U.S. patent application number 15/110932 was filed with the patent office on 2016-11-10 for mycobacterial antigen composition.
The applicant listed for this patent is The Secretary of State for Health. Invention is credited to Joanna BACON, Yper HALL, Philip MARSH.
Application Number | 20160326236 15/110932 |
Document ID | / |
Family ID | 50239107 |
Filed Date | 2016-11-10 |
United States Patent
Application |
20160326236 |
Kind Code |
A1 |
HALL; Yper ; et al. |
November 10, 2016 |
MYCOBACTERIAL ANTIGEN COMPOSITION
Abstract
The present invention provides an antigenic composition for use
as a mycobacterial vaccine, said composition comprising (i) a first
mycobacterial antigenic polypeptide, wherein said first
mycobacterial antigenic polypeptide comprises a polypeptide
sequence having at least 70% amino acid sequence identity to the
amino acid sequence of SEQ ID NO: 6, 12, 2, 18, 8, 10, 6, 4, or a
fragment thereof having at least 50 consecutive amino acids
thereof; or (ii) a first mycobacterial polynucleotide, wherein said
first mycobacterial polynucleotide comprises a polynucleotide
sequence encoding said first mycobacterial antigenic polypeptide,
or 10 wherein said first mycobacterial polynucleotide comprises a
polynucleotide sequence selected from SEQ ID NO: 5, 11, 1, 17, 7,
9, 15, 3.
Inventors: |
HALL; Yper; (Salisbury,
GB) ; BACON; Joanna; (Salisbury, GB) ; MARSH;
Philip; (Salisbury, GB) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Secretary of State for Health |
London |
|
GB |
|
|
Family ID: |
50239107 |
Appl. No.: |
15/110932 |
Filed: |
January 16, 2015 |
PCT Filed: |
January 16, 2015 |
PCT NO: |
PCT/GB2015/050100 |
371 Date: |
July 11, 2016 |
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/53 20130101;
A61K 39/04 20130101; A61K 2039/6006 20130101; C07K 16/1289
20130101; A61P 31/04 20180101; A61K 2039/57 20130101; C07K 2319/21
20130101; A61K 39/00 20130101; G01N 33/5695 20130101; G01N 2333/35
20130101 |
International
Class: |
C07K 16/12 20060101
C07K016/12; A61K 39/04 20060101 A61K039/04; G01N 33/569 20060101
G01N033/569 |
Foreign Application Data
Date |
Code |
Application Number |
Jan 17, 2014 |
GB |
1400819.7 |
Claims
1. An antigenic composition comprising either: (i) a first
mycobacterial antigenic polypeptide, wherein said first
mycobacterial antigenic polypeptide comprises a polypeptide
sequence having at least 90% amino acid sequence identity to the
amino acid sequence of SEQ ID NO: 6, 12, 2, 18, 8, 10, 16, 4, or a
fragment thereof having at least 150 consecutive amino acids
thereof, wherein said fragment has a common antigenic
cross-reactivity with a polypeptide selected from SEQ ID NOs: 6,
12, 2, 18, 8, 10, 16, 4; or (ii) a first mycobacterial
polynucleotide, wherein said first mycobacterial polynucleotide
comprises a polynucleotide sequence encoding said first
mycobacterial antigenic polypeptide, or wherein said first
mycobacterial polynucleotide comprises a polynucleotide sequence
selected from SEQ ID NO: 5, 11, 1, 17, 7, 9, 15, 3; wherein said
antigenic composition is for use in treating, suppressing or
preventing a mycobacterial infection in a subject.
2. The antigenic composition according to claim 1, wherein said
first mycobacterial polynucleotide comprises a polynucleotide
sequence having at least 90% nucleotide sequence identity to the
nucleic acid sequence of SEQ ID NO: 5, 11, 1, 17, 7, 9, 15, 3, or a
fragment thereof having at least 450 consecutive nucleotides
thereof, wherein said fragment encodes a polypeptide that has a
common cross-reactivity with a polypeptide selected from SEQ ID
NOs: 6, 12, 2, 18, 8, 10, 16, 4.
3. The antigenic composition according to claim 1, further
comprising at least one additional (second) mycobacterial
polypeptide, which is different from said first mycobacterial
antigenic polypeptide; or at least one additional (second)
mycobacterial polynucleotide encoding a second mycobacterial
antigenic polypeptide, wherein said second mycobacterial
polypeptide is different from said first mycobacterial
polypeptide.
4. The antigenic composition according to claim 1, wherein said
antigenic composition comprises at least one vector and wherein
said mycobacterial polynucleotide(s) is/are incorporated into said
at least one vector.
5. The antigenic composition according to claim 4, wherein said
vector is an expression vector or a viral vector.
6. The antigenic composition according to claim 1, wherein said
antigenic composition comprises at least one cell, and wherein said
cell comprises at least one of said mycobacterial antigenic
polypeptides and/or mycobacterial polynucleotides.
7. A method for producing a therapeutic or prophylactic
formulation, the method comprising combining a pharmaceutically
acceptable carrier with either: (i) mycobacterial antigenic
polypeptide according to claim 1; or (ii) a first mycobacterial
polynucleotide according to claim 1.
8. (canceled)
9. An in vitro method of diagnosing a mycobacterial infection,
comprising incubating a test sample containing an immune cell such
as a T-lymphocyte from a subject with: (a) antigenic composition
according to claim 1; or (b) a first mycobacterial antigenic
polypeptide or first mycobacterial polynucleotide according to
claim 1; and detecting for activation of said immune cell, wherein
activation of said immune cell is indicative of a mycobacterial
infection in the subject.
10. An in vitro method of diagnosing a mycobacterial infection,
comprising incubating a test sample from a subject with: (a)
antigenic composition according to any of claim 1; or (b) a first
mycobacterial antigenic polypeptide or first mycobacterial
polynucleotide according to claim 1; wherein said incubating is
performed under conditions that allow binding of said first
mycobacterial antigen with antibodies in the sample to form
antigen-antibody complexes; and then detecting for the formation of
such complexes, wherein the presence of antigen-antibody complexes
is indicative of a mycobacterial infection in the subject.
11. An in vitro method of diagnosing a mycobacterial infection,
comprising incubating a test sample from a subject with: (a) an
antigenic/immunogenic composition according to claim 1; or (b) a
first antibody, wherein said first antibody binds a first
mycobacterial antigenic polypeptide according to claim 1; wherein
said incubating is performed under conditions that allow binding of
said first and second antibodies with antigens in the sample to
form antigen-antibody complexes; and then detecting for the
formation of such complexes, wherein the presence of
antigen-antibody complexes is indicative of a mycobacterial
infection in the subject.
12. A method for treating, suppressing or preventing a
mycobacterial infection in a subject, said method comprising
administering an antigenic composition according to any of claim 1
to said subject.
13. The antigenic composition of claim 4, wherein said vector is a
plasmid.
14. The antigenic composition of claim 5, wherein said viral vector
is an attenuated vaccinia virus vector or an adenoviral vector.
15. The antigenic composition of claim 6, wherein said cell is an
attenuated microbial carrier.
16. The antigenic composition of claim 15, wherein said attenuated
microbial carrier is attenuated salmonella, attenuated M. bovis or
attenuated M. tuberculosis.
17. The antigenic composition of claim 16, wherein said attenuated
M. bovis is a BCG strain of M. bovis.
18. The method of claim 7, wherein said formulation is a
vaccine.
19. The method of claim 9, wherein said mycobacterial infection is
an early stage mycobacterial infection.
20. The method of claim 10, wherein said mycobacterial infection is
an early stage mycobacterial infection.
21. The method of claim 11, wherein said mycobacterial infection is
an early stage mycobacterial infection.
Description
[0001] The present invention relates to mycobacterial
polynucleotides and polypeptides, to fragments or variants thereof,
to antibodies that bind thereto, to vectors and microbial carriers,
to therapeutic compositions such as vaccines against mycobacterial
infections, and to compositions and methods for detecting
mycobacterial infection.
[0002] Microorganisms such as species of Salmonella, Yersinia,
Shigella, Campylobacter, Chlamydia and Mycobacterium are capable of
causing intracellular infections. These infections may be
exclusively intracellular, or may contain both intracellular and
extracellular components. Generally, these microorganisms do not
circulate freely in the body (e.g. in the bloodstream) and are
often not amenable to drug treatment regimes.
[0003] The difficulties associated with treating intracellular
infection have been exacerbated by the development of multiple
drug-resistant microorganisms. Vaccine therapies have not proved
effective against intracellular microorganisms because of the
difficulties in the ability of the host defenses to access the
pathogen.
[0004] Mycobacterium tuberculosis (MTB) and closely related species
make up a small group of mycobacteria known as the Mycobacterium
tuberculosis complex (MTC). This group comprises five distinct
species: M. tuberculosis, M. microti, M. bovis, M. caneti, and M.
africanum. M. avium subsp. paratuberculosis causes Johne's disease
in ruminants, M. bovis causes tuberculosis in cattle, M. avium and
M. intracellulare cause tuberculosis in immunocompromised patients
(eg. AIDS patients, and bone marrow transplant patients), and M.
leprae causes leprosy in humans. Another important mycobacterial
species is M. vaccae.
[0005] As the aetiological agent of tuberculosis infection,
Mycobacterium tuberculosis (M. tuberculosis) is the leading cause
of death by bacterial infectious disease worldwide--latent
infection affecting as much as one third of the world's population.
The World Health Organisation (WHO) estimates that over eight
million new cases of TB, and over one million deaths, occur
globally each year. The largest number of new TB cases in 2005
occurred in South-East Asia (34% of incident cases globally), and
the estimated incidence rate in sub-Saharan Africa is nearly 350
cases per 100,000 population. However, TB infection is not limited
to the developing world: the UK has seen a resurgence of
tuberculosis since the late 1980s and there are currently over 8000
new cases each year--a rate of 14.0 per 100,000 population. About
40% of these new cases occur in the London region, where the rate
of infection is 44.8 per 100,000 population.
[0006] Optimal patient management requires early initiation of drug
therapy and isolation of infectious individuals as soon as
possible. Left untreated, each person with active TB disease will
infect on average between 10 and 15 people every year. TB infection
can normally be treated by a 6 month course of antibiotics;
however, patient compliance to long-term drug treatment is varied,
with patients often stopping therapy when their symptoms cease.
Failure to complete the treatment can promote the development of
multiple drug-resistant mycobacteria.
[0007] The term `latency` is synonymous with `persistence`, and
describes a reversible state of low metabolic activity in which
mycobacterial cells can survive for extended periods with limited
or no cell division. During latency (ie. latent infection), the
clinical symptoms associated with a mycobacterial infection do not
become manifest. However, re-activation of latent mycobacteria may
be induced by environmental stimuli. During active infection,
mycobacteria demonstrate high metabolic activity and replicate
rapidly, resulting in the development of active infection with
clinical symptoms.
[0008] In vitro studies have demonstrated that mycobacteria such as
M. tuberculosis are able to adapt to and survive under nutrient-
and oxygen-depleted conditions, and can grow over a range of
nutrient availabilities and oxygen tensions. Adaptation to carbon
starvation and/or to a low dissolved oxygen tension in vitro
triggers transition to a non-replicating persistent state that may
be analogous to latency in vivo. Intracellular survival and
multiplication of mycobacteria is suspected to be a main supportive
factor for mycobacterial disease progression. The presence of a
large reservoir of asymptomatic individuals latently-infected with
mycobacteria is a major problem for the control of mycobacterial
infections, especially M. tuberculosis infections. In addition,
conventional methods for the detection of a latent mycobacterial
infection by skin testing may be compromised by BCG vaccination and
by exposure to environmental mycobacteria.
[0009] The effectiveness of vaccine prevention against M.
tuberculosis has varied widely. The current M. tuberculosis
vaccine, BCG, is an attenuated strain of M. bovis. It is effective
against severe complications of TB in children, but it varies
greatly in its effectiveness in adults in different countries,
particularly across ethnic groups. BCG vaccination has been used to
prevent tuberculous meningitis and helps prevent the spread of M.
tuberculosis to extra-pulmonary sites, but does not prevent
infection. The limited efficacy of BCG and the global prevalence of
TB has led to an international effort to generate new, more
effective vaccines. This, in turn, requires the identification of
new vaccine candidates. In view of the increasing threat and global
prevalence of mycobacterial infection, new strategies are required
for more effective prevention, treatment, and diagnosis of
mycobacterial infection.
[0010] The invention provides an antigenic composition comprising a
mycobacterial antigen, wherein said antigen comprises: [0011] a
polypeptide sequence having at least 70% amino acid sequence
identity to the amino acid sequence of a polypeptide selected from
SEQ ID NOs: 2, 4, 6, 8, 10. 12, 14, 16 and 18, or a fragment
thereof having at least 50 consecutive amino acids thereof; or
[0012] (ii) a polynucleotide sequence encoding a polypeptide
sequence according to (i); or a polynucleotide sequence having at
least 70% nucleotide sequence identity to the nucleic acid sequence
of a polynucleotide selected from SEQ ID NOs: 1, 3, 5, 7, 9, 11,
13, 15 and 17, or a fragment thereof having at least 150
consecutive nucleotides thereof.
[0013] As used herein, the term "mycobacterial" or "mycobacterium"
embraces the species M. phlei, M. smegmatis, M. africanum, M.
caneti, M. fortuitum, M. marinum, M. ulcerans, M. tuberculosis, M.
bovis, M. microti, M. avium, M. paratuberculosis, M. leprae, M.
lepraemurium, M. intracellulare, M. scrofulaceum, M. xenopi, M.
genavense, M. kansasii, M. simiae, M. szulgai, M. haemophilum, M.
asiaticum, M. malmoense, M. vaccae, M. caneti, and M. shimoidei. Of
particular interest are the members of the MTC, such as M.
tuberculosis.
[0014] The term antigen means any substance that can be recognized
by the immune system and/or that stimulates an immune response. For
example, an antigen may stimulate a cell mediated immune response
and/or may stimulate the generation of antibodies.
[0015] In one embodiment, a mycobacterial antigen of the invention
provides a cell mediated response to infection involving immune
cells such as T cells (CD4+ and/or CD8+ T cells) and/or the ability
to respond with Th1-type cytokines such as IFN-.gamma.. In one
embodiment, a mycobacterial antigen induces IFN-.gamma.-secreting
cells (eg. predominantly CD4+ T cells). In this regard, recent
studies suggest that immune cell responses (particularly T cell
immune responses in, for example, the lung) may be critical for
protection against pulmonary mycobacterial disease.
[0016] In one embodiment, a mycobacterial antigen of the invention
provides protection (such as long term protection) against
challenge by mycobacteria such as M. tuberculosis. By way of
example, a mycobacterial antigen of the invention may induce
`memory T cells`, which can continue to stimulate protective
immunity in the long term (eg. for decades). Memory immune
responses have been attributed to the reactivation of long-lived,
antigen-specific T lymphocytes that arise directly from
differentiated effector T-cells and persist in a quiescent state.
Memory T cells are heterogeneous; at least two subsets have been
identified, having different migratory capacity and effector
function. Memory T cells of the first subset are known as `effector
memory T cells` (TEM) because they resemble the effector T cells
generated in the primary response, in that they lack the lymph
node-homing receptors for migration into inflamed tissues. Upon
re-encounter with antigen, the TEM rapidly produce IFN-.gamma. or
IL-4, or release pre-stored perforin. Memory T cells of the second
subset (known as `central memory cells` (TCM)) express L-selectin
and CCR7 and lack immediate effector function. The TCM have a low
activation threshold and proliferate and differentiate to effectors
when re-stimulated in secondary lymphoid organs.
[0017] In one embodiment, a mycobacterial antigen provides a
neutralizing antibody response to mycobacterial (eg. M.
tuberculosis) infection. In one embodiment, each mycobacterial
antigen in the antigenic composition of the present invention
independently induces an effective immune response (eg. a cell
mediated immune response or antibody response). Thus, in accordance
with this embodiment, following administration of the antigenic
composition to a subject, an immune response is induced in the
subject to each mycobacterial antigen in the antigenic
composition.
[0018] In one embodiment, a mycobacterial antigen comprises (eg.
consists of) a polypeptide sequence. Alternatively, or in addition,
a mycobacterial antigen comprises a polynucleotide (e.g. DNA or
RNA) sequence.
[0019] The specific sub-set of mycobacterial polypeptides
represented by SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 and 18 are
`latency-regulated polypeptides`. The specific subset of
mycobacterial polynucleotides represented by SEQ ID NOs: 1, 3, 5,
7, 9, 11, 13, 15 and 17 are `latency-regulated
polynucleotides`.
[0020] In one embodiment, a `latency-regulated polypeptide` is
encoded by a `latency-regulated polynucleotide`. By way of example,
the latency-regulated polypeptide SEQ ID NO: 2 is encoded by
latency-regulated polynucleotide SEQ ID NO: 1; SEQ ID NO: 4 is
encoded by SEQ ID NO: 3; SEQ ID NO: 6 is encoded by SEQ ID NO: 5;
SEQ ID NO: 8 is encoded by SEQ ID NO: 7; SEQ ID NO: 10 is encoded
by SEQ ID NO: 9; SEQ ID NO: 12 is encoded by SEQ ID NO: 11; SEQ ID
NO: 14 is encoded by SEQ ID NO: 13; SEQ ID NO: 16 is encoded by SEQ
ID NO: 15; and SEQ ID NO: 18 is encoded by SEQ ID NO: 17.
[0021] The expression or activity of a latency-regulated
polypeptide or polynucleotide is modulated in response to
mycobacterial latency--eg. in response to growth of mycobacteria
(eg. MTB) under conditions that induce or maintain mycobacterial
latency.
[0022] In one embodiment, "modulation" of expression or activity of
the latency-regulated polypeptide or polynucleotide in response to
conditions of mycobacterial latency means that the expression or
activity is induced or upregulated in response to latency. Thus,
the latency-regulated polypeptide or polynucleotide may be a
`latency-induced` or `latency-upregulated` polypeptide or
polynucleotide.
[0023] For example, the expression or activity of a
latency-upregulated polypeptide or polynucleotide may be
up-regulated by at least 1.5-fold, 2-fold, 5-fold, 10-fold, 20-fold
or 50-fold under latency conditions as compared to non-latency
conditions. Alternatively, vaccine efficacy of the
polypeptides/polynucleotides of the present invention may be
measured in terms of murine splenocyte interferon-gamma
(IFN-.gamma.) release--for example, said polypeptide/polynucleotide
demonstrate at least 380, at least 400, at least 420, at least 450,
at least 500, at least 550, at least 600 or higher spot forming
units/10.sup.6 (murine splenocyte IFN-.gamma. release)--see FIG. 1.
Alternatively, vaccine efficacy of the polypeptides/polynucleotides
of the present invention may be measured in terms of protective
efficacy (%) relative to BCG alone (i.e. when administered as a
boost to a BCG prime vaccine)--for example, said
polypeptide/polynucleotide demonstrates at least 120, at least 150,
at least 180, at least 200, at least 220, at least 250, at least
300% increase in protective efficacy, such as measured by bacterial
load (eg. in murine spleen and/or lung)--see FIGS. 2 & 3.
[0024] The expression or activity of latency-induced and
latency-upregulated polypeptides and polynucleotides may be induced
or upregulated in vivo during latency in the mycobacterium's
natural environment. As such, the present inventors believe that
latency-induced or latency-upregulated mycobacterial polypeptides
and polynucleotides represent good vaccine candidates for
preventing the establishment, spread and reactivation of disease
and/or make good diagnostic tools for latent infection.
[0025] In one embodiment, the mycobacterial antigen comprises (or
consists of) a polypeptide sequence having at least 70% amino acid
sequence identity (such as at least 75, 80, 82, 84, 86, 88, 90, 92,
94, 96, 98, 99 or 100% amino acid sequence identity) to the amino
acid sequence of a polypeptide selected from SEQ ID NOs: 2, 4, 6,
8, 10, 12, 14, 16 and 18, or a fragment thereof having at least 50
consecutive amino acids thereof. SEQ ID NOs: 2, 4, 6, 8, 10, 12,
14, 16 and 18 are defined in Table 1, below:
TABLE-US-00001 TABLE 1 SEQ Polypeptide ID No. name 2 Rv0982 4
Rv1462 6 Rv1937 8 Rv2500c 10 Rv2504c 12 Rv3270 14 Rv3537 16 Rv3608c
18 Rv3879c
[0026] Thus, in the context of the present application, an "Rv0982
polypeptide antigen" comprises or consists of SEQ ID NO: 2 (or a
sequence `variant` or `fragment` thereof as defined herein); an
"Rv1462 polypeptide antigen" comprises or consists of SEQ ID NO: 4
(or a sequence `variant` or `fragment` thereof as defined herein);
an "Rv1937 polypeptide antigen" comprises or consists of SEQ ID NO:
6 (or a sequence `variant` or `fragment` thereof as defined
herein); an "Rv2500c polypeptide antigen" comprises or consists of
SEQ ID NO: 8 (or a sequence `variant` or `fragment` thereof as
defined herein); an "Rv2504c polypeptide antigen" comprises or
consists of SEQ ID NO: 10 (or a sequence `variant` or `fragment`
thereof as defined herein); an "Rv3270 polypeptide antigen"
comprises or consists of SEQ ID NO: 12 (or a sequence `variant` or
`fragment` thereof as defined herein); an "Rv3537 polypeptide
antigen" comprises or consists of SEQ ID NO: 14 (or a sequence
`variant` or `fragment` thereof as defined herein); an "Rv3608c
polypeptide antigen" comprises or consists of SEQ ID NO: 16 (or a
sequence `variant` or `fragment` thereof as defined herein); and an
"Rv3879c polypeptide antigen" comprises or consists of SEQ ID NO:
18 (or a sequence `variant` or `fragment` thereof as defined
herein).
[0027] In one embodiment, the amino acid sequence identity exists
over a region of the polypeptide sequences that is at least 50
consecutive amino acid residues in length (eg. at least 75, 100,
150, 200, 250, 300 consecutive amino acid residues in length).
Conventional methods for determining amino acid sequence identity
are discussed in more detail later in the specification.
[0028] In the context of the first mycobacterial antigen, a
fragment of a polypeptide comprises (or consists of) at least 50
consecutive amino acid residues of said polypeptide (eg. at least
75, 100, 125, 150, 175, 200, 225, 250, 275, 300 consecutive amino
acid residues of said polypeptide). Said fragment includes at least
one epitope of the polypeptide. A fragment of a polypeptide has a
sequence length that is at least 25%, 50%, 60%, 70%, 80%, or 90% of
that of the sequence of the full-length polypeptide.
[0029] In one embodiment, in the context of the first mycobacterial
antigen, a fragment of a polypeptide comprises (or consists of) a
truncated form of said polypeptide. For example, a fragment of a
polypeptide may have an N-terminal truncation (as compared with the
polypeptide), or a fragment of a polypeptide may have a C-terminal
truncation (as compared with the polypeptide).
[0030] In one embodiment, in the context of the first mycobacterial
antigen, a fragment of a polypeptide comprises (or consists of) a
mature form of the polypeptide. For example, the polypeptide may
comprise a signal sequence (ie. a secretion/targeting sequence)
(eg. at the N-terminus), and a fragment of the polypeptide may lack
this signal sequence. In one embodiment, the fragment is formed by
cleavage of a signal sequence from the polypeptide. In one
embodiment, a fragment of polypeptide SEQ ID NO: 2 is an
N-terminally truncated form of SEQ ID NO: 2. In one embodiment, a
fragment of polypeptide SEQ ID NO: 2 has an N-terminal truncation
of 50, 100, 150, 200 or 250 amino acid residues as compared with
the amino acid sequence of SEQ ID NO: 2. In one embodiment, a
fragment of SEQ ID NO: 2 comprises at least the C-terminal 50, 100,
150, 200 or 250 amino acid sequence of SEQ ID NO: 2. Similarly, in
one embodiment, a fragment of polypeptide SEQ ID NO: 4, 6, 8, 10,
12, 14, 16, 18 is an N-terminally truncated form of SEQ ID NO: 4,
6, 8, 10, 12, 14, 16, 18 (respectively). In one embodiment, a
fragment of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 18 is a mature
polypeptide sequence, which differs from the sequence of SEQ ID NO:
4, 6, 8, 10, 12, 14, 16, 18 (respectively) by removal of an
N-terminal signal sequence. In one embodiment, a fragment of
polypeptide SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 18 has an
N-terminal truncation of 5, 10, 15, 20, 25, 30, 35, 40, 50, 100,
150, 200 or 250 amino acid residues as compared with the amino acid
sequence of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 18 (respectively).
In one embodiment, a fragment of SEQ ID NO: 4, 6, 8, 10, 12, 14,
16, 18 comprises at least the C-terminal 50, 100, 150, 200 or 250
amino acid sequence of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 18
(respectively).
[0031] In one embodiment, the mycobacterial antigen of the
invention comprises a polypeptide or fragment thereof that has a
common antigenic cross-reactivity and/or substantially the same in
vivo biological activity as a polypeptide selected from SEQ ID NOs:
2, 4, 6, 8, 10, 12, 14, 16, 18. As used herein, `common antigenic
cross-reactivity` means that the mycobacterial polypeptide or
fragment of the invention and the latency-regulated polypeptide
selected from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18 share a
common ability to induce a "recall response" of an immune cell such
as a T-lymphocyte (eg. CD4+, CD8+, effector T cell or memory T cell
such as a TEM or TCM), which has been previously exposed to an
antigenic component of a mycobacterial infection. New immunological
assays for measuring and quantifying immune cell responses (eg. T
cell responses) have been established over the last 10+ years. For
example, the interferon-gamma (IFN-.gamma.) ELISPOT assay is useful
as an immunological readout because the secretion of IFN-.gamma.
from antigen-specific immune cells such as T cells is a good
correlate of protection against M. tuberculosis. Furthermore, the
ELISPOT assay is a very reproducible and sensitive method of
quantifying the number of IFN-.gamma. secreting antigen-specific
immune cells such as T cells. Alternatively, or in addition,
`common antigenic cross-reactivity` means that an antibody capable
of binding to the mycobacterial polypeptide or fragment of the
invention would also be capable of binding to the corresponding
latency-regulated polypeptide (SEQ ID NO: 2, 4, 6, 8, 10, 12, 14,
16, 18).
[0032] In one embodiment, the mycobacterial antigen comprises, or
consists of, a polynucleotide sequence that encodes the
corresponding mycobacterial polypeptide as defined above.
[0033] Thus, in one embodiment, the first mycobacterial antigen
comprises (or consists of) a polynucleotide sequence that encodes a
polypeptide that comprises (or consists of) an amino acid sequence
having at least 70% amino acid sequence identity (such as at least
75, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 99 or 100% amino acid
sequence identity) to the amino acid sequence of a
latency-regulated polypeptide selected from SEQ ID NOs: 2, 4, 6, 8,
10, 12, 14, 16, 18, or a fragment thereof having at least 50
consecutive amino acids thereof (eg. as defined above). In one
embodiment, the mycobacterial antigen comprises (or consists of) a
polynucleotide sequence having at least 70% nucleotide sequence
identity (at least 75, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 99
or 100% nucleotide sequence identity) to the nucleic acid sequence
of a latency-regulated polynucleotide selected from SEQ ID NOs: 1,
3, 5, 7, 9, 11, 13, 15, 17, or a fragment thereof having at least
150 consecutive nucleotides thereof. In use, said polynucleotide is
in a form (e.g. vector) that provides corresponding mycobacterial
antigenic peptide/protein. Thus, in one embodiment, the
mycobacterial antigen is a `mycobacterial polynucleotide` (or
fragment), as defined above. SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15
and 17 are defined in Table 2, below:
TABLE-US-00002 TABLE 2 SEQ Polynucleotide ID No. name 1 Rv0982 3
Rv1462 5 Rv1937 7 Rv2500c 9 Rv2504c 11 Rv3270 13 Rv3537 15 Rv3608c
17 Rv3879c
[0034] Thus, in the context of the present application, an "Rv0982
polynucleotide antigen" comprises or consists of SEQ ID NO: 1 (or a
sequence `variant` or `fragment` thereof as defined herein); an
"Rv1462 polynucleotide antigen" comprises or consists of SEQ ID NO:
3 (or a sequence `variant` or `fragment` thereof as defined
herein); an "Rv1937 polynucleotide antigen" comprises or consists
of SEQ ID NO: 5 (or a sequence `variant` or `fragment` thereof as
defined herein); an "Rv2500c polynucleotide antigen" comprises or
consists of SEQ ID NO: 7 (or a sequence `variant` or `fragment`
thereof as defined herein); an "Rv2504c polynucleotide antigen"
comprises or consists of SEQ ID NO: 9 (or a sequence `variant` or
`fragment` thereof as defined herein); an "Rv3270 polynucleotide
antigen" comprises or consists of SEQ ID NO: 11 (or a sequence
`variant` or `fragment` thereof as defined herein); an "Rv3537
polynucleotide antigen" comprises or consists of SEQ ID NO: 13 (or
a sequence `variant` or `fragment` thereof as defined herein); an
"Rv3608c polynucleotide antigen" comprises or consists of SEQ ID
NO: 15 (or a sequence `variant` or `fragment` thereof as defined
herein); and an "Rv3879c polynucleotide antigen" comprises or
consists of SEQ ID NO: 17 (or a sequence `variant` or `fragment`
thereof as defined herein).
[0035] In one embodiment, the nucleotide sequence identity exists
over a region of the polynucleotide sequences that is at least 150
consecutive nucleotide residues in length (eg. at least 200, 250,
300, 350, 400, 450, 500, 550, 600, 650, 700 or 750 consecutive
nucleotide residues in length). Conventional methods for
determining nucleotide sequence identity are discussed in more
detail later in the specification.
[0036] In the context of the mycobacterial antigen, a fragment of
said polynucleotide comprises (or consists of) at least 150
consecutive nucleotide residues of said polynucleotide (eg. at
least 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700 or 750
consecutive nucleotide residues of said polynucleotide). In one
embodiment, the length of the sequence of the polynucleotide
fragment is at least 25%, 50%, 60%, 70%, 80%, or 90% that of the
polynucleotide.
[0037] In one embodiment, in the context of the mycobacterial
antigen, a fragment of a polynucleotide comprises (or consists of)
a truncated form of said polynucleotide. In one embodiment, a
fragment of a polynucleotide is truncated at the 5' end and/or the
3' end, as compared with the full-length polynucleotide sequence.
In one embodiment, a fragment of a polynucleotide encodes a
truncated form of said polypeptide. For example, a fragment of a
polynucleotide may encode a polypeptide that is N-terminally
truncated and/or C-terminally truncated polypeptide (as compared
with the polypeptide encoded by the full-length polynucleotide). In
one embodiment, in the context of the first mycobacterial antigen,
a fragment of a polynucleotide encodes a polypeptide that comprises
(or consists of) a mature polypeptide. For example, the full-length
polypeptide comprises a signal sequence (ie. a secretion/targeting
sequence) (eg. at the N-terminus), and the polynucleotide fragment
encodes a mature polypeptide that lacks this signal sequence.
[0038] In one embodiment, a fragment of polynucleotide SEQ ID NO: 1
is a 5' truncated form of SEQ ID NO: 1. In one embodiment, a
fragment of polynucleotide SEQ ID NO: 1 has a 5' truncation of 100,
200 or 300 nucleotide residues as compared with the nucleotide
sequence of SEQ ID NO: 1. In one embodiment, a fragment of
polynucleotide SEQ ID NO: 1 encodes an N-terminally truncated form
of SEQ ID NO: 2. In one embodiment, a fragment of polynucleotide
SEQ ID NO: 1 encodes a polypeptide having an N-terminal truncation
of 50, 100, 150, 200 or 250 amino acid residues as compared with
the amino acid sequence of SEQ ID NO: 2. In one embodiment, a
fragment of SEQ ID NO: 1 comprises the 3' terminal 100, 200 or 300
nucleotide residues as compared with the nucleotide sequence of SEQ
ID NO: 1. In one embodiment, a fragment of polynucleotide SEQ ID
NO: 1 encodes a polypeptide comprising at least the C-terminal 50,
100, 150, 200, 250 or 300 amino acid sequence of SEQ ID NO: 2.
[0039] In one embodiment, a fragment of polynucleotide SEQ ID NO:
3, 5, 7, 9, 11, 13, 15, 17 is a 5' truncated form of SEQ ID NO: 3,
5, 7, 9, 11, 13, 15, 17 (respectively). In one embodiment, a
fragment of polynucleotide SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17
has a 5' truncation of 25, 50, 75, 100 or 125 nucleotide residues
as compared with the nucleotide sequence of SEQ ID NO: 3, 5, 7, 9,
11, 13, 15, 17 (respectively). In one embodiment, a fragment of
polynucleotide SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17 encodes an
N-terminally truncated form of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16,
18 (respectively). In one embodiment, a fragment of polynucleotide
SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17 encodes a mature polypeptide
sequence, which differs from the sequence of SEQ ID NO: SEQ ID NO:
4, 6, 8, 10, 12, 14, 16, 18 (respectively) by removal of an
N-terminal signal sequence. In one embodiment, a fragment of
polynucleotide SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17 encodes a
polypeptide that has an N-terminal truncation of 5, 10, 15, 20, 25,
30, 35, 40, 50, 100, 150, 200 or 250 amino acid residues as
compared with the amino acid sequence of SEQ ID NO: 4, 6, 8, 10,
12, 14, 16, 18 (respectively). In one embodiment, a fragment of SEQ
ID NO: 3, 5, 7, 9, 11, 13, 15, 17 comprises the 3' terminal 150,
300, 450, 600 or 750 nucleotide residues as compared with the
nucleotide sequence of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17
(respectively). In one embodiment, a fragment of SEQ ID NO: 3, 5,
7, 9, 11, 13, 15, 17 encodes a polypeptide that comprises at least
the C-terminal 50, 100, 150, 200 or 250 amino acid sequence of SEQ
ID NO: 4, 6, 8, 10, 12, 14, 16, 18 (respectively).
[0040] In one embodiment, said mycobacterial polynucleotide, or
fragment thereof, encodes a polypeptide that has a common antigenic
cross-reactivity and/or substantially the same in vivo biological
activity as a latency-regulated polypeptide selected from SEQ ID
NOs: 2, 4, 6, 8, 10, 12, 14, 16, or 18. For example, said first
mycobacterial antigen may comprise (or consist of) a polynucleotide
sequence that encodes a polypeptide sequence that is capable of
evoking a protective immune cell response (eg. T-cell response)
against mycobacterial infection. By way of example, the polypeptide
encoded by the first mycobacterial polynucleotide or fragment
shares, with the latency-regulated polypeptide, a common ability to
induce a "recall response" of an immune cell such as a T-lymphocyte
(eg. CD4+, CD8+, effector T cell or memory T cell such as TEM or
TCM) that has previously been exposed to an antigenic component of
a mycobacterial infection. In this regard, the secretion of
IFN-.gamma. from antigen-specific immune cells such as T cells is a
good correlate of protection against M. tuberculosis. Accordingly,
the interferon-gamma (IFN-.gamma.) ELISPOT assay is a useful
immunological readout, and enables reproducible and sensitive
quantification of IFN-.gamma. secreting antigen-specific immune
cells such as T cells. Alternatively, or in addition, an antibody
capable of binding to a polypeptide encoded by the mycobacterial
polynucleotide or fragment of the invention would also be capable
of binding to the latency-regulated polypeptide (SEQ ID NO: 2, 4,
6, 8, 10, 12, 14, 16 or 18).
[0041] The antigenic composition of the invention may comprise at
least a second mycobacterial antigen, in addition to the first
mycobacterial antigen. The second mycobacterial antigen may be any
one of the aforementioned mycobacterial antigens, and is preferably
different from said first mycobacterial antigen.
[0042] In one embodiment, the second mycobacterial antigen is
capable of evoking a protective immune response (eg. a T-cell
response) against mycobacterial infection. In one embodiment, the
second mycobacterial antigen comprises (eg. consists of) a
polypeptide sequence. In one embodiment, the second mycobacterial
antigen comprises (eg. consists of) a polynucleotide sequence such
as a DNA or RNA sequence, or a mycobacterial glycolipid, such as a
mycobacterial sulphoglycolipid. In one embodiment, the second
mycobacterial antigen comprises (eg. consists of) a mycobacterial
carbohydrate antigen such as a mycobacterial saccharide or
polysaccharide. Optionally, the saccharide may be linked (eg.
chemically conjugated) to a carrier (eg. a polypeptide) to enhance
immunogenicity.
[0043] In one embodiment, the `difference` between the second
mycobacterial antigen and the first mycobacterial antigen is
defined by the specificity of the immune response to the first and
second mycobacterial antigens. For example, in one embodiment, each
of the first and second antigens induces an immune response that is
substantially specific to that antigen. The `difference` between
the second mycobacterial antigen and the first mycobacterial
antigen may be defined in terms of a substantial lack (eg. an
absence) of common antigenic cross-reactivity between the first and
second mycobacterial antigens. The `difference` between the second
mycobacterial antigen and the first mycobacterial antigen may
alternatively (or in addition) be defined as a substantial lack
(eg. an absence) of common in vivo biological activity between the
first and second mycobacterial antigens.
[0044] For example, in one embodiment, the first and second
mycobacterial antigens may exhibit (substantially) no common
antigenic cross-reactivity. In one embodiment, the first and second
mycobacterial antigens may exhibit (substantially) no common in
vivo biological activity. For example, the first and second
mycobacterial antigens induce different immune responses and/or
have different in vivo biological activities.
[0045] In one embodiment, the first and second mycobacterial
antigens comprise polypeptides (as defined herein), and the second
mycobacterial antigen has substantially no common antigenic
cross-reactivity with the first mycobacterial antigen and/or has a
substantially different in vivo biological activity from the first
mycobacterial antigen. In one embodiment, the first and second
mycobacterial antigens comprise polynucleotides (as defined
herein), and the second mycobacterial antigen encodes a polypeptide
that has substantially no common antigenic cross-reactivity with
the polypeptide encoded by the first mycobacterial antigen. In one
embodiment, the first and second mycobacterial antigens comprise
polynucleotides (as defined herein), and the second mycobacterial
antigen has a substantially different in vivo biological activity
from the first mycobacterial antigen and/or encodes a polypeptide
that has a substantially different in vivo biological activity from
the polypeptide encoded by the first mycobacterial antigen.
[0046] In one embodiment, the first mycobacterial antigen comprises
a polypeptide and the second mycobacterial antigen comprises a
polynucleotide (as defined herein), and the second mycobacterial
antigen or polypeptide encoded thereby has substantially no common
antigenic cross-reactivity with the first mycobacterial antigen
and/or has a substantially different in vivo biological activity
from the first mycobacterial antigen.
[0047] In one embodiment, the first mycobacterial antigen comprises
a polynucleotide and the second mycobacterial antigen comprises a
polypeptide (as defined herein), and the second mycobacterial
antigen has substantially no common antigenic cross-reactivity with
the first mycobacterial antigen or polypeptide encoded thereby,
and/or has a substantially different in vivo biological activity
from the first mycobacterial antigen or polypeptide encoded
thereby. By way of example, in one embodiment, the first and second
mycobacterial antigens do not share a common ability to induce a
"recall response" of an immune cell such as a T-lymphocyte (eg.
CD4+, CD8+, effector or memory T cell such as TEM or TCM) that has
previously been exposed to an antigenic component of a
mycobacterial infection. In other words, in one embodiment, the
first and second mycobacterial antigens are `different` because
they induce recall responses in different immune cells (eg. T
cells).
[0048] In one embodiment, the second mycobacterial polypeptide
comprises (or consists of) an antigenic mycobacterial
polypeptide--ie. a mycobacterial polypeptide that is capable of
evoking a protective T-cell response against mycobacterial
infection.
[0049] In one embodiment, the second mycobacterial antigen
comprises a polypeptide that is selected from the same group of
polypeptides as discussed above in connection with the first
mycobacterial antigen (preferably the second mycobacterial
polypeptide is different from the first mycobacterial
polypeptide).
[0050] Thus, in one embodiment, the second mycobacterial antigen
comprises (or consists of) a polypeptide sequence having at least
70% amino acid sequence identity (such as at least 75, 80, 82, 84,
86, 88, 90, 92, 94, 96, 98, 99 or 100% amino acid sequence
identity) to the amino acid sequence of a latency-regulated
polypeptide selected from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16,
18, or a fragment thereof having at least 50 consecutive amino
acids thereof (such as at least 75, 100, 125, 150, 175, 200, 225 or
250 consecutive amino acid residues thereof).
[0051] In one embodiment, the second mycobacterial antigen
comprises a polypeptide that is not selected from the same group of
polypeptides as discussed above in connection with the first
mycobacterial antigen. For example, in one embodiment, the second
mycobacterial antigen comprises (or consists of) a polypeptide
sequence having at least 70% amino acid sequence identity (such as
at least 75, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 99 or 100%
amino acid sequence identity) to an amino acid sequence selected
from SEQ ID NOs: 19-41, or a fragment thereof having at least 50
consecutive amino acids thereof. SEQ ID NOs: 19-41 are illustrated
in Table 3, below:
TABLE-US-00003 TABLE 3 SEQ Polypeptide ID NO: name: 19
Ag85A/Rv3804c 20 Ag85B/Rv1886c 21 ESAT-6/Rv3875 22 TB10.4/Rv0288 23
Rv0125 24 PPE18/Rv1196 25 P27/Rv1411c 26 Hsp65/Rv0440 27
HBHA/Rv0475 28 Rv2659c 29 Rv2660c 30 HspX/Rv2031c 31 RPFA/Rv0867c
32 RPFB/Rv1009 33 RPFC/Rv1884c 34 RPFD/Rv2389c 35 RPFE/Rv2450c 36
Rv1733 37 Rv2029c 38 Rv2032 39 Rv2626c 40 Rv2627c 41 Rv2628
[0052] The polypeptide "Ag85A" represented by SEQ ID NO: 19 of the
present application (Accession Nos. CAA17868 and BX842584) is a
member of a family of proteins ("the Ag85 complex"), which also
comprises Ag85B (SEQ ID NO: 20 of the present application) and
Ag85C. This family of proteins is secreted by M. tuberculosis, M.
bovis BCG, and many other species of mycobacteria. Ag85A is highly
conserved amongst all mycobacterial species and is immunodominant
in animal and human studies.
[0053] The polypeptides represented by SEQ ID NOs: 30 and 36-41 are
comprised within the DosR regulon (also known as the DevR regulon),
which includes the polypeptides represented by Rv2623-2631 and
Rv3126-3134. The expression of these polypeptides is regulated via
DosR (DevR). The polypeptides represented by SEQ ID NOs: 31-35 are
members of the RPF family of polypeptides (RPFA, RPFB, RPFC, RPFD
and RPFE, respectively).
[0054] In one embodiment, the amino acid sequence identity exists
over a region of the polypeptide sequences that is at least 50
consecutive amino acid residues in length (eg. at least 75, 100,
125, 150, 175, 200, 225 or 250 consecutive amino acid residues in
length). In one embodiment, in the context of the second
mycobacterial antigen, a fragment of said polypeptide comprises at
least 50 consecutive amino acid residues of said polypeptide
sequence. In one embodiment, the fragment comprises (or consists
of) at least 75, 100, 125, 150, 175, 200, 225 or 250 consecutive
amino acid residues of said polypeptide sequence. In one
embodiment, a fragment of a polypeptide is at least 20%, 30%, 40%,
50%, 60%, 70%, 80%, or 90% of the length of the mycobacterial
polypeptide. A fragment of a polypeptide includes at least one
epitope of the polypeptide.
[0055] In one embodiment, in the context of the second
mycobacterial antigen, a fragment of a polypeptide comprises (or
consists of) a truncated form of said polypeptide. For example, a
fragment of a polypeptide may have an N-terminal truncation (as
compared with the polypeptide), or a fragment of a polypeptide may
have a C-terminal truncation (as compared with the polypeptide). In
one embodiment, in the context of the second mycobacterial antigen,
a fragment of a polypeptide comprises (or consists of) a mature
form of the polypeptide. For example, the polypeptide may comprise
a signal sequence (ie. a secretion/targeting sequence) (eg. at the
N-terminus), and a fragment of the polypeptide may lack this signal
sequence. In one embodiment, the fragment is formed by cleavage of
a signal sequence from the polypeptide.
[0056] In one embodiment, a fragment of polypeptide SEQ ID NO:
19-41 is an N-terminally truncated form of SEQ ID NO: 19-41. In one
embodiment, a fragment of SEQ ID NO: 19-41 is a mature polypeptide
sequence, which differs from the sequence of SEQ ID NO: 19-41 by
removal of an N-terminal signal sequence. In one embodiment, a
fragment of polypeptide SEQ ID NO: 19-41 has an N-terminal
truncation of 10, 20, 30 or 40 amino acid residues as compared with
the amino acid sequence of SEQ ID NO: 19-41. In one embodiment, a
fragment of SEQ ID NO: 19-41 comprises at least the C-terminal 50,
100, 150, 200 or 250 amino acid sequence of SEQ ID NO: 19-41. In
one embodiment, the second mycobacterial polypeptide or fragment
thereof has a common antigenic cross-reactivity and/or
substantially the same in vivo biological activity as the
polypeptide selected from SEQ ID NOs: 19-41. In one embodiment,
`common antigenic cross-reactivity` means that the second
mycobacterial polypeptide, or fragment, shares a common ability,
with the polypeptide selected from SEQ ID NOs: 19-41, to induce a
"recall response" of an immune cell such as a T-lymphocyte which
has been previously exposed to an antigenic component of a
mycobacterial infection. For example, the interferon-gamma
(IFN-.gamma.) ELISPOT assay is useful as an immunological readout
because the secretion of IFN-.gamma. from antigen-specific immune
cells such as T cells is a good correlate of protection against M.
tuberculosis. Furthermore, the ELISPOT assay is a very reproducible
and sensitive method of quantifying the number of IFN-.gamma.
secreting antigen-specific immune cells such as T cells.
Alternatively, or in addition, `common antigenic cross-reactivity`
means that an antibody capable of binding to the second
mycobacterial polypeptide, or fragment, would also be capable of
binding to the polypeptide selected from SEQ ID NOs: 19-41.
[0057] In one embodiment, the second mycobacterial polynucleotide
comprises (or consists of) an antigenic mycobacterial
polynucleotide that is capable (following translation) of evoking a
protective immune cell response (eg. T-cell response) against
mycobacterial infection. In one embodiment, the second
mycobacterial polynucleotide encodes an antigenic mycobacterial
polypeptide that is capable of evoking a protective immune cell
response (eg. T-cell response) against mycobacterial infection.
Thus, in one embodiment, the second mycobacterial antigen is a
`second mycobacterial polynucleotide` (or fragment), as defined
above. In one embodiment, the second mycobacterial antigen
comprises a polynucleotide selected from the polynucleotides
discussed above in connection with the first mycobacterial antigen
(though preferably different from the first mycobacterial
polynucleotide).
[0058] Thus, in one embodiment, the second mycobacterial antigen
comprises (or consists of) a polynucleotide sequence that encodes a
polypeptide selected from the polypeptides discussed above in
connection with the first mycobacterial antigen (though the
polypeptide encoded by the second mycobacterial polynucleotide is
different from the polypeptide encoded by the first mycobacterial
polynucleotide). Thus, said second mycobacterial polynucleotide
comprises a polynucleotide sequence (e.g. as a vector or plasmid)
encoding a second mycobacterial polypeptide of the invention, as
defined above.
[0059] In one embodiment, said encoded second mycobacterial
polypeptide comprises a polypeptide sequence having at least 70%
amino acid sequence identity to the amino acid sequence of SEQ ID
NO: 2. 4. 6, 8, 10, 12, 14, 16, 18, or a fragment thereof having at
least 50 consecutive amino acids thereof. In one embodiment, the
second mycobacterial antigen comprises (or consists of) a
polynucleotide sequence having at least 70% nucleotide sequence
identity (such as at least 75, 80, 82, 84, 86, 88, 90, 92, 94, 96,
98, 99 or 100% nucleotide sequence identity) to the nucleic acid
sequence of a latency-regulated polynucleotide selected from SEQ ID
NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, or a fragment thereof having at
least 150 consecutive nucleotides thereof (such as at least 200,
250, 300, 350, 400, 450, 500, 550, 600, 650, 700 or 750 consecutive
nucleotides thereof). In one embodiment, the second mycobacterial
polypeptide comprises (or consists of) a polynucleotide sequence
having at least 70% nucleotide sequence identity to the nucleic
acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, or a
fragment thereof having at least 150 consecutive nucleotides
thereof. In one embodiment, the limitations discussed above with
respect to the first mycobacterial polypeptide apply equally to
this embodiment of the second mycobacterial polypeptide.
[0060] In one embodiment, the second mycobacterial antigen
comprises a polynucleotide that is not selected from the same group
of polynucleotides as discussed above in connection with the first
mycobacterial antigen. In one embodiment, the second mycobacterial
antigen comprises a polynucleotide that encodes a polypeptide that
is not selected from the same group of polypeptides as discussed
above in connection with the first mycobacterial antigen. In one
embodiment, the second mycobacterial antigen comprises a
polynucleotide sequence that encodes a second mycobacterial
polypeptide as defined above.
[0061] Thus, in one embodiment, the second mycobacterial antigen
comprises (or consists of) a polynucleotide sequence, wherein said
polynucleotide sequence encodes a polypeptide that comprises (or
consists of) an amino acid sequence having at least 70% amino acid
sequence identity (such as at least 75, 80, 82, 84, 86, 88, 90, 92,
94, 96, 98, 99 or 100% amino acid sequence identity) to an amino
acid sequence selected from SEQ ID NOs: 19-41, or a fragment
thereof having at least 50 consecutive amino acid residues thereof.
In one embodiment, the second mycobacterial antigen comprises (or
consists of) a polynucleotide sequence having at least 70%
nucleotide sequence identity (such as at least 75, 80, 82, 84, 86,
88, 90, 92, 94, 96, 98, 99 or 100% nucleotide sequence identity) to
a nucleic acid sequence selected from SEQ ID NOs: 42-64, or a
fragment thereof having at least 150 consecutive nucleotides
thereof. SEQ ID NOs: 42-64 are illustrated in Table 4, below:
TABLE-US-00004 TABLE 4 SEQ Polynucleotide ID NO: name: 42
Ag85A/Rv3804c 43 Ag85B/Rv1886c 44 ESAT-6/Rv3875 45 TB10.4/Rv0288 46
Rv0125 47 PPE18/Rv1196 48 P27/Rv1411c 49 Hsp65/Rv0440 50
HBHA/Rv0475 51 Rv2659c 52 Rv2660c 53 HspX/Rv2031c 54 RPFA/Rv0867c
55 RPFB/Rv1009 56 RPFC/Rv1884c 57 RPFD/Rv2389c 58 RPFE/Rv2450c 59
Rv1733 60 Rv2029c 61 Rv2032 62 Rv2626c 63 Rv2627c 64 Rv2628
[0062] The polynucleotide "Ag85A" represented by SEQ ID NO: 42 of
the present application (Accession Nos. CAA17868 and BX842584) is a
member of a family of genes ("the Ag85 complex"), which also
comprises Ag85B (SEQ ID NO: 43 of the present application) and
Ag85C. This family of genes encodes proteins that are secreted by
M. tuberculosis, M. bovis BCG, and many other species of
mycobacteria. Ag85A is highly conserved amongst all mycobacterial
species and is immunodominant in animal and human studies.
[0063] The polynucleotides represented by SEQ ID NOs: 53 and 59-64
are comprised within the DosR regulon (also known as the DevR
regulon), which includes the polynucleotides represented by
Rv2623-2631 and Rv3126-3134. The expression of these
polynucleotides is regulated via DosR (DevR). The polynucleotides
represented by SEQ ID NOs: 54-49 are members of the RPF family of
polynucleotides (RPFA, RPFB, RPFC, RPFD and RPFE,
respectively).
[0064] In one embodiment, the nucleotide sequence identity exists
over a region of the polynucleotide sequences that is at least 150
consecutive nucleotide residues in length (eg. at least 200, 250,
300, 350, 400, 450, 500, 550, 600, 650, 700 or 750 consecutive
nucleotide residues in length).
[0065] In one embodiment, in the context of the second
mycobacterial antigen, a fragment of a polynucleotide comprises at
least 150 consecutive nucleotide residues of said polynucleotide
sequence. In one embodiment, the fragment comprises (or consists
of) at least 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700
or 750 consecutive nucleotide residues of said polynucleotide
sequence. In one embodiment, a fragment of said polynucleotide is
at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the length of
the polynucleotide.
[0066] In one embodiment, in the context of the second
mycobacterial antigen, a fragment of a polynucleotide comprises (or
consists of) a truncated form of said polynucleotide. For example,
a fragment of a polynucleotide may have a 5' truncation and/or 3'
truncation as compared with the polynucleotide. In one embodiment,
in the context of the second mycobacterial antigen, a fragment of a
polynucleotide encodes a polypeptide that is truncated as compared
with the polypeptide sequence encoded by the full-length
polynucleotide. For example, the polynucleotide fragment may encode
a polypeptide that is N-terminally truncated and/or C-terminally
truncated, as compared with the polypeptide encoded by the
full-length polynucleotide. In one embodiment, in the context of
the second mycobacterial antigen, a fragment of a polynucleotide
encodes a mature polypeptide. For example, the polypeptide may
comprise a signal sequence (ie. a secretion/targeting sequence)
(eg. at the N-terminus), and the polynucleotide fragment may encode
a polypeptide fragment that lacks this signal sequence.
[0067] In one embodiment, a fragment of polynucleotide SEQ ID NO:
42-64 is a 5' truncated form of SEQ ID NO: 42-64 (respectively). In
one embodiment, a fragment of polynucleotide SEQ ID NO: 42-64 has
an N-terminal truncation of 25, 50, 75, 100 or 125 nucleotide
residues as compared with the nucleotide sequence of SEQ ID NO:
42-64 (respectively). In one embodiment, a fragment of
polynucleotide SEQ ID NO: 42-64 comprises at least the C-terminal
150, 300, 450, 600 or 750 nucleotide residues of SEQ ID NO: 42-64
(respectively). In one embodiment, a fragment of polynucleotide SEQ
ID NO: 42-64 encodes an N-terminally truncated form of SEQ ID NO:
42-64 (respectively). In one embodiment, a fragment of
polynucleotide SEQ ID NO: 42-64 encodes a mature polypeptide
sequence, which differs from the sequence of SEQ ID NO: 42-64
(respectively) by removal of an N-terminal signal sequence. In one
embodiment, a fragment of polynucleotide SEQ ID NO: 42-64 encodes a
polypeptide fragment of SEQ ID NO: 42-64 (respectively) that has an
N-terminal truncation of 10, 20, 30, 40, 50, 100, 150 amino acid
residues as compared with the amino acid sequence of SEQ ID NO:
42-64 (respectively). In one embodiment, a fragment of
polynucleotide SEQ ID NO: 42-64 encodes a polypeptide fragment of
SEQ ID NO: 42-64 (respectively) that comprises at least the
C-terminal 50, 100, 150, 200 or 250 amino acid residues of SEQ ID
NO: 42-64 (respectively). In one embodiment, a polypeptide encoded
by the second mycobacterial polynucleotide or fragment has a common
antigenic cross-reactivity and/or substantially the same in vivo
biological activity as the polypeptide selected from SEQ ID NOs:
19-41. By way of example, the polypeptide encoded by the second
mycobacterial polynucleotide, or fragment, shares a common ability,
with the polypeptide selected from SEQ ID NOs: 19-41, to induce a
"recall response" of an immune cell such as a T-lymphocyte which
has been previously exposed to an antigenic component of a
mycobacterial infection. For example, the interferon-gamma
(IFN-.gamma.) ELISPOT assay is useful as an immunological readout
because the secretion of IFN-.gamma. from antigen-specific immune
cells such as T cells is a good correlate of protection against M.
tuberculosis. Furthermore, the ELISPOT assay is a very reproducible
and sensitive method of quantifying the number of IFN-.gamma.
secreting antigen-specific immune cells such as T cells.
Alternatively, or in addition, an antibody capable of binding to a
polypeptide encoded by the second mycobacterial polynucleotide, or
fragment, would also be capable of binding to the polypeptide
selected from SEQ ID NOs: 19-41.
[0068] In one embodiment, the antigenic composition comprises both
an Rv0111 antigen (antigenic polypeptide or polynucleotide) and an
Rv0198 antigen (antigenic polypeptide or polynucleotide).
[0069] In one embodiment, where there are multiple additional
mycobacterial antigens (eg. 2 or more additional mycobacterial
antigens, as well as the first and second mycobacterial antigens),
each of said additional mycobacterial antigens is different from
each other. In one embodiment, the `difference` between the
additional mycobacterial antigen(s) and the first and second
mycobacterial antigens is defined by the specificity of the immune
response to the mycobacterial antigens. For example, in one
embodiment, each of the first, second and additional antigens
induce an immune response that is substantially specific to that
antigen. The `difference` between the first, second and additional
mycobacterial antigens may be defined in terms of a substantial
lack (eg. an absence) of common antigenic cross-reactivity between
the mycobacterial antigens. The `difference` between the first,
second and additional mycobacterial antigens may be alternatively
(or in addition) be defined as a substantial lack (eg. an absence)
of common in vivo biological activity between the mycobacterial
antigens. For example, in one embodiment, the first, second and
additional mycobacterial antigens (eg. first, second and additional
mycobacterial antigenic polypeptides, or first, second and
additional mycobacterial antigenic polynucleotides or polypeptide
encoded thereby) may exhibit (substantially) no common antigenic
cross-reactivity.
[0070] In one embodiment, the first, second and additional
mycobacterial antigens (eg. first, second and additional
mycobacterial antigenic polypeptides, or first, second and
additional mycobacterial antigenic polynucleotides or polypeptide
encoded thereby) exhibit (substantially) no common in vivo
biological activity. For example, the first, second and additional
mycobacterial antigens (eg. first, second and additional
mycobacterial antigenic polypeptides, or first, second and
additional mycobacterial antigenic polynucleotides or polypeptide
encoded thereby) may each induce different immune responses and/or
each have different in vivo biological activities. By way of
example, in one embodiment, the first, second and additional
mycobacterial antigens (eg. first, second and additional
mycobacterial antigenic polypeptides, or first, second and
additional mycobacterial antigenic polynucleotides or polypeptide
encoded thereby) do not share a common ability to induce a "recall
response" of an immune cell such as a T-lymphocyte (eg. CD4+, CD8+,
effector or memory T cell--TEM or TCM) that has previously been
exposed to an antigenic component of a mycobacterial infection. In
other words, in one embodiment, the first, second and additional
mycobacterial antigens are `different` because they induce recall
responses in different immune cells (eg. different T cells).
[0071] In one embodiment, the one or more additional mycobacterial
antigen(s) is expressed or up-regulated under different culture
conditions and/or mycobacterial infection states as compared with
the first and/or second mycobacterial antigens. In one embodiment,
the activity of the one or more additional mycobacterial antigen(s)
is up-regulated under different culture conditions and/or
mycobacterial infection states as compared with the first and/or
second mycobacterial antigens. Thus, in one embodiment, the
expression or activity of first mycobacterial antigen is
up-regulated during conditions of mycobacterial latency, whereas
the expression or activity of the second and/or additional
mycobacterial antigen is up-regulated during active mycobacterial
infection or upon re-activation from a latent state (and/or
down-regulated during conditions of mycobacterial latency). In one
embodiment, where there are multiple additional mycobacterial
antigens (eg. 2 or more additional mycobacterial antigens, as well
as the first and second mycobacterial antigens), each additional
mycobacterial antigen is expressed/up-regulated at different stages
of mycobacterial infection, or the activity of each additional
mycobacterial antigen is up-regulated at different stages of
mycobacterial infection.
[0072] In one embodiment, the one or more additional mycobacterial
antigens are from a mycobacterium other than M. tuberculosis. For
example, the one or more additional mycobacterial antigens may be
from another member of the MTC, such as M. microti, M. bovis, M.
canetti or M. africanum, or a non-MTC mycobacterium such as M.
avium-intracellulare, M. kansasii, M. marinum or M. ulcerans.
[0073] In one embodiment, the antigenic composition comprises at
least 1, 2, 3, 4 or 5 further mycobacterial antigens, in addition
to the first and second mycobacterial antigens discussed above. In
one embodiment, each of said at least 1, 2, 3, 4 or 5 additional
mycobacterial antigens is different from each other and from the
first and second mycobacterial antigens. In one embodiment, the
antigenic composition comprises up to about 10 different
mycobacterial antigens (eg. including the first and second
mycobacterial antigens discussed above). In one embodiment, the
antigenic composition comprises 1 additional mycobacterial antigen,
and thus comprises a total of 3 different mycobacterial antigens
(ie. the antigenic composition is trimeric). In one embodiment, the
antigenic composition comprises 2 additional mycobacterial
antigens, and thus comprises a total of 4 different mycobacterial
antigens (ie. the antigenic composition is tetrameric). In one
embodiment, the antigenic composition comprises 3 additional
mycobacterial antigens, and thus comprises a total of 5 different
mycobacterial antigens (ie. the antigenic composition is
pentameric). In one embodiment, the antigenic composition comprises
up to 8 additional mycobacterial antigens, and thus comprises up to
a total of 10 different mycobacterial antigens (ie. the antigenic
composition is up to decameric).
[0074] In one embodiment, the one or more additional mycobacterial
antigens comprises (or consists of) a polypeptide sequence having
at least 70% amino acid sequence identity to the amino acid
sequence of a latency-regulated polypeptide selected from SEQ ID
NOs: 1, 3, 5, 7 and 56, or a fragment thereof having at least 150
consecutive amino acids thereof, as defined above with respect to
the first mycobacterial antigen (so long as the one or more
additional mycobacterial antigens is different from the first
mycobacterial antigen). Alternatively, or in addition, the one or
more additional mycobacterial antigens may comprise (or consist of)
a polypeptide sequence having at least 70% amino acid sequence
identity to an amino acid sequence selected from SEQ ID NOs: 19-41,
or a fragment thereof having at least 50 consecutive amino acids
thereof, as defined above with respect to the second mycobacterial
antigen (so long as the one or more additional mycobacterial
antigens is different from the second mycobacterial antigen).
[0075] In one embodiment, the one or more additional mycobacterial
antigens comprises (or consists of) a polynucleotide sequence that
encodes a polypeptide sequence as described above with respect to
the first mycobacterial antigenic polypeptide (preferably different
from the first mycobacterial antigen). In one embodiment, the one
or more additional mycobacterial antigens comprises (or consists
of) a polynucleotide sequence that encodes a polypeptide sequence
as described above with respect to the second mycobacterial
antigenic polypeptide (preferably different from the second
mycobacterial antigen).
[0076] In one embodiment, the one or more additional mycobacterial
antigens comprises (or consists of) a polynucleotide sequence
having at least 70% nucleotide sequence identity to the nucleic
acid sequence of a latency-regulated polynucleotide selected from
SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, or a fragment thereof
having at least 150 consecutive nucleotides thereof, as described
above with respect to the first mycobacterial antigen (so long as
the one or more additional mycobacterial antigens is different from
the first mycobacterial antigen). Alternatively, or in addition,
the one or more additional mycobacterial antigens may comprise (or
consist of) a polynucleotide sequence having at least 70%
nucleotide sequence identity to a nucleic acid sequence selected
from SEQ ID NOs: 42-64, or a fragment thereof having at least 150
consecutive nucleotides thereof, as described above with respect to
the second mycobacterial antigen (so long as the one or more
additional mycobacterial antigens is different from the second
mycobacterial antigen).
[0077] In one embodiment, at least two of the mycobacterial
antigens in the antigenic composition comprise (or consist of) a
polypeptide sequence, and said at least two polypeptide sequences
are optionally joined together to form a fusion protein. By way of
example, in one embodiment, the first mycobacterial antigen and
second mycobacterial antigen each comprise (or consist of) a
polypeptide sequence, as defined above, and said first and second
polypeptide sequences are optionally joined together to form a
fusion protein.
[0078] In one embodiment, said fusion protein further comprises at
least one additional mycobacterial antigenic polypeptide sequence,
optionally joined to said first and/or second polypeptide
sequences, wherein each of said further mycobacterial antigens is
different from each other and from the first and second
mycobacterial antigens. For example, the fusion protein may
comprise at least 1, 2, 3, 4 or 5 further mycobacterial antigens,
in addition to said first and second mycobacterial antigens,
wherein each of said further mycobacterial antigens is different
from each other and from the first and second mycobacterial
antigens. In one embodiment, the fusion protein may comprise up to
about 10 different mycobacterial antigens (eg. including the first
and second mycobacterial antigens).
[0079] In one embodiment, the antigenic composition comprises at
least one additional mycobacterial antigen (eg. at least 1, 2, 3,
4, 5, 6, 7, 8, 9 or 10 additional mycobacterial antigens) and the
first mycobacterial antigen and said at least one additional
mycobacterial antigen each comprise (or consist of) a polypeptide
sequence, as defined above, and said polypeptide sequences are
optionally joined together to form a fusion protein. In one
embodiment, the antigenic composition comprises at least one
additional mycobacterial antigen (eg. at least 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 additional mycobacterial antigens), and the second
mycobacterial antigen and said at least one additional
mycobacterial antigen each comprise (or consist of) a polypeptide
sequence, as defined above, and said polypeptide sequences are
optionally joined together to form a fusion protein. Alternatively,
in one embodiment, the antigenic composition comprises at least two
additional mycobacterial antigens (eg. at least 2, 3, 4, 5, 6, 7,
8, 9 or 10 additional mycobacterial antigens), and said at least
two additional mycobacterial antigens each comprise (or consist of)
a polypeptide sequence, as defined above, and said polypeptide
sequences are optionally joined together to form a fusion
protein.
[0080] In one embodiment, a recombinant fusion protein may be
generated by expression of a recombinant polynucleotide sequence
that encodes said fusion protein. By way of example, polynucleotide
sequences encoding mycobacterial antigenic polypeptides of the
invention may be positioned in the same reading frame downstream of
a promoter in an expression vector, thereby allowing transcription
through the polynucleotide sequences and translation as one protein
product. In one embodiment, intervening `linker` sequences are
located between the polynucleotide sequence for each polypeptide
antigen, arising from the inclusion of restriction sites. In
general, the amino acids encoded by these linker sequences are not
deleterious to the immunogenicity of the resultant fusion protein,
and may even be beneficial to immunogenicity. Alternatively, a
fusion protein of the invention may be produced as an epitope
string, by expression of polynucleotide sequences that are linked
without intervening nucleotides. The absence of intervening linker
sequence avoids the presence of unnecessary nucleic acid and/or
amino acid material. Alternatively, a fusion protein of the
invention may be prepared by chemically conjugating the
mycobacterial antigenic polypeptides of the invention. By way of
example, the first and/or second and/or additional mycobacterial
polypeptides of the invention may be coupled to each other using
conventional chemical conjugation techniques.
[0081] In one embodiment, at least two of the mycobacterial
antigens in the antigenic composition comprise (or consist of) a
polynucleotide sequence, and said at least two polynucleotide
sequences are optionally joined together to form a polycistronic
nucleic acid sequence. By way of example, in one embodiment, the
first mycobacterial antigen and second mycobacterial antigen each
comprise (or consist of) a polynucleotide sequence, as defined
above, and said first and second polynucleotide sequences are
optionally joined together to form a polycistronic nucleic acid
sequence.
[0082] In one embodiment, said polycistronic nucleic acid sequence
comprises or consists of (in any order from the 5' to 3' end):
[0083] (i) a first mycobacterial polynucleotide, wherein said first
mycobacterial polynucleotide comprises (or consists of) a
polynucleotide sequence as hereinbefore defined; and [0084] (ii) a
second mycobacterial polynucleotide, wherein said second
mycobacterial polynucleotide comprises (or consists of) a
polynucleotide sequence as hereinbefore defined.
[0085] In one embodiment, said polycistronic sequence further
comprises at least one additional mycobacterial antigenic
polynucleotide sequence, joined to said first and second
polynucleotide sequences. Alternatively, in one embodiment, the
antigenic composition comprises at least one additional
mycobacterial antigen, and the first mycobacterial antigen and at
least one additional mycobacterial antigen each comprise (or
consist of) a polynucleotide sequence, as defined above, and said
polynucleotide sequences are joined together to form a
polycistronic nucleic acid sequence. Alternatively, in one
embodiment, the antigenic composition comprises at least one
additional mycobacterial antigen, and the second mycobacterial
antigen and at least one additional mycobacterial antigen each
comprise (or consist of) a polynucleotide sequence, as defined
above, and said polynucleotide sequences are joined together to
form a polycistronic nucleic acid sequence. Alternatively, in one
embodiment, the antigenic composition comprises at least two
additional mycobacterial antigens, and said at least two additional
mycobacterial antigens each comprise (or consist of) a
polynucleotide sequence, as defined above, and said polynucleotide
sequences are joined together to form a polycistronic nucleic acid
sequence.
[0086] In one embodiment, the polycistronic nucleic acid sequence
of the invention is positioned downstream of a promoter in frame in
a vector (eg. an expression vector or viral vector as discussed
below), thereby allowing transcription through the polynucleotide
sequences and optional translation as one `fusion protein` product.
Accordingly, in one embodiment, the polycistronic nucleic acid
sequence encodes a fusion protein as discussed above.
Alternatively, in one embodiment, the polycistronic nucleic acid
sequence encodes separate mycobacterial antigenic polypeptide
sequences, as discussed above. In one embodiment, the polycistronic
nucleic acid sequence is operably linked to a nucleic acid sequence
encoding a tag polypeptide, such that the encoded tag is covalently
linked to the encoded antigenic polypeptide(s) upon translation.
The tag may facilitate detection of antigenic polypeptide
expression, or detection of clones that express the antigen, and/or
may lead to increases in antigen efficacy. Suitable tag
polypeptides include a PK tag, FLAG tag, MYC tag, polyhistidine tag
or any detectable tag (eg. a tag that can be detected by an
antibody such as a monoclonal antibody). Other examples of tags
will be clear to skilled persons in the art. The nucleic acid
sequence encoding the tag polypeptide may be positioned such that,
following translation, the tag is located at the C-terminus of the
expressed antigenic polypeptide (ie. in the order: antigenic
polypeptide-tag). Alternatively, the nucleic acid sequence encoding
the tag polypeptide may be positioned such that, following
translation, the tag is located at the N-terminus of the expressed
antigenic polypeptide (ie. in the order: tag-antigenic
polypeptide). Alternatively, the nucleic acid sequence encoding the
tag polypeptide may be positioned such that, following translation,
the tag is located internally to the expressed antigenic
polypeptide, or between the expressed antigenic polypeptides of an
encoded fusion protein.
[0087] Nucleotides encoding a linker sequence may be inserted
between the polycistronic nucleic acid sequence encoding the
antigenic polypeptide(s) and the nucleic acid sequence encoding the
tag polypeptide. In one embodiment, the linker sequence encodes the
amino acid sequence Gly-Ser-Ile. In one embodiment, the encoded
linker sequence is located between an expressed antigenic
polypeptide and a tag polypeptide (ie. in the order: antigenic
polypeptide-linker-tag, or tag-linker-antigenic polypeptide). In
one embodiment, the nucleic acid sequence encoding the tag
polypeptide and the nucleotides encoding the linker sequence are
positioned such that, following translation, the linker sequence
(eg. Gly-Ser-Ile) is located at the C-terminus of the expressed
antigenic polypeptide and the tag is located at the C-terminus of
the expressed linker sequence (ie. in the order antigenic
polypeptide-linker-tag). Intervening `linker` sequences may
alternatively (or additionally) be located between the
mycobacterial polynucleotide sequences of the polycistronic
sequence, arising from the inclusion of restriction sites (eg. in
the form: mycobacterial polynucleotide-linker-mycobacterial
polynucleotide). However, to avoid the presence of unnecessary
nucleic acid and/or amino acid material, the polynucleotide
sequences may be linked without intervening nucleotides.
[0088] In one embodiment, the polycistronic nucleic acid sequence
is operably linked to a leader sequence. For example, the leader
sequence may be fused to the N-terminus of the polycistronic
sequence (ie. in the form: leader-polycistronic sequence) or to the
C-terminus of the polycistronic sequence (ie. in the form:
polycistronic sequence-leader). A leader sequence may affect
processing of a primary DNA transcript to mRNA, and/or may affect
mRNA stability or translation efficiency. In one embodiment, a
leader sequence ensures that the encoded polypeptide antigen is
directed to the secretory machinery of a host cell. In one
embodiment, a leader sequence enhances expression and/or
immunogenicity of the antigen. Enhanced expression may be
determined by a conventional assay, such as using an antibody (eg.
monoclonal antibody) to detect the amount of protein produced.
Enhanced immunogenicity may be determined using a conventional
assay such as a cultured or ex vivo ELISPOT assay. In one
embodiment, the presence of a leader sequence enhances the
expression and/or immunogenicity of the mycobacterial antigenic
polypeptide by 2-fold, 3-fold or more when compared with antigenic
polypeptide expressed without the leader sequence. An example of a
suitable leader sequence is t-PA (tissue plasminogen activator).
Accordingly, in one embodiment, the polycistronic nucleic acid
sequence encoding said mycobacterial antigenic polypeptides is
operably linked to a leader sequence and a tag sequence. For
example, the leader sequence may be fused to the N-terminus of the
polycistronic sequence and the tag sequence may be fused to the
C-terminus of the polycistronic sequence (ie. in the form:
leader-polycistronic sequence-tag. In one embodiment, a linker
sequence is located between the polycistronic sequence and the
nucleic acid sequence encoding the tag (ie. in the form
leader-polycistronic sequence-linker-tag). In one embodiment, the
leader sequence is a t-PA leader sequence and/or the tag sequence
is a PK tag sequence (ie. in the form: t-PA leader-polycistronic
sequence-PK tag). In one embodiment, a linker sequence is located
between the polycistronic sequence and the nucleic acid sequence
encoding the tag (ie. in the form t-PA leader-polycistronic
sequence-linker-PK tag). In one embodiment, intervening leader
sequences are located between one or more of the mycobacterial
polynucleotide sequences of the polycistronic sequence (ie. in the
form: mycobacterial polynucleotide-leader-mycobacterial
polynucleotide). In one embodiment, the polycistronic nucleic acid
sequence encoding the mycobacterial antigenic polypeptides is
operably linked to an N-terminal leader sequence, internal leader
sequence and a tag sequence (ie. in the form: leader-first
mycobacterial polynucleotide-leader-second mycobacterial
polynucleotide-tag). In one embodiment, a linker sequence is
located between the polycistronic sequence and the nucleic acid
sequence encoding the tag (ie. in the form: leader-first
mycobacterial polynucleotide-leader--second mycobacterial
polynucleotide-linker-tag). In one embodiment, the leader sequence
is a t-PA leader sequence and/or the tag sequence is a PK tag
sequence (ie. in the form: t-PA leader-first mycobacterial
polynucleotide-t-PA leader-second mycobacterial polynucleotide-PK
tag). In one embodiment, a linker sequence is located between the
polycistronic sequence and the nucleic acid sequence encoding the
tag (ie. in the form t-PA leader-first mycobacterial
polynucleotide-t-PA leader-second mycobacterial
polynucleotide-linker-PK tag). In one embodiment, the polycistronic
nucleic acid sequence further comprises a polyadenylation signal,
such as a bovine growth hormone (BGH) polyadenylation signal.
[0089] In one embodiment, the antigenic composition comprises one
or more cells, wherein said cells comprise at least one of the
mycobacterial antigens. In one embodiment, said one or more cells
comprise a first mycobacterial antigen and/or a second
mycobacterial antigen, as defined above. In one embodiment, said
one or more cells comprises one or more of said additional
mycobacterial antigens, as defined above. In one embodiment, one or
more of said additional mycobacterial antigens comprises a
polypeptide sequence as defined above. In one embodiment, one or
more of said additional mycobacterial antigens comprises a
polynucleotide sequence as filed above.
[0090] In one embodiment, said at least one mycobacterial antigen
(eg. polypeptide) is at least partially exposed at the surface of
the cell(s). In an alternative embodiment, the cell becomes
degraded in vivo so that at least part of the mycobacterial antigen
(eg. polypeptide) becomes exposed to a host's immune system. In an
alternative embodiment, the cell at least partially releases (eg.
secretes or exports) the mycobacterial antigen (eg. polypeptide) to
the outside of the cell, so that it is exposed to a host's immune
system. In one embodiment, said antigenic composition comprises an
individual cell, wherein said cell comprises at least two of said
mycobacterial antigens. By way of example, in one embodiment, said
antigenic composition comprises an individual cell, wherein said
cell comprises both said first mycobacterial antigen and said
second mycobacterial antigen. In one embodiment, said individual
cell further comprises one or more of said additional mycobacterial
antigens.
[0091] In one embodiment, said antigenic composition comprises an
individual cell, wherein said cell comprises said first
mycobacterial antigen and said one or more additional mycobacterial
antigens. In one embodiment, said antigenic composition comprises
an individual cell, wherein said cell comprises said second
mycobacterial antigen and said one more additional mycobacterial
antigens. In one embodiment, said antigenic composition comprises
an individual cell, wherein said cell comprises said at least two
of said additional mycobacterial antigens. In an alternative
embodiment, the antigenic composition comprises at least first and
second cells, wherein said first cell comprises said first
mycobacterial antigen (as defined above) and wherein said second
cell comprises said second mycobacterial antigen (as defined
above). In this embodiment, the first and second mycobacterial
antigens are not present in the same cell; rather, the first and
second mycobacterial antigens are in different cells. In one
embodiment, said antigenic composition further comprises at least a
third cell, wherein said cell comprises an additional mycobacterial
antigen, as defined above.
[0092] In one embodiment, said at least one cell is an attenuated
microbial carrier. An attenuated carrier is a cell (such as a
bacterial cell) that is incapable of causing a significant
pathological effect in an animal subject, typically a mammalian
subject such as a human, bovine, porcine or equine subject.
Suitable examples of attenuated microbial carriers include
attenuated salmonella, attenuated M. tuberculosis, or attenuated M.
bovis (eg. BCG strain).
[0093] In one embodiment, the antigenic composition comprises one
or more vectors, wherein said vectors comprise at least one of the
mycobacterial antigens. In one embodiment, said one or more vectors
comprises a first mycobacterial antigen, as defined above. In one
embodiment, said first mycobacterial antigen comprises a
polypeptide sequence as defined above. In one embodiment, said one
or more vectors comprises a second mycobacterial antigen, as
defined above. In one embodiment, said vector comprises said first
mycobacterial antigen and said second (and optionally additional)
mycobacterial antigen. By way of example, said vector may comprise
a first mycobacterial polynucleotide as defined herein and a second
(and optionally additional) mycobacterial polynucleotide as defined
herein. In one embodiment, said vector comprises: [0094] (i) a
first mycobacterial polynucleotide, wherein said first
mycobacterial polynucleotide comprises (or consists of) a
polynucleotide sequence as hereinbefore defined; and optionally
[0095] (ii) a second mycobacterial polynucleotide, wherein said
second mycobacterial polynucleotide comprises (or consists of) a
polynucleotide sequence as hereinbefore defined.
[0096] In one embodiment, said one or more vectors comprises one or
more of said additional mycobacterial antigens, as defined above.
In one embodiment, one or more of said additional mycobacterial
antigens comprises a polypeptide sequence as defined above. In one
embodiment, one or more of said additional mycobacterial antigens
comprises a polynucleotide sequence as filed above.
[0097] Examples of vectors include DNA vectors (e.g. Vaccinia virus
vectors, such as MVA) and RNA vectors (e.g. Sinbis or Semiliki
Forest virus vectors). The term `vector` embraces expression
vectors (which may be useful for preparation of mycobacterial
antigens of the invention), and viral vectors (which may be useful
for replication and/or delivery of mycobacterial antigens of the
invention). The vectors optionally include appropriate control
sequences such as a promoter and/or terminator. In one embodiment,
the vector comprises one or more polynucleotide sequence(s)
encoding said mycobacterial antigen(s). Said polynucleotide
sequence may be operably linked to a nucleic acid sequence encoding
a tag polypeptide, such that the encoded tag is covalently linked
to the antigen upon translation. The tag may facilitate detection
of antigen expression, or of clones that express the antigen,
and/or may lead to increases in antigen efficacy. Suitable tag
polypeptides include a PK tag, FLAG tag, MYC tag, polyhistidine tag
or any detectable tag (eg. a tag that can be detected by an
antibody such as a monoclonal antibody). The nucleic acid sequence
encoding the tag polypeptide may be positioned such that, following
translation, the tag is located at the C-terminus of the expressed
antigen. Alternatively, the nucleic acid sequence encoding the tag
polypeptide may be positioned such that, following translation, the
tag is located at the N-terminus of the expressed antigen.
Alternatively, the nucleic acid sequence encoding the tag
polypeptide may be positioned such that, following translation, the
tag is located internally to the expressed antigen. Nucleotides
encoding a linker sequence may be inserted between the
polynucleotide encoding the expressed antigen and the nucleic acid
sequence encoding the tag polypeptide. In one embodiment, the
encoded linker sequence is located between an expressed antigen
polypeptide and a tag polypeptide. In one embodiment, the nucleic
acid sequence encoding the tag polypeptide and the nucleotides
encoding the linker sequence are positioned such that, following
translation, the linker sequence is located at the C-terminus of
the expressed antigen and the tag is located at the C-terminus of
the expressed linker sequence.
[0098] In one embodiment, the vector comprises one or more
polynucleotide sequences encoding mycobacterial antigenic
polypeptide(s), wherein said polynucleotide sequence is operably
linked to a leader sequence. A leader sequence may affect
processing of the primary transcript to mRNA, and/or may affect
mRNA stability or translation efficiency. In one embodiment, a
leader sequence ensures that the encoded polypeptide antigen is
directed to the secretory machinery of a host cell. In one
embodiment, a leader sequence enhances expression and/or
immunogenicity of the antigen. Enhanced immunogenicity may be
determined using a conventional assay such as a cultured or ex vivo
ELISPOT assay. Enhanced expression may be determined by a
conventional assay, such as using an antibody (eg. monoclonal
antibody) to detect the amount of protein produced. In one
embodiment, the presence of a leader sequence enhances the
expression and/or immunogenicity of the mycobacterial antigen by
2-fold, 3-fold or more when compared with antigen expressed without
the leader sequence. An example of a suitable leader sequence is
t-PA (tissue plasminogen activator). In one embodiment, the vector
comprises a C-terminally truncated polynucleotide encoding said
mycobacterial antigen fused to a t-PA leader sequence. In one
embodiment, the vector comprises a C-terminally truncated
polynucleotide encoding said mycobacterial antigen fused to a t-PA
leader sequence and a PK tag sequence. For example, the leader
sequence may be fused to the N-terminus of the polynucleotide
encoding the antigen and the tag sequence may be fused to the
C-terminus of the polynucleotide encoding the antigen. In one
embodiment, a linker sequence (eg. Gly-Ser-Ile) is located between
the polynucleotide encoding the antigen and the nucleic acid
sequence encoding the tag.
[0099] In one embodiment, said antigenic composition comprises an
individual vector, wherein said vector comprises both said first
mycobacterial antigen and said second mycobacterial antigen. In one
embodiment, said individual vector further comprises one or more of
said additional mycobacterial antigens. In one embodiment, said
antigenic composition comprises an individual vector, wherein said
vector comprises said first mycobacterial antigen and said one or
more additional mycobacterial antigens. In one embodiment, said
antigenic composition comprises an individual vector, wherein said
vector comprises said second mycobacterial antigen and said one
more additional mycobacterial antigens. In one embodiment, said
antigenic composition comprises an individual vector, wherein said
cell comprises said one or more additional mycobacterial antigens.
In an alternative embodiment, the antigenic composition comprises
at least first and second vectors, wherein said first vector
comprises said first mycobacterial antigen (as defined above) and
wherein said second vector comprises said second mycobacterial
antigen (as defined above). In this embodiment, the first and
second mycobacterial antigens are not present in the same vector;
rather, first and second mycobacterial antigens are in different
vectors. In one embodiment, said antigenic composition further
comprises at least a third vector, wherein said third vector
comprises an (one or more) additional mycobacterial antigen(s), as
defined above.
[0100] In one embodiment, the vector (or at least one of said
vectors) is a viral vector. Viral vectors are usually
non-replicating or replication-impaired vectors, which means that
the viral vector cannot replicate to any significant extent in
normal cells (eg. normal human cells), as measured by conventional
means--eg. via measuring DNA synthesis and/or viral titre.
Non-replicating or replication-impaired vectors may have become so
naturally (ie. they have been isolated as such from nature) or
artificially (eg. by breeding in vitro or by genetic manipulation).
There will generally be at least one cell-type in which the
replication-impaired viral vector can be grown--for example,
modified vaccinia Ankara (MVA) can be grown in CEF cells.
Typically, the viral vector is incapable of causing a significant
infection in an animal subject, typically in a mammalian subject
such as a human, bovine, porcine or equine patient. Examples of
viral vectors that are useful in this context include attenuated
vaccinia virus vectors such as modified vaccinia Ankara (MVA) and
NYVAC, or strains derived therefrom. Other suitable viral vectors
include poxvirus vectors, such as avipox vectors, for example
attenuated fowlpox vectors (eg. FP9) or canarypox vectors (eg.
ALVAC and strains derived therefrom). Alternative viral vectors
useful in the present invention include adenoviral vectors (eg.
non-human adenovirus vectors), alphavirus vectors, flavivirus
vectors, herpes viral vectors, influenza virus vectors and
retroviral vectors.
[0101] In one embodiment, the vector (or at least one of said
vectors) is an expression vector. Expression vectors are nucleic
acid molecules (linear or circular) that comprise one or more
polynucleotide sequences encoding a polypeptide(s) of interest,
operably linked to additional regulatory elements required for its
expression. In this regard, expression vectors generally include
promoter and terminator sequences, and optionally one or more
enhancer sequences, polyadenylation signals, and the like.
Expression vectors may also include suitable translational
regulatory elements, including ribosomal binding sites, and
translation initiation and termination sequences. The
transcriptional and translational regulatory elements employed in
the expression vectors of the invention are functional in the host
cell used for expression, and may include those naturally
associated with mycobacterial genes.
[0102] The selection of suitable promoters, terminators, selectable
markers and other elements is a matter of routine design within the
level of ordinary skill in the art. Promoters such as the trp, lac
and phage promoters, tRNA promoters and glycolytic enzyme promoters
may be used in prokaryotic hosts. Useful yeast promoters include
the promoter regions for metallothionein, 3-phosphoglycerate kinase
or other glycolytic enzymes such as enolase or
glyceraldehyde-3-phosphate dehydrogenase, enzymes responsible for
maltose and galactose utilization, and others. Appropriate
non-native mammalian promoters may include the early and late
promoters from SV40 or promoters derived from murine moloney
leukemia virus, mouse mammary tumour virus, avian sarcoma viruses,
adenovirus II, bovine papilloma virus or polyoma. In one
embodiment, the expression vector comprises a CMV promoter.
[0103] Generally, "operably linked" means that the nucleic acid
sequences being linked are contiguous and arranged so that they
function in concert for their intended purposes--for example,
transcription initiates in the promoter and proceeds through the
coding polynucleotide segment to the terminator. Where necessary to
join two protein coding regions, the polynucleotide coding
sequences should be contiguous and in reading frame.
[0104] In one embodiment, the invention provides a host cell
comprising an antigenic composition of the invention, as defined
above. The host cell thus comprises the first mycobacterial antigen
and second mycobacterial antigen of the invention, wherein said
mycobacterial antigens may comprise polypeptide and/or
polynucleotide sequences, as discussed above.
[0105] Accordingly, in one embodiment, a host cell comprises an
antigenic composition comprising a first mycobacterial antigen and
a second mycobacterial antigen; wherein said first mycobacterial
antigen comprises: [0106] (i) a first mycobacterial polypeptide
sequence as hereinbefore defined; and optionally [0107] (ii) a
second (and optionally additional) mycobacterial polynucleotide
sequence as hereinbefore defined; [0108] and wherein said second
mycobacterial antigen is different from said first mycobacterial
antigen.
[0109] In one embodiment, said host cell comprises either: [0110]
(i) a first mycobacterial antigenic polypeptide as herein before
defined; or [0111] (ii) a first mycobacterial polynucleotide,
wherein said first mycobacterial polynucleotide comprises a
polynucleotide sequence encoding said first mycobacterial antigenic
polypeptide; [0112] and optionally either: [0113] (iii) a second
mycobacterial antigenic polypeptide as hereinbefore defined; or
[0114] (iv) a second mycobacterial polynucleotide, wherein said
second mycobacterial polynucleotide comprises a polynucleotide
sequence encoding said second mycobacterial polypeptide.
[0115] The antigenic compositions, polynucleotides or polypeptides
of the present invention may be prepared by expressing the
polynucleotide sequences of the invention in vectors or other
expression vehicles in compatible prokaryotic or eukaryotic host
cells using standard molecular biology methods (e.g., Sambrook et
al. 1989, Molecular Cloning a Laboratory Manual, Second Edition,
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.;
incorporated herein by reference).
[0116] The most commonly used prokaryotic hosts are strains of E.
coli, although other prokaryotes, such as B. subtilis or
Pseudomonas may be used. Mammalian or other eukaryotic host cells,
such as those of yeast, filamentous fungi, plant, insect, amphibian
or avian species, may also be useful in the present invention.
Propagation of mammalian cells in culture is per se well known.
Examples of commonly used mammalian host cell lines are VERO and
HeLa cells, Chinese hamster ovary (CHO) cells, and WI38, BHK, and
COS cell lines, although other cell lines may be appropriate, e.g.,
to provide higher expression. As used herein, "recombinant host
cells", "host cells", "cells", "cell lines", "cell cultures", and
other such terms denoting microorganisms or higher eukaryotic cell
lines cultured as unicellular entities refer to cells which can be,
or have been, used as recipients for recombinant vector or other
transfer DNA, and include the progeny of the original cell which
has been transformed. It is understood that the progeny of a single
parental cell may not necessarily be completely identical in
morphology or in genomic or total DNA complement as the original
parent, due to natural, accidental or deliberate mutation.
[0117] Polynucleotide sequences of interest can be transcribed in
vitro and the resulting RNA introduced into the host cell (eg. by
injection), or the polynucleotide sequences can be introduced
directly into host cells by methods which vary depending on the
type of cellular host, including electroporation; transfection
employing calcium chloride, rubidium chloride, calcium phosphate,
DEAE-dextran, or other substances; microprojectile bombardment;
lipofection; infection (where the vector is an infectious agent,
such as a retroviral genome). "Transformation" refers to the
insertion of an exogenous polynucleotide into a host cell,
irrespective of the method used for the insertion, for example,
direct uptake, transduction, f-mating or electroporation.
[0118] Vectors may replicate autonomously, or may replicate by
being inserted into the genome of a host cell, in which case they
include an insertion sequence. Expression and cloning vectors may
contain a selectable marker, a gene encoding a protein necessary
for the survival or growth of a host cell transformed with the
vector. This gene ensures the growth of only those host cells which
express the inserts. Conventional selection genes encode proteins
that (a) confer resistance to antibiotics or other toxic
substances, eg. ampicillin, neomycin, methotrexate, etc.; (b)
complement auxotrophic deficiencies; or (c) supply critical
nutrients not available from complex media, e.g. the gene encoding
D-alanine racemase for bacilli. The choice of appropriate
selectable marker will depend on the host cell. The transformed
host cell can be cultured in accordance with known methods, and the
expressed polypeptide may be recovered and isolated (eg. from the
culture medium) using conventional protocols.
[0119] In one aspect, the present invention provides a method for
producing an antigenic composition comprising (at least) a first
mycobacterial antigen and optionally a second mycobacterial
antigen, as defined above; said method comprising: [0120] (a)
expressing a polynucleotide sequence as defined above that encode
said at least first and optionally second mycobacterial antigens;
or [0121] (b) culturing a host cell as described above, whereby
said cell produces said at least first and optionally second
mycobacterial antigens; [0122] and recovering the expressed
antigen(s).
[0123] The invention also relates to antibodies that bind a first
mycobacterial antigen (eg. polypeptide) as defined above and a
second mycobacterial antigen (eg. polypeptide) as defined above.
Thus, in one embodiment, the invention provides an immunogenic
composition comprising a first antibody and optionally a second
antibody, wherein said first antibody binds a first mycobacterial
antigen and said second antibody binds a second mycobacterial
antigen; [0124] wherein said first mycobacterial antigen comprises:
[0125] (i) a polypeptide sequence as hereinbefore defined; or
[0126] (ii) a polynucleotide sequence encoding a polypeptide
sequence (i) as hereinbefore defined; [0127] and wherein said
second mycobacterial antigen is different from said first
mycobacterial antigen.
[0128] In one embodiment, the immunogenic composition comprises a
first antibody and a second antibody, wherein said first antibody
binds a first mycobacterial antigenic polypeptide and said second
antibody binds a second mycobacterial antigenic polypeptide as
hereinbefore defined. Optionally, said immunogenic composition
further comprises at least a third antibody (eg. at least a 3, 4,
5, 6, 7, 8 additional antibodies), wherein said third antibody
binds a third mycobacterial antigen that is different from the
first and second mycobacterial antigens.
[0129] The term `antibody` encompasses any polypeptide that
comprises an antigen binding fragment or an antigen-binding domain.
Examples include, but are not limited to, polyclonal, monoclonal,
specific, monospecific, polyspecific, non specific, humanized,
human, single chain, chimeric, affibodies, synthetic, recombinant,
hybrid, mutated, grafted, and in vitro generated antibodies. Unless
preceded by the word "intact", the term "antibody" includes
antibody fragments such as Fab, F(ab')2, Fv, scFv, Fd, dAb, and
other antibody fragments that retain antigen binding function. In
one embodiment the antibody belongs to the IgG, IgM or IgA isotype
families. Reference to the IgA isotype includes the secretory form
of this antibody (ie. sIgA). The secretory component (SC) of sIgA
may be added in vitro or in vivo. In the latter case, the use of a
patient's natural SC labeling machinery may be employed. In one
embodiment, the antibody specifically binds the mycobacterial
antigen in question. "Specific binding" is intended to mean the
formation of a complex between two or more molecules that is
relatively stable under physiologic conditions. Specific binding is
characterized by a high affinity and a low to moderate capacity, as
distinguished from nonspecific binding which usually has a low
affinity with a moderate to high capacity. Typically, binding
between an antibody and an antigen is considered to be specific
when the association constant KA is higher than 106 M 1. If
necessary, nonspecific binding can be reduced without substantially
affecting specific binding by varying the binding conditions. The
appropriate binding conditions, such as antibody concentration,
ionic strength of the solution, temperature, time allowed for
binding, concentration of a blocking agent (e.g., serum albumin,
milk casein), etc., may be optimized by a skilled person using
routine techniques. In one embodiment, said first and second
antibodies have been raised against the first and second
mycobacterial antigens of the invention, as described herein,
respectively. In one embodiment, said first and second antibodies
have been raised against the first and second mycobacterial
antigenic polypeptides of the invention, as described herein,
respectively. In one embodiment, the invention provides antisera
isolated from animals that have been immunized with an antigenic
composition of the invention. As used herein, the term `antisera`
refers to antibodies in serum that possess detectable binding,
e.g., by ELISA or flow cytometry, for a particular antigen. Methods
of preparing immune sera are known in the art. For example, the
first and second antibodies (and optional additional antibodies) of
the invention, or immunogenic composition of the invention, can be
administered to an animal (such as a mammal--eg. a horse or a
human) until an antibody response (for instance, neutralizing
antibody response) is generated to the first and second
mycobacterial antigens.
[0130] Antibodies raised against antigenic fragments disclosed
herein (eg. polypeptide fragments) may have the property of
recognizing the full-length antigen (eg. full-length polypeptide)
from which they are derived. In this regard, polypeptide fragments
bear antigenic determinants that are detectable by conventional
immunoassays. One or more antigenic determinants is shared by
full-length antigens of the invention and fragments thereof, thus
antibodies raised against an antigenic fragment may also bind
corresponding full-length antigens of the invention. In one
embodiment, the antibodies are provided in an isolated form. The
antibodies may be tagged with a detectable or functional label.
These labels include radiolabels (eg. 1311 or 99Tc), enzymatic
labels (eg. horseradish peroxidase or alkaline phosphatase), and
other chemical moieties (eg. biotin).
[0131] The above-described antibodies may provide improved survival
when administered to a mammal, such as a human, prior to or shortly
after exposure to mycobacteria such as M. tuberculosis.
Accordingly, the first and second antibodies (and optional
additional antibodies) of the invention (or immunogenic,
antibody-containing composition of the invention) can be used as a
passive immune serum to prevent mycobacterial infection, or to
treat patients exposed to mycobacteria (such as M. tuberculosis).
In one embodiment, binding of the antibodies to the mycobacterial
antigens of the invention may initiate coating of a mycobacterium
expressing said antigen. Coating of the mycobacterium preferably
leads to opsonization thereof, which leads to the bacterium being
destroyed. Opsonization by antibodies may influence cellular entry
and spread of mycobacteria in phagocytic and non-phagocytic cells
by preventing or modulating receptor-mediated entry and replication
in macrophages. Without being bound by any theory, the inventors
believe that macrophage lysis may result in bacilli release. It is
at this stage that the mycobacteria are considered to be most
vulnerable to antibody attack. Thus, the antibodies of the present
invention may act on released bacilli, and thereby exert a
post-infection effect. It is therefore possible that passive
protection (ie. delivery of antibodies of the present invention) is
facilitated by enhanced accessibility of the antibodies of the
present invention to antigens on mycobacterial bacilli, and that
antibody binding may block macrophage infection by steric hindrance
or disruption of its oligomeric structure. Thus, antibodies acting
on mycobacterial bacilli released from killed, infected macrophages
may interfere with the spread of re-infection to fresh macrophages.
This hypothesis involves a synergistic action between antibodies
and cytotoxic T cells, acting early after infection, eg. NK T
cells, but could later involve also CD8 and CD4 cytotoxic T
cells.
[0132] In the context of the therapeutic uses and methods discussed
below, a `subject` is any animal subject that would benefit from
stimulation of an immune response against mycobacteria, such as M.
tuberculosis. Typical animal subjects are mammals, for example,
human, bovine, porcine, ovine, caprine, equine, corvine, canine or
feline subjects. In one embodiment, the subject is human, bovine,
porcine or equine.
[0133] According to one aspect of the present invention, there is
provided the use of a first mycobacterial antigen and (optionally)
a second mycobacterial antigen for the manufacture of a medicament
for stimulating an immune response in a subject, such as a
mammalian subject, (eg. a human, bovine, porcine or equine
subject); wherein said first mycobacterial antigen comprises:
[0134] (i) a polypeptide sequence as hereinbefore defined; or
[0135] (ii) a polynucleotide sequence as hereinbefore defined
encoding a polypeptide sequence according to (i); and wherein said
optional second mycobacterial antigen is different from said first
mycobacterial antigen.
[0136] The invention also provides a first mycobacterial antigen
and (optionally) a second mycobacterial antigen for use in
stimulating an immune response in a subject, such as a mammalian
subject, (eg. a human, bovine, porcine or equine subject); wherein
said first mycobacterial antigen comprises: [0137] (i) a
polypeptide sequence as hereinbefore defined; or [0138] (ii) a
polynucleotide sequence as hereinbefore defined encoding a
polypeptide sequence according to (i); and wherein said second
mycobacterial antigen is different from said first mycobacterial
antigen.
[0139] In one embodiment, said second mycobacterial antigen
comprises or consists of a mycobacterial antigenic polypeptide or
polynucleotide sequence, such as a mycobacterial antigenic
polypeptide or polynucleotide sequence as defined in (i) or (ii)
(wherein said second mycobacterial antigen is different from said
first mycobacterial antigen).
[0140] In one embodiment, the invention provides (a) a first
mycobacterial antigenic polypeptide or a first mycobacterial
polynucleotide, and optionally (b) a second mycobacterial antigenic
polypeptide or a second mycobacterial polynucleotide, for use in
stimulating an immune response in a subject; wherein [0141] (i)
said first mycobacterial antigenic polypeptide comprises a
polypeptide sequence as hereinbefore defined; [0142] (ii) said
first mycobacterial polynucleotide sequence as hereinbefore defined
comprises a polynucleotide sequence encoding said first
mycobacterial antigenic polypeptide; [0143] (iii) said optional
second mycobacterial antigenic polypeptide as hereinbefore defined;
and [0144] (iv) said second mycobacterial polynucleotide sequence
as hereinbefore defined comprises a polynucleotide sequence
encoding said second mycobacterial antigenic polypeptide.
[0145] In one embodiment, the invention provides (a) a first
mycobacterial antigenic polypeptide or a first mycobacterial
polynucleotide, and optionally (b) a second mycobacterial antigenic
polypeptide or a second mycobacterial polynucleotide, for use in
stimulating an immune response in a subject; wherein [0146] (i)
said first mycobacterial antigenic polypeptide comprises a
polypeptide sequence as hereinbefore defined; [0147] (ii) said
first mycobacterial polynucleotide sequence as hereinbefore
comprises a polynucleotide sequence encoding said first
mycobacterial antigenic polypeptide; [0148] (iii) said optional
second mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; and [0149] (iv) said second
mycobacterial polynucleotide sequence as hereinbefore defined
comprises a polynucleotide sequence encoding said second
mycobacterial antigenic polypeptide.
[0150] In one embodiment, immune stimulation is measured by a
protective effect in an in vivo survival assay. In one embodiment,
immune stimulation is measured by an increased frequency in immune
cells such as T lymphocytes specific for the antigen in the
vaccine--ie. an immune cell response (eg. T cell immune response).
In one embodiment, the immune stimulation is a memory T cell immune
response, such as a central memory T cell response (eg. a CCR7+
response). In one embodiment, immune stimulation is measured by an
increase in antibody titer that is specific for the antigen in the
vaccine.
[0151] In one embodiment, said medicament further comprises one or
more additional mycobacterial antigens, as described herein. In one
embodiment, one or more additional mycobacterial antigens, as
described herein, are also for use with said first and second
mycobacterial antigens. In one embodiment of this therapeutic use,
said first and optional second (and optional additional
mycobacterial antigen(s)) are provided in the form of an antigenic
composition as described herein. In one embodiment, one or more of
said first, second and/or optional additional mycobacterial
antigens may be comprised within one or more vectors or cells as
described herein. In one embodiment of this therapeutic use, said
first and optional second mycobacterial antigens (and optional
additional mycobacterial antigen(s)) are for administration to the
subject substantially simultaneously, or sequentially. Simultaneous
and sequential administration regimes are discussed in more detail
below.
[0152] The present invention also provides the use of a first
mycobacterial antigen and optionally a second mycobacterial antigen
for the manufacture of a medicament for treating or preventing a
mycobacterial infection (eg. M. tuberculosis infection) in a
subject, such as a mammalian subject (eg. a human, bovine, porcine
or equine subject); wherein said first mycobacterial antigen
comprises: [0153] (i) a polypeptide sequence as hereinbefore
defined; or [0154] (ii) a polynucleotide sequence as hereinbefore
defined encoding a polypeptide sequence according to (i); and
wherein said second mycobacterial antigen is different from said
first mycobacterial antigen.
[0155] The invention also provides a first mycobacterial antigen
and optionally a second mycobacterial antigen for use in treating
or preventing a mycobacterial infection (eg. M. tuberculosis
infection) in a subject, such as a mammalian subject (eg. a human,
bovine, porcine or equine subject); wherein said first
mycobacterial antigen comprises: [0156] (i) a polypeptide sequence
as hereinbefore defined; or [0157] (ii) a polynucleotide sequence
encoding a polypeptide sequence as hereinbefore according to (i;
and wherein said second mycobacterial antigen is different from
said first mycobacterial antigen.
[0158] In one embodiment, said second mycobacterial antigen
comprises or consists of a mycobacterial antigenic polypeptide or
polynucleotide sequence, such as a mycobacterial antigenic
polypeptide or polynucleotide sequence as defined in (i) or (ii)
(wherein said second mycobacterial antigen is different from said
first mycobacterial antigen).
[0159] In one embodiment, the invention provides (a) a first
mycobacterial antigenic polypeptide or a first mycobacterial
polynucleotide, and optionally (b) a second mycobacterial antigenic
polypeptide or a second mycobacterial polynucleotide, for use in
treating or preventing a mycobacterial infection (eg. M.
tuberculosis infection) in a subject; wherein: [0160] (i) said
first mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; [0161] (ii) said first
mycobacterial polynucleotide sequence as hereinbefore defined
comprises a polynucleotide sequence encoding said first
mycobacterial antigenic polypeptide; [0162] (iii) said optional
second mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; and [0163] (iv) said second
mycobacterial polynucleotide sequence as hereinbefore defined
comprises a polynucleotide sequence encoding said second
mycobacterial antigenic polypeptide.
[0164] For example, said use or medicament may protect the subject
against infection with mycobacteria, such as M. tuberculosis. For
example, suitable subjects include human, bovine, porcine or equine
subjects. In one embodiment, said medicament further comprises one
or more additional mycobacterial antigens, as described herein. In
one embodiment, one or more additional mycobacterial antigens, as
described herein, are also for use with said first and second
mycobacterial antigens.
[0165] In one embodiment of this therapeutic use, said first and
second (and optional additional mycobacterial antigen(s)) are
provided in the form of an antigenic composition as described
herein. In one embodiment, one or more of said first, second and/or
optional additional mycobacterial antigens may be comprised within
one or more vectors or cells as described herein. In one embodiment
of this therapeutic use, said first and second mycobacterial
antigens (and optional additional mycobacterial antigen(s)) are for
administration to the subject substantially simultaneously, or
sequentially.
[0166] A related aspect includes a method for stimulating an immune
response in a subject, comprising administering to a subject, such
as a mammal (eg. a human, bovine, porcine or equine subject) an
effective amount of a first mycobacterial antigen and optionally a
second mycobacterial antigen; [0167] wherein said first
mycobacterial antigen comprises: [0168] (i) a polypeptide sequence
has hereinbefore defined; or [0169] (ii) a polynucleotide sequence
encoding a polypeptide sequence as hereinbefore defined according
to (i); and wherein said second mycobacterial antigen is different
from said first mycobacterial antigen.
[0170] In one embodiment, said optional second mycobacterial
antigen comprises or consists of a mycobacterial antigenic
polypeptide or polynucleotide sequence, such as a mycobacterial
antigenic polypeptide or polynucleotide sequence as defined in (i)
or (ii) (wherein said second mycobacterial antigen is different
from said first mycobacterial antigen).
[0171] In one embodiment, the invention provides a method of
stimulating an immune response in a subject, comprising
administrating to said subject: (a) a first mycobacterial antigenic
polypeptide or a first mycobacterial polynucleotide, and optionally
(b) a second mycobacterial antigenic polypeptide or a second
mycobacterial polynucleotide; wherein: [0172] (i) said first
mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; [0173] (ii) said first
mycobacterial polynucleotide as hereinbefore defined comprises a
polynucleotide sequence encoding said first mycobacterial antigenic
polypeptide; [0174] (iii) said second mycobacterial antigenic
polypeptide comprises a polypeptide sequence as hereinbefore
defined; and [0175] (iv) said second mycobacterial polynucleotide
as hereinbefore defined comprises a polynucleotide sequence
encoding said second mycobacterial polypeptide.
[0176] In one embodiment, immune stimulation is measured by a
protective effect in an in vivo survival assay. In one embodiment,
immune stimulation is measured by an increased frequency in immune
cells such as T lymphocytes specific for the antigen in the
vaccine--ie. an immune cell response (eg. a T cell immune
response). In one embodiment, the immune stimulation is a memory T
cell immune response, such as a central memory T cell response (eg.
a CCR7+ response). In one embodiment, immune stimulation is
measured by an increase in antibody titre that is specific for the
antigen in the vaccine. In one embodiment, said method further
comprises administering one or more additional mycobacterial
antigens, as described herein. In one embodiment of this
therapeutic method, said first and optional second (and optional
additional mycobacterial antigen(s)) are provided in the form of an
antigenic composition or formulation as described herein. In one
embodiment, one or more of said first, second and/or optional
additional mycobacterial antigens may be comprised within one or
more vectors or cells as described herein. In one embodiment of
this therapeutic method, any of the limitations described herein
with respect to said first and/or second mycobacterial antigens
(and/or optional additional mycobacterial antigens) apply equally
to the therapeutic uses thereof. In one embodiment, the method
comprises administering said first and second mycobacterial
antigens to the subject substantially simultaneously, or
sequentially. Simultaneous and sequential administration regimes
are discussed in more detail below.
[0177] In a related aspect, there is provided a method of treating
or preventing a mycobacterial infection (eg. an M. tuberculosis
infection), comprising administering to a subject, such as a mammal
(eg. a human, bovine, porcine or equine subject) an effective
amount of a first mycobacterial antigen and optionally a second
mycobacterial antigen; [0178] wherein said first mycobacterial
antigen comprises: [0179] (i) a polypeptide sequence as
hereinbefore defined; or [0180] (ii) a polynucleotide sequence as
hereinbefore defined encoding a polypeptide sequence according to
(i); and wherein said second mycobacterial antigen is different
from said first mycobacterial antigen.
[0181] In one embodiment, said second mycobacterial antigen
comprises or consists of a mycobacterial antigenic polypeptide or
polynucleotide sequence, such as a mycobacterial antigenic
polypeptide or polynucleotide sequence as defined in (i) or (ii)
(wherein said second mycobacterial antigen is different from said
first mycobacterial antigen). In one embodiment, the invention
provides a method of treating or preventing a mycobacterial
infection (eg. M. tuberculosis infection) in a subject; comprising
administering to said subject: (a) a first mycobacterial antigenic
polypeptide or a first mycobacterial polynucleotide, and optionally
(b) a second mycobacterial antigenic polypeptide or a second
mycobacterial polynucleotide; wherein: [0182] (i) said first
mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; [0183] (ii) said first
mycobacterial polynucleotide as hereinbefore defined comprises a
polynucleotide sequence encoding said first mycobacterial antigenic
polypeptide; [0184] (iii) said second mycobacterial antigenic
polypeptide comprises a polypeptide sequence as hereinbefore
defined; and [0185] (iv) said second mycobacterial polynucleotide
as hereinbefore defined.
[0186] For example, said method may protect the subject against
infection with mycobacteria, such as M. tuberculosis. For example,
said method may treat TB in the subject. In one embodiment, said
method may protect the subject against an early stage infection
with mycobacteria, such as M. tuberculosis. Early stage
mycobacterial infection is defined above. In one embodiment, said
method further comprises administering one or more additional
mycobacterial antigens, as described herein. In one embodiment of
this therapeutic method, said first and optional second (and
optional additional mycobacterial antigen(s)) are provided in the
form of an antigenic composition as described herein. In one
embodiment, one or more of said first, second and/or optional
additional mycobacterial antigens may be comprised within one or
more vectors or cells as described herein. In one embodiment, the
method comprises administering said first and second mycobacterial
antigens to the subject substantially simultaneously, or
sequentially. In a related aspect, the first and second (and
optional additional) mycobacterial antigens, antigenic composition,
antibodies, immunogenic composition or medicament of the present
invention, as defined herein, may be useful in therapies (including
preventative treatments) for a range of mycobacterial diseases not
limited to tuberculosis (TB), leprosy, M. avium infection, M. bovis
infection, M. paratuberculosis infection, M. ulcerans infection
(eg. Buruli ulcer), or other non-tuberculosis mycobacterial
infection.
[0187] The first and second (and optional additional) mycobacterial
antigens, antigenic composition, antibodies, immunogenic
composition or medicament of the present invention may be useful
for inducing a range of immune responses and may therefore be
useful in methods for treating a range of diseases. In one
embodiment, the first and optional second (and optional additional)
mycobacterial antigens, antigenic composition or medicament of the
present invention is useful for treating or preventing a range of
non-mycobacterial diseases in which mycobacteria are implicated.
For example, diseases that may benefit from the medicament of the
invention include inflammatory diseases such as autoimmune disease,
cancer (eg. bladder cancer), inflammatory bowel disease, Crohn's
Disease, Johne's Disease, Hansen's Disease, osteomyelitis,
lymphadenitis, smallpox or monkeypox.
[0188] As used herein, the term "treatment" or "treating" embraces
therapeutic or preventative/prophylactic measures, and includes
post-infection therapy and amelioration/suppression of a
mycobacterial infection. As used herein, the term "preventing"
includes preventing the initiation of a mycobacterial infection
and/or reducing the severity or intensity of a mycobacterial
infection. As used herein, the term "vaccine efficacy" describes
the ability of a vaccine to protect a subject (typically a
mammalian subject eg. a human, bovine, porcine or equine subject)
from challenge with mycobacteria such as M. tuberculosis. By way of
example, "vaccine efficacy" may refer to the efficacy of a vaccine
in preventing the initiation of a mycobacterial infection and/or
reducing the severity/intensity of a mycobacterial infection.
[0189] A therapeutic/prophylactic composition or medicament may be
administered to a subject (typically a mammalian subject such as a
human, bovine, porcine or equine subject) already having a
mycobacterial infection, condition or symptoms associated with a
mycobacterial infection, to treat or prevent said mycobacterial
infection. In one embodiment, the subject is suspected of having
come in contact with mycobacteria, or has had known contact with
mycobacteria, but is not yet showing symptoms of exposure. In one
embodiment, the subject has an early-stage infection. When
administered to a subject (eg. a mammal such as a human, bovine,
porcine or equine subject) that already has a mycobacterial
infection or disease, or is showing symptoms associated with a
mycobacterial infection, the therapeutic composition/medicament can
cure, delay, reduce the severity of, or ameliorate one or more
symptoms, and/or prolong the survival of a subject beyond that
expected in the absence of such treatment. Alternatively, a
therapeutic/prophylactic composition or medicament may be
administered to a subject (eg. a mammal such as a human, bovine,
porcine or equine subject) who ultimately may acquire a
mycobacterial infection, in order to prevent, cure, delay, reduce
the severity of, or ameliorate one or more symptoms of said
mycobacterial infection, or in order to prolong the survival of a
subject beyond that expected in the absence of such treatment. In
one embodiment, the subject has previously been exposed to
mycobacteria. For example, the subject may have had a mycobacterial
infection in the past (but is optionally not currently infected
with mycobacteria). The subject may be latently infected with
mycobacteria. Alternatively, or in addition, the subject may have
been vaccinated against mycobacterial infection in the past (eg.
the subject has previously received a BCG vaccination).
[0190] The treatments and preventative therapies of the present
invention are applicable to a variety of different subjects of
different ages. In the context of humans, the therapies are
applicable to children (eg. infants, children under 5 years old,
older children or teenagers) and adults. In the context of other
animal subjects (eg. mammals such as bovine, porcine or equine
subjects), the therapies are applicable to immature subjects (eg.
calves, piglets, foals) and mature/adult subjects. The treatments
and preventative therapies of the present invention are applicable
to subjects who are immunocompromised or immunosuppressed (eg.
human patients who have HIV or AIDS, or other animal patients with
comparable immunodeficiency diseases), subjects who have undergone
an organ transplant, bone marrow transplant, or who have genetic
immuno-deficiencies.
[0191] The invention provides therapeutic formulations, medicaments
and prophylactic formulations (eg. vaccines) comprising a
pharmaceutically acceptable carrier, a first mycobacterial antigen
of the invention as defined above, and a second mycobacterial
antigen of the invention, as defined above (and optionally one or
more additional mycobacterial antigens of the invention, as
described above). In one embodiment, the invention provides a
therapeutic or prophylactic formulation (eg. vaccine), comprising
pharmaceutically acceptable carrier and: [0192] (a) a first
mycobacterial antigen, wherein said first mycobacterial antigen
comprises: [0193] (i) a polypeptide sequence as hereinbefore
defined; or [0194] (ii) a polynucleotide sequence as hereinbefore
defined encoding a polypeptide sequence according to (i); and
optionally [0195] (b) a second mycobacterial antigen, wherein said
second mycobacterial antigen is different from said first
mycobacterial antigen; wherein said formulation is for simultaneous
or sequential administration of said first and second mycobacterial
antigens.
[0196] In one embodiment, said second mycobacterial antigen
comprises or consists of a mycobacterial antigenic polypeptide or
polynucleotide sequence, such as a mycobacterial antigenic
polypeptide or polynucleotide sequence as defined in (i) or (ii)
(wherein said second mycobacterial antigen is different from said
first mycobacterial antigen).
[0197] In one embodiment, said therapeutic or prophylactic
formulation (eg. vaccine), comprises (a) a pharmaceutically
acceptable carrier; (b) a first mycobacterial antigenic polypeptide
or a first mycobacterial polynucleotide; and optionally (c) a
second mycobacterial antigenic polypeptide or a second
mycobacterial polynucleotide; wherein: [0198] (i) said first
mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; [0199] (ii) said first
mycobacterial polynucleotide as hereinbefore defined comprises a
polynucleotide sequence encoding said first mycobacterial antigenic
polypeptide; [0200] (iii) said second mycobacterial antigenic
polypeptide comprises a polypeptide sequence as hereinbefore
defined; and [0201] (iv) said second mycobacterial polynucleotide
as hereinbefore defined comprises a polynucleotide sequence
encoding said second mycobacterial polypeptide; [0202] wherein said
formulation is for simultaneous or sequential administration of
said first mycobacterial antigenic polypeptide or polynucleotide
and said second mycobacterial antigenic polypeptide or
polynucleotide.
[0203] In one embodiment, said therapeutic formulation, medicament
or prophylactic formulation (eg. vaccine) of the invention
comprises an antigenic composition of the invention, as defined
above. In one embodiment, said therapeutic formulation, medicament
or prophylactic formulation (eg. vaccine) comprises an antigenic
composition comprising one or more vectors or cells, as described
above, wherein said vectors or cells comprise at least one of the
mycobacterial antigens. In one embodiment of said therapeutic
formulation, medicament or prophylactic formulation (eg. vaccine),
any of the limitations described herein with respect to said first
and/or second (or additional) mycobacterial antigens apply equally
to said therapeutic formulation, medicament or prophylactic
formulation (eg. vaccine). In one embodiment, a vaccine of the
invention is a "vectored vaccine" comprising one or more vectors as
described above.
[0204] In one embodiment, the therapeutic formulations, medicaments
or prophylactic formulations (eg. vaccines) of the invention are
for simultaneous administration of said first and second (and/or
optional additional) mycobacterial antigens. In an alternative
embodiment, the therapeutic formulations, medicaments or
prophylactic formulations (eg. vaccines) of the invention are for
sequential administration of said first and second (and/or optional
additional) mycobacterial antigens. Therapeutic formulations,
medicaments and prophylactic formulations (eg. vaccines) of the
invention comprise a pharmaceutically acceptable carrier, and
optionally one or more of a salt, excipient, diluent and/or
adjuvant. In one embodiment, the therapeutic formulation,
medicament or prophylactic formulation (eg. vaccine) of the
invention may comprise one or more immunoregulatory agents selected
from, for example, immunoglobulins, antibiotics, interleukins (eg.
IL-2, IL-12), and/or cytokines (eg. IFN-.gamma.). In one
embodiment, the therapeutic formulation, medicament or prophylactic
formulation (eg. vaccine) of the invention may comprise one or more
antimicrobial compounds, such as conventional anti-tuberculosis
drugs (eg. rifampicin, isoniazid, ethambutol or pyrazinamide).
[0205] Accordingly, in one aspect, the invention provides a method
for producing a therapeutic or prophylactic formulation (eg.
vaccine), the method comprising combining a pharmaceutically
acceptable carrier with a first mycobacterial antigen of the
invention, as defined above; and a second mycobacterial antigen of
the invention, as defined above (and optionally one or more
additional mycobacterial antigens, as defined above).
[0206] Thus, in one embodiment, the invention provides a method for
producing a therapeutic or prophylactic formulation (eg. vaccine),
the method comprising combining a pharmaceutically acceptable
carrier with: [0207] (a) a first mycobacterial antigen, wherein
said first mycobacterial antigen comprises: [0208] (i) a
polypeptide sequence as hereinbefore defined; or [0209] (ii) a
polynucleotide sequence as hereinbefore defined encoding a
polypeptide sequence according to (i); and optionally [0210] (b) a
second mycobacterial antigen, wherein said second mycobacterial
antigen is different from said first mycobacterial antigen.
[0211] In one embodiment, said second mycobacterial antigen
comprises or consists of a mycobacterial antigenic polypeptide or
polynucleotide sequence, such as a mycobacterial antigenic
polypeptide or polynucleotide sequence as defined in (i) or (ii)
(wherein said second mycobacterial antigen is different from said
first mycobacterial antigen).
[0212] In one embodiment, the invention provides a method for
producing a therapeutic or prophylactic formulation (eg. vaccine),
the method comprising:
combining a pharmaceutically acceptable carrier with either: [0213]
(i) a first mycobacterial antigenic polypeptide, wherein said first
mycobacterial antigenic polypeptide comprises a polypeptide
sequence as hereinbefore defined; or [0214] (ii) a first
mycobacterial polynucleotide, wherein said first mycobacterial
polynucleotide comprises a polynucleotide sequence as hereinbefore
defined encoding said first mycobacterial antigenic polypeptide;
and optionally with either: [0215] (iii) a second mycobacterial
antigenic polypeptide, wherein said second mycobacterial antigenic
polypeptide comprises a polypeptide sequence as hereinbefore
defined; or [0216] (iv) a second mycobacterial polynucleotide,
wherein said second mycobacterial polynucleotide as hereinbefore
defined comprises a polynucleotide sequence encoding said second
mycobacterial polypeptide.
[0217] In one embodiment, said mycobacterial antigens are in the
form of an antigenic composition of the invention, as defined
above. In one embodiment, the method further comprises combining
said pharmaceutically acceptable carrier and mycobacterial antigens
(or antigenic composition) with one or more of a salt, excipient,
diluent, adjuvant, immunoregulatory agent and/or antimicrobial
compound.
[0218] As used, herein, a "vaccine" is a formulation that, when
administered to an animal subject such as a mammal (eg. a human,
bovine, porcine, ovine, caprine, equine, corvine, canine or feline
subject), stimulates a protective immune response against
mycobacterial infection. The immune response may be a humoral
and/or cell-mediated immune response (eg. a T cell response). A
vaccine of the invention can be used, for example, to protect an
animal from the effects of mycobacterial infection (eg. M.
tuberculosis infection), such as an early-stage infection. The
immunogenicity of the epitopes of the first and second
mycobacterial antigens (eg. polypeptides) of the invention may be
enhanced by preparing them in mammalian or yeast systems fused with
or assembled with particle-forming proteins such as, for example,
that associated with hepatitis B surface antigen. In one
embodiment, the vaccine comprises at least one mycobacterial
polypeptide that has been treated with a chemical modifying agent
(such as formaldehyde) to give a vaccine of improved efficacy.
[0219] The polypeptides and/or polynucleotides of the invention may
be formulated into a vaccine as neutral or salt forms.
Pharmaceutically acceptable salts include acid addition salts
formed with inorganic acids such as, for example, hydrochloric or
phosphoric acids, or with organic acids such as acetic, oxalic,
tartaric, maleic, and the like. Salts formed with the free carboxyl
groups may also be derived from inorganic bases such as, for
example, sodium, potassium, ammonium, calcium, or ferric
hydroxides, and such organic bases as isopropylamine,
trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the
like.
[0220] Administration of therapeutic formulations, medicaments and
prophylactic formulations (eg. vaccines) is generally by
conventional routes e.g. intravenous, subcutaneous,
intraperitoneal, or mucosal (eg. intranasal) routes. The
administration may be by parenteral injection, for example, a
subcutaneous or intramuscular injection. Formulations comprising
neutralizing antibodies may be particularly suited to
administration intravenously, intramuscularly, intradermally, or
subcutaneously. Accordingly, the therapeutic formulations,
medicaments and prophylactic formulations (eg. vaccines) of the
invention are typically prepared as injectables, either as liquid
solutions or suspensions. Solid forms suitable for solution in, or
suspension in, liquid prior to injection may alternatively be
prepared. The preparation may also be emulsified, or the peptide
encapsulated in liposomes or microcapsules. The active immunogenic
ingredients are often mixed with excipients which are
pharmaceutically acceptable and compatible with the active
ingredient. Suitable excipients are, for example, water, saline,
dextrose, glycerol, ethanol, or the like and combinations thereof.
In addition, if desired, the vaccine may contain minor amounts of
auxiliary substances such as wetting or emulsifying agents, pH
buffering agents, and/or adjuvants which enhance the effectiveness
of the vaccine. Generally, the carrier is a
pharmaceutically-acceptable carrier. Non-limiting examples of
pharmaceutically acceptable carriers include water, saline, and
phosphate-buffered saline. In some embodiments, however, the
composition is in lyophilized form, in which case it may include a
stabilizer, such as BSA. In some embodiments, it may be desirable
to formulate the composition with a preservative, such as
thiomersal or sodium azide, to facilitate long term storage.
Examples of adjuvants which may be effective include but are not
limited to: complete Freunds adjuvant (CFA), Incomplete Freunds
adjuvant (IVA), Saponin, a purified extract fraction of Saponin
such as Quil A, a derivative of Saporin such as QS-21, lipid
particles based on Saponin such as ISCOM/ISCOMATIX, E. coli heat
labile toxin (LT) mutants such as LTK63 and/or LTK72, aluminium
hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP),
N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred
to as nor-MDP),
N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'-dip-
almitoyl-sn-glycero-3-hydroxyphosphoryl oxy)-ethylamine (CGP
19835A, referred to as MTP-PE), and RIBI, which contains three
components extracted from bacteria, monophosphoryl lipid A,
trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2%
squalene/Tween 80 emulsion. Examples of buffering agents include,
but are not limited to, sodium succinate (pH 6.5), and phosphate
buffered saline (PBS; pH 6.5 and 7.5). Additional formulations
which are suitable for other modes of administration include
suppositories and, in some cases, oral formulations or formulations
suitable for distribution as aerosols. For suppositories,
traditional binders and carriers may include, for example,
polyalkylene glycols or triglycerides; such suppositories may be
formed from mixtures containing the active ingredient in the range
of 0.5% to 10%, preferably 1%-2%. Oral formulations include such
normally employed excipients as, for example, pharmaceutical grades
of mannitol, lactose, starch, magnesium stearate, sodium
saccharine, cellulose, magnesium carbonate, and the like. These
compositions take the form of solutions, suspensions, tablets,
pills, capsules, sustained release formulations or powders.
[0221] In the case of a mycobacterial respiratory infection (eg. a
M. tuberculosis infection), efficient transmission of the
therapeutic/prophylactic composition or medicament to the site of
infection in the lungs may be achieved by oral or intra-nasal
administration (i.n.). These modes of delivery correspond to the
route of delivery of a M. tuberculosis infection. In the case of
antibody-based compositions, these modes of delivery ensure that
antibodies are present at the site of infection to combat the
bacterium before it becomes intracellular and also during the
period when it spreads between cells. Formulations for intranasal
administration may in the form of nasal droplets or a nasal spray.
An intranasal formulation may comprise droplets having approximate
diameters in the range of 100-5000 .mu.m, such as 500-4000 .mu.m,
1000-3000 .mu.m or 100-1000 .mu.m. Alternatively, in terms of
volume, the droplets may be in the range of about 0.001-100 .mu.l,
such as 0.1-50 .mu.l or 1.0-25 .mu.l, or such as 0.001-1 .mu.l.
Alternatively, the therapeutic/prophylactic formulation or
medicament may be an aerosol formulation. The aerosol formulation
may take the form of a powder, suspension or solution. The size of
aerosol particles is relevant to the delivery capability of an
aerosol. Smaller particles may travel further down the respiratory
airway towards the alveoli than would larger particles. In one
embodiment, the aerosol particles have a diameter distribution to
facilitate delivery along the entire length of the bronchi,
bronchioles, and alveoli. Alternatively, the particle size
distribution may be selected to target a particular section of the
respiratory airway, for example the alveoli. In the case of aerosol
delivery of the medicament, the particles may have diameters in the
approximate range of 0.1-50 .mu.m, preferably 1-25 .mu.m, more
preferably 1-5 .mu.m. Aerosol particles may be for delivery using a
nebulizer (eg. via the mouth) or nasal spray. An aerosol
formulation may optionally contain a propellant and/or surfactant.
It is possible that, following i.n. delivery of mycobacterial
antigens or antibodies, their passage to the lungs is facilitated
by a reverse flow of mucosal secretions, although mucociliary
action in the respiratory tract is thought to take particles within
the mucus out of the lungs. The relatively long persistence in lung
lavage, fast clearance from the bile and lack of transport to the
saliva of some antibodies suggests the role of mucosal
site-specific mechanisms. By controlling the size of the
droplets/particles to within the defined range of the present
invention, it is possible to avoid (or minimize) inadvertent
antigen delivery to the alveoli and thus avoid alveoli-associated
pathological problems such as inflammation and fibrotic scarring of
the lungs. I.n. vaccination engages both T and B cell mediated
effector mechanisms in nasal and bronchus associated mucosal
tissues, which differ from other mucosae-associated lymphoid
tissues. The protective mechanisms invoked by the intranasal route
of administration may include: the activation of T lymphocytes with
preferential lung homing; up-regulation of co-stimulatory molecules
(eg. B7.2); and/or activation of macrophages or secretory IgA
antibodies. Intranasal delivery of antigens may facilitate the
invoking of a mucosal antibody response, which is favoured by a
shift in the T cell response toward the Th2 phenotype which helps
antibody production. A mucosal response is characterised by
enhanced IgA production, and a Th2 response is characterised by
enhanced IL-4 production. Intranasal delivery of mycobacterial
antigens of the invention allows targeting of the antigens to
sub-mucosal B cells of the respiratory system. These B cells are
the major local IgA-producing cells in mammals and intranasal
delivery facilitates a rapid increase in IgA production by these
cells against the mycobacterial antigens. In one embodiment, the
therapeutic/prophylactic formulation or medicament of the invention
stimulates a mucosal and/or Th2 immune response. In another
embodiment, IgA antibody production is stimulated, and the IgA
antibody binds to the mycobacterial antigen.
[0222] In one embodiment, the first and second (and optional
additional) mycobacterial antigens or antibodies of the invention
are for simultaneous administration. Thus, in one embodiment, the
methods/uses of the invention comprise simultaneous administration
of the first and second (and optional additional) mycobacterial
antigens. Simultaneous administration means administration at
(substantially) the same time. For example, in one embodiment the
first and second (and optional additional) mycobacterial antigens
are administered to the subject within 5 minutes of each other,
such as within 4, 3, 2 or 1 minute of each other, for example
within 30 seconds of each other. In one embodiment of `simultaneous
administration`, at least two components (eg. antigens) of the
invention are combined into one composition (eg. a single antigenic
composition or immunogenic composition of the invention as defined
herein). This composition is administered to the subject (such as a
mammal--eg. a human, bovine, porcine, ovine, caprine, equine,
corvine, canine or feline subject) thereby providing both
components to the subject simultaneously. In an alternative
embodiment of `simultaneous administration`, at least two of the
components (eg. antigens) of the invention are provided separately
from each other, but are administered to the subject (such as a
mammal--eg. a human, bovine, porcine, ovine, caprine, equine,
corvine, canine or feline subject) at (substantially) the same
time. The concurrent/parallel administration of said separate
compositions provides both components to the subject at
(substantially) the same time. By way of example, the therapeutic
or prophylactic formulation (eg. vaccine) of the invention may
comprise a first mycobacterial antigen in a first composition and
the second mycobacterial antigen in a second composition. In one
embodiment, the first and second (and optional additional)
mycobacterial antigens of the invention are for simultaneous
administration at (substantially) the same site. Thus, in one
embodiment, the methods/uses of the invention comprise simultaneous
administration of the first and second (and optional additional)
mycobacterial antigens at (substantially) the same site. In this
regard, it is considered advantageous to administer each different
antigenic component of conventional multivalent vaccines at
different sites of the subject's body, in order to stimulate
different lymph nodes. Administration of different antigenic
components of conventional multivalent vaccines at different sites
is also considered advantageous in order to reduce or avoid
undesirable antigenic competition.
[0223] In one embodiment, the present invention advantageously
avoids the need to administer each different antigenic component to
different sites/locations of the subject's body. In this regard, in
one embodiment, the first and second (and optional additional)
antigens of the present invention (substantially) do not compete
with each other, or are associated with relatively low levels of
antigenic competition, as compared with the competitive effect that
might have been expected in view of known multivalent vaccine
compositions. If at least two components (eg. antigens) of the
invention are combined into a single composition (eg. a single
antigenic composition or immunogenic composition of the invention
as defined herein), it is evident that all components of the
invention are administered to the subject at the same site. In one
embodiment, if the first and second (and optional additional)
mycobacterial antigens of the invention are provided separately
from each other, for simultaneous, parallel administration to the
subject at (substantially) the same time, the separate compositions
are administered at the same (or substantially the same) site on/in
the subject.
[0224] In one embodiment, administration at (substantially) the
same site on/in the subject means that the site at which each
mycobacterial antigen of the invention is administered is in the
vicinity of, or in close proximity to, the site at which the other
mycobacterial antigens of the invention are administered.
Alternatively, administration at (substantially) the same site
on/in the subject means that the site at which the each
mycobacterial antigen of the invention is administered is at the
precise site at which the other mycobacterial antigens of the
invention are administered. By way of example, the first and second
(and optional additional) mycobacterial antigens of the invention
may be for administration to the same vein, artery or muscle of the
subject, or via the same nostril of the subject; or to the same
limb (eg. arm) of the subject (eg. to the same upper arm of the
subject); or the first and second (and optional additional)
mycobacterial antigens of the invention may all be for oral or
sublingual administration. In one embodiment, the first and second
(and optional additional) mycobacterial antigens of the invention
may all be for administration at or in close proximity to the same
lymph node. Alternatively, the mycobacterial antigens of the
invention are for administration to the subject (eg. a mammal such
as a human, bovine, porcine, ovine, caprine, equine, corvine,
canine or feline subject) sequentially (ie. one after the other).
In this embodiment, at least two of the components (eg. antigens)
of the invention are provided separately from each other, and are
administered sequentially to the subject. By way of example, the
therapeutic or prophylactic formulation (eg. vaccine) of the
invention may comprise a first mycobacterial antigen in a first
composition and the second mycobacterial antigen in a second
composition. The sequential administration of said first and second
compositions provides both components to the subject one after the
other. Thus, in one embodiment, the methods of the invention
comprise administration of the first mycobacterial antigen, and
then administration of the second mycobacterial antigen.
Alternatively, the second mycobacterial antigen may be administered
and then the first mycobacterial antigen is administered. Any
additional mycobacterial antigens may be administered together with
the first and/or second mycobacterial antigens. Alternatively, any
additional mycobacterial antigens may be administered before or
after the first and/or second mycobacterial antigens.
[0225] In one embodiment, each sequential administration of antigen
is made immediately one after the other. In one embodiment, there
is a time-gap or pause between one or more (eg. between each) of
the administrations. A time-gap or pause between sequential
administrations may be at least 5, 10, 15, or 30 minutes, or may be
at least 1, 2, 5, 12, 18 or 24 hours, or may be at least 1, 2, or 5
days, or may be at least 1 or 2 weeks. In one embodiment, the first
and second (and optional additional) mycobacterial antigens of the
invention are for sequential administration at (substantially) the
same site. Thus, in one embodiment, the methods/uses of the
invention comprise sequential administration of the first and
second (and optional additional) mycobacterial antigens at
(substantially) the same site. In one embodiment, administration at
(substantially) the same site on/in the subject means that the site
at which the each mycobacterial antigen of the invention is
administered is in the vicinity of, or in close proximity to, the
site at which the other mycobacterial antigens of the invention are
administered. Alternatively, administration at (substantially) the
same site on/in the subject means that the site at which each
mycobacterial antigen of the invention is administered is at the
precise site at which the other mycobacterial antigens of the
invention are administered. By way of example, the first and second
(and optional additional) mycobacterial antigens of the invention
may be for administration to the same vein, artery or muscle of the
subject, or via the same nostril of the subject; or to the same
limb (eg. arm) of the subject (eg. to the same upper arm of the
subject); or the first and second (and optional additional)
mycobacterial antigens of the invention may all be for oral or
sublingual administration. In one embodiment, the first and second
(and optional additional) mycobacterial antigens of the invention
may all be for administration at or in close proximity to the same
lymph node.
[0226] The therapeutic formulation, medicament or prophylactic
formulation (eg. a vaccine) of the invention may be given in a
single dose schedule (ie. the full dose is given at substantially
one time). Alternatively, the therapeutic formulation, medicament
or prophylactic formulation (eg. a vaccine) of the invention may be
given in a multiple dose schedule. A multiple dose schedule is one
in which a primary course of treatment (eg. vaccination) may be
with 1-6 separate doses, followed by other doses given at
subsequent time intervals required to maintain and or reinforce the
immune response, for example (for human subjects), at 1-4 months
for a second dose, and if needed, a subsequent dose(s) after a
further 1-4 months. The dosage regimen will be determined, at least
in part, by the need of the individual and be dependent upon the
judgment of the practitioner (eg. doctor or veterinarian). In one
embodiment, the vaccine of the present invention may be
administered as part of a `prime-boost` vaccination regime.
[0227] Prime-boost vaccination regimes involve: Priming--ie.
exposing a subject to one or more antigens or a vaccine; and
subsequently: Boosting--ie. exposing the subject to one or more
antigens or a vaccine. The `boost` antigens/vaccine is typically
different from the `primer` antigens/vaccine (known as
"heterologous" prime-boost). In this regard, heterologous
prime-boost immunization strategies have been shown to induce
higher levels of immune cell responses (eg. effector T cell
responses) in subjects as compared with homologous boosting with
the same vaccine. For example, repeated vaccination with
conventional vaccines such as BCG does not appear to further
enhance protection against TB. However, incorporating BCG into a
heterologous prime-boost regime may retain the protective effects
of BCG. Thus, in one embodiment the invention provides a method of
vaccination against mycobacterial infection comprising `priming` a
subject's immune system by administration of a heterologous
conventional vaccine (eg. BCG vaccine) and then `boosting` the
subject's immune system by administration of the vaccine of the
present invention. In one embodiment, the invention provides a
method of vaccination against mycobacterial infection comprising
administering the vaccine of the present invention to a subject
that has been pre-exposed to a heterologous conventional vaccine
such as BCG. Alternatively, a subject's immune system may be
`primed` by administration of the vaccine of the present invention,
and then `boosted` by administration of a heterologous conventional
vaccine (eg. BCG vaccine). Accordingly, in one embodiment, the
vaccine is administered to a subject that is subsequently to be
exposed to a heterologous conventional vaccine such as BCG. The
`priming` step may be carried out on the subject at any age--in the
case of mammalian subjects (eg. human, bovine, porcine, ovine,
caprine, equine, cervine, canine or feline subjects), priming with
BCG is conventionally carried out neonatally, or during infancy,
adolescence or adulthood. The `boosting` step may be carried out at
any time after the `priming` step. In the case of mammalian
subjects (eg. human, bovine, porcine, ovine, caprine, equine,
cervine, canine or feline subjects), a boosting step may be carried
out at least about 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 weeks after the
priming step, or at least about 3, 6, 8 or 12 months after the
priming step, or at least about 2, 5, 10, 15, 20, 25, 30, 35, or 40
or more years after the boosting step. In one embodiment, for a
human subject, the priming step is carried out during infancy and
the boosting step is carried out during adolescence. In one
embodiment, the therapeutic formulation, medicament or prophylactic
formulation (eg. a vaccine) of the invention can be administered to
a subject such as a mammal (eg. a human, bovine, porcine, ovine,
caprine, equine, corvine, canine or feline subject) in conjunction
with (simultaneously or sequentially) one or more immunoregulatory
agents selected from, for example, immunoglobulins, antibiotics,
interleukins (eg. IL-2, IL-12), and/or cytokines (eg. IFN.gamma.).
In one embodiment, the therapeutic formulation, medicament or
prophylactic formulation (eg. vaccine) of the invention can be
administered to a subject such as a mammal (eg. a human, bovine,
porcine, ovine, caprine, equine, corvine, canine or feline subject)
in conjunction with (simultaneously or sequentially) one or more
antimicrobial compounds, such as conventional anti-tuberculosis
drugs (eg. rifampicin, isoniazid, ethambutol or pyrazinamide).
[0228] The therapeutic formulation, medicament or prophylactic
formulation (eg. vaccine) may contain 5% to 95% of active
ingredient, such as at least 10% or 25% of active ingredient, or at
least 40% of active ingredient or at least 50, 55, 60, 70 or 75%
active ingredient. The therapeutic formulation, medicament or
prophylactic formulation (eg. a vaccine) is administered in a
manner compatible with the dosage formulation, and in such amount
as will be prophylactically and/or therapeutically effective. In
this regard, as used herein, an "effective amount" is a dosage or
amount that is sufficient to achieve a desired biological outcome.
As used herein, a "therapeutically effective amount" is an amount
which is effective, upon single or multiple dose administration to
a subject (such as a mammal--eg. a human, bovine, porcine, ovine,
caprine, equine, corvine, canine or feline subject) for treating,
preventing, curing, delaying, reducing the severity of,
ameliorating at least one symptom of a disorder or recurring
disorder, or prolonging the survival of the subject beyond that
expected in the absence of such treatment. Accordingly, the
quantity of active ingredient to be administered, which is
generally in the range of 5 micrograms to 250 micrograms of antigen
per dose (or higher if delivered orally or in the form of viral
vectors), depends on the subject to be treated, capacity of the
subject's immune system to generate a protective immune response,
and the degree of protection desired. Precise amounts of active
ingredient required to be administered may depend on the judgment
of the practitioner and may be particular to each subject.
[0229] According to a further aspect of the invention, the first
and second mycobacterial antigens (and optional additional
mycobacterial antigens) of the invention, as described herein, are
useful in immunoassays to detect the presence in a test sample of
antibodies to said first and second mycobacterial antigens. In one
embodiment, said first and second mycobacterial antigens (and
optional additional antigens) are used in the form of an antigenic
composition, as described herein. According to another aspect of
the invention, the first and second antibodies (and optional
additional antibodies) of the invention, as described herein, are
useful in immunoassays to detect the presence in a test sample of
said first and second mycobacterial antigens. In one embodiment,
said first and second antibodies (and optional additional
antibodies) are used in the form of an immunogenic
antibody-containing composition, as described herein.
[0230] A test sample may be a biological sample such as a clinical
sample or environmental sample. As used herein, a `clinical sample`
refers to a sample of tissue or fluid isolated from an individual,
including but not limited to, for example, plasma, serum, spinal
fluid, lymph fluid, the external sections of the skin, respiratory,
intestinal, and genitourinary tracts, tears, saliva, milk, blood
cells, tumours, organs, and also samples of in vitro cell culture
constituents (including but not limited to conditioned medium
resulting from the growth of cells in cell culture medium,
putatively infected cells, recombinant cells, and cell components).
In the context of the diagnostic methods discussed below, a
`subject` is any animal subject that would benefit from detection
of mycobacterial infection, such as M. tuberculosis infection.
Typical animal subjects are mammals, for example, human, bovine,
porcine, ovine, caprine, equine, corvine, canine or feline
subjects. In one embodiment, the subject is human, bovine, porcine
or equine.
[0231] Design of immunoassays is subject to a great deal of
variation, and many formats are known in the art. Protocols may be
based, for example, upon competition, direct reaction, or sandwich
type assays. Protocols may also, for example, use solid supports,
or may employ immuno-precipitation. Most assays involve the use of
labeled antibodies or polypeptides; the labels may be, for example,
enzymatic, fluorescent, chemiluminescent, radioactive, or dye
molecules. Assays that comprise signal amplification are also
known; for example, assays that utilize biotin and avidin, or
enzyme-labeled and mediated immunoassays, such as ELISA assays. In
one aspect of the invention, the first and second mycobacterial
antigens (or antigenic composition) of the invention are useful for
detecting the presence of a T-lymphocyte that has been previously
exposed to an antigenic component of a mycobacterial infection in a
patient. Accordingly, in one embodiment, the invention provides an
in vitro method of diagnosing a mycobacterial infection, such as an
early stage mycobacterial infection, comprising incubating
(`challenging`) a test sample containing an immune cell such as a
T-lymphocyte from a subject (eg. a mammal such as a human, bovine,
porcine or equine subject) with a first mycobacterial antigen of
the invention and a second mycobacterial antigen of the invention,
as defined herein; or an antigenic composition of the invention, as
defined herein; and detecting activation of said immune cell (eg.
T-lymphocyte). Activation of said immune cell is indicative of a
mycobacterial infection in the subject.
[0232] In one embodiment of said in vitro method, said first
mycobacterial antigen is selected from (i) a first mycobacterial
antigenic polypeptide comprising a polypeptide sequence having at
least 70% amino acid sequence identity to the amino acid sequence
of SEQ ID NO: 1 or 7, or a fragment thereof having at least 50
consecutive amino acids thereof; or (ii) a first mycobacterial
polynucleotide sequence comprising a polynucleotide sequence
encoding said first mycobacterial antigenic polypeptide. In one
embodiment of said in vitro method, said second mycobacterial
antigen is selected from (iii) a second mycobacterial antigenic
polypeptide comprising a polypeptide sequence having at least 70%
amino acid sequence identity to the amino acid sequence of SEQ ID
NO: 5, or a fragment thereof having at least 7 consecutive amino
acids thereof; or (iv) a second mycobacterial polynucleotide
sequence comprising a polynucleotide sequence encoding said second
mycobacterial antigenic polypeptide.
[0233] An immune cell, such as a T-lymphocyte, that has been
previously exposed to one or both of the first and second
mycobacterial antigens will become `activated` on subsequent
challenge by the same antigen. As such, activation of said immune
cell (eg. T-lymphocyte) is indicative of a mycobacterial infection
in the subject, and provides a means for identifying a positive
diagnosis of mycobacterial infection. In contrast, the same
activation is not achieved by an immune cell (eg. T-lymphocyte)
that has not been previously exposed to the particular antigen. The
above-described `activation` of an immune cell (eg. T-lymphocyte)
is sometimes referred to as a `recall response` and may be
measured, for example, by determining the release of interferon
(eg. IFN-.gamma.) from the activated immune cell (eg.
T-lymphocyte). Thus, the presence of a mycobacterial infection in a
patient may be determined by detecting activation of immune cell
(eg. T-lymphocyte) in response to in vitro challenge with the first
and second mycobacterial antigens (or antigenic composition) of the
present invention--eg. by detecting the release of a minimum
concentration of interferon from immune cell (eg. T-lymphocyte)
after a defined time period following the challenge. The above
immune cell (eg. T-lymphocyte) diagnostic assay may further include
an antigen presenting cell (APC) expressing at least one major
histocompatibility complex (MHC) class II molecule expressed by the
patient in question. The APC may be inherently provided in the
biological sample, or may be added exogenously. In one embodiment,
the T-lymphocyte is a CD4 T-lymphocyte.
[0234] Alternative immunoassays for diagnosing mycobacterial
infection depend upon detection of antibodies to the first and
second mycobacterial antigens (eg. polypeptides) of the invention.
Such assays may comprise the step of incubating a test sample (eg.
a biological sample) suspected of containing the antibodies with
said first and second antigens (or antigenic composition) of the
invention. Accordingly, the invention also provides an in vitro
method of diagnosing a mycobacterial infection, such as an early
stage mycobacterial infection, comprising incubating a test sample
from a subject (eg. a mammal such as a human, bovine, porcine or
equine subject) with a first mycobacterial antigen and a second
mycobacterial antigen of the invention, as defined herein; or an
antigenic composition of the invention, as defined herein; wherein
said incubating is performed under conditions that allow binding of
said first and second mycobacterial antigens with antibodies in the
sample to form antigen-antibody complexes; and then detecting the
formation of such complexes. The presence of antigen-antibody
complexes is indicative of a mycobacterial infection in the
subject.
[0235] In one embodiment of said in vitro method, said first
mycobacterial antigen is selected from (i) a first mycobacterial
antigenic polypeptide comprising a polypeptide sequence as
hereinbefore defined; or (ii) a first mycobacterial polynucleotide
sequence comprising a polynucleotide sequence as hereinbefore
defined encoding said first mycobacterial antigenic polypeptide;
and optionally said second mycobacterial antigen is selected from
(iii) a second mycobacterial antigenic polypeptide comprising a
polypeptide sequence as hereinbefore defined; and (iv) a second
mycobacterial polynucleotide sequence as hereinbefore defined
comprising a polynucleotide sequence encoding said second
mycobacterial antigenic polypeptide. Antigen-antibody complexes
(or, in the case of competitive assays, the amount of competing
antibody) may be detected by any of a number of known techniques,
depending on the format. For example, unlabelled antibodies in the
complex may be detected using a conjugate of anti-xenogeneic Ig
complexed with a label (eg. an enzyme label). The immunoassay may
be of a standard or competitive type. In one embodiment, the first
and second mycobacterial antigens are bound to one or more solid
supports to facilitate separation of the sample from the antigens
after incubation. Examples of solid supports that can be used are
nitrocellulose (eg. in membrane or microtitre well form), polyvinyl
chloride (eg. in sheets or microtiter wells), polystyrene latex
(eg. in beads or microtiter plates, polyvinylidine fluoride (known
as Immulon), diazotized paper, nylon membranes, activated beads,
and Protein A beads. For example, Dynatech Immulon microtiter
plates or 60 mm diameter polystyrene beads (Precision Plastic Ball)
may be used. The solid support(s) containing the first and second
mycobacterial antigens is typically washed after separating it from
the test sample, and prior to detection of bound antibodies. The
invention also embraces immunoassays for detecting the presence of
the first and second mycobacterial antigens (eg. polypeptides) of
the invention in a test sample (eg. a biological sample). In such
methods, a test sample suspected of containing said mycobacterial
antigens may be incubated with antibodies directed against the
first and second mycobacterial antigens.
[0236] Accordingly, the invention provides an in vitro method of
diagnosing a mycobacterial infection, such as an early stage
mycobacterial infection, comprising incubating a test sample from a
subject (eg. a mammal such as a human, bovine, porcine or equine
subject) with a first antibody and a second antibody of the
invention, as defined herein; or an immunogenic composition of the
invention, as defined herein; wherein said incubating is performed
under conditions that allow binding of said first and second
antibodies with antigens in the sample to form antigen-antibody
complexes; and then detecting the formation of such complexes,
wherein the presence of antigen-antibody complexes is indicative of
a mycobacterial infection in the subject. In one embodiment of said
in vitro method, said first antibody binds a first mycobacterial
antigenic polypeptide; and said optional second antibody binds a
second mycobacterial antigenic polypeptide. It may be desirable to
treat the biological sample prior to testing, to release putative
bacterial components. Various formats can be employed. For example,
a "sandwich assay" may be employed, where antibodies bound to a
solid support are incubated with the test sample; washed; incubated
with second, labeled antibodies to the first and second antigens,
and the support is washed again. The first and second mycobacterial
antigens are detected by determining if the second antibody is
bound to the support. In a competitive format, a test sample is
usually incubated with antibodies and a labeled, competing antigen
is also incubated, either sequentially or simultaneously.
[0237] In one aspect, the invention provides an immunoassay kit,
comprising an antigenic composition of the invention, or antibodies
to said first and second mycobacterial antigens. The immunoassay
kit may further comprise a buffer. The term "polypeptide"
throughout this specification is synonymous with the terms
"oligopeptide", "peptide" and "protein". These terms are used
interchangeably and do not refer to a specific length of the
product. These terms embrace post-translational modifications such
as glycosylation, acetylation and phosphorylation. In one
embodiment, the isolated polypeptides of the invention are
substantially free from other proteins with which they are
co-produced as well as from other contaminants. For instance, an
isolated polypeptide is substantially free of material or other
proteins from the cell, bacterial, or tissue source from which it
was derived.
[0238] The present invention encompasses polypeptides that are
substantially homologous to a polypeptide based on any one of the
reference SEQ ID NOs identified in this application (including
fragments thereof). The terms "sequence identity" and "sequence
homology" are considered synonymous in this specification. By way
of example, a polypeptide of interest may comprise an amino acid
sequence having at least 70, 75, 80, 82, 84, 86, 88, 90, 92, 94,
96, 98, 99 or 100% amino acid sequence identity with the amino acid
sequence of a reference polypeptide.
[0239] There are many established algorithms available to align two
amino acid sequences. Typically, one sequence acts as a reference
sequence, to which test sequences may be compared. The sequence
comparison algorithm calculates the percentage sequence identity
for the test sequence(s) relative to the reference sequence, based
on the designated program parameters. Alignment of amino acid
sequences for comparison may be conducted, for example, by computer
implemented algorithms (eg. GAP, BESTFIT, FASTA or TFASTA), BLAST
and BLAST 2.0 algorithms, or BLOSUM62--Henikoff & Henikoff,
Proc. Natl. Acad. Sci. USA 89:10915-10919, 1992; incorporated
herein by reference). In a homology comparison, the identity may
exist over a region of the sequences that is at least 50 amino acid
residues in length (eg. at least 75, 100, 150, 200, 250, 300, 350,
400, 450, 500, 550, 600 or 650 amino acid residues in length--eg.
up to the entire length of the reference sequence. Substantially
homologous polypeptides have one or more amino acid substitutions,
deletions, or additions. In many embodiments, those changes are of
a minor nature, for example, involving only conservative amino acid
substitutions. Conservative substitutions are those made by
replacing one amino acid with another amino acid within the
following groups: Basic: arginine, lysine, histidine; Acidic:
glutamic acid, aspartic acid; Polar: glutamine, asparagine;
Hydrophobic: leucine, isoleucine, valine; Aromatic: phenylalanine,
tryptophan, tyrosine; Small: glycine, alanine, serine, threonine,
methionine. Substantially homologous polypeptides also encompass
those comprising other substitutions that do not significantly
affect the folding or activity of the polypeptide; small deletions,
typically of 1 to about 30 amino acids (such as 1-10, or 1-5 amino
acids); and small amino- or carboxyl-terminal extensions, such as
an amino-terminal methionine residue, a small linker peptide of up
to about 20-25 residues, or an affinity tag.
[0240] The polypeptides of the present invention may also comprise
non-naturally occurring amino acid residues. In this regard, in
addition to the 20 standard amino acids, non-standard amino acids
(such as 4-hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric
acid, isovaline and .alpha.-methyl serine) may be substituted for
amino acid residues of the mycobacterial polypeptides of the
present invention. A limited number of non-conservative amino
acids, amino acids that are not encoded by the genetic code, and
unnatural amino acids may be substituted for mycobacterial
polypeptide amino acid residues. Non-naturally occurring amino
acids include, without limitation, trans-3-methylproline,
2,4-methano-proline, cis-4-hydroxyproline, trans-4-hydroxy-proline,
N-methylglycine, allo-threonine, methyl-threonine,
hydroxy-ethylcysteine, hydroxyethylhomo-cysteine, nitro-glutamine,
homoglutamine, pipecolic acid, tert-leucine, norvaline,
2-azaphenylalanine, 3-azaphenyl-alanine, 4-azaphenyl-alanine, and
4-fluorophenylalanine.
[0241] Routine deletion analyses of nucleic acid molecules can be
performed to obtain functional fragments of a nucleic acid molecule
that encodes a polypeptide of the invention. As an illustration,
DNA molecules can be digested with Bal31 nuclease to obtain a
series of nested deletions. These DNA fragments are then inserted
into expression vectors in proper reading frame, and the expressed
polypeptides are isolated and tested for the desired activity. An
alternative to exonuclease digestion is to use
oligonucleotide-directed mutagenesis to introduce deletions, or
stop codons to specify production of a desired fragment.
Alternatively, particular polynucleotide fragments can be
synthesized using the polymerase chain reaction. A mutant of a
polypeptide of the invention may contain one or more analogs of an
amino acid (eg. an unnatural amino acid), or a substituted linkage,
as compared with the sequence of the reference polypeptide. In a
further embodiment, a polypeptide of interest may be a mimic of the
reference polypeptide, which mimic reproduces at least one epitope
of the reference polypeptide. Mutants of the disclosed
polynucleotide and polypeptide sequences of the invention can be
generated through DNA shuffling. Briefly, mutant DNAs are generated
by in vitro homologous recombination by random fragmentation of a
parent DNA followed by reassembly using PCR, resulting in randomly
introduced point mutations. This technique can be modified by using
a family of parent DNAs, to introduce additional variability into
the process. Selection or screening for the desired activity,
followed by additional iterations of mutagenesis and assay provides
for rapid "evolution" of sequences by selecting for desirable
mutations while simultaneously selecting against detrimental
changes. Mutagenesis methods as disclosed above can be combined
with high-throughput screening methods to detect activity of cloned
mutant polypeptides. Mutagenized nucleic acid molecules that encode
polypeptides of the invention, or fragments thereof, can be
recovered from the host cells and rapidly sequenced using modern
equipment. These methods allow the rapid determination of the
importance of individual amino acid residues in a polypeptide of
interest, and can be applied to polypeptides of unknown
structure.
[0242] A "fragment" of a polypeptide of interest comprises a series
of consecutive amino acid residues from the sequence of said
polypeptide. By way of example, a "fragment" of a polypeptide of
interest may comprise (or consist of) at least 50 consecutive amino
acid residues from the sequence of said polypeptide (eg. at least
75, 100, 125, 150, 175, 200, 225, 250, 275, 300 consecutive amino
acid residues of said polypeptide). A fragment includes at least
one epitope of the polypeptide of interest.
[0243] As used herein, the terms "nucleic acid sequence" and
"polynucleotide" are used interchangeably and do not imply any
length restriction. As used herein, the terms "nucleic acid" and
"nucleotide" are used interchangeably. The terms "nucleic acid
sequence" and "polynucleotide" embrace DNA (including cDNA) and RNA
sequences. The polynucleotide sequences of the present invention
include nucleic acid sequences that have been removed from their
naturally occurring environment, recombinant or cloned DNA
isolates, and chemically synthesized analogues or analogues
biologically synthesized by heterologous systems. The natural or
synthetic DNA fragments coding for a desired fragment may be
incorporated into recombinant nucleic acid constructs, typically
DNA constructs, capable of introduction into and replication in a
prokaryotic or eukaryotic cell. Usually the DNA constructs will be
suitable for autonomous replication in a unicellular host, such as
yeast or bacteria, but may also be intended for introduction to and
integration within the genome of a cultured insect, mammalian,
plant or other eukaryotic cell lines. The term "recombinant" as
used herein intends a polynucleotide of genomic, cDNA,
semi-synthetic, or synthetic origin which, by virtue of its origin
or manipulation: (1) is not associated with all or a portion of a
polynucleotide with which it is associated in nature; or (2) is
linked to a polynucleotide other than that to which it is linked in
nature; and (3) does not occur in nature. When applied to a nucleic
acid sequence, the term "isolated" in the context of the present
invention denotes that the polynucleotide sequence has been removed
from its natural genetic milieu and is thus free of other
extraneous or unwanted coding sequences (but may include naturally
occurring 5' and 3' untranslated regions such as promoters and
terminators), and is in a form suitable for use within genetically
engineered protein production systems. Such isolated molecules are
those that are separated from their natural environment. A
"variant" nucleic acid sequence has substantial homology or
substantial similarity to a reference nucleic acid sequence (or a
fragment thereof). A nucleic acid sequence or fragment thereof is
"substantially homologous" (or "substantially identical") to a
reference sequence if, when optimally aligned (with appropriate
nucleotide insertions or deletions) with the other nucleic acid (or
its complementary strand), there is nucleotide sequence identity in
at least about 70%, 75%, 80%, 82, 84, 86, 88, 90, 92, 94, 96, 98 or
99% of the nucleotide bases. Homology determination is performed as
described supra for polypeptides. Alternatively, a "variant"
nucleic acid sequence is substantially homologous with (or
substantially identical to) a reference sequence (or a fragment
thereof) if the "variant" and the reference sequence they are
capable of hybridizing under stringent (eg. highly stringent)
hybridization conditions. Nucleic acid sequence hybridization will
be affected by such conditions as salt concentration (eg. NaCl),
temperature, or organic solvents, in addition to the base
composition, length of the complementary strands, and the number of
nucleotide base mismatches between the hybridizing nucleic acids,
as will be readily appreciated by those skilled in the art.
Stringent temperature conditions are preferably employed, and
generally include temperatures in excess of 30.degree. C.,
typically in excess of 37.degree. C. and preferably in excess of
45.degree. C. Stringent salt conditions will ordinarily be less
than 1000 mM, typically less than 500 mM, and preferably less than
200 mM. The pH is typically between 7.0 and 8.3. The combination of
parameters is much more important than any single parameter. A
"fragment" of a polynucleotide of interest comprises a series of
consecutive amino acid residues from the sequence of said
full-length polynucleotide. By way of example, a "fragment" of a
polynucleotide of interest may comprise (or consist of) at least
150 consecutive nucleic acid residues from the sequence of said
polypeptide (eg. at least 200, 250, 300, 350, 400, 450, 500, 550,
600, 650, 700 or 750 consecutive nucleic acid residues of said
polynucleotide). A fragment encodes at least one antigenic epitope
of the corresponding polypeptide of interest.
TABLE-US-00005 SEQ ID No. 1
atgtggtggttccgccgccgagaccgggcgccgctgcgcgccaccagctcattatccctgcggtggcgggtcat-
gctgctggcgatgtccatg
gtcgcgatggtggttgtgctgatgtcgttcgccgtctatgcggtgatctcggccgcgctctacagcgacatcga-
caaccaactgcagagccggg
cgcaactgctcatcgccagtggctcgctggcagctgatccgggtaaggcaatcgagggtaccgcctattcggat-
gtcaacgcgatgctggtca
accccggccagtccatctacaccgctcaacagccgggccagacgctgccggtcggtgctgccgagaaggcggtg-
atccgtggcgagttgtt
catgtcgcggcgcaccaccgccgaccaacgggtgcttgccatccgtctgaccaacggtagttcgctgctgatct-
ccaaaagtctcaagccca
ccgaagcagtcatgaacaagctgcgttgggtgctattgatcgtgggtgggatcggggtggcggtcgccgcggtg-
gccggggggatggtcac
ccgggccgggctgaggccggtgggccgcctcaccgaagcggccgagcgggtggcgcgaaccgacgacctgcggc-
ccatccccgtcttc
ggcagcgacgaattggccaggctgacagaggcattcaatttaatgctgcgggcgctggccgagtcacgggaacg-
gcaggcaaggctggtt
accgacgccggacatgaattgcgtaccccgctaacgtcgctgcgcaccaatgtcgaactcttgatggcctcgat-
ggccccgggggctccgcg
gctacccaagcaggagatggtcgacctgcgtgccgatgtgctggctcaaatcgaggaattgtccacactggtag-
gcgatttggtggacctgtc
ccgaggcgacgccggagaagtggtgcacgagccggtcgacatggctgacgtcgtcgaccgcagcctggagcggg-
tcaggcggcggcgc
aacgatatccttttcgacgtcgaggtgattgggtggcaggtttatggcgataccgctggattgtcgcggatggc-
gcttaacctgatggacaacgc
cgcgaagtggagcccgccgggcggccacgtgggtgtcaggctgagccagctcgacgcgtcgcacgctgagctgg-
tggtttccgaccgcgg
cccgggcattcccgtgcaggagcgccgtctggtgtttgaacggttttaccggtcggcatcggcacgggcgttgc-
cgggttcgggcctcgggttg
gcgatcgtcaaacaggtggtgctcaaccacggcggattgctgcgcatcgaagacaccgacccaggcggccagcc-
ccctggaacgtcgatt
tacgtgctgctccccggccgtcggatgccgattccgcagcttcccggtgcgacggctggcgctcggagcacgga-
catcgagaactctcgggg
ttcggcgaacgttatctcagtggaatctcagtccacgcgcgcaacctag SEQ ID No. 2
MWWFRRRDRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLL
IASGSLAADPGKAIEGTAYSDVNAMLVNPGQSIYTAQQPGQTLPVGAAEKAVIRGELFMSRRTTADQ
RVLAIRLTNGSSLLISKSLKPTEAVMNKLRWVLLIVGGIGVAVAAVAGGMVTRAGLRPVGRLTEAAER
VARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASM
APGAPRLPKQEMVDLRADVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMADVVDRSLERVRRRR
NDILFDVEVIGWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQLDASHAELVVSDRGPGIP
VQERRLVFERFYRSASARALPGSGLGLAIVKQVVLNHGGLLRIEDTDPGGQPPGTSIYVLLPGRRMPI
PQLPGATAGARSTDIENSRGSANVISVESQSTRAT SEQ ID No. 3
atgacggctccgggactgacagcagccgtcgaggggatcgcacacaacaagggcgagctgttcgcctcctttga-
cgtggacgcgttcgagg
ttccgcacggccgcgacgagatctggcggttcaccccgttgcggcggctgcgtggcctgcacgacggctccgcg-
cgggccaccggtagcg
ccacgatcacggtcagcgagcggccgggcgtatacacccagaccgtgcgccgcggcgatccacgactgggcgag-
ggcggcgtacccac
cgaccgcgttgccgcccaagcgttttcgtcgttcaactccgcgactctggtcaccgtcgagcgcgacacccagg-
tcgtcgagccggtaggcat
caccgtgaccgggccgggggagggcgcggtggcctatgggcacctgcaggtgcgtatcgaggagcttggcgagg-
cggtcgtggtcatcga
ccaccggggcggcggaacctacgccgacaacgtcgagttcgttgtcgacgacgccgctcggctgaccgccgtgt-
ggatcgccgactgggc
cgacaacaccgttcacctcagcgcgcaccatgctcggatcggcaaggacgcggtgctgcgccacgtcaccgtca-
tgttgggcggcgacgtg
gtgcgaatgtcggcgggcgtgcggttctgcggtgcgggtggggacgcggaactgctggggctgtatttcgccga-
cgacggccagcacctgg
agtcgcggctgctggtggaccacgcccaccccgactgcaagtcgaacgtgctgtataagggtgcactgcaaggt-
gatccggcgtcgtcgttg
cccgacgcacacacggtctgggtgggtgacgtgctgatccgtgcgcaggccaccggcaccgacaccttcgaggt-
gaaccggaacctggtg
ctcaccgacggcgcgcgtgccgactcggtgcccaacctggagatcgagaccggcgagatcgtcggcgccggaca-
cgccagcgccaccg
gtcgcttcgacgatgagcaattgttctacctgcgttcgcgcggtattcccgaagcacaggcccgccggctggtg-
gtccgcggcttcttcggtgag
atcatcgccaagatcgcggtgcccgaggtacgcgagcgcctgaccgcagccatcgaacacgagctggaaatcac-
ggaatcaacggaaa agacaacagtctcatga SEQ ID No. 4
MTAPGLTAAVEGIAHNKGELFASFDVDAFEVPHGRDEIWRFTPLRRLRGLHDGSARATGSATITVSE
RPGVYTQTVRRGDPRLGEGGVPTDRVAAQAFSSFNSATLVTVERDTQVVEPVGITVTGPGEGAVAY
GHLQVRIEELGEAVVVIDHRGGGTYADNVEFVVDDAARLTAVWIADWADNTVHLSAHHARIGKDAVL
RHVTVMLGGDVVRMSAGVRFCGAGGDAELLGLYFADDGQHLESRLLVDHAHPDCKSNVLYKGALQ
GDPASSLPDAHTVWVGDVLIRAQATGTDTFEVNRNLVLTDGARADSVPNLEIETGEIVGAGHASATG
RFDDEQLFYLRSRGIPEAQARRLVVRGFFGEIIAKIAVPEVRERLTAAIEHELEITESTEKTTVS
SEQ ID No. 5
atggcggttcgtcaggtcaccgtcggctattcggacggcacgcacaagacgatgccggtgcggtgcgaccagac-
ggtcctggatgccgccg
aggaacacggcgtggccatcgtcaacgaatgccaaagcgggatatgtggcacctgcgtggccacctgcaccgcc-
ggccgctaccagatg
ggacgcaccgagggactgtccgatgtcgagcgggcggcgcgaaagatcctcacctgccagacgtttgttacctc-
cgattgccggatcgagct
gcagtatccggtcgacgacaacgccgccctgctggtcaccggtgacggtgtggtgaccgcggtcgagttggtgt-
cgcccagcaccgccatcc
tgcgggtggacacctctggcatggccggcgcgctgagataccgggccggccagttcgcccaattgcaggttccc-
ggtaccaacgtatggcg
caactactcctacgcccatccggccgacggccgcggtgagtgcgagttcatcatcaggttgctgccggacggcg-
tgatgtcgaattatcttcgc
gaccgcgcccagcccggtgaccatatcgcgctgcgctgcagcaagggcagcttttatctgcgcccgatcgtgcg-
accggtgatcctggtcgc
cggaggaaccggcctgtcagcgatcctggcgatggcccagagcctggatgccgatgtcgctcacccggtctacc-
tgctctacggggtcgagc
gcaccgaagacctgtgcaagctcgacgaactcaccgagctgcgccgccgcgttggccgcctggaggtgcacgtc-
gtcgtcgctcgcccgg
accccgactgggatgggcgcaccgggctggtcaccgacctgctcgacgagcggatgctggcgagcggtgacgcc-
gacgtgtatctgtgcg
gtccggtcgccatggtcgacgcagcccgaacctggctggaccacaatggctttcaccgtgtcgggttgtactac-
gagaagttcgtggccagcg
gggcggcgcgccgccgcaccccggctcggctggattacgcgggcgtggacattgccgaggtgtgccgccgcggc-
cgcggcaccgcggtg
gtcatcggcggcagcatcgcgggcatcgcggcggcgaaaatgctcagcgagaccttcgatcgcgtcatcgtgct-
ggagaaggacggcccg
caccgtcgccgcgagggcaggccgggcgcggcacagggttggcacctgcaccacctgctgaccgccgggcagat-
cgagctggagcgca
tcttccctggcatcgtcgacgacatggtgcgcgagggagcgttcaaggtcgacatggccgcgcagtaccgtatc-
cggctgggcggcacctgg
aagaagcccggcactagtgacatcgagatcgtctgcgcgggaaggccgctgctcgaatggtgtgtgcgccgccg-
gctcgacgacgaaccg
cgcatcgacttccgctacgaatcggaggtggccgatctcgccttcgaccgcgccaacaatgccatcgtcggcgt-
cgccgtggacaatggcga
cgccgacggaggcgacggtttgcaggtggtgcccgccgagttcgtcgtggacgcgtcgggcaagaacacccgcg-
tgccggagttcttggag
cgtctcggtgttggcgctcccgaggccgagcaggacatcatcaactgcttctactccacgatgcagcaccgggt-
tccgccggagcggcggtg
gcaggacaaggtgatggtgatctgctatgcgtaccgccctttcgaggatacctacgccgcgcagtactacaccg-
acagctcccgcaccatcct
gtccacctcactggtggcctacaactgctattcgccgccgcgtaccgcccgagaattccgcgcgttcgccgacc-
tgatgccgtccccggtcatc
ggggagaacatcgacgggctggagccggcatcgcccatctacaatttccgctatcccaacatgctgcggctgcg-
ctacgagaagaagcgc
aacctgccgcgggctttgctggcggtgggcgatgcctacaccagcgccgacccggtgtcgggtctgggtatgag-
cctggcgctcaaggaagt
tcgggagatgcaggcgctgctggctaaatacggcgccggtcaccgggatctgccgcgccggtactaccgggcga-
tcgccaagatggccga
cacggcctggttcgtgatccgcgagcagaacctgcgcttcgactggatgaaggacgtcgacaagaagcgcccgt-
tctatttcggtgtgctgac
ctggtacatggaccgcgtgctggagctggtgcatgacgatctcgacgcgtaccgggaattcttggccgtcgtcc-
atctggtcaagccgccgtcg
gcgctgatgcgacccaggatcgccagccgcgtcctcggcaaatgggcacgaacccgattgtcgggccagaagac-
gttgattgcccgcaac
tacgaaaatcatccgataccagccgaacccgcggaccaacttgtaaacgcttag SEQ ID No. 6
MAVRQVTVGYSDGTHKTMPVRCDQTVLDAAEEHGVAIVNECQSGICGTCVATCTAGRYQMGRTEG
LSDVERAARKILTCQTFVTSDCRIELQYPVDDNAALLVTGDGVVTAVELVSPSTAILRVDTSGMAGAL
RYRAGQFAQLQVPGTNVWRNYSYAHPADGRGECEFIIRLLPDGVMSNYLRDRAQPGDHIALRCSKG
SFYLRPIVRPVILVAGGTGLSAILAMAQSLDADVAHPVYLLYGVERTEDLCKLDELTELRRRVGRLEVH
VVVARPDPDWDGRTGLVTDLLDERMLASGDADVYLCGPVAMVDAARTWLDHNGFHRVGLYYEKFV
ASGAARRRTPARLDYAGVDIAEVCRRGRGTAVVIGGSIAGIAAAKMLSETFDRVIVLEKDGPHRRREG
RPGAAQGWHLHHLLTAGQIELERIFPGIVDDMVREGAFKVDMAAQYRIRLGGTWKKPGTSDIEIVCA
GRPLLEWCVRRRLDDEPRIDFRYESEVADLAFDRANNAIVGVAVDNGDADGGDGLQVVPAEFVVDA
SGKNTRVPEFLERLGVGAPEAEQDIINCFYSTMQHRVPPERRWQDKVMVICYAYRPFEDTYAAQYY
TDSSRTILSTSLVAYNCYSPPRTAREFRAFADLMPSPVIGENIDGLEPASPIYNFRYPNMLRLRYEKKR
NLPRALLAVGDAYTSADPVSGLGMSLALKEVREMQALLAKYGAGHRDLPRRYYRAIAKMADTAWFVI
REQNLRFDWMKDVDKKRPFYFGVLTWYMDRVLELVHDDLDAYREFLAVVHLVKPPSALMRPRIASR
VLGKWARTRLSGQKTLIARNYENHPIPAEPADQLVNA SEQ ID No. 7
atgaccacaacgactacaacgatttctggggggatattacccaaggaataccaagatcttcgggatacggtggc-
cgattttgcgcgcaccgtg
gtcgcgccggtatcggccaaacacgatgcggaacacagcttcccatacgaaattgtcgccaagatgggagagat-
gggcctgttcgggctgc
cgtttccggaggagtacggcggcatgggcggcgactacttcgcgctgtcgctggtacttgaggagctgggcaag-
gttgaccaatcggtagcg
atcacgctggaggccgcggtgggcctgggtgcgatgccgatctaccggttcggtaccgaggagcagaaacagaa-
gtggttgcccgacttga
cgtctggccgtgcgctcgccggttttggtctcaccgagccgggagcgggatcggacgcgggcagcacccgcacc-
acggcgcgtctcgaag
gtgacgagtggatcatcaacggctccaagcaatttatcaccaactcgggcaccgacatcacatcgctggtcacc-
gtcactgcggttaccggg
accaccggaaccgctgcggatgccaagaaagagatttcgacgatcatcgtgcccagcggcacaccgggattcac-
cgtggaaccggtctat
aacaaggtcggctggaacgcctcggacacccacccactgacatttgccgatgcgcgggtcccgagggagaacct-
gctgggagcccgggg
gagcggctatgccaacttcttgtccatcctggacgagggccggattgcgattgcagcgctggccaccggcgcgg-
cgcagggctgtgttgacg
agagcgtcaagtacgccaaccagcgtcagtcgtttggccagccgatcggcgcttatcaggcgatcggcttcaag-
atcgcgcggatggaggc
acgcgcccatgttgcccgcacagcgtactatgatgccgccgcaaagatgttggcgggcaagcccttcaagaagg-
aggcggcgatcgcgaa
gatgatctcctcggaggcggcgatggacaactcccgcgatgccacccagatacacggcggatacggctttatga-
acgaatatccggtggcg
cgtcattaccgcgacagcaaggtgctcgagattggtgagggcaccacggaagtgcagctgatgcttatcgcgcg-
atcgttgggactgcagtg a SEQ ID No. 8
MTTTTTTISGGILPKEYQDLRDTVADFARTVVAPVSAKHDAEHSFPYEIVAKMGEMGLFGLPFPEEYG
GMGGDYFALSLVLEELGKVDQSVAITLEAAVGLGAMPIYRFGTEEQKQKWLPDLTSGRALAGFGLTE
PGAGSDAGSTRTTARLEGDEWIINGSKQFITNSGTDITSLVTVTAVTGTTGTAADAKKEISTIIVPSGTP
GFTVEPVYNKVGWNASDTHPLTFADARVPRENLLGARGSGYANFLSILDEGRIAIAALATGAAQGCV
DESVKYANQRQSFGQPIGAYQAIGFKIARMEARAHVARTAYYDAAAKMLAGKPFKKEAAIAKMISSEA
AMDNSRDATQIHGGYGFMNEYPVARHYRDSKVLEIGEGTTEVQLMLIARSLGLQ SEQ ID No. 9
atggacaaggtggtggccaccgccgcggaggcggtcgcagacatagccaacgggtcgtcgcttgcggttggtgg-
attcgggctttgcggcat
ccccgaagcactgatcgcagcgttggtggatagcggtgtcaccgacctggaaacagtctcgaacaactgcggaa-
tcgacggtgttggtctgg
gactattgttgcaacacaagcgaattcgccggacagtctcctcctacgtgggggagaacaaggagttcgcccgc-
cagttcctcgcgggcgag
ctcgaggtggaactgaccccgcagggcacgctggccgagcggttgcgggccggagggatgggcataccggcctt-
ctatacaccggcagg
ggtcggtacccaggtcgccgacggcgggttgccgtggcgctacgacgcctcgggcggggtggcggtggtgtcgc-
cggccaaggagactcg
ggagttcgatggtgtcacctatgtcctcgagcgggggatccggaccgacttcgcactggtgcatgcctggcagg-
gggaccggcacggcaac
ctgatgtaccgccacgccgcggccaacttcaacccggagtgcgcatccgcaggcaggatcacgatcgccgaggt-
cgagcacttggtcgag
ccgggtgagatcgaccctgccaccgtacacaccccgggcgtgtttgtgcaccgggtggttcatgtgcccaaccc-
cgccaagaagatcgaga gggagacggtgcggcaatga SEQ ID No. 10
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVGLGLLLQHK
RIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTPAGVGTQVADGGLPW
RYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRHGNLMYRHAAANFNPECASA
GRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKKIERETVRQ SEQ ID No. 11
atgaccctggaagtggtatcggacgcggccggacgcatgcgggtcaaagtcgactgggtccgttgcgattcccg-
gcgcgcggtcgcggtcg
aagaggccgttgccaagcagaacggtgtgcgcgtcgtgcacgcctacccgcgcaccgggtccgtggtcgtgtgg-
tattcacccagacgcgc
cgaccgcgcggcggtgctggcggcgatcaagggcgccgcgcacgtcgccgccgaactgatccccgcgcgtgcgc-
cgcactcggccgag
atccgcaacaccgacgtgctccggatggtcatcggcggggtggcactggccttgctcggggtgcgccgctacgt-
gttcgcgcggccaccgct
gctcggaaccaccgggcggacggtggccaccggtgtcaccattttcaccgggtatccgttcctgcgtggcgcgc-
tgcgctcgctgcgctccgg
aaaggccggcaccgatgccctggtctccgcggcgacggtggcaagcctcatcctgcgcgagaacgtggtcgcac-
tcaccgtcctgtggttgc
tcaacatcggtgagtacctgcaggatctgacgctgcggcggacccggcgggccatctcggagctgctgcgcggc-
aaccaggacacggcct
gggtgcgcctcaccgatccttctgcaggctccgacgcggccaccgaaatccaggtcccgatcgacaccgtgcag-
atcggtgacgaggtggt
ggtccacgagcacgtcgcgataccggtcgacggtgaggtggtcgacggcgaagcgatcgtcaatcagtccgcga-
tcaccggggaaaacct
gccggtcagcgtcgtggtcggaacgcgcgtgcacgccggttcggtcgtggtgcgcggacgcgtggtggtgcgcg-
cccacgcggtaggcaa
ccaaaccaccatcggtcgcatcattagcagggtcgaagaggctcagctcgaccgggcacccatccagacggtgg-
gcgagaacttctcccg
ccgcttcgttcccacctcgttcatcgtctcggccatcgcgttgctgatcaccggcgacgtgcggcgcgcgatga-
ccatgttgttgatcgcatgccc
gtgcgcggtgggactgtccaccccgaccgcgatcagcgcagcgatcggcaacggcgcgcgccgtggcatcctga-
tcaagggcggatccc
acctcgagcaggcgggccgcgtcgacgccatcgtgttcgacaagaccgggacgttgaccgtgggccgccccgtg-
gtcaccaatatcgttgc
catgcataaagattgggagcccgagcaagtgctggcctatgccgccagctcggagatccactcacgtcatccgc-
tggccgaggcggtgatc
cgctcgacggaggaacgccgcatcagcatcccaccacacgaggagtgcgaggtgctggtcggcctgggcatgcg-
gacctgggccgacg
gtcggaccctgctgctgggcagtccgtcgttgctgcgcgccgaaaaagttcgggtgtccaagaaggcgtcggag-
tgggtcgacaagctgcg
ccgccaggcggagaccccgctgctgctcgcggtggacggcacgctggtcggcctgatcagcctgcgcgacgagg-
tgcgtccggaggcgg
cccaggtgctgacgaagctgcgggccaatgggattcgccggatcgtcatgctcaccggcgaccacccggagatc-
gcccaggttgtcgccga
cgaactggggattgatgagtggcgcgccgaggtcatgccggaggacaagctcgcggcggtgcgcgagctgcagg-
acgacggctacgtcg
tcgggatggtcggcgacggcatcaacgacgccccggcgctggccgccgccgatatcgggatcgccatgggcctt-
gccggaaccgacgtcg
ccgtcgagaccgccgatgtcgcgctggccaacgacgacctgcaccgcctgctcgacgttggggacctgggcgag-
cgggcagtggatgtaa
tccggcagaactacggcatgtccatcgccgtcaacgcggccgggctgctgatcggcgcgggcggtgcgctctcg-
ccggtgctggcggcgat
cctgcacaacgcgtcgtcggtggcggtggtggccaacagttcccggttgatccgctaccgcctggaccgctag
SEQ ID No. 12
MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTGSVVVWYSPRRADRA
AVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMVIGGVALALLGVRRYVFARPPLLGTTGRTVATGV
TIFTGYPFLRGALRSLRSGKAGTDALVSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRAISE
LLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVQIGDEVVVHEHVAIPVDGEVVDGEAIVNQSAITGE
NLPVSVVVGTRVHAGSVVVRGRVVVRAHAVGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTS
FIVSAIALLITGDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAGRVDAIVFDKT
GTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRISIPPHEECEVLVGLG
MRTWADGRTLLLGSPSLLRAEKVRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAA
QVLTKLRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQDDGYVVGMVGDGI
NDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHRLLDVGDLGERAVDVIRQNYGMSIAVNAAGL
LIGAGGALSPVLAAILHNASSVAVVANSSRLIRYRLDR SEQ ID No. 13
atgactgtgcaggagttcgacgtcgtggtggtcggcagcggcgccgccggcatggttgctgcgctggtcgccgc-
tcaccgaggtctctcgacg
gtagtcgtcgagaaggccccgcactacggcggctccaccgcacgctcgggcggcggcgtctggatccccaacaa-
cgaggtcctcaagcg
ccgcggcgttcgagatacaccggaggcggcacgcacctatctgcacggcatcgtcggcgaaatcgtcgagccgg-
aacgcatcgatgctta
cctcgaccgcgggcccgagatgctgtcgttcgtgctgaagcacacgccgctgaagatgtgctgggtacccggct-
actccgactactaccccg
aggctccgggcggccgcccgggcggacgttcgatcgagccgaaaccgttcaacgcgcgcaagcttggtgccgac-
atggccgggctggag
cccgcgtatggcaaggttccgctcaatgtggttgtgatgcagcaggactacgttcgcctcaatcagctcaaacg-
tcacccccgtggcgtgctgc
gcagcatgaaggtcggcgcccgcacgatgtgggcgaaggcaacaggtaagaacctggtcggcatgggtcgagcc-
ctcattgggccgttgc
ggatcgggttgcagcgcgccggagtgccggtcgaactcaacaccgccttcaccgatcttttcgtcgaaaatggc-
gtcgtgtccggggtatacgt
ccgcgattcccacgaggcggaatccgctgagccgcagctgatccgggctcgccgcggcgtgatcctggcctgtg-
gtggtttcgagcataacg
agcagatgcgaatcaagtaccagcgggcacccatcaccaccgagtggaccgtgggcgccagcgccaataccggt-
gacggcattctcgcc
gccgaaaagctcggcgcagcactggatctgatggatgacgcttggtggggcccgacggtaccgctggtcggcaa-
accatggttcgcgctctc
ggagcgcaactctcccggttcgatcatcgtcaacatgtcaggcaagcgattcatgaacgaatcgatgccatacg-
tcgaagcctgtcatcatatg
tacggcggcgaacacggccaggggcccggaccgggcgagaacattccggcgtggctggtgttcgaccagcgata-
ccgggaccgctacat
cttcgcgggactacaaccagggcaacgcattccgagcaggtggctggattccggcgtcatcgtccaggccgata-
cccttgcggagctggcc
ggcaaggccggtctacccgcggacgaactcactgccaccgtccagcgtttcaacgcattcgcccggtccggtgt-
cgacgaggactaccacc
gcggggaaagtgcctacgatcgctactacggcgacccgagcaacaagcccaatccgaacctcggcgaggtcggc-
cacccgccctattatg
gcgccaagatggttccgggcgacctggggaccaagggcggtatccgcaccgatgtcaacggacgtgctctgcgg-
gacgacggcagcatc
atcgacggcctttacgctgcaggcaatgtcagtgccccagtgatgggacacacctaccccggtccgggcggcag-
ataggcccggcgatg
acgttcgggtacctggcggcgctgcacattgccgatcaggcgggaaagcgctga SEQ ID No.
14
MTVQEFDVVVVGSGAAGMVAALVAAHRGLSTVVVEKAPHYGGSTARSGGGVWIPNNEVLKRRGVR
DTPEAARTYLHGIVGEIVEPERIDAYLDRGPEMLSFVLKHTPLKMCWVPGYSDYYPEAPGGRPGGRS
IEPKPFNARKLGADMAGLEPAYGKVPLNVVVMQQDYVRLNQLKRHPRGVLRSMKVGARTMWAKAT
GKNLVGMGRALIGPLRIGLQRAGVPVELNTAFTDLFVENGVVSGVYVRDSHEAESAEPQLIRARRGVI
LACGGFEHNEQMRIKYQRAPITTEWTVGASANTGDGILAAEKLGAALDLMDDAWWGPTVPLVGKPW
FALSERNSPGSIIVNMSGKRFMNESMPYVEACHHMYGGEHGQGPGPGENIPAWLVFDQRYRDRYIF
AGLQPGQRIPSRWLDSGVIVQADTLAELAGKAGLPADELTATVQRFNAFARSGVDEDYHRGESAYD
RYYGDPSNKPNPNLGEVGHPPYYGAKMVPGDLGTKGGIRTDVNGRALRDDGSIIDGLYAAGNVSAP
VMGHTYPGPGGTIGPAMTFGYLAALHIADQAGKR SEQ ID No. 15
gtgagtccggcgcccgtgcaggtgatgggggttctaaacgtcacggacgactctttctcggacggcgggtgtta-
tctcgatctcgacgatgcgg
tgaagcacggtctggcgatggcagccgcaggtgcgggcatcgtcgacgtcggtggtgagtcgagccggcccggt-
gccactcgggttgaccc
ggcggtggagacgtctcgtgtcatacccgtcgtcaaagagcttgcagcacaaggcatcaccgtcagcatcgata-
ccatgcgcgcggatgtcg
ctcgggcggcgttgcagaacggtgcccagatggtcaacgacgtgtcgggtgggcgggccgatccggcgatgggg-
ccgctgttggccgagg
ccgatgtgccgtgggtgttgatgcactggcgggcggtatcggccgataccccgcatgtgcctgtgcgctacggc-
aacgtggtggccgaggtcc
gtgccgacctgctggccagcgtcgccgacgcggtggccgcaggcgtcgacccggcaaggctggtgctcgatccc-
gggcttggattcgccaa
gacggcgcaacataattgggcgatcttgcatgcccttccggaactggtcgcgaccggaatcccagtgctggtgg-
gtgcttcgcgcaagcgctt
cctcggtgcgttgttggccgggcccgacggcgtgatgcggccaaccgatgggcgtgacaccgcgacggcggtga-
tttccgcgctggccgca
ctgcacggggcctggggtgtgcgggtgcatgatgtgcgggcctcggtcgatgccatcaaggtggtcgaagcgtg-
gatgggagcggaaagg atagaacgcgatggctga SEQ ID No. 16
VSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVE
TSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMH
WRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALP
ELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAALHGAWGVRVHDVRASVDAI
KVVEAWMGAERIERDG SEQ ID No. 17
atgagtattaccaggccgacgggcagctatgccagacagatgctggatccgggcggctgggtggaagccgatga-
agacactttctatgacc
gggcccaggaatatagccaggttttgcaaagggtcaccgatgtattggacacctgccgccagcagaaaggccac-
gtcttcgaaggcggcct
atggtccggcggcgccgccaatgctgccaacggcgccctgggtgcaaacatcaatcaattgatgacgctgcagg-
attatctcgccacggtga
ttacctggcacaggcatattgccgggttgattgagcaagctaaatccgatatcggcaataatgtggatggcgct-
caacgggagatcgatatcct
ggagaatgaccctagcctggatgctgatgagcgccataccgccatcaattcattggtcacggcgacgcatgggg-
ccaatgtcagtctggtcgc
cgagaccgctgagcgggtgctggaatccaagaattggaaacctccgaagaacgcactcgaggatttgcttcagc-
agaagtcgccgccacc
cccagacgtgcctaccctggtcgtgccatccccgggcacaccgggcacaccgggaaccccgatcaccccgggaa-
ccccgatcaccccgg
gaaccccaatcacacccatcccgggagcgccggtaactccgatcacaccaacgcccggcactcccgtcacgccg-
gtgaccccgggcaa
gccggtcaccccggtgaccccggtcaaaccgggcacaccaggcgagccaaccccgatcacgccggtcacccccc-
cggtcgccccggcc
acaccggcaaccccggccacgcccgttaccccagctcccgctccacacccgcagccggctccggcaccggcgcc-
atcgcctgggcccca
gccggttacaccggccactcccggtccgtctggtccagcaacaccgggcaccccagggggcgagccggcgccgc-
acgtcaaacccgcg
gcgttggcggagcaacctggtgtgccgggccagcatgcgggcggggggacgcagtcggggcctgcccatgcgga-
cgaatccgccgcgtc
ggtgacgccggctgcggcgtccggtgtcccgggcgcacgggcggcggccgccgcgccgagcggtaccgccgtgg-
gagcgggcgcgcgt
tcgagcgtgggtacggccgcggcctcgggcgcggggtcgcatgctgccactgggcgggcgccggtggctacctc-
ggacaaggcggcggc
accgagcacgcgggcggcctcggcgcggacggcacctcctgcccgcccgccgtcgaccgatcacatcgacaaac-
ccgatcgcagcgag
tctgcagatgacggtacgccggtgtcgatgatcccggtgtcggcggctcgggcggcacgcgacgccgccactgc-
agctgccagcgcccgc
cagcgtggccgcggtgatgcgctgcggttggcgcgacgcatcgcggcggcgctcaacgcgtccgacaacaacgc-
gggcgactacgggtt
cttctggatcaccgcggtgaccaccgacggttccatcgtcgtggccaacagctatgggctggcctacatacccg-
acgggatggaattgccga
ataaggtgtacttggccagcgcggatcacgcaatcccggttgacgaaattgcacgctgtgccacctacccggtt-
ttggccgtgcaagcctggg
cggctttccacgacatgacgctgcgggcggtgatcggtaccgcggagcagttggccagttcggatcccggtgtg-
gccaagattgtgctggag
ccagatgacattccggagagcggcaaaatgacgggccggtcgcggctggaggtcgtcgacccctcggcggcggc-
tcagctggccgacac
taccgatcagcgtttgctcgacttgttgccgccggcgccggtggatgtcaatccaccgggcgatgagcggcaca-
tgctgtggttcgagctgatg
aagcccatgaccagcaccgctaccggccgcgaggccgctcatctgcgggcgttccgggcctacgctgcccactc-
acaggagattgccctgc
accaagcgcacactgcgactgacgcggccgtccagcgtgtggccgtcgcggactggctgtactggcaatacgtc-
accgggttgctcgaccg ggccctggccgccgcatgctga SEQ ID No. 18
MSITRPTGSYARQMLDPGGWVEADEDTFYDRAQEYSQVLQRVTDVLDTCRQQKGHVFEGGLWSG
GAANAANGALGANINQLMTLQDYLATVITWHRHIAGLIEQAKSDIGNNVDGAQREIDILENDPSLDADE
RHTAINSLVTATHGANVSLVAETAERVLESKNWKPPKNALEDLLQQKSPPPPDVPTLVVPSPGTPGT
PGTPITPGTPITPGTPITPIPGAPVTPITPTPGTPVTPVTPGKPVTPVTPVKPGTPGEPTPITPVTPPVAP
ATPATPATPVTPAPAPHPQPAPAPAPSPGPQPVTPATPGPSGPATPGTPGGEPAPHVKPAALAEQP
GVPGQHAGGGTQSGPAHADESAASVTPAAASGVPGARAAAAAPSGTAVGAGARSSVGTAAASGA
GSHAATGRAPVATSDKAAAPSTRAASARTAPPARPPSTDHIDKPDRSESADDGTPVSMIPVSAARAA
RDAATAAASARQRGRGDALRLARRIAAALNASDNNAGDYGFFWITAVTTDGSIVVANSYGLAYIPDG
MELPNKVYLASADHAIPVDEIARCATYPVLAVQAWAAFHDMTLRAVIGTAEQLASSDPGVAKIVLEPD
DIPESGKMTGRSRLEVVDPSAAAQLADTTDQRLLDLLPPAPVDVNPPGDERHMLWFELMKPMTSTA
TGREAAHLRAFRAYAAHSQEIALHQAHTATDAAVQRVAVADWLYWQYVTGLLDRALAAAC SEQ ID
NO: 19
MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDI
KVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPA
CGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGL
LIDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKP
SDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRA
LGATPNTGPAPQGA SEQ ID NO: 20
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQF
QSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAG
CQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQG
MGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGA
NIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSVVEYWGAQLNAMKGDLQSSLGAG
SEQ ID NO: 21
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELN
NALQNLARTISEAGQAMASTEGNVTGMFA SEQ ID NO: 22
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMED
LVRAYHAMSSTHEANTMAMMARDTAEAAKWGG SEQ ID NO: 23
MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNI
NTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLR
GAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQ
FDAAIQPGDSGGPVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHI
GPTAFLGLGVVDNNGNGARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVI
SVTWQTKSGGTRTGNVTLAEGPPA SEQ ID NO: 24
MVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGL
MVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPA
IAVNEAEYGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQ
LMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSS
MLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAAN
QAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAG SEQ
ID NO: 25
MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKI
PGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVL
NPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQL
AQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS SEQ ID NO: 26
MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKIG
AELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEV
ETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDP
ERQEAVLEDPYILLVSSKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAP
GFGDRRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAIAGRVA
QIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGG
GVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQIAFNSGLEPGVVAEKVRNLPAGHGLNAQTGV
YEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAVVADKPEKEKASVPGGGDMGGMDF SEQ ID
NO: 27
MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLT
ELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEA
LGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK SEQ
ID NO: 28
VTQTGKRQRRKFGRIRQFNSGRWQASYTGPDGRVYIAPKTFNAKIDAEAWLTDRRREIDRQLWSPA
SGQEDRPGAPFGEYAEGVVLKQRGIKDRTRAHYRKLLDNHILATFADTDLRDITPAAVRRWYATTAVG
TPTMRAHSYSLLRAIMQTALADDLIDSNPCRISGASTARRVHKIRPATLDELETITKAMPDPYQAFVLM
AAWLAMRYGELTELRRKDIDLHGEVARVRRAVVRVGEGFKVTTPKSDAGVRDISIPPHLIPAIEDHLH
KHVNPGRESLLFPSVNDPNRHLAPSALYRMFYKARKAAGRPDLRVHDLRHSGAVLAASTGATLAEL
MQRLGHSTAGAALRYQHAAKGRDREIAALLSKLAENQEM SEQ ID NO: 29
VIAGVDQALAATGQASQRAAGASGGVTVGVGVGTEQRNLSVVAPSQFTFSSRSPDFVDETAGQSW
CAILGLNQFH SEQ ID NO: 30
MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDV
DIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPT
EKHIQIRSTN
SEQ ID NO: 31
MSGRHRKPTTSNVSVAKIAFTGAVLGGGGIAMAAQATAATDGEWDQVARCESGGNWSINTGNGYL
GGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVGERVLATQGRGAWPVCGRGLSNATPREVLPAS
AAMDAPLDAAAVNGEPAPLAPPPADPAPPVELAANDLPAPLGEPLPAAPADPAPPADLAPPAPADVA
PPVELAVNDLPAPLGEPLPAAPADPAPPADLAPPAPADLAPPAPADLAPPAPADLAPPVELAVNDLPA
PLGEPLPAAPAELAPPADLAPASADLAPPAPADLAPPAPAELAPPAPADLAPPAAVNEQTAPGDQPA
TAPGGPVGLATDLELPEPDPQPADAPPPGDVTEAPAETPQVSNIAYTKKLWQAIRAQDVCGNDALDS
LAQPYVIG SEQ ID NO: 32
MLRLVVGALLLVLAFAGGYAVAACKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRDDLYPAAG
VQVHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMTDTAPAAASRASRVPLSGMALP
VVSAKTVQLNDGGLVRTVHLPAPNVAGLLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKVTE
RLPLPPNARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEVNGVETGRLPVANVVVTPAHEAVVR
VGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAINTGNGYYGGVQFDQGTWEANGGLRYAPRADLAT
REEQIAVAEVTRLRQGWGAWPVCAARAGAR SEQ ID NO: 33
VHPLPADHGRSRCNRHPISPLSLIGNASATSGDMSSMTRIAKPLIKSAMAAGLVTASMSLSTAVAHAG
PSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQ
GLDAWPTCGAASGLPIALWSKPAQGIKQIINEIIWAGIQASIPR SEQ ID NO: 34
MTPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSKADDIDWDAIAQCESGGNWAA
NTGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAPLGS
LTHILTFLAAETGGCSGSRDD SEQ ID NO: 35
LKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDA
GFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLRFTAGTWRA
NGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG SEQ ID NO: 36
MIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLEAVVMLLAVTVSLLTIPFAAAAGTAVQD
SRSHVYAHQAQTRHPATATVIDHEGVIDSNTTATSAPPRTKITVPARWVVNGIERSGEVNAKPGTKS
GDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAGALLALTRAILIRVRNASWQHDIDS
LFCTQR SEQ ID NO: 37
MTEPAAWDEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHVLGGCSTAL
FPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPGPSLTVAEQEQCLDELR
GAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSGGGLQHISSGVFLLKASVRELRECV
GSELLTEPEQLAAAHELIDRGRAEVVVVSLGSQGALLATRHASHRFSSIPMTAVSGVGAGDAMVAAIT
VGLSRGWSLIKSVRLGNAAGAAMLLTPGTAACNRDDVERFFELAAEPTEVGQDQYVWHPIVNPEAS
P SEQ ID NO: 38
MPDTMVTTDVIKSAVQLACRAPSLHNSQPWRWIAEDHTVALFLDKDRVLYATDHSGREALLGCGAVL
DHFRVAMAAAGTTANVERFPNPNDPLHLASIDFSPADFVTEGHRLRADAILLRRTDRLPFAEPPDWD
LVESQLRTTVTADTVRIDVIADDMRPELAAASKLTESLRLYDSSYHAELFWWTGAFETSEGIPHSSLV
SAAESDRVTFGRDFPVVANTDRRPEFGHDRSKVLVLSTYDNERASLLRCGEMLSAVLLDATMAGLA
TCTLTHITELHASRDLVAALIGQPATPQALVRVGLAPEMEEPPPATPRRPIDEVFHVRAKDHR SEQ
ID NO: 39
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTA
TAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICS
PMALAS SEQ ID NO: 40
MASSASDGTHERSAFRLSPPVLSGAMGPFMHTGLYVAQSWRDYLGQQPDKLPIARPTIALAAQAFR
DEIVLLGLKARRPVSNHRVFERISQEVAAGLEFYGNRRWLEKPSGFFAQPPPLTEVAVRKVKDRRRS
FYRIFFDSGFTPHPGEPGSQRWLSYTANNREYALLLRHPEPRPWLVCVHGTEMGRAPLDLAVFRAW
KLHDELGLNIVMPVLPMHGPRGQGLPKGAVFPGEDVLDDVHGTAQAVWDIRRLLSWIRSQEEESLIG
LNGLSLGGYIASLVASLEEGLACAILGVPVADLIELLGRHCGLRHKDPRRHTVKMAEPIGRMISPLSLT
PLVPMPGRFIYAGIADRLVHPREQVTRLWEHWGKPEIVWYPGGHTGFFQSRPVRRFVQAALEQSGL
LDAPRTQRDRSA SEQ ID NO: 41
MSTQRPRHSGIRAVGPYAWAGRCGRIGRWGVHQEAMMNLAIVVHPRKVQSATIYQVTDRSHDGRTA
RVPGDEITSTVSGWLSELGTQSPLADELARAVRIGDWPAAYAIGEHLSVEIAVAV SEQ ID NO:
42
atgcagcttgttgacagggttcgtggcgccgtcacgggtatgtcgcgtcgactcgtggtcggggccgtcggcgc-
ggccctagtgtcgggtctgg
tcggcgccgtcggtggcacggcgaccgcgggggcattttcccggccgggcttgccggtggagtacctgcaggtg-
ccgtcgccgtcgatggg
ccgtgacatcaaggtccaattccaaagtggtggtgccaactcgcccgccctgtacctgctcgacggcctgcgcg-
cgcaggacgacttcagcg
gctgggacatcaacaccccggcgttcgagtggtacgaccagtcgggcctgtcggtggtcatgccggtgggtggc-
cagtcaagcttctactccg
actggtaccagcccgcctgcggcaaggccggttgccagacttacaagtgggagaccttcctgaccagcgagctg-
ccggggtggctgcagg
ccaacaggcacgtcaagcccaccggaagcgccgtcgtcggtctttcgatggctgcttcttcggcgctgacgctg-
gcgatctatcacccccagc
agttcgtctacgcgggagcgatgtcgggcctgttggacccctcccaggcgatgggtcccaccctgatcggcctg-
gcgatgggtgacgctggc
ggctacaaggcctccgacatgtggggcccgaaggaggacccggcgtggcagcgcaacgacccgctgttgaacgt-
cgggaagctgatcgc
caacaacacccgcgtctgggtgtactgcggcaacggcaagccgtcggatctgggtggcaacaacctgccggcca-
agttcctcgagggcttc
gtgcggaccagcaacatcaagttccaagacgcctacaacgccggtggcggccacaacggcgtgttcgacttccc-
ggacagcggtacgcac
agctgggagtactggggcgcgcagctcaacgctatgaagcccgacctgcaacgggcactgggtgccacgcccaa-
caccgggcccgcgc cccagggcgcctag SEQ ID NO: 43
atgacagacgtgagccgaaagattcgagcttggggacgccgattgatgatcggcacggcagcggctgtagtcct-
tccgggcctggtggggct
tgccggcggagcggcaaccgcgggcgcgttctcccggccggggctgccggtcgagtacctgcaggtgccgtcgc-
cgtcgatgggccgcga
catcaaggttcagttccagagcggtgggaacaactcacctgcggtttatctgctcgacggcctgcgcgcccaag-
acgactacaacggctggg
atatcaacaccccggcgttcgagtggtactaccagtcgggactgtcgatagtcatgccggtcggcgggcagtcc-
agcttctacagcgactggt
acagcccggcctgcggtaaggctggctgccagacttacaagtgggaaaccttcctgaccagcgagctgccgcaa-
tggttgtccgccaacag
ggccgtgaagcccaccggcagcgctgcaatcggcttgtcgatggccggctcgtcggcaatgatcttggccgcct-
accacccccagcagttca
tctacgccggctcgctgtcggccctgctggacccctctcaggggatggggcctagcctgatcggcctcgcgatg-
ggtgacgccggcggttaca
aggccgcagacatgtggggtccctcgagtgacccggcatgggagcgcaacgaccctacgcagcagatccccaag-
ctggtcgcaaacaa
cacccggctatgggtttattgcgggaacggcaccccgaacgagttgggcggtgccaacatacccgccgagttct-
tggagaacttcgttcgtag
cagcaacctgaagttccaggatgcgtacaacgccgcgggcgggcacaacgccgtgttcaacttcccgcccaacg-
gcacgcacagctggg
agtactggggcgctcagctcaacgccatgaagggtgacctgcagagttcgttaggcgccggctga
SEQ ID NO: 44
atgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaatgtcacgtccat-
tcattccctccttgacga
ggggaagcagtccctgaccaagctcgcagcggcctggggcggtagcggttcggaggcgtaccagggtgtccagc-
aaaaatgggacgcc
acggctaccgagctgaacaacgcgctgcagaacctggcgcggacgatcagcgaagccggtcaggcaatggcttc-
gaccgaaggcaacg tcactgggatgttcgcatag SEQ ID NO: 45
atgtcgcaaatcatgtacaactaccccgcgatgttgggtcacgccggggatatggccggatatgccggcacgct-
gcagagcttgggtgccga
gatcgccgtggagcaggccgcgttgcagagtgcgtggcagggcgataccgggatcacgtatcaggcgtggcagg-
cacagtggaaccagg
ccatggaagatttggtgcgggcctatcatgcgatgtccagcacccatgaagccaacaccatggcgatgatggcc-
cgcgacacggccgaag ccgccaaatggggcggctag SEQ ID NO: 46
atgagcaattcgcgccgccgctcactcaggtggtcatggttgctgagcgtgctggctgccgtcgggctgggcct-
ggccacggcgccggccca
ggcggccccgccggccttgtcgcaggaccggttcgccgacttccccgcgctgcccctcgacccgtccgcgatgg-
tcgcccaagtggggcca
caggtggtcaacatcaacaccaaactgggctacaacaacgccgtgggcgccgggaccggcatcgtcatcgatcc-
caacggtgtcgtgctg
accaacaaccacgtgatcgcgggcgccaccgacatcaatgcgttcagcgtcggctccggccaaacctacggcgt-
cgatgtggtcgggtatg
accgcacccaggatgtcgcggtgctgcagctgcgcggtgccggtggcctgccgtcggcggcgatcggtggcggc-
gtcgcggttggtgagcc
cgtcgtcgcgatgggcaacagcggtgggcagggcggaacgccccgtgcggtgcctggcagggtggtcgcgctcg-
gccaaaccgtgcagg
cgtcggattcgctgaccggtgccgaagagacattgaacgggttgatccagttcgatgccgcgatccagcccggt-
gattcgggcgggcccgtc
gtcaacggcctaggacaggtggtcggtatgaacacggccgcgtccgataacttccagctgtcccagggtgggca-
gggattcgccattccgat
cgggcaggcgatggcgatcgcgggccagatccgatcgggtggggggtcacccaccgttcatatcgggcctaccg-
ccttcctcggcttgggtg
ttgtcgacaacaacggcaacggcgcacgagtccaacgcgtggtcgggagcgctccggcggcaagtctcggcatc-
tccaccggcgacgtg
atcaccgcggtcgacggcgctccgatcaactcggccaccgcgatggcggacgcgcttaacgggcatcatcccgg-
tgacgtcatctcggtga
cctggcaaaccaagtcgggcggcacgcgtacagggaacgtgacattggccgagggacccccggcctga
SEQ ID NO: 47
atggtggatttcggggcgttaccaccggagatcaactccgcgaggatgtacgccggcccgggttcggcctcgct-
ggtggccgcggctcagat
gtgggacagcgtggcgagtgacctgttttcggccgcgtcggcgtttcagtcggtggtctggggtctgacggtgg-
ggtcgtggataggttcgtcgg
cgggtctgatggtggcggcggcctcgccgtatgtggcgtggatgagcgtcaccgcggggcaggccgagctgacc-
gccgcccaggtccggg
ttgctgcggcggcctacgagacggcgtatgggctgacggtgcccccgccggtgatcgccgagaaccgtgctgaa-
ctgatgattctgatagcg
accaacctcttggggcaaaacaccccggcgatcgcggtcaacgaggccgaatacggcgagatgtgggcccaaga-
cgccgccgcgatgtt
tggctacgccgcggcgacggcgacggcgacggcgacgttgctgccgttcgaggaggcgccggagatgaccagcg-
cgggtgggctcctcg
agcaggccgccgcggtcgaggaggcctccgacaccgccgcggcgaaccagttgatgaacaatgtgccccaggcg-
ctgcaacagctggc
ccagcccacgcagggcaccacgccttcttccaagctgggtggcctgtggaagacggtctcgccgcatcggtcgc-
cgatcagcaacatggtgt
cgatggccaacaaccacatgtcgatgaccaactcgggtgtgtcgatgaccaacaccttgagctcgatgttgaag-
ggctttgctccggcggcgg
ccgcccaggccgtgcaaaccgcggcgcaaaacggggtccgggcgatgagctcgctgggcagctcgctgggttct-
tcgggtctgggcggtg
gggtggccgccaacttgggtcgggcggcctcggtcggttcgttgtcggtgccgcaggcctgggccgcggccaac-
caggcagtcaccccggc
ggcgcgggcgctgccgctgaccagcctgaccagcgccgcggaaagagggcccgggcagatgctgggcgggctgc-
cggtggggcagat
gggcgccagggccggtggtgggctcagtggtgtgctgcgtgttccgccgcgaccctatgtgatgccgcattctc-
cggcggccggctag SEQ ID NO: 48
atgcggacccccagacgccactgccgtcgcatcgccgtcctcgccgccgttagcatcgccgccactgtcgttgc-
cggctgctcgtcgggctcg
aagccaagcggcggaccacttccggacgcgaagccgctggtcgaggaggccaccgcgcagaccaaggctctcaa-
gagcgcgcacatg
gtgctgacggtcaacggcaagatcccgggactgtctctgaagacgctgagcggcgatctcaccaccaaccccac-
cgccgcgacgggaaa
cgtcaagctcacgctgggtgggtctgatatcgatgccgacttcgtggtgttcgacgggatcctgtacgccaccc-
tgacgcccaaccagtggag
cgatttcggtcccgccgccgacatctacgaccccgcccaggtgctgaatccggataccggcctggccaacgtgc-
tggcgaatttcgccgacg
caaaagccgaagggcgggataccatcaacggccagaacaccatccgcatcagcgggaaggtatcggcacaggcg-
gtgaaccagatag
cgccgccgttcaacgcgacgcagccggtgccggcgaccgtctggattcaggagaccggcgatcatcaactggca-
caggcccagttggacc
gcggctcgggcaattccgtccagatgaccttgtcgaaatggggcgagaaggtccaggtcacgaagcccccggtg-
agctga SEQ ID NO: 49
atggccaagacaattgcgtacgacgaagaggcccgtcgcggcctcgagcggggcttgaacgccctcgccgatgc-
ggtaaaggtgacattg
ggccccaagggccgcaacgtcgtcctggaaaagaagtggggtgcccccacgatcaccaacgatggtgtgtccat-
cgccaaggagatcga
gctggaggatccgtacgagaagatcggcgccgagctggtcaaagaggtagccaagaagaccgatgacgtcgccg-
gtgacggcaccacg
acggccaccgtgctggcccaggcgttggttcgcgagggcctgcccaacgtcgcggccggcgccaacccgctcgg-
tctcaaacgcggctc
gaaaaggccgtggagaaggtcaccgagaccctgctcaagggcgccaaggaggtcgagaccaaggagcagattgc-
ggccaccgcagc
gatttcggcgggtgaccagtccatcggtgacctgatcgccgaggcgatggacaaggtgggcaacgagggcgtca-
tcaccgtcgaggagtc
caacacctttgggctgcagctcgagctcaccgagggtatgcggttcgacaagggctacatctcggggtacttcg-
tgaccgacccggagcgtc
aggaggcggtcctggaggacccctacatcctgctggtcagctccaaggtgtccactgtcaaggatctgctgccg-
ctgctcgagaaggtcatcg
gagccggtaagccgctgctgatcatcgccgaggacgtcgagggcgaggcgctgtccaccctggtcgtcaacaag-
atccgcggcaccttca
agtcggtggcggtcaaggctcccggcttcggcgaccgccgcaaggcgatgctgcaggatatggccattctcacc-
ggtggtcaggtgatcagc
gaagaggtcggcctgacgctggagaacgccgacctgtcgctgctaggcaaggcccgcaaggtcgtggtcaccaa-
ggacgagaccaccat
cgtcgagggcgccggtgacaccgacgccatcgccggacgagtggcccagatccgccaggagatcgagaacagcg-
actccgactacgac
cgtgagaagctgcaggagcggctggccaagctggccggtggtctcgcggtgatcaaggccggtgccgccaccga-
ggtcgaactcaagga
gcgcaagcaccgcatcgaggatgcggttcgcaatgccaaggccgccgtcgaggagggcatcgtcgccggtgggg-
gtgtgacgctgttgca
agcggccccgaccctggacgagctgaagctcgaaggcgacgaggcgaccggcgccaacatcgtgaaggtggcgc-
tggaggccccgct
gaagcagatcgccttcaactccgggctggagccgggcgtggtggccgagaaggtgcgcaacctgccggctggcc-
acggactgaacgctc
agaccggtgtctacgaggatctgctcgctgccggcgttgctgacccggtcaaggtgacccgttcggcgctgcag-
aatgcggcgtccatcgcg
gggctgttcctgaccaccgaggccgtcgttgccgacaagccggaaaaggagaaggcttccgttcccggtggcgg-
cgacatgggtggcatg gatttctga SEQ ID NO: 50
atggctgaaaactcgaacattgatgacatcaaggctccgttgcttcccgcgcttggagcggccgacctggcctt-
ggccactgtcaacgagttga
tcacgaacctgcgtgagcgtgcggaggagactcgtacggacacccgcagccgggtcgaggagagccgtgctcgc-
ctgaccaagctgcag
gaagatctgcccgagcagctcaccgagctgcgtgagaagttcaccgccgaggagctgcgtaaggccgccgaggg-
ctacctcgaggccgc
gactagccggtacaacgagctggtcgagcgcggtgaggccgctctagagcggctgcgcagccagcagagcttcg-
aggaagtgtcggcgc
gcgccgaaggctacgtggaccaggcggtggagttgacccaggaggcgttgggtacggtcgcatcgcagacccgc-
gcggtcggtgagcgt
gccgccaagctggtcggcatcgagctgcctaagaaggctgctccggccaagaaggccgctccggccaagaaggc-
cgctccggccaaga
aggcggcggccaagaaggcgcccgcgaagaaggcggcggccaagaaggtcacccagaagtag SEQ
ID NO: 51
gtgacgcaaaccggcaagcgtcagagacgcaaattcggtcgcatccgacagttcaactccggccgctggcaagc-
cagctacaccggccc
cgacggccgcgtgtacatcgcccccaaaaccttcaacgccaagatcgacgccgaagcatggctcaccgaccgcc-
gccgcgaaatcgacc
gacaactatggtccccggcatcgggtcaggaagaccgccccggagccccattcggtgagtacgccgaaggatgg-
ctgaagcagcgtgga
atcaaggaccgcacccgcgcccactatcgcaaactgctggacaaccacatcctggccaccttcgctgacaccga-
cctacgcgacatcacc
ccggccgccgtgcgccgctggtacgccaccaccgccgtgggcacaccgaccatgcgggcacactcctacagctt-
gctgcgcgcaatcatg
cagaccgccttggccgacgacctgatcgactccaacccctgccgcatctcaggcgcgtccaccgcccgccgcgt-
ccacaagatcaggccc
gccaccctcgacgagctggaaaccatcaccaaagccatgcccgacccctaccaggcgttcgtgctgatggcggc-
atggctggccatgcgct
acggcgagctgaccgaattacgccgcaaagacatcgacctgcacggcgaggttgcgcgggtgcggcgggctgtc-
gttcgggtgggcgaa
ggcttcaaggtgacgacaccgaaaagcgatgcgggagtgcgcgacataagtatcccgccacatctgatacccgc-
catcgaagaccacctt
cacaaacacgtcaaccccggccgggagtccctgctgttcccatcggtcaacgaccccaaccgtcacctagcacc-
ctcggcgctgtaccgca
tgttctacaaggcccgaaaagccgccggccgaccagacttacgggtgcacgaccttcgacactccggcgccgtg-
ttggctgcatccaccgg
cgccacactggccgaactgatgcagcggctaggacacagcacagccggcgccgcactccgctaccagcacgccg-
ccaagggccggga ccgcgaaatcgccgcactgttaagcaaactggccgagaaccaggagatgtga
SEQ ID NO: 52
gtgatagcgggcgtcgaccaggcgcttgcagcaacaggccaggctagccagcgggcggcaggcgcatctggtgg-
ggtcaccgtcggtgtc
ggcgtgggcacggaacagaggaacctttcggtggttgcaccgagtcagttcacatttagttcacgcagcccaga-
ttttgtggatgaaaccgca ggtcaatcgtggtgcgcgatactgggattgaaccagtttcactag
SEQ ID NO: 53
atggccaccacccttcccgttcagcgccacccgcggtccctcttccccgagttttctgagctgttcgcggcctt-
cccgtcattcgccggactccgg
cccaccttcgacacccggttgatgcggctggaagacgagatgaaagaggggcgctacgaggtacgcgcggagct-
tcccggggtcgaccc
cgacaaggacgtcgacattatggtccgcgatggtcagctgaccatcaaggccgagcgcaccgagcagaaggact-
tcgacggtcgctcgga
attcgcgtacggttccttcgttcgcacggtgtcgctgccggtaggtgctgacgaggacgacattaaggccacct-
acgacaagggcattcttactg
tgtcggtggcggtttcggaagggaagccaaccgaaaagcacattcagatccggtccaccaactga
SEQ ID NO: 54
atgagtggacgccaccgtaagcccaccacatccaacgtcagcgtcgccaagatcgcctttaccggcgcagtact-
cggtggcggcggcatcg
ccatggccgctcaggcgaccgcggccaccgacggggaatgggatcaggtggcccgctgcgagtcgggcggcaac-
tggtcgatcaacac
cggcaacggttacctcggtggcttgcagttcactcaaagcacctgggccgcacatggtggcggcgagttcgccc-
cgtcggctcagctggcca
gccgggagcagcagattgccgtcggtgagcgggtgctggccacccagggtcgcggcgcctggccggtgtgcggc-
cgcgggttatcgaacg
caacaccccgcgaagtgcttcccgcttcggcagcgatggacgctccgttggacgcggccgcggtcaacggcgaa-
ccagcaccgctggccc
cgccgcccgccgacccggcgccacccgtggaacttgccgctaacgacctgcccgcaccgctgggtgaacccctc-
ccggcagctcccgcc
gacccggcaccacccgccgacctggcaccacccgcgcccgccgacgtcgcgccacccgtggaacttgccgtaaa-
cgacctgcccgcac
cgctgggtgaacccctcccggcagctcccgccgacccggcaccacccgccgacctggcaccacccgcgcccgcc-
gacctggcgccacc
cgcgcccgccgacctggcgccacccgcgcccgccgacctggcaccacccgtggaacttgccgtaaacgacctgc-
ccgcgccgctgggtg
aacccctcccggcagctcccgccgaactggcgccacccgccgatctggcacccgcgtccgccgacctggcgcca-
cccgcgcccgccgac
ctggcgccacccgcgcccgccgaactggcgccacccgcgcccgccgacctggcaccacccgctgcggtgaacga-
gcaaaccgcgccg
ggcgatcagcccgccacagctccaggcggcccggttggccttgccaccgatttggaactccccgagcccgaccc-
ccaaccagctgacgca
ccgccgcccggcgacgtcaccgaggcgcccgccgaaacgccccaagtctcgaacatcgcctatacgaagaagct-
gtggcaggcgattcg
ggcccaggacgtctgcggcaacgatgcgctggactcgctcgcacagccgtacgtcatcggctga
SEQ ID NO: 55
atgttgcgcctggtagtcggtgcgctgctgctggtgttggcgttcgccggtggctatgcggtcgccgcatgcaa-
aacggtgacgttgaccgtcga
cggaaccgcgatgcgggtgaccacgatgaaatcgcgggtgatcgacatcgtcgaagagaacgggttctcagtcg-
acgaccgcgacgacc
tgtatcccgcggccggcgtgcaggtccatgacgccgacaccatcgtgctgcggcgtagccgtccgctgcagatc-
tcgctggatggtcacgac
gctaagcaggtgtggacgaccgcgtcgacggtggacgaggcgctggcccaactcgcgatgaccgacacggcgcc-
ggccgcggcttctcg
cgccagccgcgtcccgctgtccgggatggcgctaccggtcgtcagcgccaagacggtgcagctcaacgacggcg-
ggttggtgcgcacggt
gcacttgccggcccccaatgtcgcggggctgctgagtgcggccggcgtgccgctgttgcaaagcgaccacgtgg-
tgcccgccgcgacggc
cccgatcgtcgaaggcatgcagatccaggtgacccgcaatcggatcaagaaggtcaccgagcggctgccgctgc-
cgccgaacgcgcgtc
gtgtcgaggacccggagatgaacatgagccgggaggtcgtcgaagacccgggggttccggggacccaggatgtg-
acgttcgcggtagctg
aggtcaacggcgtcgagaccggccgtttgcccgtcgccaacgtcgtggtgaccccggcccacgaagccgtggtg-
cgggtgggcaccaagc
ccggtaccgaggtgcccccggtgatcgacggaagcatctgggacgcgatcgccggctgtgaggccggtggcaac-
tgggcgatcaacacc
ggcaacgggtattacggtggtgtgcagtttgaccagggcacctgggaggccaacggcgggctgcggtatgcacc-
ccgcgctgacctcgcca
cccgcgaagagcagatcgccgttgccgaggtgacccgactgcgtcaaggttggggcgcctggccggtatgtgct-
gcacgagcgggtgcgc gctga SEQ ID NO: 56
gtgcatcctttgccggccgaccacggccggtcgcggtgcaatagacacccgatctcaccactctctctaatcgg-
taacgcttcggccacttccg
gcgatatgtcgagcatgacaagaatcgccaagccgctcatcaagtccgccatggccgcaggactcgtcacggca-
tccatgtcgctctccacc
gccgttgcccacgccggtcccagcccgaactgggacgccgtcgcgcagtgcgaatccgggggcaactgggcggc-
caacaccggaaacg
gcaaatacggcggactgcagttcaagccggccacctgggccgcattcggcggtgtcggcaacccagcagctgcc-
tctcgggaacaacaa
atcgcagttgccaatcgggttctcgccgaacagggattggacgcgtggccgacgtgcggcgccgcctctggcct-
tccgatcgcactgtggtcg
aaacccgcgcagggcatcaagcaaatcatcaacgagatcatttgggcaggcattcaggcaagtattccgcgctg-
a SEQ ID NO: 57
atgacaccgggtttgcttactactgcgggtgctggccgaccacgtgacaggtgcgccaggatcgtatgcacggt-
gttcatcgaaaccgccgttg
tcgcgaccatgtttgtcgcgttgttgggtctgtccaccatcagctcgaaagccgacgacatcgattgggacgcc-
atcgcgcaatgcgaatccgg
cggcaattgggcggccaacaccggtaacgggttatacggtggtctgcagatcagccaggcgacgtgggattcca-
acggtggtgtcgggtcg
ccggcggccgcgagtccccagcaacagatcgaggtcgcagacaacattatgaaaacccaaggcccgggtgcgtg-
gccgaaatgtagttct
tgtagtcagggagacgcaccgctgggctcgctcacccacatcctgacgttcctcgcggccgagactggaggttg-
ttcggggagcagggacg attga SEQ ID NO: 58
ttgaagaacgcccgtacgacgctcatcgccgccgcgattgccgggacgttggtgaccacgtcaccagccggtat-
cgccaatgccgacgacg
cgggcttggacccaaacgccgcagccggcccggatgccgtgggctttgacccgaacctgccgccggccccggac-
gctgcacccgtcgata
ctccgccggctccggaggacgcgggctttgatcccaacctccccccgccgctggccccggacttcctgtccccg-
cctgcggaggaagcgcct
cccgtgcccgtggcctacagcgtgaactgggacgcgatcgcgcagtgcgagtccggtggaaactggtcgatcaa-
caccggtaacggttact
acggcggcctgcggttcaccgccggcacctggcgtgccaacggtggctcggggtccgcggccaacgcgagccgg-
gaggagcagatccg
ggtggctgagaacgtgctgcgttcgcagggtatccgcgcctggccggtctgcggccgccgcggctga
SEQ ID NO: 59
atgatcgccacaacccgcgatcgtgaaggagccaccatgatcacgtttaggctgcgcttgccgtgccggacgat-
actgcgggtgttcagccg
caatccgctggtgcgtgggacggatcgactcgaggcggtcgtcatgctgctggccgtcacggtctcgctgctga-
ctatcccgttcgccgccgcg
gccggcaccgcagtccaggattcccgcagccacgtctatgcccaccaggcccagacccgccatcccgcaaccgc-
gaccgtgatcgatcac
gagggggtgatcgacagcaacacgaccgccacgtcagcgccgccgcgcacgaagatcaccgtgcctgcccgatg-
ggtcgtgaacggaa
tagaacgcagcggtgaggtcaacgcgaagccgggaaccaaatccggtgaccgcgtcggcatttgggtcgacagt-
gccggtcagctggtcg
atgaaccagctccgccggcccgtgccattgcggatgcggccctggccgccttgggactctggttgagcgtcgcc-
gcggttgcgggcgccctg
ctggcgctcactcgggcgattctgatccgcgttcgcaacgccagttggcaacacgacatcgacagcctgttctg-
cacgcagcggtga SEQ ID NO: 60
atgacggagccagcggcgtgggacgaaggcaagccgcgaatcatcactttgaccatgaaccccgccttggacat-
cacgacgagcgtcga
cgtggtgcgcccgaccgagaaaatgcgttgtggcgcacctcgctacgatcccggcggcggcggtatcaatgtcg-
cccgcattgtgcatgtcct
cggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatggcgctgctcggtgatg-
cgggagtgccatttcgcgt
cattccgatcgcggcctcgacgcgggagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcg-
tgcttccggggccgtcgct
gaccgtcgcggagcaggagcaatgcctcgacgaactgcgcggtgcggcggcttcggccgcctttgtggtggcca-
gtggcagcctgccgcc
aggtgtggctgccgactactatcagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggata-
catctggtggcgggttgcag
cacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactgcgcgagtgcgtcggatccgaactgct-
gaccgagcccgaacaactg
gccgccgcacacgaactcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggcgcgct-
attggccacacgacatgc
gagccatcgattttcgtcgattccgatgaccgcggttagcggtgtcggcgccggcgacgcgatggtggccgcga-
ttaccgtgggcctcagccg
tggctggtcgctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggcaccg-
cggcctgcaatcgcgac
gatgtggagaggttcttcgagctggcggccgaacccaccgaagtcgggcaggatcaatacgtttggcacccgat-
cgttaacccggaagcctc gccatga SEQ ID NO: 61
atgccggacaccatggtgaccaccgatgtcatcaagagcgcggtgcagttggcctgccgcgcaccgtcgctcca-
caacagccagccctgg
cgctggatagccgaggaccacacggttgcgctgttcctcgacaaggatcgggtgctttacgcgaccgaccactc-
cggccgggaagcgctgc
tggggtgcggcgccgtactcgaccactttcgggtggcgatggcggccgcgggtaccaccgccaatgtggaacgg-
tttcccaaccccaacga
tcctttgcatctggcgtcaattgacttcagcccggccgatttcgtcaccgagggccaccgtctaagggcggatg-
cgatcctactgcgccgtaccg
accggctgcctttcgccgagccgccggattgggacttggtggagtcgcagttgcgcacgaccgtcaccgccgac-
acggtgcgcatcgacgtc
atcgccgacgatatgcgtcccgaactggcggcggcgtccaaactcaccgaatcgctgcggctctacgattcgtc-
gtatcatgccgaactcttttg
gtggacaggggcttttgagacttctgagggcataccgcacagttcattggtatcggcggccgaaagtgaccggg-
tcaccttcggacgcgactt
cccggtcgtcgccaacaccgataggcgcccggagtttggccacgaccgctctaaggtcctggtgctctccacct-
acgacaacgaacgcgcc
agcctactgcgctgcggcgagatgctttccgccgtattgcttgacgccaccatggctgggcttgccacctgcac-
gctgacccacatcaccgaa
ctgcacgccagccgagacctggtcgcagcgctgattgggcagcccgcaactccgcaagccttggttcgcgtcgg-
tctggccccggagatgg
aagagccgccaccggcaacgcctcggcgaccaatcgatgaagtgtttcacgttcgggctaaggatcaccggtag
SEQ ID NO: 62
atgaccaccgcacgcgacatcatgaacgcaggtgtgacctgtgttggcgaacacgagacgctaaccgctgccgc-
tcaatacatgcgtgagc
acgacatcggcgcgttgccgatctgcggggacgacgaccggctgcacggcatgctcaccgaccgcgacattgtg-
atcaaaggcctggctg
cgggcctagacccgaataccgccacggctggcgagttggcccgggacagcatctactacgtcgatgcgaacgca-
agcatccaggagatg
ctcaacgtcatggaagaacatcaggtccgccgtgttccggtcatctcagagcaccgcttggtcggaatcgtcac-
cgaagccgacatcgcccg
acacctgcccgagcacgccattgtgcagttcgtcaaggcaatctgctcgcccatggccctcgccagctag
SEQ ID NO: 63
atggcaagttctgcgagcgacggcacccacgaacgctcggcttttcgcctgagtccaccggtcttgagcggcgc-
catgggaccgttcatgcac
accggtctgtacgtcgctcaatcgtggcgcgactatctgggtcaacagcccgataaactgccgatcgcacggcc-
cactattgccttagcggcg
caagcctttcgagacgaaatcgtcctgctgggcctcaaggcacgacgtccggtcagcaatcatcgagtgttcga-
gcgcatcagccaagaagt
ggccgctggactggagttctatgggaatcgcagatggctggagaagcctagcggattttttgcccagcccccac-
cgctcaccgaggtcgcggt
ccgaaaggtcaaggaccgcagacgctccttttatcgcatcttcttcgacagtgggtttacgccgcatccgggtg-
aaccgggcagccaacggtg
gctctcatacactgcgaacaatcgcgagtacgccctgttactgcggcacccagagccgcgtccctggctggttt-
gtgtacacggcaccgagat
gggcagggccccgttggatctcgcggtgttccgcgcctggaagctgcatgacgaactcggcctgaacattgtca-
tgccggttcttccgatgcat
ggtccccgcgggcaaggtctgccgaagggcgccgtttttcccggagaagatgttctcgacgatgtgcatgggac-
ggctcaagcggtgtggga
tatccggcggctgttgtcctggatacgatcgcaggaggaggagtcgctgatcgggttgaacggtctctcgctgg-
gcggctacatcgcgtcattg
gtcgccagcctcgaagaaggtctcgcctgcgcgattctcggtgtcccagtggctgatctgatcgagttgttggg-
ccgccactgcggtcttcggca
caaagacccccgccgccacaccgtcaagatggccgaaccgatcggccgaatgatctcgccgctctcacttacgc-
cactggtgcccatg
ccgggccgctttatctacgcgggcattgccgaccgactcgtgcatccacgcgaacaggtgactcgcctctggga-
gcactggggcaaacccg
aaatcgtgtggtatccaggcggtcacactggcttcttccagtcgcggccggtacgacggtttgtccaggctgcg-
ctggagcagtcgggcctgttg gacgcgccacggacacagcgcgaccgttccgcctaa SEQ ID
NO: 64
atgtccacgcaacgaccgaggcactccggtattcgggctgttggcccctacgcatgggccggccgatgtggtcg-
gataggcaggtgggggg
tgcaccaggaggcgatgatgaatctagcgatatggcacccgcgcaaggtgcaatccgccaccatctatcaggtg-
accgatcgctcgcacga
cgggcgcacagcacgggtgcctggtgacgagatcactagcaccgtgtccggttggttgtcggagttgggcaccc-
aaagcccgttggccgatg
agcttgcgcgtgcggtgcggatcggcgactggcccgctgcgtacgcaatcggtgagcacctgtccgttgagatt-
gccgttgcggtctaa SEQ ID NO: 65
LDFATLPPEINSARMYSGAGSAPMLAAASAWHGLSAELRASALSYSSVLSTLTGEEWHGPASASMT
AAAAPYVAWMSVTAVRAEQAGAQAEAAAAAYEAAFAATVPPPVIEANRAQLMALIATNVLGQNAPAI
AATEAQYAEMWSQDAMAMYGYAGASAAATQLTPFTEPVQTTNASGLAAQSAAIAHATGASAGAQQ
TTLSQLIAAIPSVLQGLSSSTAATFASGPSGLLGIVGSGSSWLDKLWALLDPNSNFWNTIASSGLFLPS
NTIAPFLGLLGGVAAADAAGDVLGEATSGGLGGALVAPLGSAGGLGGTVAAGLGNAATVGTLSVPPS
WTAAAPLASPLGSALGGTPMVAPPPAVAAGMPGMPFGTMGGQGFGRAVPQYGFRPNFVARPPAA
G
EXAMPLES
[0244] The invention will be further clarified by the following
examples, which are intended to be purely exemplary of the
invention and in no way limiting.
Example 1
Sub-Unit Vaccines Containing Polypeptides of the Invention
[0245] To prepare sub-unit vaccines comprising polypeptides it is
first of all necessary to obtain a supply of polypeptide to prepare
the vaccine. This can be achieved by purifying proteins of interest
from TB culture, or by cloning the gene of interest and producing a
recombinant protein. The coding sequences for the genes of interest
are amplified by PCR with restriction sites inserted at the N
terminus and C terminus to permit cloning in-frame into a protein
expression vector such as pET-15b. The genes are inserted behind an
inducible promoter such as lacZ. The vector is then transformed
into E. coli which is grown in culture. The recombinant protein is
over-expressed and is purified. One of the common purification
methods is to produce a recombinant protein with an N-terminal tag
for purification eg a His-tag. The protein can then be purified on
the basis of the affinity of the His-tag for metal ions on a Ni-NTA
column after which the His-tag is cleaved. The purified protein is
then administered to animals in a suitable adjuvant.
Example 2
Use of BCG as a Microbial Carrier
[0246] The polynucleotide sequence of interest is amplified by PCR.
The amplified product is purified and cloned into a plasmid
(pMV306) that integrates site specifically into the mycobacterial
genome at the attachment site (attB) for mycobacteriophage L5. BCG
is transformed with the plasmid by electroporation, which involves
damaging the cell envelope with high voltage electrical pulses,
resulting in uptake of the DNA. The plasmid integrates into the BCG
chromosome at the attB site, generating stable recombinants.
Recombinants are selected and are checked by PCR or Southern
blotting to ensure that the gene has been integrated. The
recombinant strain is then used for protection studies.
Example 3
Viral Vectors (Eg. Attenuated Vaccinia Virus) Expressing
Mycobacterial Genes
##STR00001##
[0248] Methodologies permitting recombination of foreign or target
genes into the genome of MVA are well known in the art [1,2].
Insertion of the target gene(s) is mediated by transfer DNA with
features similar to those shown above. The transfer DNA may be in
the form of a plasmid that can be propagated in a bacterial strain
optimised for routine cloning procedures. The target gene(s) is
introduced to the cassette downstream of a promoter such as mH5,
p7.5 or another. The target gene(s) may comprise one or more of
nucleotide Seq IDs 1-18 and/or fragments thereof. The target
gene(s) may also comprise adjuvanting cofactors such as B7-1 or
IL-12 as is well described in the art [3]. The target gene(s) would
be positioned downstream and in frame with an optimised Kozak
sequence e.g. GCCACCATGG. The target gene(s) may also be positioned
downstream and in frame with a leader sequence e.g. tPA. The target
gene(s) may be positioned upstream of an in-frame tag e.g. V5, HIS
or another. Transfer of the cassette into the genome of MVA is
mediated by homologous flanking regions well known in the art e.g.
Del I-VI. [0249] 1. Generation of recombinant vaccinia viruses.
(2001) Earl P L et al. Current Protocols in Protein Science [0250]
2. Preparation of cell cultures and vaccine virus stocks. (2001)
Earl P L et al. Current Protocols in Protein Science [0251] 3.
Construction and characterisation of a triple-recombinant vaccine
virus encoding B7-1, Interleukin 12 and a model tumor antigen.
(1998) Carroll M W et al. Journal of the National Cancer Institute
Dec. 16, 1998; 90(24): 1881-1887
Example 4
Preparation of DNA Expression Vectors
[0252] DNA vaccines consist of a nucleic acid sequence of interest
cloned into a bacterial plasmid. The plasmid vector pVAX1 is
commonly used in the preparation of DNA vaccines. The vector is
designed to facilitate high copy number replication in E. coli and
high level transient expression of the peptide of interest in most
mammalian cells (for details see manufacturer's protocol for pVAX1
(catalog No. V260-20 www.invitrogen.com).
[0253] The vector contains the following elements: [0254] Human
cytomegalovirus immediate-early (CMV) promoter for high-level
expression in a variety of mammalian cells [0255] T7
promoter/priming site to allow in vitro transcription in the sense
orientation and sequencing through the insert [0256] Bovine growth
hormone (BGH) polyadenylation signal for efficient transcription
termination and polyadenylation of mRNA [0257] Kanamycin resistance
gene for selection in E. coli [0258] A multiple cloning site [0259]
pUC origin for high-copy number replication and growth in E. coli
[0260] BGH reverse priming site to permit sequencing through the
insert
[0261] Vectors may be prepared by means of standard recombinant
techniques that are known in the art, for example Sambrook et al.
(1989). Key stages in preparing the vaccine are as follows: [0262]
The polynucleotide of interest is ligated into pVAX1 via one of the
multiple cloning sites [0263] The ligation mixture is then
transformed into a competent E. coli strain (e.g. TOP10) and LB
plates containing 50 .mu.g/ml kanamycin are used to select
transformants. [0264] Clones are selected and may be sequenced to
confirm the presence and orientation of the gene of interest.
[0265] Once the presence of the gene has been verified, the vector
can be used to transfect a mammalian cell line to check for protein
expression. Methods for transfection are known in the art and
include, for example, electroporation, calcium phosphate, and
lipofection. [0266] Once polypeptide expression has been confirmed,
large quantities of the vector can be produced and purified from
the appropriate cell host, eg. E. coli.
[0267] pVAX1 does not integrate into the host chromosome. All
non-essential sequences have been removed to minimise the
possibility of integration. When constructing a specific vector, a
leader sequence may be included to direct secretion of the encoded
protein when expressed inside the eukaryotic cell. Other examples
of vectors that can be used include V1Jns.tPA and pCMV4. Expression
vectors may be used that integrate into the genome of the host,
however, it is more common and more preferable to use a vector that
does not integrate. Integration would lead to the generation of a
genetically modified host which raises other issues.
Example 5
Plasmid DNA Vaccines Carrying Mycobacterial Polynucleotides
[0268] A polynucleotide sequence of interest is amplified by PCR,
purified and inserted into specialized vectors developed for
vaccine development, such as pVAX1. As above (Example 4), these
vectors contain promoter sequences (eg. CMV or SV40 promoters),
which direct strong expression of the introduced polynucleotide
(encoding the candidate antigen) in eukaryotic cells; and
polyadenylation signals (eg. SV40 or bovine growth hormone) to
stabilize the mRNA transcript. The target gene(s) would be
positioned downstream and in frame with an optimised Kozak sequence
e.g. GCCACCATGG. The target gene(s) may also be positioned
downstream and in frame with a leader sequence e.g. tPA. The target
gene(s) may be positioned upstream of an in-frame tag e.g. V5. The
vector is transformed into E. coli and transformants are selected
using a marker, such as kanamycin resistance, encoded by the
plasmid. The plasmid is then recovered from transformed colonies
and is sequenced to check that the polynucleotide of interest is
present and encoded properly without PCR generated mutations. Large
quantities of the plasmid are then produced in E. coli and the
plasmid is recovered and purified using commercially available kits
(e.g. Qiagen Endofree-plasmid preparation). The vaccine is then
administered to animals (e.g. by intramuscular injection) in the
presence or absence of an adjuvant.
Example 6
RNA Vaccine
[0269] RNA can be introduced directly into the host. Thus, a vector
construct may be used to generate RNA in vitro and the purified RNA
is then injected into the host. The RNA then serves as a template
for translation in the host cell. In this embodiment, integration
would not normally occur.
[0270] An alternative option is to use an infectious agent such as
the retroviral genome carrying RNA corresponding to the gene of
interest. In this embodiment, integration into the host genome will
occur. Another option is the use of RNA replicon vaccines which can
be derived from virus vectors such as Sindbis virus or Semliki
Forest virus. These vaccines are self-replicating and self-limiting
and may be administered as either RNA or DNA which is then
transcribed into RNA replicons in vivo. The vector eventually
causes lysis of the transfected cells thereby reducing concerns
about integration into the host genome.
Example 7
Diagnostic Assays Based on Assessing T Cell Responses
[0271] For a diagnostic assay based on assessing T cell responses
it would be sufficient to obtain a sample of blood from the
patient. Mononuclear cells (monocytes, T and B lymphocytes) can be
separated from the blood using density gradients such as Ficoll
gradients.
[0272] Both monocytes and B-lymphocytes are both able to present
antigen, although less efficiently than professional antigen
presenting cells (APCs) such as dendritic cells. The latter are
more localized in lymphoid tissue.
[0273] The simplest approach would be to add antigen to the
separated mononuclear cells and incubate for a week and then assess
the amount of proliferation. If the individual had been exposed to
the antigen previously through infection, then T-cell closes
specific to the antigen should be more prevalent in the sample and
should respond. It is also possible to separate the different
cellular populations should it be desired to control the ratio of T
cells to APCs. Another variation of this type of assay is to
measure cytokine production by the responding lymphocytes as a
measure of response. The ELISPOT assay is a suitable example of
this assay.
Example 8
Detection of Latent Mycobacteria
[0274] The presence of latent mycobacteria-associated antigen may
be detected either by detecting antigen-specific antibody, or by
detecting T-cells in blood samples.
[0275] A 96 well plate is coated with cytokine (e.g. interferon-,
IL-2)-specific antibody. Peripheral blood monocytes are then
isolated from patient whole blood and are applied to the wells.
Antigen is added to stimulate specific T cells that may be present
and the plates are incubated for 24 h. The antigen stimulates the
T-cells to produce cytokines, which bind a specific antibody. The
plates are washed leaving a footprint where antigen-specific T
cells were present. A second antibody coupled with a suitable
detection system, e.g. enzyme, is then added and the number of
spots is enumerated after the appropriate substrate has been added.
The number of spots, each corresponding to a single
antigen-specific T cell, is related to the total number of cells
originally added. The above-described assay may also be used to
distinguish TB-infected individuals from BCG-vaccinated
individuals.
Example 9
Antigenic Activity
[0276] Mice are immunised with a mycobacterial antigen. Delivery
systems include, but are not restricted to DNA vaccines,
recombinant MVA, adjuvanted protein. Delivery routes include, but
are not restricted to sub-cutaneous, intra-dermal, intra-muscular
or aerosol administration. The immunisation regimen sometimes
involves heterologous prime-boosting e.g. DNA vaccine followed by
MVA vaccine. The immunisation regimen may also involve multiple
doses.
[0277] After vaccination e.g. 2 weeks later, splenocytes are
removed from the vaccinated animals and stimulated with polypeptide
representative of the immunising antigen. An immune response is
measurable through antigen-specific induction of cytokine release
e.g. IFN-.gamma., and is evidence for immunisation against the
target antigen.
Example 10
Demonstrating Vaccine Efficacy in an Experimental Model
[0278] Vaccine candidate efficacy in guinea pigs or mice may be
assessed on the basis of reducing the bacterial burden of M.
tuberculosis in the lungs and/or spleens at 6-24 weeks post-aerosol
challenge--see FIGS. 1 & 2.
[0279] The mycobacterial antigens are delivered as sub-unit DNA
vaccines or protein in a Th1-inducing adjuvant such as DDA/MPL, or
by expression vectors such as recombinant viruses or BCG (see
examples 1-4). The mycobacterial antigens may be delivered as a
boost to an initial prime provided by BCG. There may be additional
boosts provided by repeat inoculation of either DNA, polypeptide or
viral vector or (less commonly) recombinant BCG. Groups of six to
eight animals are immunised and then rested for 6 weeks prior to
challenge. A group of positive control animals are inoculated
sub-cutaneously with 5.times.10.sup.4 colony forming units (CFU) of
BCG Danish (1331), and a group of negative control animals remain
unvaccinated. Six weeks following the final vaccination, fine
particle aerosols of M. tuberculosis (2 .mu.m mean diameter;
generated in a Collison nebuliser), are delivered directly to the
animal snout using a contained Henderson apparatus. 6 weeks
post-aerosol challenge, the animals are euthanised and the lungs
and spleen removed for CFU determination. Homogenised samples are
serially diluted and plated on Middlebrook 7H11 selective agar and
the mean CFU for each treatment group is determined. Vaccine
efficacy is assessed in terms of reduction in bacterial counts in
lungs or spleens compared to the unvaccinated control group. The
reduction in bacterial load of test groups can be expressed as a
proportion of the reduction achieved by BCG alone. Protective
efficacy in animal models is indicative of the ability of the
mycobacterial antigen to protect humans and animals from pathogenic
mycobacterial infection.
Example 11
Demonstrating Vaccine Efficacy in an Experimental Model
[0280] Vaccine candidate efficacy in guinea pigs or mice may be
assessed on the basis of reducing the bacterial burden of M.
tuberculosis in the lungs and/or spleens at 6-24 weeks post-aerosol
challenge--see FIG. 3.
[0281] The mycobacterial antigens are delivered as sub-unit DNA
vaccines or protein in a Th1-inducing adjuvant such as DDA/MPL, or
by expression vectors such as recombinant viruses or BCG (see
examples 1-4). The mycobacterial antigens may be delivered as a
boost to an initial prime provided by BCG. There may be additional
boosts provided by repeat inoculation of either DNA, polypeptide or
viral vector or (less commonly) recombinant BCG. Groups of six to
eight animals are immunised and then rested for 6 weeks prior to
challenge. A group of positive control animals are inoculated
sub-cutaneously with 5.times.10.sup.4 colony forming units (CFU) of
BCG Danish (1331), and a group of negative control animals remain
unvaccinated. Six weeks following the final vaccination, fine
particle aerosols of M. tuberculosis (2 .mu.m mean diameter;
generated in a Collison nebuliser), are delivered directly to the
animal snout using a contained Henderson apparatus. 24 weeks
post-aerosol challenge, the animals are euthanised and the lungs
and spleen removed for CFU determination. Homogenised samples are
serially diluted and plated on Middlebrook 7H11 selective agar and
the mean CFU for each treatment group is determined. Vaccine
efficacy is assessed in terms of reduction in bacterial counts in
lungs or spleens compared to the unvaccinated control group. The
reduction in bacterial load of test groups can be expressed as a
proportion of the reduction achieved by BCG alone, or as the
additional reduction in bacterial burden achieved. Protective
efficacy in animal models is indicative of the ability of the
mycobacterial antigen to protect humans and animals from pathogenic
mycobacterial infection.
Sequence CWU 1
1
6511515DNAMycobacterium tuberculosis 1atgtggtggt tccgccgccg
agaccgggcg ccgctgcgcg ccaccagctc attatccctg 60cggtggcggg tcatgctgct
ggcgatgtcc atggtcgcga tggtggttgt gctgatgtcg 120ttcgccgtct
atgcggtgat ctcggccgcg ctctacagcg acatcgacaa ccaactgcag
180agccgggcgc aactgctcat cgccagtggc tcgctggcag ctgatccggg
taaggcaatc 240gagggtaccg cctattcgga tgtcaacgcg atgctggtca
accccggcca gtccatctac 300accgctcaac agccgggcca gacgctgccg
gtcggtgctg ccgagaaggc ggtgatccgt 360ggcgagttgt tcatgtcgcg
gcgcaccacc gccgaccaac gggtgcttgc catccgtctg 420accaacggta
gttcgctgct gatctccaaa agtctcaagc ccaccgaagc agtcatgaac
480aagctgcgtt gggtgctatt gatcgtgggt gggatcgggg tggcggtcgc
cgcggtggcc 540ggggggatgg tcacccgggc cgggctgagg ccggtgggcc
gcctcaccga agcggccgag 600cgggtggcgc gaaccgacga cctgcggccc
atccccgtct tcggcagcga cgaattggcc 660aggctgacag aggcattcaa
tttaatgctg cgggcgctgg ccgagtcacg ggaacggcag 720gcaaggctgg
ttaccgacgc cggacatgaa ttgcgtaccc cgctaacgtc gctgcgcacc
780aatgtcgaac tcttgatggc ctcgatggcc ccgggggctc cgcggctacc
caagcaggag 840atggtcgacc tgcgtgccga tgtgctggct caaatcgagg
aattgtccac actggtaggc 900gatttggtgg acctgtcccg aggcgacgcc
ggagaagtgg tgcacgagcc ggtcgacatg 960gctgacgtcg tcgaccgcag
cctggagcgg gtcaggcggc ggcgcaacga tatccttttc 1020gacgtcgagg
tgattgggtg gcaggtttat ggcgataccg ctggattgtc gcggatggcg
1080cttaacctga tggacaacgc cgcgaagtgg agcccgccgg gcggccacgt
gggtgtcagg 1140ctgagccagc tcgacgcgtc gcacgctgag ctggtggttt
ccgaccgcgg cccgggcatt 1200cccgtgcagg agcgccgtct ggtgtttgaa
cggttttacc ggtcggcatc ggcacgggcg 1260ttgccgggtt cgggcctcgg
gttggcgatc gtcaaacagg tggtgctcaa ccacggcgga 1320ttgctgcgca
tcgaagacac cgacccaggc ggccagcccc ctggaacgtc gatttacgtg
1380ctgctccccg gccgtcggat gccgattccg cagcttcccg gtgcgacggc
tggcgctcgg 1440agcacggaca tcgagaactc tcggggttcg gcgaacgtta
tctcagtgga atctcagtcc 1500acgcgcgcaa cctag 15152504PRTMycobacterium
tuberculosis 2Met Trp Trp Phe Arg Arg Arg Asp Arg Ala Pro Leu Arg
Ala Thr Ser 1 5 10 15 Ser Leu Ser Leu Arg Trp Arg Val Met Leu Leu
Ala Met Ser Met Val 20 25 30 Ala Met Val Val Val Leu Met Ser Phe
Ala Val Tyr Ala Val Ile Ser 35 40 45 Ala Ala Leu Tyr Ser Asp Ile
Asp Asn Gln Leu Gln Ser Arg Ala Gln 50 55 60 Leu Leu Ile Ala Ser
Gly Ser Leu Ala Ala Asp Pro Gly Lys Ala Ile 65 70 75 80 Glu Gly Thr
Ala Tyr Ser Asp Val Asn Ala Met Leu Val Asn Pro Gly 85 90 95 Gln
Ser Ile Tyr Thr Ala Gln Gln Pro Gly Gln Thr Leu Pro Val Gly 100 105
110 Ala Ala Glu Lys Ala Val Ile Arg Gly Glu Leu Phe Met Ser Arg Arg
115 120 125 Thr Thr Ala Asp Gln Arg Val Leu Ala Ile Arg Leu Thr Asn
Gly Ser 130 135 140 Ser Leu Leu Ile Ser Lys Ser Leu Lys Pro Thr Glu
Ala Val Met Asn 145 150 155 160 Lys Leu Arg Trp Val Leu Leu Ile Val
Gly Gly Ile Gly Val Ala Val 165 170 175 Ala Ala Val Ala Gly Gly Met
Val Thr Arg Ala Gly Leu Arg Pro Val 180 185 190 Gly Arg Leu Thr Glu
Ala Ala Glu Arg Val Ala Arg Thr Asp Asp Leu 195 200 205 Arg Pro Ile
Pro Val Phe Gly Ser Asp Glu Leu Ala Arg Leu Thr Glu 210 215 220 Ala
Phe Asn Leu Met Leu Arg Ala Leu Ala Glu Ser Arg Glu Arg Gln 225 230
235 240 Ala Arg Leu Val Thr Asp Ala Gly His Glu Leu Arg Thr Pro Leu
Thr 245 250 255 Ser Leu Arg Thr Asn Val Glu Leu Leu Met Ala Ser Met
Ala Pro Gly 260 265 270 Ala Pro Arg Leu Pro Lys Gln Glu Met Val Asp
Leu Arg Ala Asp Val 275 280 285 Leu Ala Gln Ile Glu Glu Leu Ser Thr
Leu Val Gly Asp Leu Val Asp 290 295 300 Leu Ser Arg Gly Asp Ala Gly
Glu Val Val His Glu Pro Val Asp Met 305 310 315 320 Ala Asp Val Val
Asp Arg Ser Leu Glu Arg Val Arg Arg Arg Arg Asn 325 330 335 Asp Ile
Leu Phe Asp Val Glu Val Ile Gly Trp Gln Val Tyr Gly Asp 340 345 350
Thr Ala Gly Leu Ser Arg Met Ala Leu Asn Leu Met Asp Asn Ala Ala 355
360 365 Lys Trp Ser Pro Pro Gly Gly His Val Gly Val Arg Leu Ser Gln
Leu 370 375 380 Asp Ala Ser His Ala Glu Leu Val Val Ser Asp Arg Gly
Pro Gly Ile 385 390 395 400 Pro Val Gln Glu Arg Arg Leu Val Phe Glu
Arg Phe Tyr Arg Ser Ala 405 410 415 Ser Ala Arg Ala Leu Pro Gly Ser
Gly Leu Gly Leu Ala Ile Val Lys 420 425 430 Gln Val Val Leu Asn His
Gly Gly Leu Leu Arg Ile Glu Asp Thr Asp 435 440 445 Pro Gly Gly Gln
Pro Pro Gly Thr Ser Ile Tyr Val Leu Leu Pro Gly 450 455 460 Arg Arg
Met Pro Ile Pro Gln Leu Pro Gly Ala Thr Ala Gly Ala Arg 465 470 475
480 Ser Thr Asp Ile Glu Asn Ser Arg Gly Ser Ala Asn Val Ile Ser Val
485 490 495 Glu Ser Gln Ser Thr Arg Ala Thr 500
31194DNAMycobacterium tuberculosis 3atgacggctc cgggactgac
agcagccgtc gaggggatcg cacacaacaa gggcgagctg 60ttcgcctcct ttgacgtgga
cgcgttcgag gttccgcacg gccgcgacga gatctggcgg 120ttcaccccgt
tgcggcggct gcgtggcctg cacgacggct ccgcgcgggc caccggtagc
180gccacgatca cggtcagcga gcggccgggc gtatacaccc agaccgtgcg
ccgcggcgat 240ccacgactgg gcgagggcgg cgtacccacc gaccgcgttg
ccgcccaagc gttttcgtcg 300ttcaactccg cgactctggt caccgtcgag
cgcgacaccc aggtcgtcga gccggtaggc 360atcaccgtga ccgggccggg
ggagggcgcg gtggcctatg ggcacctgca ggtgcgtatc 420gaggagcttg
gcgaggcggt cgtggtcatc gaccaccggg gcggcggaac ctacgccgac
480aacgtcgagt tcgttgtcga cgacgccgct cggctgaccg ccgtgtggat
cgccgactgg 540gccgacaaca ccgttcacct cagcgcgcac catgctcgga
tcggcaagga cgcggtgctg 600cgccacgtca ccgtcatgtt gggcggcgac
gtggtgcgaa tgtcggcggg cgtgcggttc 660tgcggtgcgg gtggggacgc
ggaactgctg gggctgtatt tcgccgacga cggccagcac 720ctggagtcgc
ggctgctggt ggaccacgcc caccccgact gcaagtcgaa cgtgctgtat
780aagggtgcac tgcaaggtga tccggcgtcg tcgttgcccg acgcacacac
ggtctgggtg 840ggtgacgtgc tgatccgtgc gcaggccacc ggcaccgaca
ccttcgaggt gaaccggaac 900ctggtgctca ccgacggcgc gcgtgccgac
tcggtgccca acctggagat cgagaccggc 960gagatcgtcg gcgccggaca
cgccagcgcc accggtcgct tcgacgatga gcaattgttc 1020tacctgcgtt
cgcgcggtat tcccgaagca caggcccgcc ggctggtggt ccgcggcttc
1080ttcggtgaga tcatcgccaa gatcgcggtg cccgaggtac gcgagcgcct
gaccgcagcc 1140atcgaacacg agctggaaat cacggaatca acggaaaaga
caacagtctc atga 11944397PRTMycobacterium tuberculosis 4Met Thr Ala
Pro Gly Leu Thr Ala Ala Val Glu Gly Ile Ala His Asn 1 5 10 15 Lys
Gly Glu Leu Phe Ala Ser Phe Asp Val Asp Ala Phe Glu Val Pro 20 25
30 His Gly Arg Asp Glu Ile Trp Arg Phe Thr Pro Leu Arg Arg Leu Arg
35 40 45 Gly Leu His Asp Gly Ser Ala Arg Ala Thr Gly Ser Ala Thr
Ile Thr 50 55 60 Val Ser Glu Arg Pro Gly Val Tyr Thr Gln Thr Val
Arg Arg Gly Asp 65 70 75 80 Pro Arg Leu Gly Glu Gly Gly Val Pro Thr
Asp Arg Val Ala Ala Gln 85 90 95 Ala Phe Ser Ser Phe Asn Ser Ala
Thr Leu Val Thr Val Glu Arg Asp 100 105 110 Thr Gln Val Val Glu Pro
Val Gly Ile Thr Val Thr Gly Pro Gly Glu 115 120 125 Gly Ala Val Ala
Tyr Gly His Leu Gln Val Arg Ile Glu Glu Leu Gly 130 135 140 Glu Ala
Val Val Val Ile Asp His Arg Gly Gly Gly Thr Tyr Ala Asp 145 150 155
160 Asn Val Glu Phe Val Val Asp Asp Ala Ala Arg Leu Thr Ala Val Trp
165 170 175 Ile Ala Asp Trp Ala Asp Asn Thr Val His Leu Ser Ala His
His Ala 180 185 190 Arg Ile Gly Lys Asp Ala Val Leu Arg His Val Thr
Val Met Leu Gly 195 200 205 Gly Asp Val Val Arg Met Ser Ala Gly Val
Arg Phe Cys Gly Ala Gly 210 215 220 Gly Asp Ala Glu Leu Leu Gly Leu
Tyr Phe Ala Asp Asp Gly Gln His 225 230 235 240 Leu Glu Ser Arg Leu
Leu Val Asp His Ala His Pro Asp Cys Lys Ser 245 250 255 Asn Val Leu
Tyr Lys Gly Ala Leu Gln Gly Asp Pro Ala Ser Ser Leu 260 265 270 Pro
Asp Ala His Thr Val Trp Val Gly Asp Val Leu Ile Arg Ala Gln 275 280
285 Ala Thr Gly Thr Asp Thr Phe Glu Val Asn Arg Asn Leu Val Leu Thr
290 295 300 Asp Gly Ala Arg Ala Asp Ser Val Pro Asn Leu Glu Ile Glu
Thr Gly 305 310 315 320 Glu Ile Val Gly Ala Gly His Ala Ser Ala Thr
Gly Arg Phe Asp Asp 325 330 335 Glu Gln Leu Phe Tyr Leu Arg Ser Arg
Gly Ile Pro Glu Ala Gln Ala 340 345 350 Arg Arg Leu Val Val Arg Gly
Phe Phe Gly Glu Ile Ile Ala Lys Ile 355 360 365 Ala Val Pro Glu Val
Arg Glu Arg Leu Thr Ala Ala Ile Glu His Glu 370 375 380 Leu Glu Ile
Thr Glu Ser Thr Glu Lys Thr Thr Val Ser 385 390 395
52520DNAMycobacterium tuberculosis 5atggcggttc gtcaggtcac
cgtcggctat tcggacggca cgcacaagac gatgccggtg 60cggtgcgacc agacggtcct
ggatgccgcc gaggaacacg gcgtggccat cgtcaacgaa 120tgccaaagcg
ggatatgtgg cacctgcgtg gccacctgca ccgccggccg ctaccagatg
180ggacgcaccg agggactgtc cgatgtcgag cgggcggcgc gaaagatcct
cacctgccag 240acgtttgtta cctccgattg ccggatcgag ctgcagtatc
cggtcgacga caacgccgcc 300ctgctggtca ccggtgacgg tgtggtgacc
gcggtcgagt tggtgtcgcc cagcaccgcc 360atcctgcggg tggacacctc
tggcatggcc ggcgcgctga gataccgggc cggccagttc 420gcccaattgc
aggttcccgg taccaacgta tggcgcaact actcctacgc ccatccggcc
480gacggccgcg gtgagtgcga gttcatcatc aggttgctgc cggacggcgt
gatgtcgaat 540tatcttcgcg accgcgccca gcccggtgac catatcgcgc
tgcgctgcag caagggcagc 600ttttatctgc gcccgatcgt gcgaccggtg
atcctggtcg ccggaggaac cggcctgtca 660gcgatcctgg cgatggccca
gagcctggat gccgatgtcg ctcacccggt ctacctgctc 720tacggggtcg
agcgcaccga agacctgtgc aagctcgacg aactcaccga gctgcgccgc
780cgcgttggcc gcctggaggt gcacgtcgtc gtcgctcgcc cggaccccga
ctgggatggg 840cgcaccgggc tggtcaccga cctgctcgac gagcggatgc
tggcgagcgg tgacgccgac 900gtgtatctgt gcggtccggt cgccatggtc
gacgcagccc gaacctggct ggaccacaat 960ggctttcacc gtgtcgggtt
gtactacgag aagttcgtgg ccagcggggc ggcgcgccgc 1020cgcaccccgg
ctcggctgga ttacgcgggc gtggacattg ccgaggtgtg ccgccgcggc
1080cgcggcaccg cggtggtcat cggcggcagc atcgcgggca tcgcggcggc
gaaaatgctc 1140agcgagacct tcgatcgcgt catcgtgctg gagaaggacg
gcccgcaccg tcgccgcgag 1200ggcaggccgg gcgcggcaca gggttggcac
ctgcaccacc tgctgaccgc cgggcagatc 1260gagctggagc gcatcttccc
tggcatcgtc gacgacatgg tgcgcgaggg agcgttcaag 1320gtcgacatgg
ccgcgcagta ccgtatccgg ctgggcggca cctggaagaa gcccggcact
1380agtgacatcg agatcgtctg cgcgggaagg ccgctgctcg aatggtgtgt
gcgccgccgg 1440ctcgacgacg aaccgcgcat cgacttccgc tacgaatcgg
aggtggccga tctcgccttc 1500gaccgcgcca acaatgccat cgtcggcgtc
gccgtggaca atggcgacgc cgacggaggc 1560gacggtttgc aggtggtgcc
cgccgagttc gtcgtggacg cgtcgggcaa gaacacccgc 1620gtgccggagt
tcttggagcg tctcggtgtt ggcgctcccg aggccgagca ggacatcatc
1680aactgcttct actccacgat gcagcaccgg gttccgccgg agcggcggtg
gcaggacaag 1740gtgatggtga tctgctatgc gtaccgccct ttcgaggata
cctacgccgc gcagtactac 1800accgacagct cccgcaccat cctgtccacc
tcactggtgg cctacaactg ctattcgccg 1860ccgcgtaccg cccgagaatt
ccgcgcgttc gccgacctga tgccgtcccc ggtcatcggg 1920gagaacatcg
acgggctgga gccggcatcg cccatctaca atttccgcta tcccaacatg
1980ctgcggctgc gctacgagaa gaagcgcaac ctgccgcggg ctttgctggc
ggtgggcgat 2040gcctacacca gcgccgaccc ggtgtcgggt ctgggtatga
gcctggcgct caaggaagtt 2100cgggagatgc aggcgctgct ggctaaatac
ggcgccggtc accgggatct gccgcgccgg 2160tactaccggg cgatcgccaa
gatggccgac acggcctggt tcgtgatccg cgagcagaac 2220ctgcgcttcg
actggatgaa ggacgtcgac aagaagcgcc cgttctattt cggtgtgctg
2280acctggtaca tggaccgcgt gctggagctg gtgcatgacg atctcgacgc
gtaccgggaa 2340ttcttggccg tcgtccatct ggtcaagccg ccgtcggcgc
tgatgcgacc caggatcgcc 2400agccgcgtcc tcggcaaatg ggcacgaacc
cgattgtcgg gccagaagac gttgattgcc 2460cgcaactacg aaaatcatcc
gataccagcc gaacccgcgg accaacttgt aaacgcttag
25206839PRTMycobacterium tuberculosis 6Met Ala Val Arg Gln Val Thr
Val Gly Tyr Ser Asp Gly Thr His Lys 1 5 10 15 Thr Met Pro Val Arg
Cys Asp Gln Thr Val Leu Asp Ala Ala Glu Glu 20 25 30 His Gly Val
Ala Ile Val Asn Glu Cys Gln Ser Gly Ile Cys Gly Thr 35 40 45 Cys
Val Ala Thr Cys Thr Ala Gly Arg Tyr Gln Met Gly Arg Thr Glu 50 55
60 Gly Leu Ser Asp Val Glu Arg Ala Ala Arg Lys Ile Leu Thr Cys Gln
65 70 75 80 Thr Phe Val Thr Ser Asp Cys Arg Ile Glu Leu Gln Tyr Pro
Val Asp 85 90 95 Asp Asn Ala Ala Leu Leu Val Thr Gly Asp Gly Val
Val Thr Ala Val 100 105 110 Glu Leu Val Ser Pro Ser Thr Ala Ile Leu
Arg Val Asp Thr Ser Gly 115 120 125 Met Ala Gly Ala Leu Arg Tyr Arg
Ala Gly Gln Phe Ala Gln Leu Gln 130 135 140 Val Pro Gly Thr Asn Val
Trp Arg Asn Tyr Ser Tyr Ala His Pro Ala 145 150 155 160 Asp Gly Arg
Gly Glu Cys Glu Phe Ile Ile Arg Leu Leu Pro Asp Gly 165 170 175 Val
Met Ser Asn Tyr Leu Arg Asp Arg Ala Gln Pro Gly Asp His Ile 180 185
190 Ala Leu Arg Cys Ser Lys Gly Ser Phe Tyr Leu Arg Pro Ile Val Arg
195 200 205 Pro Val Ile Leu Val Ala Gly Gly Thr Gly Leu Ser Ala Ile
Leu Ala 210 215 220 Met Ala Gln Ser Leu Asp Ala Asp Val Ala His Pro
Val Tyr Leu Leu 225 230 235 240 Tyr Gly Val Glu Arg Thr Glu Asp Leu
Cys Lys Leu Asp Glu Leu Thr 245 250 255 Glu Leu Arg Arg Arg Val Gly
Arg Leu Glu Val His Val Val Val Ala 260 265 270 Arg Pro Asp Pro Asp
Trp Asp Gly Arg Thr Gly Leu Val Thr Asp Leu 275 280 285 Leu Asp Glu
Arg Met Leu Ala Ser Gly Asp Ala Asp Val Tyr Leu Cys 290 295 300 Gly
Pro Val Ala Met Val Asp Ala Ala Arg Thr Trp Leu Asp His Asn 305 310
315 320 Gly Phe His Arg Val Gly Leu Tyr Tyr Glu Lys Phe Val Ala Ser
Gly 325 330 335 Ala Ala Arg Arg Arg Thr Pro Ala Arg Leu Asp Tyr Ala
Gly Val Asp 340 345 350 Ile Ala Glu Val Cys Arg Arg Gly Arg Gly Thr
Ala Val Val Ile Gly 355 360 365 Gly Ser Ile Ala Gly Ile Ala Ala Ala
Lys Met Leu Ser Glu Thr Phe 370 375 380 Asp Arg Val Ile Val Leu Glu
Lys Asp Gly Pro His Arg Arg Arg Glu 385 390 395 400 Gly Arg Pro Gly
Ala Ala Gln Gly Trp His Leu His His Leu Leu Thr 405 410 415 Ala Gly
Gln Ile Glu Leu Glu Arg Ile Phe Pro Gly Ile Val Asp Asp 420 425 430
Met Val Arg Glu Gly Ala Phe Lys Val Asp Met Ala Ala Gln Tyr Arg 435
440 445 Ile Arg Leu Gly Gly Thr Trp Lys Lys Pro Gly Thr Ser Asp Ile
Glu 450 455 460 Ile Val Cys Ala Gly Arg Pro Leu Leu Glu Trp Cys Val
Arg Arg Arg 465 470 475 480 Leu Asp Asp Glu Pro Arg Ile Asp Phe Arg
Tyr Glu Ser Glu Val Ala 485 490 495 Asp Leu Ala Phe Asp Arg Ala Asn
Asn Ala Ile Val Gly Val Ala Val 500 505 510 Asp Asn Gly Asp Ala Asp
Gly Gly Asp Gly Leu Gln Val Val Pro Ala 515 520 525 Glu Phe Val Val
Asp Ala Ser Gly Lys Asn Thr Arg Val Pro Glu Phe 530 535 540 Leu Glu
Arg Leu Gly Val Gly Ala Pro Glu Ala Glu Gln Asp Ile Ile 545 550 555
560 Asn Cys Phe Tyr Ser Thr Met Gln His Arg Val Pro Pro Glu Arg
Arg
565 570 575 Trp Gln Asp Lys Val Met Val Ile Cys Tyr Ala Tyr Arg Pro
Phe Glu 580 585 590 Asp Thr Tyr Ala Ala Gln Tyr Tyr Thr Asp Ser Ser
Arg Thr Ile Leu 595 600 605 Ser Thr Ser Leu Val Ala Tyr Asn Cys Tyr
Ser Pro Pro Arg Thr Ala 610 615 620 Arg Glu Phe Arg Ala Phe Ala Asp
Leu Met Pro Ser Pro Val Ile Gly 625 630 635 640 Glu Asn Ile Asp Gly
Leu Glu Pro Ala Ser Pro Ile Tyr Asn Phe Arg 645 650 655 Tyr Pro Asn
Met Leu Arg Leu Arg Tyr Glu Lys Lys Arg Asn Leu Pro 660 665 670 Arg
Ala Leu Leu Ala Val Gly Asp Ala Tyr Thr Ser Ala Asp Pro Val 675 680
685 Ser Gly Leu Gly Met Ser Leu Ala Leu Lys Glu Val Arg Glu Met Gln
690 695 700 Ala Leu Leu Ala Lys Tyr Gly Ala Gly His Arg Asp Leu Pro
Arg Arg 705 710 715 720 Tyr Tyr Arg Ala Ile Ala Lys Met Ala Asp Thr
Ala Trp Phe Val Ile 725 730 735 Arg Glu Gln Asn Leu Arg Phe Asp Trp
Met Lys Asp Val Asp Lys Lys 740 745 750 Arg Pro Phe Tyr Phe Gly Val
Leu Thr Trp Tyr Met Asp Arg Val Leu 755 760 765 Glu Leu Val His Asp
Asp Leu Asp Ala Tyr Arg Glu Phe Leu Ala Val 770 775 780 Val His Leu
Val Lys Pro Pro Ser Ala Leu Met Arg Pro Arg Ile Ala 785 790 795 800
Ser Arg Val Leu Gly Lys Trp Ala Arg Thr Arg Leu Ser Gly Gln Lys 805
810 815 Thr Leu Ile Ala Arg Asn Tyr Glu Asn His Pro Ile Pro Ala Glu
Pro 820 825 830 Ala Asp Gln Leu Val Asn Ala 835
71185DNAMycobacterium tuberculosis 7atgaccacaa cgactacaac
gatttctggg gggatattac ccaaggaata ccaagatctt 60cgggatacgg tggccgattt
tgcgcgcacc gtggtcgcgc cggtatcggc caaacacgat 120gcggaacaca
gcttcccata cgaaattgtc gccaagatgg gagagatggg cctgttcggg
180ctgccgtttc cggaggagta cggcggcatg ggcggcgact acttcgcgct
gtcgctggta 240cttgaggagc tgggcaaggt tgaccaatcg gtagcgatca
cgctggaggc cgcggtgggc 300ctgggtgcga tgccgatcta ccggttcggt
accgaggagc agaaacagaa gtggttgccc 360gacttgacgt ctggccgtgc
gctcgccggt tttggtctca ccgagccggg agcgggatcg 420gacgcgggca
gcacccgcac cacggcgcgt ctcgaaggtg acgagtggat catcaacggc
480tccaagcaat ttatcaccaa ctcgggcacc gacatcacat cgctggtcac
cgtcactgcg 540gttaccggga ccaccggaac cgctgcggat gccaagaaag
agatttcgac gatcatcgtg 600cccagcggca caccgggatt caccgtggaa
ccggtctata acaaggtcgg ctggaacgcc 660tcggacaccc acccactgac
atttgccgat gcgcgggtcc cgagggagaa cctgctggga 720gcccggggga
gcggctatgc caacttcttg tccatcctgg acgagggccg gattgcgatt
780gcagcgctgg ccaccggcgc ggcgcagggc tgtgttgacg agagcgtcaa
gtacgccaac 840cagcgtcagt cgtttggcca gccgatcggc gcttatcagg
cgatcggctt caagatcgcg 900cggatggagg cacgcgccca tgttgcccgc
acagcgtact atgatgccgc cgcaaagatg 960ttggcgggca agcccttcaa
gaaggaggcg gcgatcgcga agatgatctc ctcggaggcg 1020gcgatggaca
actcccgcga tgccacccag atacacggcg gatacggctt tatgaacgaa
1080tatccggtgg cgcgtcatta ccgcgacagc aaggtgctcg agattggtga
gggcaccacg 1140gaagtgcagc tgatgcttat cgcgcgatcg ttgggactgc agtga
11858394PRTMycobacterium tuberculosis 8Met Thr Thr Thr Thr Thr Thr
Ile Ser Gly Gly Ile Leu Pro Lys Glu 1 5 10 15 Tyr Gln Asp Leu Arg
Asp Thr Val Ala Asp Phe Ala Arg Thr Val Val 20 25 30 Ala Pro Val
Ser Ala Lys His Asp Ala Glu His Ser Phe Pro Tyr Glu 35 40 45 Ile
Val Ala Lys Met Gly Glu Met Gly Leu Phe Gly Leu Pro Phe Pro 50 55
60 Glu Glu Tyr Gly Gly Met Gly Gly Asp Tyr Phe Ala Leu Ser Leu Val
65 70 75 80 Leu Glu Glu Leu Gly Lys Val Asp Gln Ser Val Ala Ile Thr
Leu Glu 85 90 95 Ala Ala Val Gly Leu Gly Ala Met Pro Ile Tyr Arg
Phe Gly Thr Glu 100 105 110 Glu Gln Lys Gln Lys Trp Leu Pro Asp Leu
Thr Ser Gly Arg Ala Leu 115 120 125 Ala Gly Phe Gly Leu Thr Glu Pro
Gly Ala Gly Ser Asp Ala Gly Ser 130 135 140 Thr Arg Thr Thr Ala Arg
Leu Glu Gly Asp Glu Trp Ile Ile Asn Gly 145 150 155 160 Ser Lys Gln
Phe Ile Thr Asn Ser Gly Thr Asp Ile Thr Ser Leu Val 165 170 175 Thr
Val Thr Ala Val Thr Gly Thr Thr Gly Thr Ala Ala Asp Ala Lys 180 185
190 Lys Glu Ile Ser Thr Ile Ile Val Pro Ser Gly Thr Pro Gly Phe Thr
195 200 205 Val Glu Pro Val Tyr Asn Lys Val Gly Trp Asn Ala Ser Asp
Thr His 210 215 220 Pro Leu Thr Phe Ala Asp Ala Arg Val Pro Arg Glu
Asn Leu Leu Gly 225 230 235 240 Ala Arg Gly Ser Gly Tyr Ala Asn Phe
Leu Ser Ile Leu Asp Glu Gly 245 250 255 Arg Ile Ala Ile Ala Ala Leu
Ala Thr Gly Ala Ala Gln Gly Cys Val 260 265 270 Asp Glu Ser Val Lys
Tyr Ala Asn Gln Arg Gln Ser Phe Gly Gln Pro 275 280 285 Ile Gly Ala
Tyr Gln Ala Ile Gly Phe Lys Ile Ala Arg Met Glu Ala 290 295 300 Arg
Ala His Val Ala Arg Thr Ala Tyr Tyr Asp Ala Ala Ala Lys Met 305 310
315 320 Leu Ala Gly Lys Pro Phe Lys Lys Glu Ala Ala Ile Ala Lys Met
Ile 325 330 335 Ser Ser Glu Ala Ala Met Asp Asn Ser Arg Asp Ala Thr
Gln Ile His 340 345 350 Gly Gly Tyr Gly Phe Met Asn Glu Tyr Pro Val
Ala Arg His Tyr Arg 355 360 365 Asp Ser Lys Val Leu Glu Ile Gly Glu
Gly Thr Thr Glu Val Gln Leu 370 375 380 Met Leu Ile Ala Arg Ser Leu
Gly Leu Gln 385 390 9747DNAMycobacterium tuberculosis 9atggacaagg
tggtggccac cgccgcggag gcggtcgcag acatagccaa cgggtcgtcg 60cttgcggttg
gtggattcgg gctttgcggc atccccgaag cactgatcgc agcgttggtg
120gatagcggtg tcaccgacct ggaaacagtc tcgaacaact gcggaatcga
cggtgttggt 180ctgggactat tgttgcaaca caagcgaatt cgccggacag
tctcctccta cgtgggggag 240aacaaggagt tcgcccgcca gttcctcgcg
ggcgagctcg aggtggaact gaccccgcag 300ggcacgctgg ccgagcggtt
gcgggccgga gggatgggca taccggcctt ctatacaccg 360gcaggggtcg
gtacccaggt cgccgacggc gggttgccgt ggcgctacga cgcctcgggc
420ggggtggcgg tggtgtcgcc ggccaaggag actcgggagt tcgatggtgt
cacctatgtc 480ctcgagcggg ggatccggac cgacttcgca ctggtgcatg
cctggcaggg ggaccggcac 540ggcaacctga tgtaccgcca cgccgcggcc
aacttcaacc cggagtgcgc atccgcaggc 600aggatcacga tcgccgaggt
cgagcacttg gtcgagccgg gtgagatcga ccctgccacc 660gtacacaccc
cgggcgtgtt tgtgcaccgg gtggttcatg tgcccaaccc cgccaagaag
720atcgagaggg agacggtgcg gcaatga 74710248PRTMycobacterium
tuberculosis 10Met Asp Lys Val Val Ala Thr Ala Ala Glu Ala Val Ala
Asp Ile Ala 1 5 10 15 Asn Gly Ser Ser Leu Ala Val Gly Gly Phe Gly
Leu Cys Gly Ile Pro 20 25 30 Glu Ala Leu Ile Ala Ala Leu Val Asp
Ser Gly Val Thr Asp Leu Glu 35 40 45 Thr Val Ser Asn Asn Cys Gly
Ile Asp Gly Val Gly Leu Gly Leu Leu 50 55 60 Leu Gln His Lys Arg
Ile Arg Arg Thr Val Ser Ser Tyr Val Gly Glu 65 70 75 80 Asn Lys Glu
Phe Ala Arg Gln Phe Leu Ala Gly Glu Leu Glu Val Glu 85 90 95 Leu
Thr Pro Gln Gly Thr Leu Ala Glu Arg Leu Arg Ala Gly Gly Met 100 105
110 Gly Ile Pro Ala Phe Tyr Thr Pro Ala Gly Val Gly Thr Gln Val Ala
115 120 125 Asp Gly Gly Leu Pro Trp Arg Tyr Asp Ala Ser Gly Gly Val
Ala Val 130 135 140 Val Ser Pro Ala Lys Glu Thr Arg Glu Phe Asp Gly
Val Thr Tyr Val 145 150 155 160 Leu Glu Arg Gly Ile Arg Thr Asp Phe
Ala Leu Val His Ala Trp Gln 165 170 175 Gly Asp Arg His Gly Asn Leu
Met Tyr Arg His Ala Ala Ala Asn Phe 180 185 190 Asn Pro Glu Cys Ala
Ser Ala Gly Arg Ile Thr Ile Ala Glu Val Glu 195 200 205 His Leu Val
Glu Pro Gly Glu Ile Asp Pro Ala Thr Val His Thr Pro 210 215 220 Gly
Val Phe Val His Arg Val Val His Val Pro Asn Pro Ala Lys Lys 225 230
235 240 Ile Glu Arg Glu Thr Val Arg Gln 245 112157DNAMycobacterium
tuberculosis 11atgaccctgg aagtggtatc ggacgcggcc ggacgcatgc
gggtcaaagt cgactgggtc 60cgttgcgatt cccggcgcgc ggtcgcggtc gaagaggccg
ttgccaagca gaacggtgtg 120cgcgtcgtgc acgcctaccc gcgcaccggg
tccgtggtcg tgtggtattc acccagacgc 180gccgaccgcg cggcggtgct
ggcggcgatc aagggcgccg cgcacgtcgc cgccgaactg 240atccccgcgc
gtgcgccgca ctcggccgag atccgcaaca ccgacgtgct ccggatggtc
300atcggcgggg tggcactggc cttgctcggg gtgcgccgct acgtgttcgc
gcggccaccg 360ctgctcggaa ccaccgggcg gacggtggcc accggtgtca
ccattttcac cgggtatccg 420ttcctgcgtg gcgcgctgcg ctcgctgcgc
tccggaaagg ccggcaccga tgccctggtc 480tccgcggcga cggtggcaag
cctcatcctg cgcgagaacg tggtcgcact caccgtcctg 540tggttgctca
acatcggtga gtacctgcag gatctgacgc tgcggcggac ccggcgggcc
600atctcggagc tgctgcgcgg caaccaggac acggcctggg tgcgcctcac
cgatccttct 660gcaggctccg acgcggccac cgaaatccag gtcccgatcg
acaccgtgca gatcggtgac 720gaggtggtgg tccacgagca cgtcgcgata
ccggtcgacg gtgaggtggt cgacggcgaa 780gcgatcgtca atcagtccgc
gatcaccggg gaaaacctgc cggtcagcgt cgtggtcgga 840acgcgcgtgc
acgccggttc ggtcgtggtg cgcggacgcg tggtggtgcg cgcccacgcg
900gtaggcaacc aaaccaccat cggtcgcatc attagcaggg tcgaagaggc
tcagctcgac 960cgggcaccca tccagacggt gggcgagaac ttctcccgcc
gcttcgttcc cacctcgttc 1020atcgtctcgg ccatcgcgtt gctgatcacc
ggcgacgtgc ggcgcgcgat gaccatgttg 1080ttgatcgcat gcccgtgcgc
ggtgggactg tccaccccga ccgcgatcag cgcagcgatc 1140ggcaacggcg
cgcgccgtgg catcctgatc aagggcggat cccacctcga gcaggcgggc
1200cgcgtcgacg ccatcgtgtt cgacaagacc gggacgttga ccgtgggccg
ccccgtggtc 1260accaatatcg ttgccatgca taaagattgg gagcccgagc
aagtgctggc ctatgccgcc 1320agctcggaga tccactcacg tcatccgctg
gccgaggcgg tgatccgctc gacggaggaa 1380cgccgcatca gcatcccacc
acacgaggag tgcgaggtgc tggtcggcct gggcatgcgg 1440acctgggccg
acggtcggac cctgctgctg ggcagtccgt cgttgctgcg cgccgaaaaa
1500gttcgggtgt ccaagaaggc gtcggagtgg gtcgacaagc tgcgccgcca
ggcggagacc 1560ccgctgctgc tcgcggtgga cggcacgctg gtcggcctga
tcagcctgcg cgacgaggtg 1620cgtccggagg cggcccaggt gctgacgaag
ctgcgggcca atgggattcg ccggatcgtc 1680atgctcaccg gcgaccaccc
ggagatcgcc caggttgtcg ccgacgaact ggggattgat 1740gagtggcgcg
ccgaggtcat gccggaggac aagctcgcgg cggtgcgcga gctgcaggac
1800gacggctacg tcgtcgggat ggtcggcgac ggcatcaacg acgccccggc
gctggccgcc 1860gccgatatcg ggatcgccat gggccttgcc ggaaccgacg
tcgccgtcga gaccgccgat 1920gtcgcgctgg ccaacgacga cctgcaccgc
ctgctcgacg ttggggacct gggcgagcgg 1980gcagtggatg taatccggca
gaactacggc atgtccatcg ccgtcaacgc ggccgggctg 2040ctgatcggcg
cgggcggtgc gctctcgccg gtgctggcgg cgatcctgca caacgcgtcg
2100tcggtggcgg tggtggccaa cagttcccgg ttgatccgct accgcctgga ccgctag
215712718PRTMycobacterium tuberculosis 12Met Thr Leu Glu Val Val
Ser Asp Ala Ala Gly Arg Met Arg Val Lys 1 5 10 15 Val Asp Trp Val
Arg Cys Asp Ser Arg Arg Ala Val Ala Val Glu Glu 20 25 30 Ala Val
Ala Lys Gln Asn Gly Val Arg Val Val His Ala Tyr Pro Arg 35 40 45
Thr Gly Ser Val Val Val Trp Tyr Ser Pro Arg Arg Ala Asp Arg Ala 50
55 60 Ala Val Leu Ala Ala Ile Lys Gly Ala Ala His Val Ala Ala Glu
Leu 65 70 75 80 Ile Pro Ala Arg Ala Pro His Ser Ala Glu Ile Arg Asn
Thr Asp Val 85 90 95 Leu Arg Met Val Ile Gly Gly Val Ala Leu Ala
Leu Leu Gly Val Arg 100 105 110 Arg Tyr Val Phe Ala Arg Pro Pro Leu
Leu Gly Thr Thr Gly Arg Thr 115 120 125 Val Ala Thr Gly Val Thr Ile
Phe Thr Gly Tyr Pro Phe Leu Arg Gly 130 135 140 Ala Leu Arg Ser Leu
Arg Ser Gly Lys Ala Gly Thr Asp Ala Leu Val 145 150 155 160 Ser Ala
Ala Thr Val Ala Ser Leu Ile Leu Arg Glu Asn Val Val Ala 165 170 175
Leu Thr Val Leu Trp Leu Leu Asn Ile Gly Glu Tyr Leu Gln Asp Leu 180
185 190 Thr Leu Arg Arg Thr Arg Arg Ala Ile Ser Glu Leu Leu Arg Gly
Asn 195 200 205 Gln Asp Thr Ala Trp Val Arg Leu Thr Asp Pro Ser Ala
Gly Ser Asp 210 215 220 Ala Ala Thr Glu Ile Gln Val Pro Ile Asp Thr
Val Gln Ile Gly Asp 225 230 235 240 Glu Val Val Val His Glu His Val
Ala Ile Pro Val Asp Gly Glu Val 245 250 255 Val Asp Gly Glu Ala Ile
Val Asn Gln Ser Ala Ile Thr Gly Glu Asn 260 265 270 Leu Pro Val Ser
Val Val Val Gly Thr Arg Val His Ala Gly Ser Val 275 280 285 Val Val
Arg Gly Arg Val Val Val Arg Ala His Ala Val Gly Asn Gln 290 295 300
Thr Thr Ile Gly Arg Ile Ile Ser Arg Val Glu Glu Ala Gln Leu Asp 305
310 315 320 Arg Ala Pro Ile Gln Thr Val Gly Glu Asn Phe Ser Arg Arg
Phe Val 325 330 335 Pro Thr Ser Phe Ile Val Ser Ala Ile Ala Leu Leu
Ile Thr Gly Asp 340 345 350 Val Arg Arg Ala Met Thr Met Leu Leu Ile
Ala Cys Pro Cys Ala Val 355 360 365 Gly Leu Ser Thr Pro Thr Ala Ile
Ser Ala Ala Ile Gly Asn Gly Ala 370 375 380 Arg Arg Gly Ile Leu Ile
Lys Gly Gly Ser His Leu Glu Gln Ala Gly 385 390 395 400 Arg Val Asp
Ala Ile Val Phe Asp Lys Thr Gly Thr Leu Thr Val Gly 405 410 415 Arg
Pro Val Val Thr Asn Ile Val Ala Met His Lys Asp Trp Glu Pro 420 425
430 Glu Gln Val Leu Ala Tyr Ala Ala Ser Ser Glu Ile His Ser Arg His
435 440 445 Pro Leu Ala Glu Ala Val Ile Arg Ser Thr Glu Glu Arg Arg
Ile Ser 450 455 460 Ile Pro Pro His Glu Glu Cys Glu Val Leu Val Gly
Leu Gly Met Arg 465 470 475 480 Thr Trp Ala Asp Gly Arg Thr Leu Leu
Leu Gly Ser Pro Ser Leu Leu 485 490 495 Arg Ala Glu Lys Val Arg Val
Ser Lys Lys Ala Ser Glu Trp Val Asp 500 505 510 Lys Leu Arg Arg Gln
Ala Glu Thr Pro Leu Leu Leu Ala Val Asp Gly 515 520 525 Thr Leu Val
Gly Leu Ile Ser Leu Arg Asp Glu Val Arg Pro Glu Ala 530 535 540 Ala
Gln Val Leu Thr Lys Leu Arg Ala Asn Gly Ile Arg Arg Ile Val 545 550
555 560 Met Leu Thr Gly Asp His Pro Glu Ile Ala Gln Val Val Ala Asp
Glu 565 570 575 Leu Gly Ile Asp Glu Trp Arg Ala Glu Val Met Pro Glu
Asp Lys Leu 580 585 590 Ala Ala Val Arg Glu Leu Gln Asp Asp Gly Tyr
Val Val Gly Met Val 595 600 605 Gly Asp Gly Ile Asn Asp Ala Pro Ala
Leu Ala Ala Ala Asp Ile Gly 610 615 620 Ile Ala Met Gly Leu Ala Gly
Thr Asp Val Ala Val Glu Thr Ala Asp 625 630 635 640 Val Ala Leu Ala
Asn Asp Asp Leu His Arg Leu Leu Asp Val Gly Asp 645 650 655 Leu Gly
Glu Arg Ala Val Asp Val Ile Arg Gln Asn Tyr Gly Met Ser 660 665 670
Ile Ala Val Asn Ala Ala Gly Leu Leu Ile Gly Ala Gly Gly Ala Leu 675
680 685 Ser Pro Val Leu Ala Ala Ile Leu His Asn Ala Ser Ser Val Ala
Val 690 695 700 Val Ala Asn Ser Ser Arg Leu Ile Arg Tyr Arg Leu Asp
Arg 705 710 715 131692DNAMycobacterium tuberculosis 13atgactgtgc
aggagttcga cgtcgtggtg
gtcggcagcg gcgccgccgg catggttgct 60gcgctggtcg ccgctcaccg aggtctctcg
acggtagtcg tcgagaaggc cccgcactac 120ggcggctcca ccgcacgctc
gggcggcggc gtctggatcc ccaacaacga ggtcctcaag 180cgccgcggcg
ttcgagatac accggaggcg gcacgcacct atctgcacgg catcgtcggc
240gaaatcgtcg agccggaacg catcgatgct tacctcgacc gcgggcccga
gatgctgtcg 300ttcgtgctga agcacacgcc gctgaagatg tgctgggtac
ccggctactc cgactactac 360cccgaggctc cgggcggccg cccgggcgga
cgttcgatcg agccgaaacc gttcaacgcg 420cgcaagcttg gtgccgacat
ggccgggctg gagcccgcgt atggcaaggt tccgctcaat 480gtggttgtga
tgcagcagga ctacgttcgc ctcaatcagc tcaaacgtca cccccgtggc
540gtgctgcgca gcatgaaggt cggcgcccgc acgatgtggg cgaaggcaac
aggtaagaac 600ctggtcggca tgggtcgagc cctcattggg ccgttgcgga
tcgggttgca gcgcgccgga 660gtgccggtcg aactcaacac cgccttcacc
gatcttttcg tcgaaaatgg cgtcgtgtcc 720ggggtatacg tccgcgattc
ccacgaggcg gaatccgctg agccgcagct gatccgggct 780cgccgcggcg
tgatcctggc ctgtggtggt ttcgagcata acgagcagat gcgaatcaag
840taccagcggg cacccatcac caccgagtgg accgtgggcg ccagcgccaa
taccggtgac 900ggcattctcg ccgccgaaaa gctcggcgca gcactggatc
tgatggatga cgcttggtgg 960ggcccgacgg taccgctggt cggcaaacca
tggttcgcgc tctcggagcg caactctccc 1020ggttcgatca tcgtcaacat
gtcaggcaag cgattcatga acgaatcgat gccatacgtc 1080gaagcctgtc
atcatatgta cggcggcgaa cacggccagg ggcccggacc gggcgagaac
1140attccggcgt ggctggtgtt cgaccagcga taccgggacc gctacatctt
cgcgggacta 1200caaccagggc aacgcattcc gagcaggtgg ctggattccg
gcgtcatcgt ccaggccgat 1260acccttgcgg agctggccgg caaggccggt
ctacccgcgg acgaactcac tgccaccgtc 1320cagcgtttca acgcattcgc
ccggtccggt gtcgacgagg actaccaccg cggggaaagt 1380gcctacgatc
gctactacgg cgacccgagc aacaagccca atccgaacct cggcgaggtc
1440ggccacccgc cctattatgg cgccaagatg gttccgggcg acctggggac
caagggcggt 1500atccgcaccg atgtcaacgg acgtgctctg cgggacgacg
gcagcatcat cgacggcctt 1560tacgctgcag gcaatgtcag tgccccagtg
atgggacaca cctaccccgg tccgggcggc 1620acgataggcc cggcgatgac
gttcgggtac ctggcggcgc tgcacattgc cgatcaggcg 1680ggaaagcgct ga
169214563PRTMycobacterium tuberculosis 14Met Thr Val Gln Glu Phe
Asp Val Val Val Val Gly Ser Gly Ala Ala 1 5 10 15 Gly Met Val Ala
Ala Leu Val Ala Ala His Arg Gly Leu Ser Thr Val 20 25 30 Val Val
Glu Lys Ala Pro His Tyr Gly Gly Ser Thr Ala Arg Ser Gly 35 40 45
Gly Gly Val Trp Ile Pro Asn Asn Glu Val Leu Lys Arg Arg Gly Val 50
55 60 Arg Asp Thr Pro Glu Ala Ala Arg Thr Tyr Leu His Gly Ile Val
Gly 65 70 75 80 Glu Ile Val Glu Pro Glu Arg Ile Asp Ala Tyr Leu Asp
Arg Gly Pro 85 90 95 Glu Met Leu Ser Phe Val Leu Lys His Thr Pro
Leu Lys Met Cys Trp 100 105 110 Val Pro Gly Tyr Ser Asp Tyr Tyr Pro
Glu Ala Pro Gly Gly Arg Pro 115 120 125 Gly Gly Arg Ser Ile Glu Pro
Lys Pro Phe Asn Ala Arg Lys Leu Gly 130 135 140 Ala Asp Met Ala Gly
Leu Glu Pro Ala Tyr Gly Lys Val Pro Leu Asn 145 150 155 160 Val Val
Val Met Gln Gln Asp Tyr Val Arg Leu Asn Gln Leu Lys Arg 165 170 175
His Pro Arg Gly Val Leu Arg Ser Met Lys Val Gly Ala Arg Thr Met 180
185 190 Trp Ala Lys Ala Thr Gly Lys Asn Leu Val Gly Met Gly Arg Ala
Leu 195 200 205 Ile Gly Pro Leu Arg Ile Gly Leu Gln Arg Ala Gly Val
Pro Val Glu 210 215 220 Leu Asn Thr Ala Phe Thr Asp Leu Phe Val Glu
Asn Gly Val Val Ser 225 230 235 240 Gly Val Tyr Val Arg Asp Ser His
Glu Ala Glu Ser Ala Glu Pro Gln 245 250 255 Leu Ile Arg Ala Arg Arg
Gly Val Ile Leu Ala Cys Gly Gly Phe Glu 260 265 270 His Asn Glu Gln
Met Arg Ile Lys Tyr Gln Arg Ala Pro Ile Thr Thr 275 280 285 Glu Trp
Thr Val Gly Ala Ser Ala Asn Thr Gly Asp Gly Ile Leu Ala 290 295 300
Ala Glu Lys Leu Gly Ala Ala Leu Asp Leu Met Asp Asp Ala Trp Trp 305
310 315 320 Gly Pro Thr Val Pro Leu Val Gly Lys Pro Trp Phe Ala Leu
Ser Glu 325 330 335 Arg Asn Ser Pro Gly Ser Ile Ile Val Asn Met Ser
Gly Lys Arg Phe 340 345 350 Met Asn Glu Ser Met Pro Tyr Val Glu Ala
Cys His His Met Tyr Gly 355 360 365 Gly Glu His Gly Gln Gly Pro Gly
Pro Gly Glu Asn Ile Pro Ala Trp 370 375 380 Leu Val Phe Asp Gln Arg
Tyr Arg Asp Arg Tyr Ile Phe Ala Gly Leu 385 390 395 400 Gln Pro Gly
Gln Arg Ile Pro Ser Arg Trp Leu Asp Ser Gly Val Ile 405 410 415 Val
Gln Ala Asp Thr Leu Ala Glu Leu Ala Gly Lys Ala Gly Leu Pro 420 425
430 Ala Asp Glu Leu Thr Ala Thr Val Gln Arg Phe Asn Ala Phe Ala Arg
435 440 445 Ser Gly Val Asp Glu Asp Tyr His Arg Gly Glu Ser Ala Tyr
Asp Arg 450 455 460 Tyr Tyr Gly Asp Pro Ser Asn Lys Pro Asn Pro Asn
Leu Gly Glu Val 465 470 475 480 Gly His Pro Pro Tyr Tyr Gly Ala Lys
Met Val Pro Gly Asp Leu Gly 485 490 495 Thr Lys Gly Gly Ile Arg Thr
Asp Val Asn Gly Arg Ala Leu Arg Asp 500 505 510 Asp Gly Ser Ile Ile
Asp Gly Leu Tyr Ala Ala Gly Asn Val Ser Ala 515 520 525 Pro Val Met
Gly His Thr Tyr Pro Gly Pro Gly Gly Thr Ile Gly Pro 530 535 540 Ala
Met Thr Phe Gly Tyr Leu Ala Ala Leu His Ile Ala Asp Gln Ala 545 550
555 560 Gly Lys Arg 15843DNAMycobacterium tuberculosis 15gtgagtccgg
cgcccgtgca ggtgatgggg gttctaaacg tcacggacga ctctttctcg 60gacggcgggt
gttatctcga tctcgacgat gcggtgaagc acggtctggc gatggcagcc
120gcaggtgcgg gcatcgtcga cgtcggtggt gagtcgagcc ggcccggtgc
cactcgggtt 180gacccggcgg tggagacgtc tcgtgtcata cccgtcgtca
aagagcttgc agcacaaggc 240atcaccgtca gcatcgatac catgcgcgcg
gatgtcgctc gggcggcgtt gcagaacggt 300gcccagatgg tcaacgacgt
gtcgggtggg cgggccgatc cggcgatggg gccgctgttg 360gccgaggccg
atgtgccgtg ggtgttgatg cactggcggg cggtatcggc cgataccccg
420catgtgcctg tgcgctacgg caacgtggtg gccgaggtcc gtgccgacct
gctggccagc 480gtcgccgacg cggtggccgc aggcgtcgac ccggcaaggc
tggtgctcga tcccgggctt 540ggattcgcca agacggcgca acataattgg
gcgatcttgc atgcccttcc ggaactggtc 600gcgaccggaa tcccagtgct
ggtgggtgct tcgcgcaagc gcttcctcgg tgcgttgttg 660gccgggcccg
acggcgtgat gcggccaacc gatgggcgtg acaccgcgac ggcggtgatt
720tccgcgctgg ccgcactgca cggggcctgg ggtgtgcggg tgcatgatgt
gcgggcctcg 780gtcgatgcca tcaaggtggt cgaagcgtgg atgggagcgg
aaaggataga acgcgatggc 840tga 84316280PRTMycobacterium tuberculosis
16Val Ser Pro Ala Pro Val Gln Val Met Gly Val Leu Asn Val Thr Asp 1
5 10 15 Asp Ser Phe Ser Asp Gly Gly Cys Tyr Leu Asp Leu Asp Asp Ala
Val 20 25 30 Lys His Gly Leu Ala Met Ala Ala Ala Gly Ala Gly Ile
Val Asp Val 35 40 45 Gly Gly Glu Ser Ser Arg Pro Gly Ala Thr Arg
Val Asp Pro Ala Val 50 55 60 Glu Thr Ser Arg Val Ile Pro Val Val
Lys Glu Leu Ala Ala Gln Gly 65 70 75 80 Ile Thr Val Ser Ile Asp Thr
Met Arg Ala Asp Val Ala Arg Ala Ala 85 90 95 Leu Gln Asn Gly Ala
Gln Met Val Asn Asp Val Ser Gly Gly Arg Ala 100 105 110 Asp Pro Ala
Met Gly Pro Leu Leu Ala Glu Ala Asp Val Pro Trp Val 115 120 125 Leu
Met His Trp Arg Ala Val Ser Ala Asp Thr Pro His Val Pro Val 130 135
140 Arg Tyr Gly Asn Val Val Ala Glu Val Arg Ala Asp Leu Leu Ala Ser
145 150 155 160 Val Ala Asp Ala Val Ala Ala Gly Val Asp Pro Ala Arg
Leu Val Leu 165 170 175 Asp Pro Gly Leu Gly Phe Ala Lys Thr Ala Gln
His Asn Trp Ala Ile 180 185 190 Leu His Ala Leu Pro Glu Leu Val Ala
Thr Gly Ile Pro Val Leu Val 195 200 205 Gly Ala Ser Arg Lys Arg Phe
Leu Gly Ala Leu Leu Ala Gly Pro Asp 210 215 220 Gly Val Met Arg Pro
Thr Asp Gly Arg Asp Thr Ala Thr Ala Val Ile 225 230 235 240 Ser Ala
Leu Ala Ala Leu His Gly Ala Trp Gly Val Arg Val His Asp 245 250 255
Val Arg Ala Ser Val Asp Ala Ile Lys Val Val Glu Ala Trp Met Gly 260
265 270 Ala Glu Arg Ile Glu Arg Asp Gly 275 280
172190DNAMycobacterium tuberculosis 17atgagtatta ccaggccgac
gggcagctat gccagacaga tgctggatcc gggcggctgg 60gtggaagccg atgaagacac
tttctatgac cgggcccagg aatatagcca ggttttgcaa 120agggtcaccg
atgtattgga cacctgccgc cagcagaaag gccacgtctt cgaaggcggc
180ctatggtccg gcggcgccgc caatgctgcc aacggcgccc tgggtgcaaa
catcaatcaa 240ttgatgacgc tgcaggatta tctcgccacg gtgattacct
ggcacaggca tattgccggg 300ttgattgagc aagctaaatc cgatatcggc
aataatgtgg atggcgctca acgggagatc 360gatatcctgg agaatgaccc
tagcctggat gctgatgagc gccataccgc catcaattca 420ttggtcacgg
cgacgcatgg ggccaatgtc agtctggtcg ccgagaccgc tgagcgggtg
480ctggaatcca agaattggaa acctccgaag aacgcactcg aggatttgct
tcagcagaag 540tcgccgccac ccccagacgt gcctaccctg gtcgtgccat
ccccgggcac accgggcaca 600ccgggaaccc cgatcacccc gggaaccccg
atcaccccgg gaaccccaat cacacccatc 660ccgggagcgc cggtaactcc
gatcacacca acgcccggca ctcccgtcac gccggtgacc 720ccgggcaagc
cggtcacccc ggtgaccccg gtcaaaccgg gcacaccagg cgagccaacc
780ccgatcacgc cggtcacccc cccggtcgcc ccggccacac cggcaacccc
ggccacgccc 840gttaccccag ctcccgctcc acacccgcag ccggctccgg
caccggcgcc atcgcctggg 900ccccagccgg ttacaccggc cactcccggt
ccgtctggtc cagcaacacc gggcacccca 960gggggcgagc cggcgccgca
cgtcaaaccc gcggcgttgg cggagcaacc tggtgtgccg 1020ggccagcatg
cgggcggggg gacgcagtcg gggcctgccc atgcggacga atccgccgcg
1080tcggtgacgc cggctgcggc gtccggtgtc ccgggcgcac gggcggcggc
cgccgcgccg 1140agcggtaccg ccgtgggagc gggcgcgcgt tcgagcgtgg
gtacggccgc ggcctcgggc 1200gcggggtcgc atgctgccac tgggcgggcg
ccggtggcta cctcggacaa ggcggcggca 1260ccgagcacgc gggcggcctc
ggcgcggacg gcacctcctg cccgcccgcc gtcgaccgat 1320cacatcgaca
aacccgatcg cagcgagtct gcagatgacg gtacgccggt gtcgatgatc
1380ccggtgtcgg cggctcgggc ggcacgcgac gccgccactg cagctgccag
cgcccgccag 1440cgtggccgcg gtgatgcgct gcggttggcg cgacgcatcg
cggcggcgct caacgcgtcc 1500gacaacaacg cgggcgacta cgggttcttc
tggatcaccg cggtgaccac cgacggttcc 1560atcgtcgtgg ccaacagcta
tgggctggcc tacatacccg acgggatgga attgccgaat 1620aaggtgtact
tggccagcgc ggatcacgca atcccggttg acgaaattgc acgctgtgcc
1680acctacccgg ttttggccgt gcaagcctgg gcggctttcc acgacatgac
gctgcgggcg 1740gtgatcggta ccgcggagca gttggccagt tcggatcccg
gtgtggccaa gattgtgctg 1800gagccagatg acattccgga gagcggcaaa
atgacgggcc ggtcgcggct ggaggtcgtc 1860gacccctcgg cggcggctca
gctggccgac actaccgatc agcgtttgct cgacttgttg 1920ccgccggcgc
cggtggatgt caatccaccg ggcgatgagc ggcacatgct gtggttcgag
1980ctgatgaagc ccatgaccag caccgctacc ggccgcgagg ccgctcatct
gcgggcgttc 2040cgggcctacg ctgcccactc acaggagatt gccctgcacc
aagcgcacac tgcgactgac 2100gcggccgtcc agcgtgtggc cgtcgcggac
tggctgtact ggcaatacgt caccgggttg 2160ctcgaccggg ccctggccgc
cgcatgctga 219018729PRTMycobacterium tuberculosis 18Met Ser Ile Thr
Arg Pro Thr Gly Ser Tyr Ala Arg Gln Met Leu Asp 1 5 10 15 Pro Gly
Gly Trp Val Glu Ala Asp Glu Asp Thr Phe Tyr Asp Arg Ala 20 25 30
Gln Glu Tyr Ser Gln Val Leu Gln Arg Val Thr Asp Val Leu Asp Thr 35
40 45 Cys Arg Gln Gln Lys Gly His Val Phe Glu Gly Gly Leu Trp Ser
Gly 50 55 60 Gly Ala Ala Asn Ala Ala Asn Gly Ala Leu Gly Ala Asn
Ile Asn Gln 65 70 75 80 Leu Met Thr Leu Gln Asp Tyr Leu Ala Thr Val
Ile Thr Trp His Arg 85 90 95 His Ile Ala Gly Leu Ile Glu Gln Ala
Lys Ser Asp Ile Gly Asn Asn 100 105 110 Val Asp Gly Ala Gln Arg Glu
Ile Asp Ile Leu Glu Asn Asp Pro Ser 115 120 125 Leu Asp Ala Asp Glu
Arg His Thr Ala Ile Asn Ser Leu Val Thr Ala 130 135 140 Thr His Gly
Ala Asn Val Ser Leu Val Ala Glu Thr Ala Glu Arg Val 145 150 155 160
Leu Glu Ser Lys Asn Trp Lys Pro Pro Lys Asn Ala Leu Glu Asp Leu 165
170 175 Leu Gln Gln Lys Ser Pro Pro Pro Pro Asp Val Pro Thr Leu Val
Val 180 185 190 Pro Ser Pro Gly Thr Pro Gly Thr Pro Gly Thr Pro Ile
Thr Pro Gly 195 200 205 Thr Pro Ile Thr Pro Gly Thr Pro Ile Thr Pro
Ile Pro Gly Ala Pro 210 215 220 Val Thr Pro Ile Thr Pro Thr Pro Gly
Thr Pro Val Thr Pro Val Thr 225 230 235 240 Pro Gly Lys Pro Val Thr
Pro Val Thr Pro Val Lys Pro Gly Thr Pro 245 250 255 Gly Glu Pro Thr
Pro Ile Thr Pro Val Thr Pro Pro Val Ala Pro Ala 260 265 270 Thr Pro
Ala Thr Pro Ala Thr Pro Val Thr Pro Ala Pro Ala Pro His 275 280 285
Pro Gln Pro Ala Pro Ala Pro Ala Pro Ser Pro Gly Pro Gln Pro Val 290
295 300 Thr Pro Ala Thr Pro Gly Pro Ser Gly Pro Ala Thr Pro Gly Thr
Pro 305 310 315 320 Gly Gly Glu Pro Ala Pro His Val Lys Pro Ala Ala
Leu Ala Glu Gln 325 330 335 Pro Gly Val Pro Gly Gln His Ala Gly Gly
Gly Thr Gln Ser Gly Pro 340 345 350 Ala His Ala Asp Glu Ser Ala Ala
Ser Val Thr Pro Ala Ala Ala Ser 355 360 365 Gly Val Pro Gly Ala Arg
Ala Ala Ala Ala Ala Pro Ser Gly Thr Ala 370 375 380 Val Gly Ala Gly
Ala Arg Ser Ser Val Gly Thr Ala Ala Ala Ser Gly 385 390 395 400 Ala
Gly Ser His Ala Ala Thr Gly Arg Ala Pro Val Ala Thr Ser Asp 405 410
415 Lys Ala Ala Ala Pro Ser Thr Arg Ala Ala Ser Ala Arg Thr Ala Pro
420 425 430 Pro Ala Arg Pro Pro Ser Thr Asp His Ile Asp Lys Pro Asp
Arg Ser 435 440 445 Glu Ser Ala Asp Asp Gly Thr Pro Val Ser Met Ile
Pro Val Ser Ala 450 455 460 Ala Arg Ala Ala Arg Asp Ala Ala Thr Ala
Ala Ala Ser Ala Arg Gln 465 470 475 480 Arg Gly Arg Gly Asp Ala Leu
Arg Leu Ala Arg Arg Ile Ala Ala Ala 485 490 495 Leu Asn Ala Ser Asp
Asn Asn Ala Gly Asp Tyr Gly Phe Phe Trp Ile 500 505 510 Thr Ala Val
Thr Thr Asp Gly Ser Ile Val Val Ala Asn Ser Tyr Gly 515 520 525 Leu
Ala Tyr Ile Pro Asp Gly Met Glu Leu Pro Asn Lys Val Tyr Leu 530 535
540 Ala Ser Ala Asp His Ala Ile Pro Val Asp Glu Ile Ala Arg Cys Ala
545 550 555 560 Thr Tyr Pro Val Leu Ala Val Gln Ala Trp Ala Ala Phe
His Asp Met 565 570 575 Thr Leu Arg Ala Val Ile Gly Thr Ala Glu Gln
Leu Ala Ser Ser Asp 580 585 590 Pro Gly Val Ala Lys Ile Val Leu Glu
Pro Asp Asp Ile Pro Glu Ser 595 600 605 Gly Lys Met Thr Gly Arg Ser
Arg Leu Glu Val Val Asp Pro Ser Ala 610 615 620 Ala Ala Gln Leu Ala
Asp Thr Thr Asp Gln Arg Leu Leu Asp Leu Leu 625 630 635 640 Pro Pro
Ala Pro Val Asp Val Asn Pro Pro Gly Asp Glu Arg His Met 645 650 655
Leu Trp Phe Glu Leu Met Lys Pro Met Thr Ser Thr Ala Thr Gly Arg 660
665 670 Glu Ala Ala His Leu Arg Ala Phe Arg Ala Tyr Ala Ala His Ser
Gln 675 680 685 Glu Ile Ala Leu His Gln Ala His Thr Ala Thr Asp Ala
Ala Val Gln 690 695 700
Arg Val Ala Val Ala Asp Trp Leu Tyr Trp Gln Tyr Val Thr Gly Leu 705
710 715 720 Leu Asp Arg Ala Leu Ala Ala Ala Cys 725
19338PRTMycobacterium tuberculosis 19Met Gln Leu Val Asp Arg Val
Arg Gly Ala Val Thr Gly Met Ser Arg 1 5 10 15 Arg Leu Val Val Gly
Ala Val Gly Ala Ala Leu Val Ser Gly Leu Val 20 25 30 Gly Ala Val
Gly Gly Thr Ala Thr Ala Gly Ala Phe Ser Arg Pro Gly 35 40 45 Leu
Pro Val Glu Tyr Leu Gln Val Pro Ser Pro Ser Met Gly Arg Asp 50 55
60 Ile Lys Val Gln Phe Gln Ser Gly Gly Ala Asn Ser Pro Ala Leu Tyr
65 70 75 80 Leu Leu Asp Gly Leu Arg Ala Gln Asp Asp Phe Ser Gly Trp
Asp Ile 85 90 95 Asn Thr Pro Ala Phe Glu Trp Tyr Asp Gln Ser Gly
Leu Ser Val Val 100 105 110 Met Pro Val Gly Gly Gln Ser Ser Phe Tyr
Ser Asp Trp Tyr Gln Pro 115 120 125 Ala Cys Gly Lys Ala Gly Cys Gln
Thr Tyr Lys Trp Glu Thr Phe Leu 130 135 140 Thr Ser Glu Leu Pro Gly
Trp Leu Gln Ala Asn Arg His Val Lys Pro 145 150 155 160 Thr Gly Ser
Ala Val Val Gly Leu Ser Met Ala Ala Ser Ser Ala Leu 165 170 175 Thr
Leu Ala Ile Tyr His Pro Gln Gln Phe Val Tyr Ala Gly Ala Met 180 185
190 Ser Gly Leu Leu Asp Pro Ser Gln Ala Met Gly Pro Thr Leu Ile Gly
195 200 205 Leu Ala Met Gly Asp Ala Gly Gly Tyr Lys Ala Ser Asp Met
Trp Gly 210 215 220 Pro Lys Glu Asp Pro Ala Trp Gln Arg Asn Asp Pro
Leu Leu Asn Val 225 230 235 240 Gly Lys Leu Ile Ala Asn Asn Thr Arg
Val Trp Val Tyr Cys Gly Asn 245 250 255 Gly Lys Pro Ser Asp Leu Gly
Gly Asn Asn Leu Pro Ala Lys Phe Leu 260 265 270 Glu Gly Phe Val Arg
Thr Ser Asn Ile Lys Phe Gln Asp Ala Tyr Asn 275 280 285 Ala Gly Gly
Gly His Asn Gly Val Phe Asp Phe Pro Asp Ser Gly Thr 290 295 300 His
Ser Trp Glu Tyr Trp Gly Ala Gln Leu Asn Ala Met Lys Pro Asp 305 310
315 320 Leu Gln Arg Ala Leu Gly Ala Thr Pro Asn Thr Gly Pro Ala Pro
Gln 325 330 335 Gly Ala 20325PRTMycobacterium tuberculosis 20Met
Thr Asp Val Ser Arg Lys Ile Arg Ala Trp Gly Arg Arg Leu Met 1 5 10
15 Ile Gly Thr Ala Ala Ala Val Val Leu Pro Gly Leu Val Gly Leu Ala
20 25 30 Gly Gly Ala Ala Thr Ala Gly Ala Phe Ser Arg Pro Gly Leu
Pro Val 35 40 45 Glu Tyr Leu Gln Val Pro Ser Pro Ser Met Gly Arg
Asp Ile Lys Val 50 55 60 Gln Phe Gln Ser Gly Gly Asn Asn Ser Pro
Ala Val Tyr Leu Leu Asp 65 70 75 80 Gly Leu Arg Ala Gln Asp Asp Tyr
Asn Gly Trp Asp Ile Asn Thr Pro 85 90 95 Ala Phe Glu Trp Tyr Tyr
Gln Ser Gly Leu Ser Ile Val Met Pro Val 100 105 110 Gly Gly Gln Ser
Ser Phe Tyr Ser Asp Trp Tyr Ser Pro Ala Cys Gly 115 120 125 Lys Ala
Gly Cys Gln Thr Tyr Lys Trp Glu Thr Phe Leu Thr Ser Glu 130 135 140
Leu Pro Gln Trp Leu Ser Ala Asn Arg Ala Val Lys Pro Thr Gly Ser 145
150 155 160 Ala Ala Ile Gly Leu Ser Met Ala Gly Ser Ser Ala Met Ile
Leu Ala 165 170 175 Ala Tyr His Pro Gln Gln Phe Ile Tyr Ala Gly Ser
Leu Ser Ala Leu 180 185 190 Leu Asp Pro Ser Gln Gly Met Gly Pro Ser
Leu Ile Gly Leu Ala Met 195 200 205 Gly Asp Ala Gly Gly Tyr Lys Ala
Ala Asp Met Trp Gly Pro Ser Ser 210 215 220 Asp Pro Ala Trp Glu Arg
Asn Asp Pro Thr Gln Gln Ile Pro Lys Leu 225 230 235 240 Val Ala Asn
Asn Thr Arg Leu Trp Val Tyr Cys Gly Asn Gly Thr Pro 245 250 255 Asn
Glu Leu Gly Gly Ala Asn Ile Pro Ala Glu Phe Leu Glu Asn Phe 260 265
270 Val Arg Ser Ser Asn Leu Lys Phe Gln Asp Ala Tyr Asn Ala Ala Gly
275 280 285 Gly His Asn Ala Val Phe Asn Phe Pro Pro Asn Gly Thr His
Ser Trp 290 295 300 Glu Tyr Trp Gly Ala Gln Leu Asn Ala Met Lys Gly
Asp Leu Gln Ser 305 310 315 320 Ser Leu Gly Ala Gly 325
2195PRTMycobacterium tuberculosis 21Met Thr Glu Gln Gln Trp Asn Phe
Ala Gly Ile Glu Ala Ala Ala Ser 1 5 10 15 Ala Ile Gln Gly Asn Val
Thr Ser Ile His Ser Leu Leu Asp Glu Gly 20 25 30 Lys Gln Ser Leu
Thr Lys Leu Ala Ala Ala Trp Gly Gly Ser Gly Ser 35 40 45 Glu Ala
Tyr Gln Gly Val Gln Gln Lys Trp Asp Ala Thr Ala Thr Glu 50 55 60
Leu Asn Asn Ala Leu Gln Asn Leu Ala Arg Thr Ile Ser Glu Ala Gly 65
70 75 80 Gln Ala Met Ala Ser Thr Glu Gly Asn Val Thr Gly Met Phe
Ala 85 90 95 2296PRTMycobacterium tuberculosis 22Met Ser Gln Ile
Met Tyr Asn Tyr Pro Ala Met Leu Gly His Ala Gly 1 5 10 15 Asp Met
Ala Gly Tyr Ala Gly Thr Leu Gln Ser Leu Gly Ala Glu Ile 20 25 30
Ala Val Glu Gln Ala Ala Leu Gln Ser Ala Trp Gln Gly Asp Thr Gly 35
40 45 Ile Thr Tyr Gln Ala Trp Gln Ala Gln Trp Asn Gln Ala Met Glu
Asp 50 55 60 Leu Val Arg Ala Tyr His Ala Met Ser Ser Thr His Glu
Ala Asn Thr 65 70 75 80 Met Ala Met Met Ala Arg Asp Thr Ala Glu Ala
Ala Lys Trp Gly Gly 85 90 95 23355PRTMycobacterium tuberculosis
23Met Ser Asn Ser Arg Arg Arg Ser Leu Arg Trp Ser Trp Leu Leu Ser 1
5 10 15 Val Leu Ala Ala Val Gly Leu Gly Leu Ala Thr Ala Pro Ala Gln
Ala 20 25 30 Ala Pro Pro Ala Leu Ser Gln Asp Arg Phe Ala Asp Phe
Pro Ala Leu 35 40 45 Pro Leu Asp Pro Ser Ala Met Val Ala Gln Val
Gly Pro Gln Val Val 50 55 60 Asn Ile Asn Thr Lys Leu Gly Tyr Asn
Asn Ala Val Gly Ala Gly Thr 65 70 75 80 Gly Ile Val Ile Asp Pro Asn
Gly Val Val Leu Thr Asn Asn His Val 85 90 95 Ile Ala Gly Ala Thr
Asp Ile Asn Ala Phe Ser Val Gly Ser Gly Gln 100 105 110 Thr Tyr Gly
Val Asp Val Val Gly Tyr Asp Arg Thr Gln Asp Val Ala 115 120 125 Val
Leu Gln Leu Arg Gly Ala Gly Gly Leu Pro Ser Ala Ala Ile Gly 130 135
140 Gly Gly Val Ala Val Gly Glu Pro Val Val Ala Met Gly Asn Ser Gly
145 150 155 160 Gly Gln Gly Gly Thr Pro Arg Ala Val Pro Gly Arg Val
Val Ala Leu 165 170 175 Gly Gln Thr Val Gln Ala Ser Asp Ser Leu Thr
Gly Ala Glu Glu Thr 180 185 190 Leu Asn Gly Leu Ile Gln Phe Asp Ala
Ala Ile Gln Pro Gly Asp Ser 195 200 205 Gly Gly Pro Val Val Asn Gly
Leu Gly Gln Val Val Gly Met Asn Thr 210 215 220 Ala Ala Ser Asp Asn
Phe Gln Leu Ser Gln Gly Gly Gln Gly Phe Ala 225 230 235 240 Ile Pro
Ile Gly Gln Ala Met Ala Ile Ala Gly Gln Ile Arg Ser Gly 245 250 255
Gly Gly Ser Pro Thr Val His Ile Gly Pro Thr Ala Phe Leu Gly Leu 260
265 270 Gly Val Val Asp Asn Asn Gly Asn Gly Ala Arg Val Gln Arg Val
Val 275 280 285 Gly Ser Ala Pro Ala Ala Ser Leu Gly Ile Ser Thr Gly
Asp Val Ile 290 295 300 Thr Ala Val Asp Gly Ala Pro Ile Asn Ser Ala
Thr Ala Met Ala Asp 305 310 315 320 Ala Leu Asn Gly His His Pro Gly
Asp Val Ile Ser Val Thr Trp Gln 325 330 335 Thr Lys Ser Gly Gly Thr
Arg Thr Gly Asn Val Thr Leu Ala Glu Gly 340 345 350 Pro Pro Ala 355
24391PRTMycobacterium tuberculosis 24Met Val Asp Phe Gly Ala Leu
Pro Pro Glu Ile Asn Ser Ala Arg Met 1 5 10 15 Tyr Ala Gly Pro Gly
Ser Ala Ser Leu Val Ala Ala Ala Gln Met Trp 20 25 30 Asp Ser Val
Ala Ser Asp Leu Phe Ser Ala Ala Ser Ala Phe Gln Ser 35 40 45 Val
Val Trp Gly Leu Thr Val Gly Ser Trp Ile Gly Ser Ser Ala Gly 50 55
60 Leu Met Val Ala Ala Ala Ser Pro Tyr Val Ala Trp Met Ser Val Thr
65 70 75 80 Ala Gly Gln Ala Glu Leu Thr Ala Ala Gln Val Arg Val Ala
Ala Ala 85 90 95 Ala Tyr Glu Thr Ala Tyr Gly Leu Thr Val Pro Pro
Pro Val Ile Ala 100 105 110 Glu Asn Arg Ala Glu Leu Met Ile Leu Ile
Ala Thr Asn Leu Leu Gly 115 120 125 Gln Asn Thr Pro Ala Ile Ala Val
Asn Glu Ala Glu Tyr Gly Glu Met 130 135 140 Trp Ala Gln Asp Ala Ala
Ala Met Phe Gly Tyr Ala Ala Ala Thr Ala 145 150 155 160 Thr Ala Thr
Ala Thr Leu Leu Pro Phe Glu Glu Ala Pro Glu Met Thr 165 170 175 Ser
Ala Gly Gly Leu Leu Glu Gln Ala Ala Ala Val Glu Glu Ala Ser 180 185
190 Asp Thr Ala Ala Ala Asn Gln Leu Met Asn Asn Val Pro Gln Ala Leu
195 200 205 Gln Gln Leu Ala Gln Pro Thr Gln Gly Thr Thr Pro Ser Ser
Lys Leu 210 215 220 Gly Gly Leu Trp Lys Thr Val Ser Pro His Arg Ser
Pro Ile Ser Asn 225 230 235 240 Met Val Ser Met Ala Asn Asn His Met
Ser Met Thr Asn Ser Gly Val 245 250 255 Ser Met Thr Asn Thr Leu Ser
Ser Met Leu Lys Gly Phe Ala Pro Ala 260 265 270 Ala Ala Ala Gln Ala
Val Gln Thr Ala Ala Gln Asn Gly Val Arg Ala 275 280 285 Met Ser Ser
Leu Gly Ser Ser Leu Gly Ser Ser Gly Leu Gly Gly Gly 290 295 300 Val
Ala Ala Asn Leu Gly Arg Ala Ala Ser Val Gly Ser Leu Ser Val 305 310
315 320 Pro Gln Ala Trp Ala Ala Ala Asn Gln Ala Val Thr Pro Ala Ala
Arg 325 330 335 Ala Leu Pro Leu Thr Ser Leu Thr Ser Ala Ala Glu Arg
Gly Pro Gly 340 345 350 Gln Met Leu Gly Gly Leu Pro Val Gly Gln Met
Gly Ala Arg Ala Gly 355 360 365 Gly Gly Leu Ser Gly Val Leu Arg Val
Pro Pro Arg Pro Tyr Val Met 370 375 380 Pro His Ser Pro Ala Ala Gly
385 390 25236PRTMycobacterium tuberculosis 25Met Arg Thr Pro Arg
Arg His Cys Arg Arg Ile Ala Val Leu Ala Ala 1 5 10 15 Val Ser Ile
Ala Ala Thr Val Val Ala Gly Cys Ser Ser Gly Ser Lys 20 25 30 Pro
Ser Gly Gly Pro Leu Pro Asp Ala Lys Pro Leu Val Glu Glu Ala 35 40
45 Thr Ala Gln Thr Lys Ala Leu Lys Ser Ala His Met Val Leu Thr Val
50 55 60 Asn Gly Lys Ile Pro Gly Leu Ser Leu Lys Thr Leu Ser Gly
Asp Leu 65 70 75 80 Thr Thr Asn Pro Thr Ala Ala Thr Gly Asn Val Lys
Leu Thr Leu Gly 85 90 95 Gly Ser Asp Ile Asp Ala Asp Phe Val Val
Phe Asp Gly Ile Leu Tyr 100 105 110 Ala Thr Leu Thr Pro Asn Gln Trp
Ser Asp Phe Gly Pro Ala Ala Asp 115 120 125 Ile Tyr Asp Pro Ala Gln
Val Leu Asn Pro Asp Thr Gly Leu Ala Asn 130 135 140 Val Leu Ala Asn
Phe Ala Asp Ala Lys Ala Glu Gly Arg Asp Thr Ile 145 150 155 160 Asn
Gly Gln Asn Thr Ile Arg Ile Ser Gly Lys Val Ser Ala Gln Ala 165 170
175 Val Asn Gln Ile Ala Pro Pro Phe Asn Ala Thr Gln Pro Val Pro Ala
180 185 190 Thr Val Trp Ile Gln Glu Thr Gly Asp His Gln Leu Ala Gln
Ala Gln 195 200 205 Leu Asp Arg Gly Ser Gly Asn Ser Val Gln Met Thr
Leu Ser Lys Trp 210 215 220 Gly Glu Lys Val Gln Val Thr Lys Pro Pro
Val Ser 225 230 235 26540PRTMycobacterium tuberculosis 26Met Ala
Lys Thr Ile Ala Tyr Asp Glu Glu Ala Arg Arg Gly Leu Glu 1 5 10 15
Arg Gly Leu Asn Ala Leu Ala Asp Ala Val Lys Val Thr Leu Gly Pro 20
25 30 Lys Gly Arg Asn Val Val Leu Glu Lys Lys Trp Gly Ala Pro Thr
Ile 35 40 45 Thr Asn Asp Gly Val Ser Ile Ala Lys Glu Ile Glu Leu
Glu Asp Pro 50 55 60 Tyr Glu Lys Ile Gly Ala Glu Leu Val Lys Glu
Val Ala Lys Lys Thr 65 70 75 80 Asp Asp Val Ala Gly Asp Gly Thr Thr
Thr Ala Thr Val Leu Ala Gln 85 90 95 Ala Leu Val Arg Glu Gly Leu
Arg Asn Val Ala Ala Gly Ala Asn Pro 100 105 110 Leu Gly Leu Lys Arg
Gly Ile Glu Lys Ala Val Glu Lys Val Thr Glu 115 120 125 Thr Leu Leu
Lys Gly Ala Lys Glu Val Glu Thr Lys Glu Gln Ile Ala 130 135 140 Ala
Thr Ala Ala Ile Ser Ala Gly Asp Gln Ser Ile Gly Asp Leu Ile 145 150
155 160 Ala Glu Ala Met Asp Lys Val Gly Asn Glu Gly Val Ile Thr Val
Glu 165 170 175 Glu Ser Asn Thr Phe Gly Leu Gln Leu Glu Leu Thr Glu
Gly Met Arg 180 185 190 Phe Asp Lys Gly Tyr Ile Ser Gly Tyr Phe Val
Thr Asp Pro Glu Arg 195 200 205 Gln Glu Ala Val Leu Glu Asp Pro Tyr
Ile Leu Leu Val Ser Ser Lys 210 215 220 Val Ser Thr Val Lys Asp Leu
Leu Pro Leu Leu Glu Lys Val Ile Gly 225 230 235 240 Ala Gly Lys Pro
Leu Leu Ile Ile Ala Glu Asp Val Glu Gly Glu Ala 245 250 255 Leu Ser
Thr Leu Val Val Asn Lys Ile Arg Gly Thr Phe Lys Ser Val 260 265 270
Ala Val Lys Ala Pro Gly Phe Gly Asp Arg Arg Lys Ala Met Leu Gln 275
280 285 Asp Met Ala Ile Leu Thr Gly Gly Gln Val Ile Ser Glu Glu Val
Gly 290 295 300 Leu Thr Leu Glu Asn Ala Asp Leu Ser Leu Leu Gly Lys
Ala Arg Lys 305 310 315 320 Val Val Val Thr Lys Asp Glu Thr Thr Ile
Val Glu Gly Ala Gly Asp 325 330 335 Thr Asp Ala Ile Ala Gly Arg Val
Ala Gln Ile Arg Gln Glu Ile Glu 340 345 350 Asn Ser Asp Ser Asp Tyr
Asp Arg Glu Lys Leu Gln Glu Arg Leu Ala 355 360 365 Lys Leu Ala Gly
Gly Val Ala Val Ile Lys Ala Gly Ala Ala Thr Glu 370 375 380 Val Glu
Leu Lys Glu Arg Lys His Arg Ile Glu Asp Ala Val Arg Asn 385 390 395
400 Ala Lys Ala Ala
Val Glu Glu Gly Ile Val Ala Gly Gly Gly Val Thr 405 410 415 Leu Leu
Gln Ala Ala Pro Thr Leu Asp Glu Leu Lys Leu Glu Gly Asp 420 425 430
Glu Ala Thr Gly Ala Asn Ile Val Lys Val Ala Leu Glu Ala Pro Leu 435
440 445 Lys Gln Ile Ala Phe Asn Ser Gly Leu Glu Pro Gly Val Val Ala
Glu 450 455 460 Lys Val Arg Asn Leu Pro Ala Gly His Gly Leu Asn Ala
Gln Thr Gly 465 470 475 480 Val Tyr Glu Asp Leu Leu Ala Ala Gly Val
Ala Asp Pro Val Lys Val 485 490 495 Thr Arg Ser Ala Leu Gln Asn Ala
Ala Ser Ile Ala Gly Leu Phe Leu 500 505 510 Thr Thr Glu Ala Val Val
Ala Asp Lys Pro Glu Lys Glu Lys Ala Ser 515 520 525 Val Pro Gly Gly
Gly Asp Met Gly Gly Met Asp Phe 530 535 540 27199PRTMycobacterium
tuberculosis 27Met Ala Glu Asn Ser Asn Ile Asp Asp Ile Lys Ala Pro
Leu Leu Ala 1 5 10 15 Ala Leu Gly Ala Ala Asp Leu Ala Leu Ala Thr
Val Asn Glu Leu Ile 20 25 30 Thr Asn Leu Arg Glu Arg Ala Glu Glu
Thr Arg Thr Asp Thr Arg Ser 35 40 45 Arg Val Glu Glu Ser Arg Ala
Arg Leu Thr Lys Leu Gln Glu Asp Leu 50 55 60 Pro Glu Gln Leu Thr
Glu Leu Arg Glu Lys Phe Thr Ala Glu Glu Leu 65 70 75 80 Arg Lys Ala
Ala Glu Gly Tyr Leu Glu Ala Ala Thr Ser Arg Tyr Asn 85 90 95 Glu
Leu Val Glu Arg Gly Glu Ala Ala Leu Glu Arg Leu Arg Ser Gln 100 105
110 Gln Ser Phe Glu Glu Val Ser Ala Arg Ala Glu Gly Tyr Val Asp Gln
115 120 125 Ala Val Glu Leu Thr Gln Glu Ala Leu Gly Thr Val Ala Ser
Gln Thr 130 135 140 Arg Ala Val Gly Glu Arg Ala Ala Lys Leu Val Gly
Ile Glu Leu Pro 145 150 155 160 Lys Lys Ala Ala Pro Ala Lys Lys Ala
Ala Pro Ala Lys Lys Ala Ala 165 170 175 Pro Ala Lys Lys Ala Ala Ala
Lys Lys Ala Pro Ala Lys Lys Ala Ala 180 185 190 Ala Lys Lys Val Thr
Gln Lys 195 28375PRTMycobacterium tuberculosis 28Val Thr Gln Thr
Gly Lys Arg Gln Arg Arg Lys Phe Gly Arg Ile Arg 1 5 10 15 Gln Phe
Asn Ser Gly Arg Trp Gln Ala Ser Tyr Thr Gly Pro Asp Gly 20 25 30
Arg Val Tyr Ile Ala Pro Lys Thr Phe Asn Ala Lys Ile Asp Ala Glu 35
40 45 Ala Trp Leu Thr Asp Arg Arg Arg Glu Ile Asp Arg Gln Leu Trp
Ser 50 55 60 Pro Ala Ser Gly Gln Glu Asp Arg Pro Gly Ala Pro Phe
Gly Glu Tyr 65 70 75 80 Ala Glu Gly Trp Leu Lys Gln Arg Gly Ile Lys
Asp Arg Thr Arg Ala 85 90 95 His Tyr Arg Lys Leu Leu Asp Asn His
Ile Leu Ala Thr Phe Ala Asp 100 105 110 Thr Asp Leu Arg Asp Ile Thr
Pro Ala Ala Val Arg Arg Trp Tyr Ala 115 120 125 Thr Thr Ala Val Gly
Thr Pro Thr Met Arg Ala His Ser Tyr Ser Leu 130 135 140 Leu Arg Ala
Ile Met Gln Thr Ala Leu Ala Asp Asp Leu Ile Asp Ser 145 150 155 160
Asn Pro Cys Arg Ile Ser Gly Ala Ser Thr Ala Arg Arg Val His Lys 165
170 175 Ile Arg Pro Ala Thr Leu Asp Glu Leu Glu Thr Ile Thr Lys Ala
Met 180 185 190 Pro Asp Pro Tyr Gln Ala Phe Val Leu Met Ala Ala Trp
Leu Ala Met 195 200 205 Arg Tyr Gly Glu Leu Thr Glu Leu Arg Arg Lys
Asp Ile Asp Leu His 210 215 220 Gly Glu Val Ala Arg Val Arg Arg Ala
Val Val Arg Val Gly Glu Gly 225 230 235 240 Phe Lys Val Thr Thr Pro
Lys Ser Asp Ala Gly Val Arg Asp Ile Ser 245 250 255 Ile Pro Pro His
Leu Ile Pro Ala Ile Glu Asp His Leu His Lys His 260 265 270 Val Asn
Pro Gly Arg Glu Ser Leu Leu Phe Pro Ser Val Asn Asp Pro 275 280 285
Asn Arg His Leu Ala Pro Ser Ala Leu Tyr Arg Met Phe Tyr Lys Ala 290
295 300 Arg Lys Ala Ala Gly Arg Pro Asp Leu Arg Val His Asp Leu Arg
His 305 310 315 320 Ser Gly Ala Val Leu Ala Ala Ser Thr Gly Ala Thr
Leu Ala Glu Leu 325 330 335 Met Gln Arg Leu Gly His Ser Thr Ala Gly
Ala Ala Leu Arg Tyr Gln 340 345 350 His Ala Ala Lys Gly Arg Asp Arg
Glu Ile Ala Ala Leu Leu Ser Lys 355 360 365 Leu Ala Glu Asn Gln Glu
Met 370 375 2975PRTMycobacterium tuberculosis 29Val Ile Ala Gly Val
Asp Gln Ala Leu Ala Ala Thr Gly Gln Ala Ser 1 5 10 15 Gln Arg Ala
Ala Gly Ala Ser Gly Gly Val Thr Val Gly Val Gly Val 20 25 30 Gly
Thr Glu Gln Arg Asn Leu Ser Val Val Ala Pro Ser Gln Phe Thr 35 40
45 Phe Ser Ser Arg Ser Pro Asp Phe Val Asp Glu Thr Ala Gly Gln Ser
50 55 60 Trp Cys Ala Ile Leu Gly Leu Asn Gln Phe His 65 70 75
30144PRTMycobacterium tuberculosis 30Met Ala Thr Thr Leu Pro Val
Gln Arg His Pro Arg Ser Leu Phe Pro 1 5 10 15 Glu Phe Ser Glu Leu
Phe Ala Ala Phe Pro Ser Phe Ala Gly Leu Arg 20 25 30 Pro Thr Phe
Asp Thr Arg Leu Met Arg Leu Glu Asp Glu Met Lys Glu 35 40 45 Gly
Arg Tyr Glu Val Arg Ala Glu Leu Pro Gly Val Asp Pro Asp Lys 50 55
60 Asp Val Asp Ile Met Val Arg Asp Gly Gln Leu Thr Ile Lys Ala Glu
65 70 75 80 Arg Thr Glu Gln Lys Asp Phe Asp Gly Arg Ser Glu Phe Ala
Tyr Gly 85 90 95 Ser Phe Val Arg Thr Val Ser Leu Pro Val Gly Ala
Asp Glu Asp Asp 100 105 110 Ile Lys Ala Thr Tyr Asp Lys Gly Ile Leu
Thr Val Ser Val Ala Val 115 120 125 Ser Glu Gly Lys Pro Thr Glu Lys
His Ile Gln Ile Arg Ser Thr Asn 130 135 140 31407PRTMycobacterium
tuberculosis 31Met Ser Gly Arg His Arg Lys Pro Thr Thr Ser Asn Val
Ser Val Ala 1 5 10 15 Lys Ile Ala Phe Thr Gly Ala Val Leu Gly Gly
Gly Gly Ile Ala Met 20 25 30 Ala Ala Gln Ala Thr Ala Ala Thr Asp
Gly Glu Trp Asp Gln Val Ala 35 40 45 Arg Cys Glu Ser Gly Gly Asn
Trp Ser Ile Asn Thr Gly Asn Gly Tyr 50 55 60 Leu Gly Gly Leu Gln
Phe Thr Gln Ser Thr Trp Ala Ala His Gly Gly 65 70 75 80 Gly Glu Phe
Ala Pro Ser Ala Gln Leu Ala Ser Arg Glu Gln Gln Ile 85 90 95 Ala
Val Gly Glu Arg Val Leu Ala Thr Gln Gly Arg Gly Ala Trp Pro 100 105
110 Val Cys Gly Arg Gly Leu Ser Asn Ala Thr Pro Arg Glu Val Leu Pro
115 120 125 Ala Ser Ala Ala Met Asp Ala Pro Leu Asp Ala Ala Ala Val
Asn Gly 130 135 140 Glu Pro Ala Pro Leu Ala Pro Pro Pro Ala Asp Pro
Ala Pro Pro Val 145 150 155 160 Glu Leu Ala Ala Asn Asp Leu Pro Ala
Pro Leu Gly Glu Pro Leu Pro 165 170 175 Ala Ala Pro Ala Asp Pro Ala
Pro Pro Ala Asp Leu Ala Pro Pro Ala 180 185 190 Pro Ala Asp Val Ala
Pro Pro Val Glu Leu Ala Val Asn Asp Leu Pro 195 200 205 Ala Pro Leu
Gly Glu Pro Leu Pro Ala Ala Pro Ala Asp Pro Ala Pro 210 215 220 Pro
Ala Asp Leu Ala Pro Pro Ala Pro Ala Asp Leu Ala Pro Pro Ala 225 230
235 240 Pro Ala Asp Leu Ala Pro Pro Ala Pro Ala Asp Leu Ala Pro Pro
Val 245 250 255 Glu Leu Ala Val Asn Asp Leu Pro Ala Pro Leu Gly Glu
Pro Leu Pro 260 265 270 Ala Ala Pro Ala Glu Leu Ala Pro Pro Ala Asp
Leu Ala Pro Ala Ser 275 280 285 Ala Asp Leu Ala Pro Pro Ala Pro Ala
Asp Leu Ala Pro Pro Ala Pro 290 295 300 Ala Glu Leu Ala Pro Pro Ala
Pro Ala Asp Leu Ala Pro Pro Ala Ala 305 310 315 320 Val Asn Glu Gln
Thr Ala Pro Gly Asp Gln Pro Ala Thr Ala Pro Gly 325 330 335 Gly Pro
Val Gly Leu Ala Thr Asp Leu Glu Leu Pro Glu Pro Asp Pro 340 345 350
Gln Pro Ala Asp Ala Pro Pro Pro Gly Asp Val Thr Glu Ala Pro Ala 355
360 365 Glu Thr Pro Gln Val Ser Asn Ile Ala Tyr Thr Lys Lys Leu Trp
Gln 370 375 380 Ala Ile Arg Ala Gln Asp Val Cys Gly Asn Asp Ala Leu
Asp Ser Leu 385 390 395 400 Ala Gln Pro Tyr Val Ile Gly 405
32362PRTMycobacterium tuberculosis 32Met Leu Arg Leu Val Val Gly
Ala Leu Leu Leu Val Leu Ala Phe Ala 1 5 10 15 Gly Gly Tyr Ala Val
Ala Ala Cys Lys Thr Val Thr Leu Thr Val Asp 20 25 30 Gly Thr Ala
Met Arg Val Thr Thr Met Lys Ser Arg Val Ile Asp Ile 35 40 45 Val
Glu Glu Asn Gly Phe Ser Val Asp Asp Arg Asp Asp Leu Tyr Pro 50 55
60 Ala Ala Gly Val Gln Val His Asp Ala Asp Thr Ile Val Leu Arg Arg
65 70 75 80 Ser Arg Pro Leu Gln Ile Ser Leu Asp Gly His Asp Ala Lys
Gln Val 85 90 95 Trp Thr Thr Ala Ser Thr Val Asp Glu Ala Leu Ala
Gln Leu Ala Met 100 105 110 Thr Asp Thr Ala Pro Ala Ala Ala Ser Arg
Ala Ser Arg Val Pro Leu 115 120 125 Ser Gly Met Ala Leu Pro Val Val
Ser Ala Lys Thr Val Gln Leu Asn 130 135 140 Asp Gly Gly Leu Val Arg
Thr Val His Leu Pro Ala Pro Asn Val Ala 145 150 155 160 Gly Leu Leu
Ser Ala Ala Gly Val Pro Leu Leu Gln Ser Asp His Val 165 170 175 Val
Pro Ala Ala Thr Ala Pro Ile Val Glu Gly Met Gln Ile Gln Val 180 185
190 Thr Arg Asn Arg Ile Lys Lys Val Thr Glu Arg Leu Pro Leu Pro Pro
195 200 205 Asn Ala Arg Arg Val Glu Asp Pro Glu Met Asn Met Ser Arg
Glu Val 210 215 220 Val Glu Asp Pro Gly Val Pro Gly Thr Gln Asp Val
Thr Phe Ala Val 225 230 235 240 Ala Glu Val Asn Gly Val Glu Thr Gly
Arg Leu Pro Val Ala Asn Val 245 250 255 Val Val Thr Pro Ala His Glu
Ala Val Val Arg Val Gly Thr Lys Pro 260 265 270 Gly Thr Glu Val Pro
Pro Val Ile Asp Gly Ser Ile Trp Asp Ala Ile 275 280 285 Ala Gly Cys
Glu Ala Gly Gly Asn Trp Ala Ile Asn Thr Gly Asn Gly 290 295 300 Tyr
Tyr Gly Gly Val Gln Phe Asp Gln Gly Thr Trp Glu Ala Asn Gly 305 310
315 320 Gly Leu Arg Tyr Ala Pro Arg Ala Asp Leu Ala Thr Arg Glu Glu
Gln 325 330 335 Ile Ala Val Ala Glu Val Thr Arg Leu Arg Gln Gly Trp
Gly Ala Trp 340 345 350 Pro Val Cys Ala Ala Arg Ala Gly Ala Arg 355
360 33176PRTMycobacterium tuberculosis 33Val His Pro Leu Pro Ala
Asp His Gly Arg Ser Arg Cys Asn Arg His 1 5 10 15 Pro Ile Ser Pro
Leu Ser Leu Ile Gly Asn Ala Ser Ala Thr Ser Gly 20 25 30 Asp Met
Ser Ser Met Thr Arg Ile Ala Lys Pro Leu Ile Lys Ser Ala 35 40 45
Met Ala Ala Gly Leu Val Thr Ala Ser Met Ser Leu Ser Thr Ala Val 50
55 60 Ala His Ala Gly Pro Ser Pro Asn Trp Asp Ala Val Ala Gln Cys
Glu 65 70 75 80 Ser Gly Gly Asn Trp Ala Ala Asn Thr Gly Asn Gly Lys
Tyr Gly Gly 85 90 95 Leu Gln Phe Lys Pro Ala Thr Trp Ala Ala Phe
Gly Gly Val Gly Asn 100 105 110 Pro Ala Ala Ala Ser Arg Glu Gln Gln
Ile Ala Val Ala Asn Arg Val 115 120 125 Leu Ala Glu Gln Gly Leu Asp
Ala Trp Pro Thr Cys Gly Ala Ala Ser 130 135 140 Gly Leu Pro Ile Ala
Leu Trp Ser Lys Pro Ala Gln Gly Ile Lys Gln 145 150 155 160 Ile Ile
Asn Glu Ile Ile Trp Ala Gly Ile Gln Ala Ser Ile Pro Arg 165 170 175
34154PRTMycobacterium tuberculosis 34Met Thr Pro Gly Leu Leu Thr
Thr Ala Gly Ala Gly Arg Pro Arg Asp 1 5 10 15 Arg Cys Ala Arg Ile
Val Cys Thr Val Phe Ile Glu Thr Ala Val Val 20 25 30 Ala Thr Met
Phe Val Ala Leu Leu Gly Leu Ser Thr Ile Ser Ser Lys 35 40 45 Ala
Asp Asp Ile Asp Trp Asp Ala Ile Ala Gln Cys Glu Ser Gly Gly 50 55
60 Asn Trp Ala Ala Asn Thr Gly Asn Gly Leu Tyr Gly Gly Leu Gln Ile
65 70 75 80 Ser Gln Ala Thr Trp Asp Ser Asn Gly Gly Val Gly Ser Pro
Ala Ala 85 90 95 Ala Ser Pro Gln Gln Gln Ile Glu Val Ala Asp Asn
Ile Met Lys Thr 100 105 110 Gln Gly Pro Gly Ala Trp Pro Lys Cys Ser
Ser Cys Ser Gln Gly Asp 115 120 125 Ala Pro Leu Gly Ser Leu Thr His
Ile Leu Thr Phe Leu Ala Ala Glu 130 135 140 Thr Gly Gly Cys Ser Gly
Ser Arg Asp Asp 145 150 35172PRTMycobacterium tuberculosis 35Leu
Lys Asn Ala Arg Thr Thr Leu Ile Ala Ala Ala Ile Ala Gly Thr 1 5 10
15 Leu Val Thr Thr Ser Pro Ala Gly Ile Ala Asn Ala Asp Asp Ala Gly
20 25 30 Leu Asp Pro Asn Ala Ala Ala Gly Pro Asp Ala Val Gly Phe
Asp Pro 35 40 45 Asn Leu Pro Pro Ala Pro Asp Ala Ala Pro Val Asp
Thr Pro Pro Ala 50 55 60 Pro Glu Asp Ala Gly Phe Asp Pro Asn Leu
Pro Pro Pro Leu Ala Pro 65 70 75 80 Asp Phe Leu Ser Pro Pro Ala Glu
Glu Ala Pro Pro Val Pro Val Ala 85 90 95 Tyr Ser Val Asn Trp Asp
Ala Ile Ala Gln Cys Glu Ser Gly Gly Asn 100 105 110 Trp Ser Ile Asn
Thr Gly Asn Gly Tyr Tyr Gly Gly Leu Arg Phe Thr 115 120 125 Ala Gly
Thr Trp Arg Ala Asn Gly Gly Ser Gly Ser Ala Ala Asn Ala 130 135 140
Ser Arg Glu Glu Gln Ile Arg Val Ala Glu Asn Val Leu Arg Ser Gln 145
150 155 160 Gly Ile Arg Ala Trp Pro Val Cys Gly Arg Arg Gly 165 170
36210PRTMycobacterium tuberculosis 36Met Ile Ala Thr Thr Arg Asp
Arg Glu Gly Ala Thr Met Ile Thr Phe 1 5 10 15 Arg Leu Arg Leu Pro
Cys Arg Thr Ile Leu Arg Val Phe Ser Arg Asn 20 25 30 Pro Leu Val
Arg Gly Thr Asp Arg Leu Glu Ala Val Val Met Leu Leu 35 40 45 Ala
Val Thr Val Ser Leu Leu Thr Ile
Pro Phe Ala Ala Ala Ala Gly 50 55 60 Thr Ala Val Gln Asp Ser Arg
Ser His Val Tyr Ala His Gln Ala Gln 65 70 75 80 Thr Arg His Pro Ala
Thr Ala Thr Val Ile Asp His Glu Gly Val Ile 85 90 95 Asp Ser Asn
Thr Thr Ala Thr Ser Ala Pro Pro Arg Thr Lys Ile Thr 100 105 110 Val
Pro Ala Arg Trp Val Val Asn Gly Ile Glu Arg Ser Gly Glu Val 115 120
125 Asn Ala Lys Pro Gly Thr Lys Ser Gly Asp Arg Val Gly Ile Trp Val
130 135 140 Asp Ser Ala Gly Gln Leu Val Asp Glu Pro Ala Pro Pro Ala
Arg Ala 145 150 155 160 Ile Ala Asp Ala Ala Leu Ala Ala Leu Gly Leu
Trp Leu Ser Val Ala 165 170 175 Ala Val Ala Gly Ala Leu Leu Ala Leu
Thr Arg Ala Ile Leu Ile Arg 180 185 190 Val Arg Asn Ala Ser Trp Gln
His Asp Ile Asp Ser Leu Phe Cys Thr 195 200 205 Gln Arg 210
37339PRTMycobacterium tuberculosis 37Met Thr Glu Pro Ala Ala Trp
Asp Glu Gly Lys Pro Arg Ile Ile Thr 1 5 10 15 Leu Thr Met Asn Pro
Ala Leu Asp Ile Thr Thr Ser Val Asp Val Val 20 25 30 Arg Pro Thr
Glu Lys Met Arg Cys Gly Ala Pro Arg Tyr Asp Pro Gly 35 40 45 Gly
Gly Gly Ile Asn Val Ala Arg Ile Val His Val Leu Gly Gly Cys 50 55
60 Ser Thr Ala Leu Phe Pro Ala Gly Gly Ser Thr Gly Ser Leu Leu Met
65 70 75 80 Ala Leu Leu Gly Asp Ala Gly Val Pro Phe Arg Val Ile Pro
Ile Ala 85 90 95 Ala Ser Thr Arg Glu Ser Phe Thr Val Asn Glu Ser
Arg Thr Ala Lys 100 105 110 Gln Tyr Arg Phe Val Leu Pro Gly Pro Ser
Leu Thr Val Ala Glu Gln 115 120 125 Glu Gln Cys Leu Asp Glu Leu Arg
Gly Ala Ala Ala Ser Ala Ala Phe 130 135 140 Val Val Ala Ser Gly Ser
Leu Pro Pro Gly Val Ala Ala Asp Tyr Tyr 145 150 155 160 Gln Arg Val
Ala Asp Ile Cys Arg Arg Ser Ser Thr Pro Leu Ile Leu 165 170 175 Asp
Thr Ser Gly Gly Gly Leu Gln His Ile Ser Ser Gly Val Phe Leu 180 185
190 Leu Lys Ala Ser Val Arg Glu Leu Arg Glu Cys Val Gly Ser Glu Leu
195 200 205 Leu Thr Glu Pro Glu Gln Leu Ala Ala Ala His Glu Leu Ile
Asp Arg 210 215 220 Gly Arg Ala Glu Val Val Val Val Ser Leu Gly Ser
Gln Gly Ala Leu 225 230 235 240 Leu Ala Thr Arg His Ala Ser His Arg
Phe Ser Ser Ile Pro Met Thr 245 250 255 Ala Val Ser Gly Val Gly Ala
Gly Asp Ala Met Val Ala Ala Ile Thr 260 265 270 Val Gly Leu Ser Arg
Gly Trp Ser Leu Ile Lys Ser Val Arg Leu Gly 275 280 285 Asn Ala Ala
Gly Ala Ala Met Leu Leu Thr Pro Gly Thr Ala Ala Cys 290 295 300 Asn
Arg Asp Asp Val Glu Arg Phe Phe Glu Leu Ala Ala Glu Pro Thr 305 310
315 320 Glu Val Gly Gln Asp Gln Tyr Val Trp His Pro Ile Val Asn Pro
Glu 325 330 335 Ala Ser Pro 38331PRTMycobacterium tuberculosis
38Met Pro Asp Thr Met Val Thr Thr Asp Val Ile Lys Ser Ala Val Gln 1
5 10 15 Leu Ala Cys Arg Ala Pro Ser Leu His Asn Ser Gln Pro Trp Arg
Trp 20 25 30 Ile Ala Glu Asp His Thr Val Ala Leu Phe Leu Asp Lys
Asp Arg Val 35 40 45 Leu Tyr Ala Thr Asp His Ser Gly Arg Glu Ala
Leu Leu Gly Cys Gly 50 55 60 Ala Val Leu Asp His Phe Arg Val Ala
Met Ala Ala Ala Gly Thr Thr 65 70 75 80 Ala Asn Val Glu Arg Phe Pro
Asn Pro Asn Asp Pro Leu His Leu Ala 85 90 95 Ser Ile Asp Phe Ser
Pro Ala Asp Phe Val Thr Glu Gly His Arg Leu 100 105 110 Arg Ala Asp
Ala Ile Leu Leu Arg Arg Thr Asp Arg Leu Pro Phe Ala 115 120 125 Glu
Pro Pro Asp Trp Asp Leu Val Glu Ser Gln Leu Arg Thr Thr Val 130 135
140 Thr Ala Asp Thr Val Arg Ile Asp Val Ile Ala Asp Asp Met Arg Pro
145 150 155 160 Glu Leu Ala Ala Ala Ser Lys Leu Thr Glu Ser Leu Arg
Leu Tyr Asp 165 170 175 Ser Ser Tyr His Ala Glu Leu Phe Trp Trp Thr
Gly Ala Phe Glu Thr 180 185 190 Ser Glu Gly Ile Pro His Ser Ser Leu
Val Ser Ala Ala Glu Ser Asp 195 200 205 Arg Val Thr Phe Gly Arg Asp
Phe Pro Val Val Ala Asn Thr Asp Arg 210 215 220 Arg Pro Glu Phe Gly
His Asp Arg Ser Lys Val Leu Val Leu Ser Thr 225 230 235 240 Tyr Asp
Asn Glu Arg Ala Ser Leu Leu Arg Cys Gly Glu Met Leu Ser 245 250 255
Ala Val Leu Leu Asp Ala Thr Met Ala Gly Leu Ala Thr Cys Thr Leu 260
265 270 Thr His Ile Thr Glu Leu His Ala Ser Arg Asp Leu Val Ala Ala
Leu 275 280 285 Ile Gly Gln Pro Ala Thr Pro Gln Ala Leu Val Arg Val
Gly Leu Ala 290 295 300 Pro Glu Met Glu Glu Pro Pro Pro Ala Thr Pro
Arg Arg Pro Ile Asp 305 310 315 320 Glu Val Phe His Val Arg Ala Lys
Asp His Arg 325 330 39143PRTMycobacterium tuberculosis 39Met Thr
Thr Ala Arg Asp Ile Met Asn Ala Gly Val Thr Cys Val Gly 1 5 10 15
Glu His Glu Thr Leu Thr Ala Ala Ala Gln Tyr Met Arg Glu His Asp 20
25 30 Ile Gly Ala Leu Pro Ile Cys Gly Asp Asp Asp Arg Leu His Gly
Met 35 40 45 Leu Thr Asp Arg Asp Ile Val Ile Lys Gly Leu Ala Ala
Gly Leu Asp 50 55 60 Pro Asn Thr Ala Thr Ala Gly Glu Leu Ala Arg
Asp Ser Ile Tyr Tyr 65 70 75 80 Val Asp Ala Asn Ala Ser Ile Gln Glu
Met Leu Asn Val Met Glu Glu 85 90 95 His Gln Val Arg Arg Val Pro
Val Ile Ser Glu His Arg Leu Val Gly 100 105 110 Ile Val Thr Glu Ala
Asp Ile Ala Arg His Leu Pro Glu His Ala Ile 115 120 125 Val Gln Phe
Val Lys Ala Ile Cys Ser Pro Met Ala Leu Ala Ser 130 135 140
40413PRTMycobacterium tuberculosis 40Met Ala Ser Ser Ala Ser Asp
Gly Thr His Glu Arg Ser Ala Phe Arg 1 5 10 15 Leu Ser Pro Pro Val
Leu Ser Gly Ala Met Gly Pro Phe Met His Thr 20 25 30 Gly Leu Tyr
Val Ala Gln Ser Trp Arg Asp Tyr Leu Gly Gln Gln Pro 35 40 45 Asp
Lys Leu Pro Ile Ala Arg Pro Thr Ile Ala Leu Ala Ala Gln Ala 50 55
60 Phe Arg Asp Glu Ile Val Leu Leu Gly Leu Lys Ala Arg Arg Pro Val
65 70 75 80 Ser Asn His Arg Val Phe Glu Arg Ile Ser Gln Glu Val Ala
Ala Gly 85 90 95 Leu Glu Phe Tyr Gly Asn Arg Arg Trp Leu Glu Lys
Pro Ser Gly Phe 100 105 110 Phe Ala Gln Pro Pro Pro Leu Thr Glu Val
Ala Val Arg Lys Val Lys 115 120 125 Asp Arg Arg Arg Ser Phe Tyr Arg
Ile Phe Phe Asp Ser Gly Phe Thr 130 135 140 Pro His Pro Gly Glu Pro
Gly Ser Gln Arg Trp Leu Ser Tyr Thr Ala 145 150 155 160 Asn Asn Arg
Glu Tyr Ala Leu Leu Leu Arg His Pro Glu Pro Arg Pro 165 170 175 Trp
Leu Val Cys Val His Gly Thr Glu Met Gly Arg Ala Pro Leu Asp 180 185
190 Leu Ala Val Phe Arg Ala Trp Lys Leu His Asp Glu Leu Gly Leu Asn
195 200 205 Ile Val Met Pro Val Leu Pro Met His Gly Pro Arg Gly Gln
Gly Leu 210 215 220 Pro Lys Gly Ala Val Phe Pro Gly Glu Asp Val Leu
Asp Asp Val His 225 230 235 240 Gly Thr Ala Gln Ala Val Trp Asp Ile
Arg Arg Leu Leu Ser Trp Ile 245 250 255 Arg Ser Gln Glu Glu Glu Ser
Leu Ile Gly Leu Asn Gly Leu Ser Leu 260 265 270 Gly Gly Tyr Ile Ala
Ser Leu Val Ala Ser Leu Glu Glu Gly Leu Ala 275 280 285 Cys Ala Ile
Leu Gly Val Pro Val Ala Asp Leu Ile Glu Leu Leu Gly 290 295 300 Arg
His Cys Gly Leu Arg His Lys Asp Pro Arg Arg His Thr Val Lys 305 310
315 320 Met Ala Glu Pro Ile Gly Arg Met Ile Ser Pro Leu Ser Leu Thr
Pro 325 330 335 Leu Val Pro Met Pro Gly Arg Phe Ile Tyr Ala Gly Ile
Ala Asp Arg 340 345 350 Leu Val His Pro Arg Glu Gln Val Thr Arg Leu
Trp Glu His Trp Gly 355 360 365 Lys Pro Glu Ile Val Trp Tyr Pro Gly
Gly His Thr Gly Phe Phe Gln 370 375 380 Ser Arg Pro Val Arg Arg Phe
Val Gln Ala Ala Leu Glu Gln Ser Gly 385 390 395 400 Leu Leu Asp Ala
Pro Arg Thr Gln Arg Asp Arg Ser Ala 405 410 41120PRTMycobacterium
tuberculosis 41Met Ser Thr Gln Arg Pro Arg His Ser Gly Ile Arg Ala
Val Gly Pro 1 5 10 15 Tyr Ala Trp Ala Gly Arg Cys Gly Arg Ile Gly
Arg Trp Gly Val His 20 25 30 Gln Glu Ala Met Met Asn Leu Ala Ile
Trp His Pro Arg Lys Val Gln 35 40 45 Ser Ala Thr Ile Tyr Gln Val
Thr Asp Arg Ser His Asp Gly Arg Thr 50 55 60 Ala Arg Val Pro Gly
Asp Glu Ile Thr Ser Thr Val Ser Gly Trp Leu 65 70 75 80 Ser Glu Leu
Gly Thr Gln Ser Pro Leu Ala Asp Glu Leu Ala Arg Ala 85 90 95 Val
Arg Ile Gly Asp Trp Pro Ala Ala Tyr Ala Ile Gly Glu His Leu 100 105
110 Ser Val Glu Ile Ala Val Ala Val 115 120 421017DNAMycobacterium
tuberculosis 42atgcagcttg ttgacagggt tcgtggcgcc gtcacgggta
tgtcgcgtcg actcgtggtc 60ggggccgtcg gcgcggccct agtgtcgggt ctggtcggcg
ccgtcggtgg cacggcgacc 120gcgggggcat tttcccggcc gggcttgccg
gtggagtacc tgcaggtgcc gtcgccgtcg 180atgggccgtg acatcaaggt
ccaattccaa agtggtggtg ccaactcgcc cgccctgtac 240ctgctcgacg
gcctgcgcgc gcaggacgac ttcagcggct gggacatcaa caccccggcg
300ttcgagtggt acgaccagtc gggcctgtcg gtggtcatgc cggtgggtgg
ccagtcaagc 360ttctactccg actggtacca gcccgcctgc ggcaaggccg
gttgccagac ttacaagtgg 420gagaccttcc tgaccagcga gctgccgggg
tggctgcagg ccaacaggca cgtcaagccc 480accggaagcg ccgtcgtcgg
tctttcgatg gctgcttctt cggcgctgac gctggcgatc 540tatcaccccc
agcagttcgt ctacgcggga gcgatgtcgg gcctgttgga cccctcccag
600gcgatgggtc ccaccctgat cggcctggcg atgggtgacg ctggcggcta
caaggcctcc 660gacatgtggg gcccgaagga ggacccggcg tggcagcgca
acgacccgct gttgaacgtc 720gggaagctga tcgccaacaa cacccgcgtc
tgggtgtact gcggcaacgg caagccgtcg 780gatctgggtg gcaacaacct
gccggccaag ttcctcgagg gcttcgtgcg gaccagcaac 840atcaagttcc
aagacgccta caacgccggt ggcggccaca acggcgtgtt cgacttcccg
900gacagcggta cgcacagctg ggagtactgg ggcgcgcagc tcaacgctat
gaagcccgac 960ctgcaacggg cactgggtgc cacgcccaac accgggcccg
cgccccaggg cgcctag 101743978DNAMycobacterium tuberculosis
43atgacagacg tgagccgaaa gattcgagct tggggacgcc gattgatgat cggcacggca
60gcggctgtag tccttccggg cctggtgggg cttgccggcg gagcggcaac cgcgggcgcg
120ttctcccggc cggggctgcc ggtcgagtac ctgcaggtgc cgtcgccgtc
gatgggccgc 180gacatcaagg ttcagttcca gagcggtggg aacaactcac
ctgcggttta tctgctcgac 240ggcctgcgcg cccaagacga ctacaacggc
tgggatatca acaccccggc gttcgagtgg 300tactaccagt cgggactgtc
gatagtcatg ccggtcggcg ggcagtccag cttctacagc 360gactggtaca
gcccggcctg cggtaaggct ggctgccaga cttacaagtg ggaaaccttc
420ctgaccagcg agctgccgca atggttgtcc gccaacaggg ccgtgaagcc
caccggcagc 480gctgcaatcg gcttgtcgat ggccggctcg tcggcaatga
tcttggccgc ctaccacccc 540cagcagttca tctacgccgg ctcgctgtcg
gccctgctgg acccctctca ggggatgggg 600cctagcctga tcggcctcgc
gatgggtgac gccggcggtt acaaggccgc agacatgtgg 660ggtccctcga
gtgacccggc atgggagcgc aacgacccta cgcagcagat ccccaagctg
720gtcgcaaaca acacccggct atgggtttat tgcgggaacg gcaccccgaa
cgagttgggc 780ggtgccaaca tacccgccga gttcttggag aacttcgttc
gtagcagcaa cctgaagttc 840caggatgcgt acaacgccgc gggcgggcac
aacgccgtgt tcaacttccc gcccaacggc 900acgcacagct gggagtactg
gggcgctcag ctcaacgcca tgaagggtga cctgcagagt 960tcgttaggcg ccggctga
97844288DNAMycobacterium tuberculosis 44atgacagagc agcagtggaa
tttcgcgggt atcgaggccg cggcaagcgc aatccaggga 60aatgtcacgt ccattcattc
cctccttgac gaggggaagc agtccctgac caagctcgca 120gcggcctggg
gcggtagcgg ttcggaggcg taccagggtg tccagcaaaa atgggacgcc
180acggctaccg agctgaacaa cgcgctgcag aacctggcgc ggacgatcag
cgaagccggt 240caggcaatgg cttcgaccga aggcaacgtc actgggatgt tcgcatag
28845291DNAMycobacterium tuberculosis 45atgtcgcaaa tcatgtacaa
ctaccccgcg atgttgggtc acgccgggga tatggccgga 60tatgccggca cgctgcagag
cttgggtgcc gagatcgccg tggagcaggc cgcgttgcag 120agtgcgtggc
agggcgatac cgggatcacg tatcaggcgt ggcaggcaca gtggaaccag
180gccatggaag atttggtgcg ggcctatcat gcgatgtcca gcacccatga
agccaacacc 240atggcgatga tggcccgcga cacggccgaa gccgccaaat
ggggcggcta g 291461068DNAMycobacterium tuberculosis 46atgagcaatt
cgcgccgccg ctcactcagg tggtcatggt tgctgagcgt gctggctgcc 60gtcgggctgg
gcctggccac ggcgccggcc caggcggccc cgccggcctt gtcgcaggac
120cggttcgccg acttccccgc gctgcccctc gacccgtccg cgatggtcgc
ccaagtgggg 180ccacaggtgg tcaacatcaa caccaaactg ggctacaaca
acgccgtggg cgccgggacc 240ggcatcgtca tcgatcccaa cggtgtcgtg
ctgaccaaca accacgtgat cgcgggcgcc 300accgacatca atgcgttcag
cgtcggctcc ggccaaacct acggcgtcga tgtggtcggg 360tatgaccgca
cccaggatgt cgcggtgctg cagctgcgcg gtgccggtgg cctgccgtcg
420gcggcgatcg gtggcggcgt cgcggttggt gagcccgtcg tcgcgatggg
caacagcggt 480gggcagggcg gaacgccccg tgcggtgcct ggcagggtgg
tcgcgctcgg ccaaaccgtg 540caggcgtcgg attcgctgac cggtgccgaa
gagacattga acgggttgat ccagttcgat 600gccgcgatcc agcccggtga
ttcgggcggg cccgtcgtca acggcctagg acaggtggtc 660ggtatgaaca
cggccgcgtc cgataacttc cagctgtccc agggtgggca gggattcgcc
720attccgatcg ggcaggcgat ggcgatcgcg ggccagatcc gatcgggtgg
ggggtcaccc 780accgttcata tcgggcctac cgccttcctc ggcttgggtg
ttgtcgacaa caacggcaac 840ggcgcacgag tccaacgcgt ggtcgggagc
gctccggcgg caagtctcgg catctccacc 900ggcgacgtga tcaccgcggt
cgacggcgct ccgatcaact cggccaccgc gatggcggac 960gcgcttaacg
ggcatcatcc cggtgacgtc atctcggtga cctggcaaac caagtcgggc
1020ggcacgcgta cagggaacgt gacattggcc gagggacccc cggcctga
1068471176DNAMycobacterium tuberculosis 47atggtggatt tcggggcgtt
accaccggag atcaactccg cgaggatgta cgccggcccg 60ggttcggcct cgctggtggc
cgcggctcag atgtgggaca gcgtggcgag tgacctgttt 120tcggccgcgt
cggcgtttca gtcggtggtc tggggtctga cggtggggtc gtggataggt
180tcgtcggcgg gtctgatggt ggcggcggcc tcgccgtatg tggcgtggat
gagcgtcacc 240gcggggcagg ccgagctgac cgccgcccag gtccgggttg
ctgcggcggc ctacgagacg 300gcgtatgggc tgacggtgcc cccgccggtg
atcgccgaga accgtgctga actgatgatt 360ctgatagcga ccaacctctt
ggggcaaaac accccggcga tcgcggtcaa cgaggccgaa 420tacggcgaga
tgtgggccca agacgccgcc gcgatgtttg gctacgccgc ggcgacggcg
480acggcgacgg cgacgttgct gccgttcgag gaggcgccgg agatgaccag
cgcgggtggg 540ctcctcgagc aggccgccgc ggtcgaggag gcctccgaca
ccgccgcggc gaaccagttg 600atgaacaatg tgccccaggc gctgcaacag
ctggcccagc ccacgcaggg caccacgcct 660tcttccaagc tgggtggcct
gtggaagacg gtctcgccgc atcggtcgcc gatcagcaac 720atggtgtcga
tggccaacaa ccacatgtcg atgaccaact cgggtgtgtc gatgaccaac
780accttgagct cgatgttgaa gggctttgct ccggcggcgg ccgcccaggc
cgtgcaaacc 840gcggcgcaaa acggggtccg ggcgatgagc tcgctgggca
gctcgctggg ttcttcgggt 900ctgggcggtg gggtggccgc caacttgggt
cgggcggcct cggtcggttc gttgtcggtg 960ccgcaggcct gggccgcggc
caaccaggca gtcaccccgg cggcgcgggc gctgccgctg 1020accagcctga
ccagcgccgc ggaaagaggg cccgggcaga tgctgggcgg gctgccggtg
1080gggcagatgg gcgccagggc cggtggtggg ctcagtggtg tgctgcgtgt
tccgccgcga 1140ccctatgtga
tgccgcattc tccggcggcc ggctag 117648711DNAMycobacterium tuberculosis
48atgcggaccc ccagacgcca ctgccgtcgc atcgccgtcc tcgccgccgt tagcatcgcc
60gccactgtcg ttgccggctg ctcgtcgggc tcgaagccaa gcggcggacc acttccggac
120gcgaagccgc tggtcgagga ggccaccgcg cagaccaagg ctctcaagag
cgcgcacatg 180gtgctgacgg tcaacggcaa gatcccggga ctgtctctga
agacgctgag cggcgatctc 240accaccaacc ccaccgccgc gacgggaaac
gtcaagctca cgctgggtgg gtctgatatc 300gatgccgact tcgtggtgtt
cgacgggatc ctgtacgcca ccctgacgcc caaccagtgg 360agcgatttcg
gtcccgccgc cgacatctac gaccccgccc aggtgctgaa tccggatacc
420ggcctggcca acgtgctggc gaatttcgcc gacgcaaaag ccgaagggcg
ggataccatc 480aacggccaga acaccatccg catcagcggg aaggtatcgg
cacaggcggt gaaccagata 540gcgccgccgt tcaacgcgac gcagccggtg
ccggcgaccg tctggattca ggagaccggc 600gatcatcaac tggcacaggc
ccagttggac cgcggctcgg gcaattccgt ccagatgacc 660ttgtcgaaat
ggggcgagaa ggtccaggtc acgaagcccc cggtgagctg a
711491623DNAMycobacterium tuberculosis 49atggccaaga caattgcgta
cgacgaagag gcccgtcgcg gcctcgagcg gggcttgaac 60gccctcgccg atgcggtaaa
ggtgacattg ggccccaagg gccgcaacgt cgtcctggaa 120aagaagtggg
gtgcccccac gatcaccaac gatggtgtgt ccatcgccaa ggagatcgag
180ctggaggatc cgtacgagaa gatcggcgcc gagctggtca aagaggtagc
caagaagacc 240gatgacgtcg ccggtgacgg caccacgacg gccaccgtgc
tggcccaggc gttggttcgc 300gagggcctgc gcaacgtcgc ggccggcgcc
aacccgctcg gtctcaaacg cggcatcgaa 360aaggccgtgg agaaggtcac
cgagaccctg ctcaagggcg ccaaggaggt cgagaccaag 420gagcagattg
cggccaccgc agcgatttcg gcgggtgacc agtccatcgg tgacctgatc
480gccgaggcga tggacaaggt gggcaacgag ggcgtcatca ccgtcgagga
gtccaacacc 540tttgggctgc agctcgagct caccgagggt atgcggttcg
acaagggcta catctcgggg 600tacttcgtga ccgacccgga gcgtcaggag
gcggtcctgg aggaccccta catcctgctg 660gtcagctcca aggtgtccac
tgtcaaggat ctgctgccgc tgctcgagaa ggtcatcgga 720gccggtaagc
cgctgctgat catcgccgag gacgtcgagg gcgaggcgct gtccaccctg
780gtcgtcaaca agatccgcgg caccttcaag tcggtggcgg tcaaggctcc
cggcttcggc 840gaccgccgca aggcgatgct gcaggatatg gccattctca
ccggtggtca ggtgatcagc 900gaagaggtcg gcctgacgct ggagaacgcc
gacctgtcgc tgctaggcaa ggcccgcaag 960gtcgtggtca ccaaggacga
gaccaccatc gtcgagggcg ccggtgacac cgacgccatc 1020gccggacgag
tggcccagat ccgccaggag atcgagaaca gcgactccga ctacgaccgt
1080gagaagctgc aggagcggct ggccaagctg gccggtggtg tcgcggtgat
caaggccggt 1140gccgccaccg aggtcgaact caaggagcgc aagcaccgca
tcgaggatgc ggttcgcaat 1200gccaaggccg ccgtcgagga gggcatcgtc
gccggtgggg gtgtgacgct gttgcaagcg 1260gccccgaccc tggacgagct
gaagctcgaa ggcgacgagg cgaccggcgc caacatcgtg 1320aaggtggcgc
tggaggcccc gctgaagcag atcgccttca actccgggct ggagccgggc
1380gtggtggccg agaaggtgcg caacctgccg gctggccacg gactgaacgc
tcagaccggt 1440gtctacgagg atctgctcgc tgccggcgtt gctgacccgg
tcaaggtgac ccgttcggcg 1500ctgcagaatg cggcgtccat cgcggggctg
ttcctgacca ccgaggccgt cgttgccgac 1560aagccggaaa aggagaaggc
ttccgttccc ggtggcggcg acatgggtgg catggatttc 1620tga
162350600DNAMycobacterium tuberculosis 50atggctgaaa actcgaacat
tgatgacatc aaggctccgt tgcttgccgc gcttggagcg 60gccgacctgg ccttggccac
tgtcaacgag ttgatcacga acctgcgtga gcgtgcggag 120gagactcgta
cggacacccg cagccgggtc gaggagagcc gtgctcgcct gaccaagctg
180caggaagatc tgcccgagca gctcaccgag ctgcgtgaga agttcaccgc
cgaggagctg 240cgtaaggccg ccgagggcta cctcgaggcc gcgactagcc
ggtacaacga gctggtcgag 300cgcggtgagg ccgctctaga gcggctgcgc
agccagcaga gcttcgagga agtgtcggcg 360cgcgccgaag gctacgtgga
ccaggcggtg gagttgaccc aggaggcgtt gggtacggtc 420gcatcgcaga
cccgcgcggt cggtgagcgt gccgccaagc tggtcggcat cgagctgcct
480aagaaggctg ctccggccaa gaaggccgct ccggccaaga aggccgctcc
ggccaagaag 540gcggcggcca agaaggcgcc cgcgaagaag gcggcggcca
agaaggtcac ccagaagtag 600511128DNAMycobacterium tuberculosis
51gtgacgcaaa ccggcaagcg tcagagacgc aaattcggtc gcatccgaca gttcaactcc
60ggccgctggc aagccagcta caccggcccc gacggccgcg tgtacatcgc ccccaaaacc
120ttcaacgcca agatcgacgc cgaagcatgg ctcaccgacc gccgccgcga
aatcgaccga 180caactatggt ccccggcatc gggtcaggaa gaccgccccg
gagccccatt cggtgagtac 240gccgaaggat ggctgaagca gcgtggaatc
aaggaccgca cccgcgccca ctatcgcaaa 300ctgctggaca accacatcct
ggccaccttc gctgacaccg acctacgcga catcaccccg 360gccgccgtgc
gccgctggta cgccaccacc gccgtgggca caccgaccat gcgggcacac
420tcctacagct tgctgcgcgc aatcatgcag accgccttgg ccgacgacct
gatcgactcc 480aacccctgcc gcatctcagg cgcgtccacc gcccgccgcg
tccacaagat caggcccgcc 540accctcgacg agctggaaac catcaccaaa
gccatgcccg acccctacca ggcgttcgtg 600ctgatggcgg catggctggc
catgcgctac ggcgagctga ccgaattacg ccgcaaagac 660atcgacctgc
acggcgaggt tgcgcgggtg cggcgggctg tcgttcgggt gggcgaaggc
720ttcaaggtga cgacaccgaa aagcgatgcg ggagtgcgcg acataagtat
cccgccacat 780ctgatacccg ccatcgaaga ccaccttcac aaacacgtca
accccggccg ggagtccctg 840ctgttcccat cggtcaacga ccccaaccgt
cacctagcac cctcggcgct gtaccgcatg 900ttctacaagg cccgaaaagc
cgccggccga ccagacttac gggtgcacga ccttcgacac 960tccggcgccg
tgttggctgc atccaccggc gccacactgg ccgaactgat gcagcggcta
1020ggacacagca cagccggcgc cgcactccgc taccagcacg ccgccaaggg
ccgggaccgc 1080gaaatcgccg cactgttaag caaactggcc gagaaccagg agatgtga
112852228DNAMycobacterium tuberculosis 52gtgatagcgg gcgtcgacca
ggcgcttgca gcaacaggcc aggctagcca gcgggcggca 60ggcgcatctg gtggggtcac
cgtcggtgtc ggcgtgggca cggaacagag gaacctttcg 120gtggttgcac
cgagtcagtt cacatttagt tcacgcagcc cagattttgt ggatgaaacc
180gcaggtcaat cgtggtgcgc gatactggga ttgaaccagt ttcactag
22853435DNAMycobacterium tuberculosis 53atggccacca cccttcccgt
tcagcgccac ccgcggtccc tcttccccga gttttctgag 60ctgttcgcgg ccttcccgtc
attcgccgga ctccggccca ccttcgacac ccggttgatg 120cggctggaag
acgagatgaa agaggggcgc tacgaggtac gcgcggagct tcccggggtc
180gaccccgaca aggacgtcga cattatggtc cgcgatggtc agctgaccat
caaggccgag 240cgcaccgagc agaaggactt cgacggtcgc tcggaattcg
cgtacggttc cttcgttcgc 300acggtgtcgc tgccggtagg tgctgacgag
gacgacatta aggccaccta cgacaagggc 360attcttactg tgtcggtggc
ggtttcggaa gggaagccaa ccgaaaagca cattcagatc 420cggtccacca actga
435541224DNAMycobacterium tuberculosis 54atgagtggac gccaccgtaa
gcccaccaca tccaacgtca gcgtcgccaa gatcgccttt 60accggcgcag tactcggtgg
cggcggcatc gccatggccg ctcaggcgac cgcggccacc 120gacggggaat
gggatcaggt ggcccgctgc gagtcgggcg gcaactggtc gatcaacacc
180ggcaacggtt acctcggtgg cttgcagttc actcaaagca cctgggccgc
acatggtggc 240ggcgagttcg ccccgtcggc tcagctggcc agccgggagc
agcagattgc cgtcggtgag 300cgggtgctgg ccacccaggg tcgcggcgcc
tggccggtgt gcggccgcgg gttatcgaac 360gcaacacccc gcgaagtgct
tcccgcttcg gcagcgatgg acgctccgtt ggacgcggcc 420gcggtcaacg
gcgaaccagc accgctggcc ccgccgcccg ccgacccggc gccacccgtg
480gaacttgccg ctaacgacct gcccgcaccg ctgggtgaac ccctcccggc
agctcccgcc 540gacccggcac cacccgccga cctggcacca cccgcgcccg
ccgacgtcgc gccacccgtg 600gaacttgccg taaacgacct gcccgcaccg
ctgggtgaac ccctcccggc agctcccgcc 660gacccggcac cacccgccga
cctggcacca cccgcgcccg ccgacctggc gccacccgcg 720cccgccgacc
tggcgccacc cgcgcccgcc gacctggcac cacccgtgga acttgccgta
780aacgacctgc ccgcgccgct gggtgaaccc ctcccggcag ctcccgccga
actggcgcca 840cccgccgatc tggcacccgc gtccgccgac ctggcgccac
ccgcgcccgc cgacctggcg 900ccacccgcgc ccgccgaact ggcgccaccc
gcgcccgccg acctggcacc acccgctgcg 960gtgaacgagc aaaccgcgcc
gggcgatcag cccgccacag ctccaggcgg cccggttggc 1020cttgccaccg
atttggaact ccccgagccc gacccccaac cagctgacgc accgccgccc
1080ggcgacgtca ccgaggcgcc cgccgaaacg ccccaagtct cgaacatcgc
ctatacgaag 1140aagctgtggc aggcgattcg ggcccaggac gtctgcggca
acgatgcgct ggactcgctc 1200gcacagccgt acgtcatcgg ctga
1224551089DNAMycobacterium tuberculosis 55atgttgcgcc tggtagtcgg
tgcgctgctg ctggtgttgg cgttcgccgg tggctatgcg 60gtcgccgcat gcaaaacggt
gacgttgacc gtcgacggaa ccgcgatgcg ggtgaccacg 120atgaaatcgc
gggtgatcga catcgtcgaa gagaacgggt tctcagtcga cgaccgcgac
180gacctgtatc ccgcggccgg cgtgcaggtc catgacgccg acaccatcgt
gctgcggcgt 240agccgtccgc tgcagatctc gctggatggt cacgacgcta
agcaggtgtg gacgaccgcg 300tcgacggtgg acgaggcgct ggcccaactc
gcgatgaccg acacggcgcc ggccgcggct 360tctcgcgcca gccgcgtccc
gctgtccggg atggcgctac cggtcgtcag cgccaagacg 420gtgcagctca
acgacggcgg gttggtgcgc acggtgcact tgccggcccc caatgtcgcg
480gggctgctga gtgcggccgg cgtgccgctg ttgcaaagcg accacgtggt
gcccgccgcg 540acggccccga tcgtcgaagg catgcagatc caggtgaccc
gcaatcggat caagaaggtc 600accgagcggc tgccgctgcc gccgaacgcg
cgtcgtgtcg aggacccgga gatgaacatg 660agccgggagg tcgtcgaaga
cccgggggtt ccggggaccc aggatgtgac gttcgcggta 720gctgaggtca
acggcgtcga gaccggccgt ttgcccgtcg ccaacgtcgt ggtgaccccg
780gcccacgaag ccgtggtgcg ggtgggcacc aagcccggta ccgaggtgcc
cccggtgatc 840gacggaagca tctgggacgc gatcgccggc tgtgaggccg
gtggcaactg ggcgatcaac 900accggcaacg ggtattacgg tggtgtgcag
tttgaccagg gcacctggga ggccaacggc 960gggctgcggt atgcaccccg
cgctgacctc gccacccgcg aagagcagat cgccgttgcc 1020gaggtgaccc
gactgcgtca aggttggggc gcctggccgg tatgtgctgc acgagcgggt
1080gcgcgctga 108956531DNAMycobacterium tuberculosis 56gtgcatcctt
tgccggccga ccacggccgg tcgcggtgca atagacaccc gatctcacca 60ctctctctaa
tcggtaacgc ttcggccact tccggcgata tgtcgagcat gacaagaatc
120gccaagccgc tcatcaagtc cgccatggcc gcaggactcg tcacggcatc
catgtcgctc 180tccaccgccg ttgcccacgc cggtcccagc ccgaactggg
acgccgtcgc gcagtgcgaa 240tccgggggca actgggcggc caacaccgga
aacggcaaat acggcggact gcagttcaag 300ccggccacct gggccgcatt
cggcggtgtc ggcaacccag cagctgcctc tcgggaacaa 360caaatcgcag
ttgccaatcg ggttctcgcc gaacagggat tggacgcgtg gccgacgtgc
420ggcgccgcct ctggccttcc gatcgcactg tggtcgaaac ccgcgcaggg
catcaagcaa 480atcatcaacg agatcatttg ggcaggcatt caggcaagta
ttccgcgctg a 53157465DNAMycobacterium tuberculosis 57atgacaccgg
gtttgcttac tactgcgggt gctggccgac cacgtgacag gtgcgccagg 60atcgtatgca
cggtgttcat cgaaaccgcc gttgtcgcga ccatgtttgt cgcgttgttg
120ggtctgtcca ccatcagctc gaaagccgac gacatcgatt gggacgccat
cgcgcaatgc 180gaatccggcg gcaattgggc ggccaacacc ggtaacgggt
tatacggtgg tctgcagatc 240agccaggcga cgtgggattc caacggtggt
gtcgggtcgc cggcggccgc gagtccccag 300caacagatcg aggtcgcaga
caacattatg aaaacccaag gcccgggtgc gtggccgaaa 360tgtagttctt
gtagtcaggg agacgcaccg ctgggctcgc tcacccacat cctgacgttc
420ctcgcggccg agactggagg ttgttcgggg agcagggacg attga
46558519DNAMycobacterium tuberculosis 58ttgaagaacg cccgtacgac
gctcatcgcc gccgcgattg ccgggacgtt ggtgaccacg 60tcaccagccg gtatcgccaa
tgccgacgac gcgggcttgg acccaaacgc cgcagccggc 120ccggatgccg
tgggctttga cccgaacctg ccgccggccc cggacgctgc acccgtcgat
180actccgccgg ctccggagga cgcgggcttt gatcccaacc tccccccgcc
gctggccccg 240gacttcctgt ccccgcctgc ggaggaagcg cctcccgtgc
ccgtggccta cagcgtgaac 300tgggacgcga tcgcgcagtg cgagtccggt
ggaaactggt cgatcaacac cggtaacggt 360tactacggcg gcctgcggtt
caccgccggc acctggcgtg ccaacggtgg ctcggggtcc 420gcggccaacg
cgagccggga ggagcagatc cgggtggctg agaacgtgct gcgttcgcag
480ggtatccgcg cctggccggt ctgcggccgc cgcggctga
51959633DNAMycobacterium tuberculosis 59atgatcgcca caacccgcga
tcgtgaagga gccaccatga tcacgtttag gctgcgcttg 60ccgtgccgga cgatactgcg
ggtgttcagc cgcaatccgc tggtgcgtgg gacggatcga 120ctcgaggcgg
tcgtcatgct gctggccgtc acggtctcgc tgctgactat cccgttcgcc
180gccgcggccg gcaccgcagt ccaggattcc cgcagccacg tctatgccca
ccaggcccag 240acccgccatc ccgcaaccgc gaccgtgatc gatcacgagg
gggtgatcga cagcaacacg 300accgccacgt cagcgccgcc gcgcacgaag
atcaccgtgc ctgcccgatg ggtcgtgaac 360ggaatagaac gcagcggtga
ggtcaacgcg aagccgggaa ccaaatccgg tgaccgcgtc 420ggcatttggg
tcgacagtgc cggtcagctg gtcgatgaac cagctccgcc ggcccgtgcc
480attgcggatg cggccctggc cgccttggga ctctggttga gcgtcgccgc
ggttgcgggc 540gccctgctgg cgctcactcg ggcgattctg atccgcgttc
gcaacgccag ttggcaacac 600gacatcgaca gcctgttctg cacgcagcgg tga
633601020DNAMycobacterium tuberculosis 60atgacggagc cagcggcgtg
ggacgaaggc aagccgcgaa tcatcacttt gaccatgaac 60cccgccttgg acatcacgac
gagcgtcgac gtggtgcgcc cgaccgagaa aatgcgttgt 120ggcgcacctc
gctacgatcc cggcggcggc ggtatcaatg tcgcccgcat tgtgcatgtc
180ctcggcggtt gctcgacagc actgttcccg gccggcgggt cgaccgggag
cctgctgatg 240gcgctgctcg gtgatgcggg agtgccattt cgcgtcattc
cgatcgcggc ctcgacgcgg 300gagagcttca cggtcaacga gtccaggacc
gccaagcagt atcgtttcgt gcttccgggg 360ccgtcgctga ccgtcgcgga
gcaggagcaa tgcctcgacg aactgcgcgg tgcggcggct 420tcggccgcct
ttgtggtggc cagtggcagc ctgccgccag gtgtggctgc cgactactat
480cagcgggttg ccgacatctg ccgccgatcg agcactccgc tgatcctgga
tacatctggt 540ggcgggttgc agcacatttc gtccggggtg tttcttctca
aggcgagcgt gcgggaactg 600cgcgagtgcg tcggatccga actgctgacc
gagcccgaac aactggccgc cgcacacgaa 660ctcattgacc gtgggcgcgc
cgaggtcgtg gtggtctcgc ttggatctca gggcgcgcta 720ttggccacac
gacatgcgag ccatcgattt tcgtcgattc cgatgaccgc ggttagcggt
780gtcggcgccg gcgacgcgat ggtggccgcg attaccgtgg gcctcagccg
tggctggtcg 840ctcatcaagt ccgttcgctt gggaaacgcg gcaggtgcag
ccatgctgct gacgccaggc 900accgcggcct gcaatcgcga cgatgtggag
aggttcttcg agctggcggc cgaacccacc 960gaagtcgggc aggatcaata
cgtttggcac ccgatcgtta acccggaagc ctcgccatga
102061996DNAMycobacterium tuberculosis 61atgccggaca ccatggtgac
caccgatgtc atcaagagcg cggtgcagtt ggcctgccgc 60gcaccgtcgc tccacaacag
ccagccctgg cgctggatag ccgaggacca cacggttgcg 120ctgttcctcg
acaaggatcg ggtgctttac gcgaccgacc actccggccg ggaagcgctg
180ctggggtgcg gcgccgtact cgaccacttt cgggtggcga tggcggccgc
gggtaccacc 240gccaatgtgg aacggtttcc caaccccaac gatcctttgc
atctggcgtc aattgacttc 300agcccggccg atttcgtcac cgagggccac
cgtctaaggg cggatgcgat cctactgcgc 360cgtaccgacc ggctgccttt
cgccgagccg ccggattggg acttggtgga gtcgcagttg 420cgcacgaccg
tcaccgccga cacggtgcgc atcgacgtca tcgccgacga tatgcgtccc
480gaactggcgg cggcgtccaa actcaccgaa tcgctgcggc tctacgattc
gtcgtatcat 540gccgaactct tttggtggac aggggctttt gagacttctg
agggcatacc gcacagttca 600ttggtatcgg cggccgaaag tgaccgggtc
accttcggac gcgacttccc ggtcgtcgcc 660aacaccgata ggcgcccgga
gtttggccac gaccgctcta aggtcctggt gctctccacc 720tacgacaacg
aacgcgccag cctactgcgc tgcggcgaga tgctttccgc cgtattgctt
780gacgccacca tggctgggct tgccacctgc acgctgaccc acatcaccga
actgcacgcc 840agccgagacc tggtcgcagc gctgattggg cagcccgcaa
ctccgcaagc cttggttcgc 900gtcggtctgg ccccggagat ggaagagccg
ccaccggcaa cgcctcggcg accaatcgat 960gaagtgtttc acgttcgggc
taaggatcac cggtag 99662432DNAMycobacterium tuberculosis
62atgaccaccg cacgcgacat catgaacgca ggtgtgacct gtgttggcga acacgagacg
60ctaaccgctg ccgctcaata catgcgtgag cacgacatcg gcgcgttgcc gatctgcggg
120gacgacgacc ggctgcacgg catgctcacc gaccgcgaca ttgtgatcaa
aggcctggct 180gcgggcctag acccgaatac cgccacggct ggcgagttgg
cccgggacag catctactac 240gtcgatgcga acgcaagcat ccaggagatg
ctcaacgtca tggaagaaca tcaggtccgc 300cgtgttccgg tcatctcaga
gcaccgcttg gtcggaatcg tcaccgaagc cgacatcgcc 360cgacacctgc
ccgagcacgc cattgtgcag ttcgtcaagg caatctgctc gcccatggcc
420ctcgccagct ag 432631242DNAMycobacterium tuberculosis
63atggcaagtt ctgcgagcga cggcacccac gaacgctcgg cttttcgcct gagtccaccg
60gtcttgagcg gcgccatggg accgttcatg cacaccggtc tgtacgtcgc tcaatcgtgg
120cgcgactatc tgggtcaaca gcccgataaa ctgccgatcg cacggcccac
tattgcctta 180gcggcgcaag cctttcgaga cgaaatcgtc ctgctgggcc
tcaaggcacg acgtccggtc 240agcaatcatc gagtgttcga gcgcatcagc
caagaagtgg ccgctggact ggagttctat 300gggaatcgca gatggctgga
gaagcctagc ggattttttg cccagccccc accgctcacc 360gaggtcgcgg
tccgaaaggt caaggaccgc agacgctcct tttatcgcat cttcttcgac
420agtgggttta cgccgcatcc gggtgaaccg ggcagccaac ggtggctctc
atacactgcg 480aacaatcgcg agtacgccct gttactgcgg cacccagagc
cgcgtccctg gctggtttgt 540gtacacggca ccgagatggg cagggccccg
ttggatctcg cggtgttccg cgcctggaag 600ctgcatgacg aactcggcct
gaacattgtc atgccggttc ttccgatgca tggtccccgc 660gggcaaggtc
tgccgaaggg cgccgttttt cccggagaag atgttctcga cgatgtgcat
720gggacggctc aagcggtgtg ggatatccgg cggctgttgt cctggatacg
atcgcaggag 780gaggagtcgc tgatcgggtt gaacggtctc tcgctgggcg
gctacatcgc gtcattggtc 840gccagcctcg aagaaggtct cgcctgcgcg
attctcggtg tcccagtggc tgatctgatc 900gagttgttgg gccgccactg
cggtcttcgg cacaaagacc cccgccgcca caccgtcaag 960atggccgaac
cgatcggccg aatgatctcg ccgctctcac ttacgccact ggtgcccatg
1020ccgggccgct ttatctacgc gggcattgcc gaccgactcg tgcatccacg
cgaacaggtg 1080actcgcctct gggagcactg gggcaaaccc gaaatcgtgt
ggtatccagg cggtcacact 1140ggcttcttcc agtcgcggcc ggtacgacgg
tttgtccagg ctgcgctgga gcagtcgggc 1200ctgttggacg cgccacggac
acagcgcgac cgttccgcct aa 124264363DNAMycobacterium tuberculosis
64atgtccacgc aacgaccgag gcactccggt attcgggctg ttggccccta cgcatgggcc
60ggccgatgtg gtcggatagg caggtggggg gtgcaccagg aggcgatgat gaatctagcg
120atatggcacc cgcgcaaggt gcaatccgcc accatctatc aggtgaccga
tcgctcgcac 180gacgggcgca cagcacgggt gcctggtgac gagatcacta
gcaccgtgtc cggttggttg 240tcggagttgg gcacccaaag cccgttggcc
gatgagcttg cgcgtgcggt gcggatcggc 300gactggcccg ctgcgtacgc
aatcggtgag cacctgtccg ttgagattgc cgttgcggtc 360taa
36365399PRTMycobacterium tuberculosis 65Leu Asp Phe Ala Thr Leu Pro
Pro Glu Ile Asn Ser Ala Arg Met Tyr 1 5 10 15 Ser Gly Ala Gly Ser
Ala Pro Met Leu Ala Ala Ala Ser Ala Trp His 20 25 30 Gly Leu Ser
Ala Glu Leu Arg Ala Ser Ala Leu Ser Tyr Ser Ser Val 35 40 45 Leu
Ser Thr Leu Thr Gly Glu Glu Trp His Gly Pro Ala Ser Ala Ser 50 55
60 Met Thr Ala Ala Ala Ala Pro Tyr Val Ala Trp Met Ser Val Thr Ala
65 70 75 80 Val Arg Ala Glu Gln Ala Gly Ala Gln Ala Glu Ala Ala Ala
Ala Ala 85 90 95 Tyr Glu Ala Ala Phe Ala Ala Thr Val Pro Pro Pro
Val Ile Glu Ala 100 105
110 Asn Arg Ala Gln Leu Met Ala Leu Ile Ala Thr Asn Val Leu Gly Gln
115 120 125 Asn Ala Pro Ala Ile Ala Ala Thr Glu Ala Gln Tyr Ala Glu
Met Trp 130 135 140 Ser Gln Asp Ala Met Ala Met Tyr Gly Tyr Ala Gly
Ala Ser Ala Ala 145 150 155 160 Ala Thr Gln Leu Thr Pro Phe Thr Glu
Pro Val Gln Thr Thr Asn Ala 165 170 175 Ser Gly Leu Ala Ala Gln Ser
Ala Ala Ile Ala His Ala Thr Gly Ala 180 185 190 Ser Ala Gly Ala Gln
Gln Thr Thr Leu Ser Gln Leu Ile Ala Ala Ile 195 200 205 Pro Ser Val
Leu Gln Gly Leu Ser Ser Ser Thr Ala Ala Thr Phe Ala 210 215 220 Ser
Gly Pro Ser Gly Leu Leu Gly Ile Val Gly Ser Gly Ser Ser Trp 225 230
235 240 Leu Asp Lys Leu Trp Ala Leu Leu Asp Pro Asn Ser Asn Phe Trp
Asn 245 250 255 Thr Ile Ala Ser Ser Gly Leu Phe Leu Pro Ser Asn Thr
Ile Ala Pro 260 265 270 Phe Leu Gly Leu Leu Gly Gly Val Ala Ala Ala
Asp Ala Ala Gly Asp 275 280 285 Val Leu Gly Glu Ala Thr Ser Gly Gly
Leu Gly Gly Ala Leu Val Ala 290 295 300 Pro Leu Gly Ser Ala Gly Gly
Leu Gly Gly Thr Val Ala Ala Gly Leu 305 310 315 320 Gly Asn Ala Ala
Thr Val Gly Thr Leu Ser Val Pro Pro Ser Trp Thr 325 330 335 Ala Ala
Ala Pro Leu Ala Ser Pro Leu Gly Ser Ala Leu Gly Gly Thr 340 345 350
Pro Met Val Ala Pro Pro Pro Ala Val Ala Ala Gly Met Pro Gly Met 355
360 365 Pro Phe Gly Thr Met Gly Gly Gln Gly Phe Gly Arg Ala Val Pro
Gln 370 375 380 Tyr Gly Phe Arg Pro Asn Phe Val Ala Arg Pro Pro Ala
Ala Gly 385 390 395
* * * * *
References