccharyl transferase (OST, OTase) from Campylobacter
spp., preferably C. jejuni, in these introduced positions.
[0010] The term "partial amino acid sequence(s)" as it is used in
the context of the present invention will also be referred to as
"optimized consensus sequence(s)". The optimized consensus sequence
is N-glycosylated by the oligosaccharyl transferase (OST, OTase)
from Campylobacter spp., preferably C. jejuni, much more
efficiently than the regular consensus sequence "N-X-S/T" known in
the prior art.
[0011] In general, the term. "recombinant N-glycosylated protein"
refers to any heterologous poly- or oligopeptide produced in a host
cell that does not naturally comprise the nucleic acid encoding
said protein. In the context of the present invention this term
refers to a protein produced recombinantly in any host cell, e.g.
an eukaryotic or prokaryotic host cell, preferably a procaryotic
host cell, e.g. Escherichia ssp., Campylobacter ssp., Salmonella
ssp., Shigella ssp., Helicobacter ssp., Pseudomonas ssp., Bacillus
ssp., more preferably Escherichia coli, Campylobacter jejuni,
Salmonella typhimurium etc., wherein the nucleic acid encoding said
protein has been introduced into said host cell and wherein the
encoded protein is N-glycosylated by the OTase from Campylobacter
spp., preferably C. jejuni, said transferase enzyme naturally
occurring in or being introduced recombinantly into said host
cell.
[0012] In accordance with the internationally accepted one letter
code for amino acids the abbreviations D, E, N, S and T denote
aspartic acid, glutamic acid, asparagine, serine, and threonine,
respectively. Proteins according to the invention differ from
natural or prior art proteins in that one or more of the optimized
consensus sequence(s) D/E-X-N-Z-S/T is/are introduced and
N-glycosylated. Hence, the proteins of the present invention differ
from the naturally occurring. C. jejuni proteins which also contain
the optimized consensus sequence but do not comprise any additional
(introduced) optimized consensus sequences.
[0013] The introduction of the optimized consensus sequence can be
accomplished by the addition, deletion and/or substitution of one
or more amino acids. The addition, deletion and/or substitution of
one or more amino acids for the purpose of introducing the
optimized consensus sequence can be accomplished by chemical
synthetic strategies well known to those skilled in the art such as
solid phase-assisted chemical peptide synthesis. Alternatively, and
preferred for larger polypeptides, the proteins of the present
invention can be prepared by standard recombinant techniques.
[0014] The proteins of the present invention have the advantage
that they may be produced with high efficiency and in any
procaryotic host comprising a functional pgl operon from
Campylobacter spp., preferably C. jejuni. Preferred alternative
OTases from Campylobacter spp. for practicing the aspects and
embodiments of the present invention are Campylobacter coli and
Campylobacter lari (see Szymanski, C. M. and Wren, B. W. (2005).
Protein glycosylation in bacterial mucosal pathogens. Nat. Rev.
Microbiol. 3: 225-237). The functional pgl operon may be present
naturally when said procaryotic host is Campylobacter spp.,
preferably C. jejuni. However, as demonstrated before in the art
and mentioned above, the pgl operon can be transferred into cells
and remain functional in said new cellular environment.
[0015] The term "functional pgl operon from Campylobacter spp.,
preferably C. jejuni" is meant to refer to the cluster of nucleic
acids encoding the functional oligosaccharyl transferase (OTase) of
Campylobacter spp., preferably C. jejuni, and one or more specific
glycosyltransferases capable of assembling an oligosaccharide on a
lipid carrier, and wherein said oligosaccharide can be transferred
from the lipid carrier to the target protein having one or more
optimized amino acid sequence(s): D/E-X N-Z-S/T by the OTase. It to
be understood that the term "functional pgl operon from
Campylobacter spp., preferably C. jejuni" in the context of this
invention does not necessarily refer to an operon as a singular
transcriptional unit. The term merely requires the presence of the
functional components for N-glycosylation of the recombinant
protein in one host cell. These components may be transcribed as
one or more separate mRNAs and may be regulated together or
separately. For example, the term also encompasses functional
components positioned in genomic DNA and plasmid(s) in one host
cell. For the purpose of efficiency, it is preferred that all
components of the functional pgl operon are regulated and expressed
simultaneously.
[0016] It is important to realize that only the functional
oligosaccharyl transferase (OTase) should originate from
Campylobacter spp., preferably C. jejuni, and that the one or more
specific glycosyltransferases capable of assembling an
oligosaccharide on a lipid carrier may originate from the host cell
or be introduced recombinantly into said host cell, the only
functional limitation being that the oligosaccharide assembled by
said glycosyltransferases can be transferred from the lipid carrier
to the target protein having one or more optimized consensus
sequences by the OTase. Hence, the selection of the host cell
comprising specific glycosyltransferases naturally and/or
incapacitating specific glycosyltransferases naturally present in
said host as well as the introduction of heterologous specific
glycosyltransferases will enable those skilled in the art to vary
the N-glycans bound to the optimized N-glycosylation consensus site
in the proteins of the present invention.
[0017] As a result of the above, the present invention provides for
the individual design of N-glycan-patterns on the proteins of the
present invention. The proteins can therefore be individualized in
their N-glycan pattern to suit biological, pharmaceutical and
purification needs.
[0018] In a preferred embodiment, the proteins of the present
invention may comprise one but also more than one, preferably at
least two, preferably at least 3, more preferably at least 5 of
said N-glycosylated optimized amino acid sequences.
[0019] The presence of one or more N-glycosylated optimized amino
acid sequence(s) in the proteins of the present invention can be of
advantage for increasing their antigenicity, increasing their
stability, affecting their biological activity, prolonging their
biological half-life and/or simplifying their purification.
[0020] The optimized consensus sequence may include any amino acid
except proline in position(s) X and Z. The term "any amino acids"
is meant to encompass common and rare natural amino acids as well
as synthetic amino acid derivatives and analogs that will still
allow the optimized consensus sequence to be N-glycosylated by the
OTase. Naturally occurring common and rare amino acids are
preferred for X and Z. X and Z may be the same or different.
[0021] It is noted that X and Z may differ for each optimized
consensus sequence in a protein according to the present
invention.
[0022] The N-glycan bound to the optimized consensus sequence will
be determined by the specific glycosyltransferases and their
interaction when assembling the oligosaccharide on a lipid carrier
for transfer by the OTase. Those skilled in the art can design the
N-glycan by varying the type(s) and amount of the specific
glycosyltransferases present in the desired host cell.
[0023] N-glycans are defined herein as mono-, oligo- or
polysaccharides of variable compositions that are linked to an
.epsilon.-amide nitrogen of an asparagine residue in a protein via
an N-glycosidic linkage. Preferably, the N-glycans transferred by
the OTase are assembled on an undecaprenol-pyrophosphate
lipid-anchor that is present in the cytoplasmic membrane of
gram-negative or positive bacteria. They are involved in the
synthesis of O antigen, O polysaccharide and peptidoglycan (Bugg,
T. D., and Brandish, P. E. (1994). From peptidoglycan to
glycoproteins: common features of lipid-linked oligosaccharide
biosynthesis. FEMS Microbiol Lett 119, 255-262; Valvano, M. A.
(2003). Export of O-specific lipopolysaccharide. Front Biosci 8,
s452-471).
[0024] In a preferred embodiment, the recombinant protein of the
present invention comprises one or more N-glycans selected from the
group of N-glycans from Campylobacter spp., preferably C. jejuni,
the N-glycans derived from oligo- and polysaccharides transferred
to O antigen forming O polysaccharide in Gram-negative bacteria or
capsular polysaccharides from Gram-positive bacteria, preferably:
P. aeruginosa O9, O11; E. coli O7, O9, O16, O157 and Shigella
dysenteriae O1 and engineered variants thereof obtained by
inserting or deleting glycosyltransferases and epimerases affecting
the polysaccharide structure.
[0025] In a further preferred embodiment the recombinant protein of
the present invention comprises two or more different
N-glycans.
[0026] For example, different N-glycans on the same protein can
prepared by controlling the timing of the expression of specific
glycosyltransferases using early or late promoters or introducing
factors for starting, silencing, enhancing and/or reducing the
promoter activity of individual specific glycosyltransferases.
Suitable promoters and factors governing their activity are
available to those in the art routinely and will not be discussed
further.
[0027] There is no limitation on the origin of the recombinant
protein of the invention. Preferably said protein is derived from
mammalian, bacterial, viral, fungal or plant proteins. More
preferably, the protein is derived from mammalian, most preferably
human proteins. For preparing antigenic recombinant proteins
according to the invention, preferably for use as active components
in vaccines, it is preferred that the recombinant protein is
derived from a bacterial, viral or fungal protein.
[0028] In a further preferred embodiment the present invention
provides for recombinant proteins wherein either the protein and/or
the N-glycan(s) is (are) therapeutically and/or prophylactically
active. The introduction of at least one optimized and
N-glycosylated consensus sequence can modify or even introduce
therapeutic and/or prophylactic activity in a protein. In a more
preferred embodiment it is the protein and/or the N-glycan(s) that
is (are) immunogenically active. In this case the introduced
N-glycosylation(s) may have a modifying effect on the proteins
biological activity and/or introduce new antigenic sites and/or may
mask the protein to evade degrading steps and/or increase the
half-life.
[0029] The recombinant proteins of the present invention can be
efficiently targeted to the outer membrane and/or surface of host
cells, preferably bacteria, more preferably gram-negative bacteria.
For assisting the surface display and/or outer membrane
localisation it is, preferred that the recombinant protein of the
invention further comprises at least one polypeptide sequence
capable of targeting said recombinant protein to the outer membrane
and/or cell surface of a bacterium, preferably a gram-negative
bacterium.
[0030] In a preferred embodiment the recombinant protein of the
invention is one, wherein said targeting polypeptide sequence is
selected from the group consisting of type II signal peptides
(Paetzel, M., Karla, A., Strynadka, N.C., and Dalbey, R. E. 2002.
Signal peptidases. Chem Rev 102: 4549-4580.) or outer membrane
proteins (reviewed in Wernerus, H., and Stahl, S. 2004.
Biotechnological applications for surface-engineered bacteria.
Biotechnol Appl Biochem 40: 209-228.), preferably selected from the
group consisting of the full length protein or the signal peptides
of OmpH1 from C. jejuni, JlpA from C. jejuni, outer membrane
proteins from E. coli, preferably OmpS, OmpC, OmpA, OprF, PhoE,
LamB, Lpp'OmpA (a fusion protein for surface display technology,
see Francisco, J. A., Earhart, C. F., and Georgiou, G. 1992.
Transport and anchoring of beta-lactamase to the external surface
of Escherichia coli. Proc Natl Acad Sci USA 89: 2713-2717.), and
the Inp protein from Pseudomonas aeruginosa.
[0031] In a different aspect, the present invention relates to a
nucleic acid encoding a recombinant protein, according to the
invention. Preferably, said nucleic acid is a mRNA, a DNA or a PNA,
more preferably a mRNA or a DNA, most preferably a DNA. The nucleic
acid may comprise the sequence coding for said protein and, in
addition, other sequences such as regulatory sequences, e.g.
promoters, enhancers, stop codons, start codons and genes required
to regulate the expression of the recombinant protein via the
mentioned regulatory sequences, etc. The term "nucleic acid
encoding a recombinant protein according to the invention" is
directed to a nucleic acid comprising said coding sequence and
optionally any further nucleic acid sequences regardless of the
sequence information as long as the nucleic acid is capable of
producing the recombinant protein of the invention in a host cell
containing a functional pgl operon from Campylobacter spp.,
preferably C. jejuni. More preferably, the present invention
provides isolated and purified nucleic acids operably linked to a
promoter, preferably linked to a promoter selected from the group
consisting of known inducible and constitutive prokaryotic
promoters, more preferably the tetracycline promoter, the arabinose
promoter, the salicylate promoter, lac-, trc-, and tac promotors
(Baneyx, F. (1999). Recombinant protein expression in Escherichia
coli. Curr Opin Biotechnol 10, 411-421; Billman-Jacobe, H. (1996).
Expression in bacteria other than Escherichia coli. Curr Opin
Biotechnol 7, 500-504.). Said operably linked nucleic acids can be
used for, e.g. vaccination.
[0032] Furthermore, another aspect of the present invention relates
to a host cell comprising a nucleic acid and/or a vector according
to the present invention. The type of host cell is not limiting as
long as it accommodates a functional pgl operon from C. jejuni and
one or more nucleic acids coding for recombinant target protein(s)
of the present invention. Preferred host cells are prokaryotic host
cells, more preferably bacteria, most preferably those selected
from the group consisting of Escherichia ssp., Campylobacter ssp.,
Salmonella ssp., Shigella ssp., Helicobacter ssp., Pseudomonas
ssp., Bacillus ssp., preferably Escherichia coli, more preferably
E. coli strains Top10, W3110, CLM24, BL21, SCM6 and SCM7 (Feldman
et al., (2005). Engineering N-linked protein glycosylation with
diverse O antigen lipopolysaccharide structures in Escherichia
coli. Proc. Natl. Acad. Sci. USA 102, 3016-3021; Alaimo, C.,
Catrein, I., Morf, L., Marolda, C. L., Callewaert, N., Valvano, M.
A., Feldman, M. F., Aebi, M. (2006). Two distinct but
interchangeable mechanisms for flipping of lipid-linked
oligosaccharides. EMBO Journal 25, 967-976) and S. enterica strains
SL3261 (Salmonella enterica sv. Typhimurium LT2 (delta) aroA, see
Hoiseth, S. K., and Stocker, B. A. 1981, Aromatic-dependent
Salmonella typhimurium are non-virulent and effective as live
vaccines. Nature 291:238-239), SL3749 (Salmonella enterica sv.
Typhimurium LT2 waaL, see Kaniuk et al., J. Biol. Chem. 279:
36470-36480) and SL3261.DELTA.waaL.
[0033] In a more preferred embodiment the host cell according to
the invention is one that is useful for the targeting to the outer
membrane and/or surface display of recombinant proteins according
to the invention, preferably one, wherein said host cell is a
recombinant gram-negative bacterium having:
i) a genotype comprising nucleotide sequences encoding for [0034]
a) at least one natural or recombinant specific glycosyltransferase
for the assembly of an oligosaccharide on a lipid carrier, [0035]
b) at least one natural or recombinant prokaryotic oligosaccharyl
transferase (OTase) from Campylobacter spp., preferably C. jejuni,
[0036] c) at least one recombinant protein according to the
invention, preferably a protein further comprising a targeting
polypeptide, and ii) a phenotype comprising a recombinant
N-glycosylated protein according to the invention that is located
in and/or on the outer membrane of the gram-negative bacterium.
[0037] The host cell for the above embodiment is preferably
selected from the group consisting of Escherichia ssp.,
Campylobacter ssp., Shigella ssp, Helicobacter ssp. and Pseudomonas
ssp., Salmonella ssp., preferably E. coli, more preferably E. coli
strains Top10, W3110, CLM24, BL21, SCM6 and SCM7, and S. enterica
strains SL3261, SL3749 and SL3261.DELTA.waaL. (see Hoiseth, S. K.,
and Stocker, B. A. 1981. Aromatic-dependent Salmonella typhimurium
are non-virulent and effective as live vaccines. Nature 291:
238-239), SL3749 (Kaniuk, N. A., Vinogradov, E., and Whitfield, C.
2004. Investigation of the structural requirements in the
lipopolysaccharide core acceptor for ligation of O antigens in the
genus Salmonella: WaaL "ligase" is not the sole determinant of
acceptor specificity. J Biol Chem 279: 36470-36480).
[0038] Because preferred proteins of the present invention may have
a therapeutic or prophylactic activity by themselves and/or due to
the introduced N-glycosylation' sites, they can be used for the
preparation of a medicament. The type of protein for practicing the
invention is not limited and, therefore, proteins of the invention
such as EPO, IFN-alpha, TNFalpha, IgG, IgM, IgA, interleukins,
cytokines, viral and bacterial proteins for vaccination like C.
jejuni proteins such as HisJ (Cj0734c), AcrA (Cj0367c), OmpH1
(Cj0982c), Diphteria toxin (CRM197), Cholera toxin, P. aeruginosa
exoprotein, to name just a few, and having introduced therein the
optimized N-glycosylated consensus sequence are useful for
preparing a medicament (Wyszynska, A., Raczko, A., Lis, M., and
Jagusztyn-Krynicka, E. K. (2004). Oral immunization of chickens
with avirulent Salmonella vaccine strain carrying C. jejuni 72Dz/92
cjaA gene elicits specific humoral immune response associated with
protection against challenge with wild-type Campylobacter. Vaccine
22, 1379-1389).
[0039] In addition, the nucleic acids and/or vectors according to
the invention are also useful for the preparation of a medicament,
preferably for use in gene therapy.
[0040] Moreover, a host cell according to the invention, preferably
one that has a phenotype comprising an N-glycosylated recombinant
protein of the invention that is located in and/or on the outer
membrane of a bacterium, preferably a gram-negative bacterium, more
preferably one of the above-listed gram-negative bacteria, is
particularly useful for the preparation of a medicament.
[0041] More preferably, a protein of the invention is used for the
preparation of a medicament for the therapeutic and/or prophylactic
vaccination of a subject in need thereof.
[0042] In a more preferred embodiment the present invention relates
to the use of a nucleic acid and/or a vector according to the
invention for the preparation of a medicament for the therapeutic
and/or prophylactic vaccination of a subject in need thereof,
preferably by gene therapy.
[0043] The host cells of the invention displaying said
N-glycosylated recombinant proteins are particularly useful for
preparing vaccines, because the displayed N-glycosylated proteins
are abundantly present on the host cell's surface and well
accessible by immune cells, in particular their hydrophilic
N-glycans, and because the host cells have the added effect of an
adjuvant, that, if alive, may even replicate to some extent and
amplify its vaccination effects.
[0044] Preferably, the host cell for practicing the medical aspects
of this invention is an attenuated or killed host cell.
[0045] Another advantage of the use of the inventive host cells for
preparing medicaments, preferably vaccines, is that they induce IgA
antibodies due to the cellular component.
[0046] Preferably, said host cells are used according to the
invention for inducing IgA antibodies in an animal, preferably a
mammal, a rodent, ovine, equine, canine, bovine or a human.
[0047] It is preferred that said subject in need of vaccination is
avian, mammalian or fish, preferably mammalian, more preferably a
mammal selected from the group consisting of cattle, sheep,
equines, dogs, cats, and humans, most preferably humans. Fowls are
also preferred.
[0048] A further aspect of the present invention relates to a
pharmaceutical composition, comprising at least one protein, at
least one nucleic acid, a least one vector and/or at least one host
cell according to the invention. The preparation of medicaments
comprising proteins or host cells, preferably attenuated or killed
host cells, and the preparation of medicaments comprising nucleic
acids and/or vectors for gene therapy are well known in the art.
The preparation scheme for the final pharmaceutical composition and
the mode and details of its administration will depend on the
protein, the host cell, the nucleic acid and/or the vector
employed.
[0049] In a preferred embodiment, the pharmaceutical composition of
the invention comprises a pharmaceutically acceptable excipient,
diluent and/or adjuvant.
[0050] The present invention provides for a pharmaceutical
composition comprising at least one of the following, (i) a
recombinant protein, a host cell, a nucleic acid and/or a
recombinant vector being/encoding/expressing a recombinant protein
according to the present invention, and (ii) a pharmaceutically
acceptable excipient, diluent and/or adjuvant.
[0051] Suitable excipients, diluents and/or adjuvants are
well-known in the art. An excipient or diluent may be a solid,
semi-solid or liquid material which may serve as a vehicle or
medium for the active ingredient. One of ordinary skill in the art
in the field of preparing compositions can readily select the
proper form and mode of administration depending upon the
particular characteristics of the product selected, the disease or
condition to be treated, the stage of the disease or condition, and
other relevant circumstances (Remington's Pharmaceutical Sciences,
Mack Publishing Co. (1990)). The proportion and nature of the
pharmaceutically acceptable diluent or excipient are determined by
the solubility and chemical properties of the pharmaceutically
active compound selected, the chosen route of administration, and
standard pharmaceutical practice. The pharmaceutical preparation
may be adapted for oral, parenteral or topical use and may be
administered to the patient in the form of tablets, capsules,
suppositories, solution, suspensions, or the like. The
pharmaceutically active compounds of the present invention, while
effective themselves, can be formulated and administered in the
form of their pharmaceutically acceptable salts, such as acid
addition salts or base addition salts, for purposes of stability,
convenience of crystallization, increased solubility, and the
like.
[0052] A further aspect of the present invention is directed to a
method for producing N-linked glycosylated proteins, comprising the
steps of:
a) providing a recombinant organism, preferably a prokaryotic
organism, comprising nucleic acids coding for [0053] i) a
functional pgl operon from Campylobacter spp., preferably C.
jejuni, and [0054] ii) at least one recombinant target protein
comprising one or more of the following N-glycosylated optimized
amino acid consensus sequence(s):
[0054] D/E-X-N-Z-S/T, [0055] wherein X and Z may be any natural
amino acid except Pro, and wherein at least one of said
N-glycosylated optimized amino acid consensus sequence(s) is
introduced, and b) culturing the recombinant organism in a manner
suitable for the production and N-glycosylation of the target
protein(s).
[0056] Preferably, the target protein is one of the above described
recombinant proteins according to the invention.
[0057] In a preferred method of the invention, the functional pgl
operon from Campylobacter spp., preferably C. jejuni, comprises
nucleic acids coding for [0058] i) recombinant OTase from
Campylobacter spp., preferably C. jejuni, and [0059] ii)
recombinant and/or natural specific glycosyltransferases from
Campylobacter spp., preferably C. jejuni, and/or [0060] iii)
recombinant and/or natural specific glycosyltransferases from
species other than Campylobacter spp., for the assembly of an
oligosaccharide on a lipid carrier to be transferred to the target
protein by the OTase.
[0061] Moreover, in a preferred embodiment the present invention
relates to a method for preparing a host cell according to the
invention comprising the steps of:
i) providing a gram-negative bacterium, ii) introducing into said
bacterium at least one nucleotide sequence encoding for [0062] a)
at least one recombinant specific glycosyltransferase for the
assembly of an oligosaccharide on a lipid carrier, and/or [0063] b)
at least one recombinant oligosaccharyl transferase (OTase) from
Campylobacter spp., preferably C. jejuni, and/or [0064] c) at least
one recombinant protein comprising one or more of the following
N-glycosylated optimized amino acid consensus sequence(s):
[0064] D/E-X-N-Z-S/T, [0065] wherein X and Z may be any natural
amino acid except Pro, and wherein at least one of said
N-glycosylated optimized amino acid consensus sequence(s) is
introduced, and iii) culturing said bacterium until at least one
recombinant N-glycosylated protein coded by the nucleotide sequence
of c) is located in and/or on the outer membrane of the
gram-negative bacterium.
[0066] For practicing the preferred methods above, the recombinant
procaryotic organism or host cell is preferably selected from the
group of bacteria consisting of Escherichia ssp., Campylobacter
ssp., Salmonella ssp., Shigella ssp., Helicobacter ssp.,
Pseudomonas ssp., Bacillus ssp., preferably Escherichia coli,
preferably E. coli strains Top10, W3110, CLM24, BL21, SCM6 and
SCM7, and S. enterica strains SL3261, SL3749 and
SL3261.DELTA.waaL.
[0067] Another preferred method for producing, isolating and/or
purifying a recombinant protein according to the invention
comprises the steps of:
a) culturing a host cell according to claim 15 or 16, b) removing
the outer membrane of said recombinant gram-negative bacterium and
c) recovering said recombinant protein.
[0068] Exemplary methods for removing the outer membrane of a cell,
preferably a prokaryotic cell, more preferably a gram-negative
bacterial cell, are suitable enzymatic treatment methods, osmotic
shock detergent solubilisation and the French press method.
[0069] Most preferred, the present invention relates to a method,
wherein recombinant or natural specific glycosyltransferases from
species other than Campylobacter spp., preferably C. jejuni, are
selected from the group of glycosyltransferases and epimerases
originating from bacteria, archea, and/or eukaryota that can be
functionally expressed in said host cell.
FIGURES
[0070] FIG. 1 illustrates the N-glycosylation of Lip proteins
derived from constructs A to C (see example 1). E. coli Top 10
cells carrying a functional pgl operon from C. jejuni (Wacker et
al., 2002, supra) and a plasmid coding for constructs A (lane 2), B
(lane 1), and C (lane 3) or a mutant of construct C with the
mutation D121A (lane 4). Proteins were expressed and purified from
periplasmic extracts. Shown is the SDS-PAGE and Coomassie brilliant
blue staining of the purified protein fractions.
[0071] FIG. 2 shows the N-glycosylation analysis of the different
proteins that were analyzed for the sequence specific
N-glycosylation by the C. jejuni pgl operon (Wacker et al., 2002,
supra) in CLM24 cells (Feldman et al., (2005). Engineering N-linked
protein glycosylation with diverse O antigen lipopolysaccharide
structures in Escherichia coli. Proc. Natl. Acad. Sci. USA 102,
3016-3021) or Top10 cells (panel E lanes 1-6) or SCM7 cells
(Alaimo, C., Catrein, I., Morf, L., Marolda, C. L., Callewaert, N.,
Valvano, M. A., Feldman, M. F., Aebi, M. (2006). Two distinct but
interchangeable mechanisms for flipping of lipid-linked
oligosaccharides. EMBO Journal 25, 967-976) (panel E, lanes 7, 8)
expressing said proteins from a plasmid. Shown are SDS-PAGE
separated periplasmic extracts that were transferred to
Nitrocellulose membrane and visualized with specific antisera. In
panels A-D the top panel show immunoblots probed with anti AcrA
antiserum (Wacker et al. 2002, supra; Nita-Lazar, M., Wacker, M.,
Schegg, B., Amber, S., and Aebi, M. (2005). The N-X-S/T consensus
sequence is required but not sufficient for bacterial N-linked
protein glycosylation. Glycobiology 15, 361-367), whereas the
bottom panels show immunoblots probed with R12 antiserum (Wacker et
al., 2002, supra). + and - indicate the presence of the functional
or mutant pgl operon in the cells. Panel A contains samples of the
soluble wildtype AcrA with the pelB signal sequence and the hexa
histag (lanes 1, 2), AcrA-N273Q (lane 3, 4), and AcrA-D121A (lane
5). Panel B: AcrA (lanes 1, 2), AcrA-T145D (lane 3),
AcrA-N123Q-N273Q-T145D (lanes 4, 5). Panel C: AcrA-F115D-T145D
(lanes 1, 2), AcrA-N123Q-N273Q-N272D (lanes 3, 4). Panel D:
AcrA-N273Q (lanes 1, 2), AcrA-N273Q-F122P (lanes 3, 4). Panel E:
CtxB (lanes 1, 2), CtxB-W88D (lanes 3, 4), CtxB-Q56/DSNIT (lanes 5,
6), and CtxB-W88D-Q56/DSNIT.
[0072] FIG. 3 shows the engineering of multiple glycosylation sites
in OmpH1. The .DELTA.waaL strain SCM6 was co-transformed with
plasmid pACYCpgl (encoding entire pgl locus) and plasmids
expressing wild type OmpH1 (lane 1), OmpH1.sup.N139S-myc (lane 2),
OmpH1.sup.KGN.fwdarw.NIT, HFGDD.fwdarw.DSNIT-myc (lane 3),
OmpH1.sup.RGD.fwdarw.NIT, HFGDD.fwdarw.DSNIT-myc (lane 4),
OmpH1.sup.KGN.fwdarw.NIT, RGD.fwdarw.NIT-myc (lane 5),
OmpH1.sup.KGN.fwdarw.NIT, RGD.fwdarw.NIT, HFGDD.fwdarw.DSNIT-myc
(lane 6) or OmpH1.sup.RGD.fwdarw.NIT,V83T-myc (lane 7). The cells
were grown aerobically, induced with 0.5% arabinose for 3 hours
prior to analysis. Whole cell lysates were TCA precipitated after
equalizing the optical density of the cultures as described in the
materials and methods section. The proteins were separated by 15%
SDS-PAGE and transferred onto a PVDF membrane. First panel,
immunoblot of whole cell lysates probed with anti-myc tag
antibodies. Bottom panel, immunoblot of whole cell lysates probed
with glycan-specific antiserum. The positions of unglycosylated-
and glycosylated OmpH1 are indicated on the right.
[0073] FIG. 4. Fluorescence microscopy of cells expressing various
OmpH1 variants. Cultures of E. coli strains CLM24 or SCM6
containing the expression plasmid for the wild type OmpH1 and its
variants were equalized to OD.sub.600 of 0.25/ml. Cells were washed
two times with phosphate-buffered saline (PBS), pH 7.4 and 100
.mu.l cell suspensions was dropped onto gelatinized glass slides
and incubated at room temperature (RT) for 30 min inside a
humidified chamber. All subsequent steps in the whole-cell
immunofluorescence labeling were done at room temperature inside a
humidified chamber. The unbound cells were removed and rest was
fixed with 4% paraformaldehyde containing PBS for 30 min at RT.
Importantly, paraformaldehyde is considered not to permeabilize
cells but keeping the compartimentalization by membranes intact.
Fixed cells were washed two times with PBS and resuspended blocking
buffer containing 5% BSA in PBS. After blocking, the cells were
incubated with anti-myc monoclonal mouse IgG (1:50, Calbiochem)
and/or anti-glycan antiserum (1:4000) for 1 h in 100 .mu.l of PBS
containing 5% BSA. The cells were washed three times with 100 .mu.l
of PBS for 5 min each and incubated with secondary anti-rabbit
antibody conjugated to FITC (1:250, Jackson Immunoresearch
Laboratories) and/or anti-mouse antibody conjugated to Cy3 (1:250,
Jackson Immunoresearch Laboratories) for 1 h in 100 .mu.l of PBS
containing 5% BSA. If required, 4, 6-diamino-2-phenylindole (DAPI)
(Sigma) (0.5 .mu.g/ml) was added at the time of secondary antibody
incubation to stain for bacterial DNA. The secondary antibody was
rinsed from the cells PBS, and coverslips were mounted on slides by
using vectashield (Vector Laboratories) mounting medium and sealed
with nail polish. Fluorescence microscopy was performed by the
using an Axioplan2 microscope (Carl Zeiss). Images were combined by
using Adobe Photoshop, version CS2. SCM6 cells expressing OmpH1
(panel A), OmpH1.sup.N139S (panel B), OmpH1.sup.C208 (panel C),
OmpH1.sup.KGN.fwdarw.NIT,HFGDD.fwdarw.DSNIT (panel D),
OmpH1.sup.RGD.fwdarw.NIT,HFGDD.fwdarw.DSNIT (panel E),
OmpH1.sup.KGN.fwdarw.NIT,RGD.fwdarw.NIT (panel F),
OmpH1.sup.V83T,KGN.fwdarw.NIT (panel G), and
OmpH1.sup.KGN.fwdarw.NIT,RGD.fwdarw.NIT,HFGDD.fwdarw.DSNIT (panel
H). The first column is a merge of the pictures in columns 2, 3,
and 4 represented in greytones on black background. Column 2: blue
fluorescence in greytones from DAPI stain, column 3: green
fluorescence from glycan specific fluorescence, column 4: red
fluorescence from anti-myc staining.
[0074] The following examples serve to illustrate further the
present invention and are not intended to limits its scope in any
way.
EXAMPLES
Selection of AcrA as Model Protein for Optimizing
N-Glycosylation
[0075] To optimize the acceptor protein requirements for
N-glycosylation detailed studies were performed on the C. jejuni
glycoprotein AcrA (Cj0367c). AcrA is a periplasmic lipoprotein of
350 amino acid residues. It has been shown that secretion to the
periplasm but not lipid-anchoring is a prerequisite for
glycosylation (Nita-Lazar et al., 2005, supra). The signal for
export can either be the native AcrA signal sequence or the
heterologous PelB signal when expressed in E. coli. Of the five
potential N-linked glycosylation sequons (N117, N123, N147, N273,
N274) the same two ones are used in C. jejuni and E. coli (N123 and
N273 (Nita-Lazar et al., 2005, supra)). AcrA was chosen as model
because it is the only periplasmic N-glycoprotein of C. jejuni for
which detailed structural information is available. Recently, the
crystal structure of an AcrA homologue, the MexA protein from the
Gram-negative bacterium. P. aeruginosa, was published (Higgins et
al., (2004). Structure of the periplasmic component of a bacterial
drug efflux pump. Proc. Natl. Acad. Sci. USA 101, 9994-9999). Both
proteins, are members of the so-called periplasmic efflux pump
proteins (PEP, (Johnson, J. M. and Church, G. M. (1999). Alignment
and structure prediction of divergent protein families: periplasmic
and outer membrane proteins of bacterial efflux pumps. J. Mol.
Biol. 287, 695-715)). The elongated molecule contains three
linearly arranged subdomains: an .alpha.-helical, anti-parallel
coiled-coil which is held together at the base by a lipoyl domain,
which is followed by a six-stranded .beta.-barrel domain. The 23-28
residues at the N-terminus and 95-101 residues in the C-terminus
are unstructured in the crystals. MexA and AcrA protein sequences
are 29.3% identical and 50% similar. Thus, the two proteins likely
exhibit a similar overall fold.
Example 1
Elucidation of the Primary Peptide Sequence that Triggers
Glycosylation
[0076] It is known that lipoyl domains similar to MexA of P.
aeruginosa and accordingly also in AcrA of C. jejuni form a compact
protein that can be, individually expressed in E. coli (reviewed by
Berg, A., and de Kok, A. (1997). 2-Oxo acid dehydrogenase
multienzyme complexes. The central role of the lipoyl domain. Biol.
Chem. 378, 617-634). To check which acceptor peptide sequence was
required for N-glycosylation by the pgl machinery in E. coli the
lipoyl domain of AcrA was taken. It was used as a molecular
scaffold to transport peptides of different lengths to the
periplasm and present them to the pgl machinery in vivo.
[0077] Therefore, a plasmid coding for the lipoyl domain (Lip) was
constructed and N-terminally fused to the signal sequence of OmpA
(Choi, J. H., and Lee, S. Y. (2004). Secretory and extracellular
production of recombinant proteins using Escherichia coli. Appl
Microbiol Biotechnol 64, 625-635) and C-terminally to a hexa
histag. Cloning was performed to place the gene expression under
the control of the arabinose promoter. For the Lip domain borders
amino acid positions were chosen that appeared at the same
positions as the domain borders of the Lipoyl domain part in MexA.
To test different peptides for their ability to accept an N-glycan
stretches of the sequence were inserted between the two
hammerhead-like parts of the Lip domain. The stretches consisted of
sequences comprising the N-glycosylation site N123 of C. jejuni
AcrA. The resulting open reading frames consisted of the sequences
coding for the OmpA signal sequence, the N-terminal hammerhead-like
part of AcrA (D60-D95, the numbering of the amino acids refers to
the mature AcrA polypeptide sequence numbering), the different
stretches containing the native N123 glycosylation site of AcrA
(see below), the C-terminal hammerhead-like part of AcrA-Lip
(L167-D210) and the C-terminal his-tag.
[0078] Construction of the plasmids was achieved by standard
molecular biology techniques. Three stretches containing the native
N123 glycosylation site of AcrA of different lengths were inserted
between the two halves of Lip resulting in three different
ORFs:
[0079] Construct A contains A118-S130 resulting in a protein
sequence of:
TABLE-US-00001 (sequence 1)
MKKTAIAIAVALAGFATVAQADVIIKPQVSGVIVNKLFKAGDKVKKGQTL
FIIEQDQASKDFNRSKALFSQLDHTEIKAPFDGTIGDALVNIGDYVSAST
TELVRVTNLNPIYADGSHHHHHH.
[0080] Construct B contains F122-E138 resulting in a protein
sequence of:
TABLE-US-00002 (sequence 2)
MKKTAIAIAVALAGFATVAQADVIIKPQVSGVIVNKLFKAGDKVKKGQTL
FIIEQDQFNRSKALFSQSAISQKELDHTEIKAPFDGTIGDALVNIGDYVS
ASTTELVRVINLNPIYADGSHHHHHH.
[0081] Construct C contains D121-A127 resulting in a protein
sequence of:
TABLE-US-00003 (sequence 3)
MKKTAIAIAVALAGFATVAQADVIIKPQVSGVIVNKLFKAGDKVKKGQTL
FIIEQDQDFNRSKALDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVT
NLNPIYADGSHHHHHH.
[0082] The underlined stretches of sequence indicate the OmpA
signal peptide, singly underlined residues were introduced for
cloning reasons or to render the protein, resistant to degradation.
Bold: glycosylation site corresponding to N123 of AcrA. Italics:
hexa-histag. The corresponding genes were expressed under the
control of the arabinose promoter in the backbone of the plasmid
pEC415 (Schulz, H., Hennecke, H., and Thony-Meyer, L. (1998).
Prototype of a heme chaperone essential for cytochrome c
maturation. Science 281, 1197-1200).
[0083] To check which of the three stretches triggered
glycosylation of the Lip proteins protein expression experiments
were performed. E. coli Top10 cells (Invitrogen, Carlsbad, Calif.,
USA) carrying pACYCpgl or pACYCpglmut (Wacker et al., 2002, supra)
and a plasmid coding constructs A, B or C were grown in LB medium
containing ampicillin and chloramphenicol up to an OD of 0.5 at
37.degree. C. For induction 1/1000 volume 20% arabinose (w/v)
solution was added and the cells were grown for another 2 hrs. The
cells were then harvested by centrifugation and resuspended in 20
mM Tris/HCl, pH 8.5, 20% sucrose (w/v), 1 mM EDTA, 1 mM PMSF, and 1
g/l (w/v) lysozyme and incubated at 4.degree. C. for 1 hr.
Periplasmic extracts were obtained after pelletting of the
spheroblasts and diluted with 1/9 volume (v/v) of 10.times. buffer
A (3 M NaCl, 0.5 M Tris/HCl, pH 8.0 and 0.1 M imidazole) and
MgSO.sub.4 added to 2.5 mM. Ni-affinity purification was performed
on 1 ml Ni-Sepharose columns from Amersham Pharmacia Biotech
(Uppsala, Sweden) in buffer A. Proteins were eluted in buffer A
containing 0.25 M imidazole.
[0084] FIG. 1 shows Coomassie brilliant blue stained SDS-PAGE gel
of the peak elution fractions from the Ni-purified periplasmic
extracts. The expression analysis showed that construct B produced
a prominent single protein species (FIG. 1, lane 1). Constructs A
and C both lead, in addition to the prominent protein, to a second
protein band with slower electrophoretic mobility (FIG. 1, lanes 2
and 3). That the heavier protein species was indeed glycosylated
was proven by MALDI-TOF/TOF (not shown). The only amino acid
missing in construct B but present in A and C was D121, the
aspartate residue 2 positions N-terminally to the glycosylated
N123. This demonstrates that D121 plays an important role for
glycosylation by the OTase. To verify that D121 is essential for
glycosylation it was mutated to alanine in construct C. Expression
analysis resulted in only one protein band (FIG. 1, lane 4), thus
showing that D121 is important for glycosylation. Furthermore, the
fact that an artificial peptide display protein can be glycosylated
shows that a short peptide of the D/E-X-N-Y-S/T type contains all
information for C. jejuni-borne N-glycosylation to occur.
Example 2
Verification of Example 1: AcrA-D121A is not Glycosylated at
N123
[0085] To confirm the findings from the peptide display approach an
aspartate to alanine mutation was inserted at position 121 (D121A,
i.e. 2 residues before the glycosylated N123) in the full length
soluble version of the AcrA protein and it was tested whether the
site N123 could still be glycosylated in E. coli. In order to test
this AcrA-D121A was expressed and its glycosylation status was
analyzed. For the analysis an engineered AcrA was used. It differed
from the original C. jejuni gene in that it contains the PelB
signal sequence (Choi and Lee, 2004, supra) for secretion into the
periplasm and a C-terminal hexa histag for purification. It has
been shown that this AcrA variant gets secreted, signal
peptide-cleaved and glycosylated as the lipid anchored, native
protein (Nita-Lazar et al., 2005, supra). The following is the
protein sequence of the soluble AcrA protein:
TABLE-US-00004 (sequence 4)
MKYLLPTAAAGLLLLAAQPAMAMHMSKEEAPKIQMPPQPVTTMSAKSEDL
PLSFTYPAKLVSDYDVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDK
FKASVDSAYGQALMAKATFENASKDFNRSKALFSKSAISQKEYDSSLATF
NNSKASLASARAQLANARIDLDHTEIKAPFDGTIGDALVNIGDWSASTTE
LVRVTNLNPIYADFFISDTDKLNLVRNTQSGKWDLDSIHANLNLNGETVQ
GKLYFIDSVIDANSGTVKAKAVFDNNNSTLLPGAFATITSEGFIQKNGFK
VPQIGVKQDQNDVYVLLVKNGKVEKSSVHISYQNNEYAIIDKGLQNGDKI
ILDNFKKIQVGSEVKEIGAQLEHHHHHH
[0086] The underlined residues are the PelB signal peptide, italics
the hexa-histag, and bold the two natural glycosylation sites at
N123 and N273. A plasmid containing the ORF for the above protein
in the pEC415 plasmid (Schulz et al., 1998) was constructed to
produce pAcrAper.
[0087] The assay to test the glycosylation status of AcrA and
mutants thereof (see below) was as follows: expression of AcrA was
induced with 0.02% arabinose in exponentially growing E. coli CLM24
(Feldman et al., 2005, supra) cells containing the plasmid-borne
pgl operon in its active or inactive form (pACYCpgl or pACYCpglmut,
see (Wacker et al., 2002, supra)) and a plasmid coding for AcrA
(pAcrAper). After four hours of induction, periplasmic extracts
were prepared as described above and analyzed by SDS-PAGE,
electrotransfer and immunodetection with either anti-AcrA antiserum
or R12 antiserum. The latter is specific for C. jejuni N-glycan
containing proteins (Wacker et al., 2002, supra).
[0088] The first two lanes of FIG. 2A show AcrA in the absence and
presence of a functional pgl operon. Only one band appears in the
absence but three in the presence of the functional pgl operon
(FIG. 2A, top panel). These correspond to unglycosylated AcrA (lane
1) and un-, mono- and diglycosylated AcrA (lane 2). That the two
heavier proteins in lane 2 were glycosylated was confirmed by the
R12 western blot (lane 2, bottom panel). When the mutant AcrA-N273Q
was expressed the same way, only the monoglycosylated AcrA was
detected in presence of the functional glycosylation pgl operon
(lane 3). Unglycosylated AcrA was detected in absence of the
functional pgl locus (lane 4). Analysis of the mutant AcrA-D121A
produced only two bands, one of them glycosylated (lane 5) as
observed with AcrA-N273Q in lane 3. This means that D121 is
essential for efficient glycosylation at position 123-125.
Example 3
Introducing Artificial Glycosylation Sites into AcrA
[0089] To test if the introduction of an aspartate residue could
generate a glycosylation site, AcrA mutants were generated in which
the residue in the -2 position of the not used glycosylation sites
in positions N117 and N147 of soluble AcrA were exchanged for
aspartate (F115D, T145D). It was then tested whether the modified
glycosylation sites could be glycosylated by the same assay as
described in example 2. Both mutations were individually inserted
either into the wildtype sequence of the soluble version of AcrA or
in the double mutant in which both used glycosylation sites were
deleted (N123Q and N273Q). Periplasmic extracts of cultures induced
for 4 hrs were prepared, separated by SDS page and analyzed by
Western blotting (FIG. 2B). As controls the samples of wildtype
glycosylated and non glycosylated AcrA were run on the same gel
(lanes 1 and 2). The T145D mutation affected the -2 position of the
natively not used glycosylation sequon N147-S149. Upon expression
of AcrA-T145D Western blotting with anti AcrA antiserum resulted in
four bands, the highest of them with slower electrophoretic
mobility than the doubly glycosylated protein in lane 2 (lane 3 in
FIG. 2B). The R12 blot confirmed that the fourth band was a triply
glycosylated AcrA. Despite the low intensity towards anti AcrA the
heaviest band gave the strongest signal with the glycosylation
specific R12 antiserum. When the same mutant AcrA-T145D was
expressed in the absence of the native N-glycosylation sequence
(AcrA-N123Q-N273Q-T145D), only monoglycosylated AcrA was detected
in the presence of a functional pgl operon (FIG. 2B, lane 4), that
was missing in absence of a functional pgl operon (lane 5). This
demonstrates that the heavier band in lane 4 was glycosylated.
Hence, by simply introducing the T145D mutation an optimized
glycosylation site was generated (DFNNS).
[0090] To further confirm that it is possible to, introduce a
glycosylation site by inserting an aspartate residue in the -2
position, the natively not used sites N117-S119 and N274-T276 were
changed to optimize N-glycosylation. For this purpose further
mutants were generated (FIG. 2C). Expression of AcrA-F115D-T145D in
the above described system, resulted in five protein species
detected with the anti AcrA antiserum (lane 2). This is indicative
for four glycosylations taking place on the same AcrA molecule.
When the detection was performed with the C. jejuni
N-glycan-specific R12 antiserum, a ladder of five bands was
detected. The lowest faint band is unglycosylated AcrA because it
is also present in the absence of glycosylation (lane 1), the
highest results in a strong signal probably due to the five
antigenic determinants in a fourfold glycosylated AcrA. Thus, the
two introduced sites (at N117 and N147) and the two natively used
sites (N123 and N273) are used and glycosylated by the pgl
machinery. Expression of AcrA-N123Q-N273Q-N272D with and without
the pgl operon demonstrated that a third artificially introduced
glycosylation site, N274 (DNNST), was also recognized by the pgl
operon (FIG. 2C, lanes 3 and 4).
[0091] The above experiments confirm the finding that the bacterial
N-glycosylation site recognized by the OTase of C. jejuni consists
partly of the same consensus as the eukaryotic one (N-X-S/T, with
X.noteq.P) but, in addition, an aspartate in the -2 position is
required for increasing efficiency. Furthermore, they demonstrate
that it is possible to glycosylate a protein at a desired site by
recombinantly introducing such an optimized consensus sequence.
Example 4
Verification of Position -1 in the Optimized N-Glycosylation
Sequence
[0092] A further experiment was performed to test whether the -1
position in the bacterial glycosylation site exhibits the same
restrictions as the +1 position in eukaryotes (Imperiali, B., and
Shannon, K. L. (1991). Differences between Asn-Xaa-Thr-containing
peptides: a comparison of solution conformation and substrate
behaviour with oligosaccharyl-transferase. Biochemistry 30,
4374-4380; Rudd, P. M., and Dwek, R. A. (1997). Glycosylation:
heterogeneity and the 3D structure of proteins. Crit. Rev. Biochem.
Mol. Biol. 32, 1-100). A proline residue at +1 is thought to
restrict the peptide in such a way that glycosylation is inhibited.
To test if a similar effect could also be observed in the -1
position a proline residue was introduced at that position of the
first natively used site in a point mutant that had the second
native site knocked out (AcrA-N273Q-F122P). The control expression
of AcrA-N273Q showed a monoglycosylated protein in the presence of
a functional pgl operon (FIG. 2D, lane 1 and 2). However,
AcrA-N273Q-F122P was not glycosylated (FIG. 2D, lanes 3 and 4).
This indicates that proline inhibited bacterial N-glycosylation
when it constitutes the residue between the asparagine and the
negatively charged residue of the -2 position.
[0093] Sequence alignments of all the sites known to be
glycosylated by the C. jejuni pgl machinery indicate that they all
comprise a D or E in the -2 position (Nita-Lazar et al., 2005,
supra; Wacker et al., 2002, supra; Young et al., (2002). Structure
of the N-linked glycan present on multiple glycoproteins in the
Gram-negative bacterium, Campylobacter jejuni. J. Biol. Chem. 277,
42530-42539). Thus, it was established that the glycosylation
consensus sequence for bacteria can be optimized by a negatively
charged amino acid in the -2 position, resulting in D/E-X-N-Z-S/T,
wherein X & Z.noteq.P.
Example 5
N-Glycosylation of a Non-C. jejuni Protein
[0094] To demonstrate that the primary sequence requirement
(optimized consensus sequence) is sufficient for N-glycosylation in
bacteria, it was tested whether a non-C. jejuni protein could be
glycosylated by applying the above strategy. Cholera toxin B
subunit (CtxB) was employed as a glycosylation target. The
corresponding gene was amplified from Vibrio cholerae in such a way
that it contained the coding sequence of the OmpA signal sequence
on the N-terminus and a hexahistag at the C-terminus, just the same
as constructs A through C in example 1. The resulting DNA was
cloned to replace construct A in the plasmids employed in example
1. A point mutation of W88 to D or a D insertion after W88
generated an optimized glycosylation site (DNNKT). The wildtype and
W88D CtxB proteins containing the signal sequence and his-tag were
expressed in E. coli Top 10 and other cell types in the presence
and absence of the functional pgl locus from C. jejuni. When
periplasmic extracts from Top10 cells were analyzed by SDS-PAGE,
electrotransfer and consecutive immunoblotting with a CtxB
antiserum, only CtxB W88D produced a higher and thus glycosylated
band in the pgl locus background (FIG. 2E, compare lanes 3 and 4).
A consensus sequence (DSNIT) was also inserted by replacing G54 or
Q56 of CtxB (the latter is denoted CtxB-Q56/DSNIT), i.e. in one of
the loops that was reported to contribute to the ganglioside GM1
binding activity of CtxB. Lanes 5 and 6 of FIG. 2E demonstrate that
the engineered protein (exemplified by the construct which contains
the peptide sequence DSNIT instead of Q56 expressed in Top10 cells)
produced a lower mobility and thus glycosylated band in
glycosylation competent but not glycosylation-deficient cells when
analyzed in the same way as described above. It was also
demonstrated that a CtxB containing two manipulations, i.e. the
insertion of D after W88 as well as DSNIT replacing Q56, was
double-glycosylated in SCM7 cells (Alaimo et al., EMBO Journal 25:
967-976 (2006)) (panel E, lanes 7 and 8). The double-glycosylated
protein CtxB shown in lane 7 was Ni.sup.2+ affinity-purified and
analyzed by ESI-MS/MS after in-gel trypsinization according to
standard protocols. The expected glycopeptides were detected
confirming that bacterial N-glycosylation can also be directed to a
non-C. jejuni protein by mutating or inserting the optimized
consensus sequence according to the invention for bacterial
N-glycosylation (not shown). Examples of other suitable exemplary
E. coli strains for practicing the present invention are W3110,
CLM24, BL21 (Stratagene, La Jolla, Calif., USA), SCM6 and SCM7.
[0095] The amino acid sequence of the CtxB protein used here is
indicated below (recombinant OmpA signal sequence underlined,
hexa-histag italics, W88 bold):
TABLE-US-00005 (sequence 5)
MKKTAIAIAVALAGFATVAQATPQNITDLCAEYHNTQIHTLNDKIFSYTE
SLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTE
AKVEKLCVVVNNKTPHAIAAISMANGSHHHHHH
Example 6
Introduction of Artificial N-Glycosylation Sites into the C. jejuni
Outer Membrane Protein, OmpH1
[0096] A potential application of the N-glycosylation in bacteria
is the display of the glycan on the surface of a bacterial host
cell in order to link the pheno- to the genotype and thereby select
for specific genetic mutations. To demonstrate that N-glycans can
be presented on outer membrane proteins the OmpH1 protein was
engineered in a way that it contained multiple optimized consensus
sites according to the invention. The sites were engineered into
loop regions of the protein as deduced from the known crystal
structure (Muller, A., Thomas, G. H., Horler, R., Brannigan, J. A.,
Blagova, E., Levdikov, V. M., Fogg, M. J., Wilson, K. S., and
Wilkinson, A. J. 2005. An ATP-binding cassette-type cysteine
transporter in Campylobacter jejuni inferred from the structure of
an extracytoplasmic solute receptor protein. Mol. Microbiol. 57:
143-155). Previous experiments showed that the best glycosylation
sequons were generated by the mutations V83T, K59N-G60I-N61T,
R190N-G191I-D192T and H263D-F264S-G265N-D266I-D267T. For surface
display it was desired to evaluate different combinations of those
introduced sites in order to establish the most. N-glycan-specific
sample. The combinations were generated in a wild type OmpH1
encoding plasmid construct and tested in a similar manner as
described for AcrA. FIG. 3 shows the analysis of various OmpH1
variants harboring multiple glycosylation sequons in addition to
the existing wild type sequon. OmpH1 variants were generated with
three (lane 3, 4, 5 and 7) and four glycosylation sequons (lane 6).
A wild type OmpH1 with only one glycosylation sequon and a mutant
lacking the critical asparagine for glycosylation were also
included in the experiment. All variants tested here did not only
demonstrate a high level of glycosylation efficiency but also that
every glycosylation sequon was utilized. The results were confirmed
with Campylobacter N-glycan specific immuneserum (FIG. 3 lower
panel).
[0097] The following is the protein sequence of the OmpH1 protein
of Campylobacter jejuni (strain 81-176) with attached myc tag in
italics:
TABLE-US-00006 (sequence 6)
MKKILLSVLTTFVAWLAACGGNSDSKTLNSLDKIKQNGWRIGVFGDKPPF
GYVDEKGNNQGYDIALAKRIAKELFGDENKVQFVLVEAANRVEFLKSNKV
DIILANFTQTPERAEQVDFCLPYMKVALGVAVPKDSNITSVEDLKDKTLL
LNKGTTADAYFTQDYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFA
WVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFH
KAYDETLKAHFGDDVKADDWIEGGKILEQKLISEEDL
[0098] The native glycosylation site in the protein is bold, the
signal sequence underlined.
Example 7
Surface Display of N-Glycans from C. jejuni on OmpH1 on the Outer
Membrane of E. coli Cells
[0099] In order to answer the question whether multiple
glycosylated OmpH1 variants can be displayed on the surface of
bacterial cells, immunofluorescence was performed on bacterial
CLM24 or SCM6 (which is SCM7 .DELTA.waaL) cells expressing various
OmpH1 variants. A wild type OmpH1 and a mutant lacking the critical
asparagine for glycosylation were included in the experiment. In
addition, a C20S mutant was constructed in order to retain the
protein in the periplasm, thus serving as a control in the
experiment. Immunostaining was carried out on the cells treated
with paraformaldehyde. Paraformaldehyde fixes cells without
destroying the cell structure or compartmentalization. The c-Myc-
and N-glycan-specific immuneserum in combination with corresponding
secondary antibodies conjugated to FITC and Cy3 were used to detect
the protein (red fluorescence) and N-glycan (green) on the
bacterial cell surface, respectively. Additionally,
4,6-diamino-2-phenylindole (DAPI, blue) was employed to, stain for
bacterial DNA to unambiguously differentiate between bacterial
cells and cellular debris. When the cells expressing wild type
OmpH1 were stained, immunofluorescence specific to the protein as
well as the N-glycan was detected (FIG. 4 A). When a mutant lacking
the critical asparagine N139S was stained with both anti-Myc- and
N-glycan-specific immuneserum only the protein but not glycan
specific signals were obtained (panel 4 B) indicating specificity
of the N-glycan-specific immune serum. When the protein was
retained within the periplasm as in the C20S mutant, no protein
specific, red immunofluorescence was detected indicating that the
antibodies were unable to diffuse within the cell and were
competent enough to detect any surface phenomenon (panel 4 C).
Next, cells expressing multiple OmpH1 variants different in
glycosylation were stained:
OmpH1.sup.KGN.fwdarw.NIT,HFGDD.fwdarw.DSNIT (panel 4 D),
OmpH1.sup.RGD.fwdarw.NIT,HFGDD.fwdarw.DSNIT (panel 4 E),
OmpH1.sup.KGN.fwdarw.NIT,RGD.fwdarw.NIT (panel 4 F),
OmpH1.sup.V83T,KGN.fwdarw.NIT (panel 4 G) and
OmpH1.sup.KGN.fwdarw.NIT,RGD.fwdarw.NIT,HFGDD.fwdarw.DSNIT (panel 4
H). All the OmpH1 variants were double-stained indicating the
presence of glycosylated protein on the bacterial surface. FIG. 4
is represented in grayscale, the first column is a merge picture of
the other pictures of the same row.
Sequence CWU 1
1
111123PRTArtificial SequenceLip with N123 glycosylation site of
AcrA and hexa His tag 1Met Lys Lys Thr Ala Ile Ala Ile Ala Val Ala
Leu Ala Gly Phe Ala 1 5 10 15 Thr Val Ala Gln Ala Asp Val Ile Ile
Lys Pro Gln Val Ser Gly Val 20 25 30 Ile Val Asn Lys Leu Phe Lys
Ala Gly Asp Lys Val Lys Lys Gly Gln 35 40 45 Thr Leu Phe Ile Ile
Glu Gln Asp Gln Ala Ser Lys Asp Phe Asn Arg 50 55 60 Ser Lys Ala
Leu Phe Ser Gln Leu Asp His Thr Glu Ile Lys Ala Pro 65 70 75 80 Phe
Asp Gly Thr Ile Gly Asp Ala Leu Val Asn Ile Gly Asp Tyr Val 85 90
95 Ser Ala Ser Thr Thr Glu Leu Val Arg Val Thr Asn Leu Asn Pro Ile
100 105 110 Tyr Ala Asp Gly Ser His His His His His His 115 120
2126PRTArtificial SequenceLip with N123 glycosylation site of AcrA
and hexa His tag 2Met Lys Lys Thr Ala Ile Ala Ile Ala Val Ala Leu
Ala Gly Phe Ala 1 5 10 15 Thr Val Ala Gln Ala Asp Val Ile Ile Lys
Pro Gln Val Ser Gly Val 20 25 30 Ile Val Asn Lys Leu Phe Lys Ala
Gly Asp Lys Val Lys Lys Gly Gln 35 40 45 Thr Leu Phe Ile Ile Glu
Gln Asp Gln Phe Asn Arg Ser Lys Ala Leu 50 55 60 Phe Ser Gln Ser
Ala Ile Ser Gln Lys Glu Leu Asp His Thr Glu Ile 65 70 75 80 Lys Ala
Pro Phe Asp Gly Thr Ile Gly Asp Ala Leu Val Asn Ile Gly 85 90 95
Asp Tyr Val Ser Ala Ser Thr Thr Glu Leu Val Arg Val Thr Asn Leu 100
105 110 Asn Pro Ile Tyr Ala Asp Gly Ser His His His His His His 115
120 125 3116PRTArtificial SequenceLip with N123 glycosylation site
of AcrA and hexa His tag 3Met Lys Lys Thr Ala Ile Ala Ile Ala Val
Ala Leu Ala Gly Phe Ala 1 5 10 15 Thr Val Ala Gln Ala Asp Val Ile
Ile Lys Pro Gln Val Ser Gly Val 20 25 30 Ile Val Asn Lys Leu Phe
Lys Ala Gly Asp Lys Val Lys Lys Gly Gln 35 40 45 Thr Leu Phe Ile
Ile Glu Gln Asp Gln Asp Phe Asn Arg Ser Lys Ala 50 55 60 Leu Asp
His Thr Glu Ile Lys Ala Pro Phe Asp Gly Thr Ile Gly Asp 65 70 75 80
Ala Leu Val Asn Ile Gly Asp Tyr Val Ser Ala Ser Thr Thr Glu Leu 85
90 95 Val Arg Val Thr Asn Leu Asn Pro Ile Tyr Ala Asp Gly Ser His
His 100 105 110 His His His His 115 4379PRTArtificial SequenceAcrA
protein with PelB signal sequence and hexa His tag 4Met Lys Tyr Leu
Leu Pro Thr Ala Ala Ala Gly Leu Leu Leu Leu Ala 1 5 10 15 Ala Gln
Pro Ala Met Ala Met His Met Ser Lys Glu Glu Ala Pro Lys 20 25 30
Ile Gln Met Pro Pro Gln Pro Val Thr Thr Met Ser Ala Lys Ser Glu 35
40 45 Asp Leu Pro Leu Ser Phe Thr Tyr Pro Ala Lys Leu Val Ser Asp
Tyr 50 55 60 Asp Val Ile Ile Lys Pro Gln Val Ser Gly Val Ile Val
Asn Lys Leu 65 70 75 80 Phe Lys Ala Gly Asp Lys Val Lys Lys Gly Gln
Thr Leu Phe Ile Ile 85 90 95 Glu Gln Asp Lys Phe Lys Ala Ser Val
Asp Ser Ala Tyr Gly Gln Ala 100 105 110 Leu Met Ala Lys Ala Thr Phe
Glu Asn Ala Ser Lys Asp Phe Asn Arg 115 120 125 Ser Lys Ala Leu Phe
Ser Lys Ser Ala Ile Ser Gln Lys Glu Tyr Asp 130 135 140 Ser Ser Leu
Ala Thr Phe Asn Asn Ser Lys Ala Ser Leu Ala Ser Ala 145 150 155 160
Arg Ala Gln Leu Ala Asn Ala Arg Ile Asp Leu Asp His Thr Glu Ile 165
170 175 Lys Ala Pro Phe Asp Gly Thr Ile Gly Asp Ala Leu Val Asn Ile
Gly 180 185 190 Asp Tyr Val Ser Ala Ser Thr Thr Glu Leu Val Arg Val
Thr Asn Leu 195 200 205 Asn Pro Ile Tyr Ala Asp Phe Phe Ile Ser Asp
Thr Asp Lys Leu Asn 210 215 220 Leu Val Arg Asn Thr Gln Ser Gly Lys
Trp Asp Leu Asp Ser Ile His 225 230 235 240 Ala Asn Leu Asn Leu Asn
Gly Glu Thr Val Gln Gly Lys Leu Tyr Phe 245 250 255 Ile Asp Ser Val
Ile Asp Ala Asn Ser Gly Thr Val Lys Ala Lys Ala 260 265 270 Val Phe
Asp Asn Asn Asn Ser Thr Leu Leu Pro Gly Ala Phe Ala Thr 275 280 285
Ile Thr Ser Glu Gly Phe Ile Gln Lys Asn Gly Phe Lys Val Pro Gln 290
295 300 Ile Gly Val Lys Gln Asp Gln Asn Asp Val Tyr Val Leu Leu Val
Lys 305 310 315 320 Asn Gly Lys Val Glu Lys Ser Ser Val His Ile Ser
Tyr Gln Asn Asn 325 330 335 Glu Tyr Ala Ile Ile Asp Lys Gly Leu Gln
Asn Gly Asp Lys Ile Ile 340 345 350 Leu Asp Asn Phe Lys Lys Ile Gln
Val Gly Ser Glu Val Lys Glu Ile 355 360 365 Gly Ala Gln Leu Glu His
His His His His His 370 375 5132PRTArtificial SequenceCtxB protein
with hexa His tag and OmpA signal sequence 5Met Lys Lys Thr Ala Ile
Ala Ile Ala Val Ala Leu Ala Gly Phe Ala 1 5 10 15 Thr Val Ala Gln
Ala Thr Pro Gln Asn Ile Thr Asp Leu Cys Ala Glu 20 25 30 Tyr His
Asn Thr Gln Ile His Thr Leu Asn Asp Lys Ile Phe Ser Tyr 35 40 45
Thr Glu Ser Leu Ala Gly Lys Arg Glu Met Ala Ile Ile Thr Phe Lys 50
55 60 Asn Gly Ala Thr Phe Gln Val Glu Val Pro Gly Ser Gln His Ile
Asp 65 70 75 80 Ser Gln Lys Lys Ala Ile Glu Arg Met Lys Asp Thr Leu
Arg Ile Ala 85 90 95 Tyr Leu Thr Glu Ala Lys Val Glu Lys Leu Cys
Val Trp Asn Asn Lys 100 105 110 Thr Pro His Ala Ile Ala Ala Ile Ser
Met Ala Asn Gly Ser His His 115 120 125 His His His His 130
6290PRTArtificial SequenceOmpH1 with myc tag 6Met Lys Lys Ile Leu
Leu Ser Val Leu Thr Thr Phe Val Ala Val Val 1 5 10 15 Leu Ala Ala
Cys Gly Gly Asn Ser Asp Ser Lys Thr Leu Asn Ser Leu 20 25 30 Asp
Lys Ile Lys Gln Asn Gly Val Val Arg Ile Gly Val Phe Gly Asp 35 40
45 Lys Pro Pro Phe Gly Tyr Val Asp Glu Lys Gly Asn Asn Gln Gly Tyr
50 55 60 Asp Ile Ala Leu Ala Lys Arg Ile Ala Lys Glu Leu Phe Gly
Asp Glu 65 70 75 80 Asn Lys Val Gln Phe Val Leu Val Glu Ala Ala Asn
Arg Val Glu Phe 85 90 95 Leu Lys Ser Asn Lys Val Asp Ile Ile Leu
Ala Asn Phe Thr Gln Thr 100 105 110 Pro Glu Arg Ala Glu Gln Val Asp
Phe Cys Leu Pro Tyr Met Lys Val 115 120 125 Ala Leu Gly Val Ala Val
Pro Lys Asp Ser Asn Ile Thr Ser Val Glu 130 135 140 Asp Leu Lys Asp
Lys Thr Leu Leu Leu Asn Lys Gly Thr Thr Ala Asp 145 150 155 160 Ala
Tyr Phe Thr Gln Asp Tyr Pro Asn Ile Lys Thr Leu Lys Tyr Asp 165 170
175 Gln Asn Thr Glu Thr Phe Ala Ala Leu Met Asp Lys Arg Gly Asp Ala
180 185 190 Leu Ser His Asp Asn Thr Leu Leu Phe Ala Trp Val Lys Asp
His Pro 195 200 205 Asp Phe Lys Met Gly Ile Lys Glu Leu Gly Asn Lys
Asp Val Ile Ala 210 215 220 Pro Ala Val Lys Lys Gly Asp Lys Glu Leu
Lys Glu Phe Ile Asp Asn 225 230 235 240 Leu Ile Ile Lys Leu Gly Gln
Glu Gln Phe Phe His Lys Ala Tyr Asp 245 250 255 Glu Thr Leu Lys Ala
His Phe Gly Asp Asp Val Lys Ala Asp Asp Val 260 265 270 Val Ile Glu
Gly Gly Lys Ile Leu Glu Gln Lys Leu Ile Ser Glu Glu 275 280 285 Asp
Leu 290 75PRTArtificial SequenceOptimized N-Glycosylation Consensus
Sequence 7Xaa Xaa Asn Xaa Xaa 1 5 85PRTArtificial
SequenceArtificial N-glycosylation consensus sequences 8Asp Phe Asn
Asn Ser 1 5 95PRTArtificial SequenceArtificial N-glycosylation
consensus sequences 9Asp Asn Asn Ser Thr 1 5 105PRTArtificial
SequenceArtificial N-glycosylation consensus sequences 10Asp Asn
Asn Lys Thr 1 5 115PRTArtificial SequenceArtificial N-glycosylation
consensus sequences 11Asp Ser Asn Ile Thr 1 5
* * * * *