U.S. patent application number 15/161893 was filed with the patent office on 2016-09-15 for nucleic acids encodng anti-c5a antibodies.
The applicant listed for this patent is Alexion Pharmaceuticals, Inc.. Invention is credited to Russell P. ROTHER, Douglas L. SHERIDAN, Paul P. TAMBURINI, Yuchun ZHANG.
Application Number | 20160264654 15/161893 |
Document ID | / |
Family ID | 44861943 |
Filed Date | 2016-09-15 |
United States Patent
Application |
20160264654 |
Kind Code |
A1 |
ROTHER; Russell P. ; et
al. |
September 15, 2016 |
NUCLEIC ACIDS ENCODNG ANTI-C5A ANTIBODIES
Abstract
The present disclosure relates to, inter alia, antibodies, or
antigen-binding fragments thereof, that bind to C5a and to use of
the antibodies in methods for treating or preventing
complement-associated disorders such as, but not limited to,
atypical hemolytic uremic syndrome, age-related macular
degeneration, rheumatoid arthritis, sepsis, severe burn,
antiphospho lipid syndrome, asthma, lupus nephritis, Goodpasture's
syndrome, and chronic obstructive pulmonary disease.
Inventors: |
ROTHER; Russell P.;
(Oklahoma City, OK) ; SHERIDAN; Douglas L.;
(Branford, CT) ; TAMBURINI; Paul P.; (Kensington,
CT) ; ZHANG; Yuchun; (Cheshire, CT) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Alexion Pharmaceuticals, Inc. |
New Haven |
CT |
US |
|
|
Family ID: |
44861943 |
Appl. No.: |
15/161893 |
Filed: |
May 23, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15040258 |
Feb 10, 2016 |
9371378 |
|
|
15161893 |
|
|
|
|
14933368 |
Nov 5, 2015 |
9309310 |
|
|
15040258 |
|
|
|
|
14657176 |
Mar 13, 2015 |
9221901 |
|
|
14933368 |
|
|
|
|
13695277 |
Apr 4, 2013 |
9011852 |
|
|
PCT/US2011/034672 |
Apr 29, 2011 |
|
|
|
14657176 |
|
|
|
|
61471465 |
Apr 4, 2011 |
|
|
|
61330260 |
Apr 30, 2010 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/505 20130101;
C07K 2317/24 20130101; C07K 2317/515 20130101; A61P 27/02 20180101;
C07K 2317/92 20130101; A61P 3/06 20180101; C07K 2317/71 20130101;
A61P 1/16 20180101; C07K 2317/21 20130101; A61P 31/04 20180101;
A61P 37/00 20180101; A61K 47/60 20170801; A61P 13/02 20180101; A61P
19/02 20180101; C07K 2317/41 20130101; C07K 2317/565 20130101; A61K
39/3955 20130101; A61P 29/00 20180101; C07K 16/28 20130101; C07K
2317/31 20130101; C07K 2317/52 20130101; A61K 45/06 20130101; C07K
2317/567 20130101; A61P 37/02 20180101; A61P 17/02 20180101; C07K
2317/76 20130101; A61P 11/16 20180101; C07K 16/461 20130101; A61P
25/04 20180101; A61P 7/02 20180101; A61P 13/12 20180101; A61P 7/00
20180101; A61P 43/00 20180101; C07K 2317/56 20130101; A61P 7/06
20180101; A61P 25/00 20180101; C07K 2317/51 20130101; A61P 11/06
20180101; C07K 16/18 20130101; C07K 2317/94 20130101; A61P 7/04
20180101; A61P 37/06 20180101; C07K 2317/33 20130101; A61P 11/00
20180101; C07K 2317/34 20130101 |
International
Class: |
C07K 16/18 20060101
C07K016/18 |
Claims
1. A nucleic acid encoding complementarity determining regions
(CDRs) of a heavy chain variable region of an antibody, or
antigen-binding fragment thereof, that binds to human C5a, wherein
the heavy chain variable region comprises the amino acid sequence
depicted in SEQ ID NO:45.
2. A nucleic acid encoding complementarity determining regions
(CDRs) of a light chain variable region of an antibody, or
antigen-binding fragment thereof, that binds to human C5a, wherein
the light chain variable region comprises the amino acid sequence
depicted in SEQ ID NO:42.
3. A nucleic acid encoding complementarity determining regions
(CDRs) of heavy and light chain variable regions of an antibody, or
antigen-binding fragments thereof, that bind to human C5a, wherein
the heavy and light chain variable regions comprise the amino acid
sequences depicted in SEQ ID NOs:45 and 42, respectively.
4. A nucleic acid encoding a heavy chain variable region of an
antibody, or antigen-binding fragment thereof, that binds to human
C5a, wherein the heavy chain variable region comprises the amino
acid sequence depicted in SEQ ID NO:45.
5. A nucleic acid encoding a light chain variable region of an
antibody, or antigen-binding fragment thereof, that binds to human
C5a, wherein the light chain variable region comprising the amino
acid sequence depicted in SEQ ID NO:42.
6. A nucleic acid encoding heavy and light chain variable regions
of an antibody, or antigen-binding fragments thereof, that bind to
human C5a, wherein the heavy and light chain variable regions
comprise the amino acid sequences depicted in SEQ ID NOs:45 and 42,
respectively.
7. A nucleic acid encoding a heavy chain of an antibody, or
antigen-binding fragment thereof, that binds to C5a, wherein the
heavy chain comprises the amino acid sequence depicted in SEQ ID
NO: 49.
8. A nucleic acid encoding a light chain of an antibody, or
antigen-binding fragment thereof, that binds to C5a, wherein the
light chain comprises the amino acid sequence depicted in SEQ ID
NO: 40.
9. A nucleic acid encoding a heavy chain and a light chain of an
antibody, or antigen-binding fragment thereof, that binds to human
C5a, wherein the heavy chain comprises the amino acid sequence
depicted in SEQ ID NO: 49 and the light chain comprises the amino
acid sequence depicted in SEQ ID NO: 40.
10. An expression vector comprising the nucleic acid according to
claim 1.
11. A cell comprising the expression vector according to claim
10.
12. An expression vector comprising the nucleic acid according to
claim 2.
13. A cell comprising the expression vector according to claim
12.
14. An expression vector comprising the nucleic acid according to
claim 3.
15. A cell comprising the expression vector according to claim
14.
16. An expression vector comprising the nucleic acid according to
claim 4.
17. A cell comprising the expression vector according to claim
16.
18. An expression vector comprising the nucleic acid according to
claim 5.
19. A cell comprising the expression vector according to claim
18.
20. An expression vector comprising the nucleic acid according to
claim 6.
21. A cell comprising the expression vector according to claim
20.
22. An expression vector comprising the nucleic acid according to
claim 7.
23. A cell comprising the expression vector according to claim
22.
24. An expression vector comprising the nucleic acid according to
claim 8.
25. A cell comprising the expression vector according to claim
24.
26. An expression vector comprising the nucleic acid according to
claim 9.
27. A cell comprising the expression vector according to claim 26.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. patent application
Ser. No. 15/040,258, filed Feb. 10, 2016, which is a continuation
of U.S. patent application Ser. No. 14/933,368, filed Nov. 5, 2015
(now U.S. Pat. No. 9,309,310), which is a divisional of U.S. patent
application Ser. No. 14/657,176, filed Mar. 13, 2015 (now U.S. Pat.
No. 9,221,901), which is a divisional of U.S. patent application
Ser. No. 13/695,277, filed Apr. 4, 2013 (now U.S. Pat. No.
9,011,852), which is a national stage filing under 35 U.S.C.
.sctn.371 of International Application No. PCT/US2011/034672, filed
Apr. 29, 2011, which claims the benefit of the filing date under 35
U.S.C. .sctn.119(e) to U.S. Provisional Patent Application Ser. No.
61/330,260, filed on Apr. 30, 2010, and 61/471,465, filed on Apr.
4, 2011, the entire contents of which are hereby incorporated by
reference in their entireties. International Application No.
PCT/US2011/034672 was published under PCT Article 21(2) in
English.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted via EFS-Web and is hereby incorporated by
reference in its entirety. Said ASCII copy, created on May 23,
2016, is named AXJ_154USDV2CNDV2_Seq.txt, and is 144,050 bytes in
size.
TECHNICAL FIELD
[0003] The field of the invention is medicine, immunology,
molecular biology, and protein chemistry.
BACKGROUND
[0004] The complement system acts in conjunction with other
immunological systems of the body to defend against intrusion of
cellular and viral pathogens. There are at least 25 complement
proteins, which are found as a complex collection of plasma
proteins and membrane cofactors. The plasma proteins make up about
10% of the globulins in vertebrate serum. Complement components
achieve their immune defensive functions by interacting in a series
of intricate but precise enzymatic cleavage and membrane binding
events. The resulting complement cascade leads to the production of
products with opsonic, immunoregulatory, and lytic functions. A
concise summary of the biologic activities associated with
complement activation is provided, for example, in The Merck
Manual, 16.sup.th Edition.
[0005] The complement cascade progresses via the classical pathway,
the alternative pathway, or the lectin pathway. These pathways
share many components, and while they differ in their initial
steps, they converge and share the same "terminal complement"
components (C5 through C9) responsible for the activation and
destruction of target cells.
[0006] The classical pathway (CP) is typically initiated by
antibody recognition of, and binding to, an antigenic site on a
target cell. The alternative pathway (AP) can be antibody
independent, and can be initiated by certain molecules on pathogen
surfaces. Additionally, the lectin pathway is typically initiated
with binding of mannose-binding lectin (MBL) to high mannose
substrates. These pathways converge at the point where complement
component C3 is cleaved by an active protease to yield C3a and C3b.
Other pathways activating complement attack can act later in the
sequence of events leading to various aspects of complement
function.
[0007] C3a is an anaphylatoxin. C3b binds to bacterial and other
cells, as well as to certain viruses and immune complexes, and tags
them for removal from the circulation. (C3b in this role is known
as opsonin.) The opsonic function of C3b is generally considered to
be the most important anti-infective action of the complement
system. Patients with genetic lesions that block C3b function are
prone to infection by a broad variety of pathogenic organisms,
while patients with lesions later in the complement cascade
sequence, i.e., patients with lesions that block C5 functions, are
found to be more prone only to Neisseria infection, and then only
somewhat more prone.
[0008] C3b also forms a complex with other components unique to
each pathway to form classical or alternative C5 convertase, which
cleaves C5 into C5a and CSb. C3 is thus regarded as the central
protein in the complement reaction sequence since it is essential
to both the alternative and classical pathways. This property of
C3b is regulated by the serum protease Factor I, which acts on C3b
to produce iC3b. While still functional as opsonin, iC3b cannot
form an active C5 convertase.
[0009] C5 is a 190 kDa beta globulin found in normal serum at a
concentration of approximately 75 .mu.g/mL (0.4 .mu.M). C5 is
glycosylated, with about 1.5 to 3 percent of its mass attributed to
carbohydrate. Mature C5 is a heterodimer of a 999 amino acid 115
kDa alpha chain that is disulfide linked to a 655 amino acid 75 kDa
beta chain. C5 is synthesized as a single chain precursor protein
product of a single copy gene (Haviland et al. (1991) J Immunol
146:362-368). The cDNA sequence of the transcript of this gene
predicts a secreted pro-C5 precursor of 1658 amino acids along with
an 18 amino acid leader sequence (see, e.g., U.S. Pat. No.
6,355,245).
[0010] The pro-C5 precursor is cleaved after amino acids 655 and
659, to yield the beta chain as an amino terminal fragment (amino
acid residues +1 to 655 of the above sequence) and the alpha chain
as a carboxyl terminal fragment (amino acid residues 660 to 1658 of
the above sequence), with four amino acids (amino acid residues
656-659 of the above sequence) deleted between the two.
[0011] C5a is cleaved from the alpha chain of C5 by either
alternative or classical C5 convertase as an amino terminal
fragment comprising the first 74 amino acids of the alpha chain
(i.e., amino acid residues 660-733 of the above sequence).
Approximately 20 percent of the 11 kDa mass of C5a is attributed to
carbohydrate. The cleavage site for convertase action is at, or
immediately adjacent to, amino acid residue 733 of the above
sequence. A compound that would bind at, or adjacent, to this
cleavage site would have the potential to block access of the C5
convertase enzymes to the cleavage site and thereby act as a
complement inhibitor.
[0012] C5 can also be activated by means other than C5 convertase
activity. Limited trypsin digestion (see, e.g., Minta and Man
(1997) J Immunol 119:1597-1602 and Wetsel and Kolb (1982) J Immunol
128:2209-2216), thrombin, and acid treatment (Yamamoto and Gewurz
(1978) J Immunol 120:2008 and Damerau et al. (1989) Molec Immunol
26:1133-1142) can also cleave C5 and produce active C5b.
[0013] Cleavage of C5 releases C5a, a potent anaphylatoxin and
chemotactic factor, and C5b which through a series of protein
interactions leads to the formation of the lytic terminal
complement complex, C5b-9. C5a and C5b-9 also have pleiotropic cell
activating properties, by amplifying the release of downstream
inflammatory factors, such as hydrolytic enzymes, reactive oxygen
species, arachidonic acid metabolites and various cytokines.
[0014] C5b combines with C6, C7, and C8 to form the C5b-8 complex
at the surface of the target cell. Upon binding of several C9
molecules, the membrane attack complex (MAC, C5b-9, terminal
complement complex--TCC) is formed. When sufficient numbers of MACs
insert into target cell membranes the openings they create (MAC
pores) mediate rapid osmotic lysis of the target cells. Lower,
non-lytic concentrations of MACs can produce other effects. In
particular, membrane insertion of small numbers of the C5b-9
complexes into endothelial cells and platelets can cause
deleterious cell activation. In some cases activation may precede
cell lysis.
[0015] As mentioned above, C3a and C5a are anaphylatoxins. These
activated complement components can trigger mast cell
degranulation, which releases histamine from basophils and mast
cells, and other mediators of inflammation, resulting in smooth
muscle contraction, increased vascular permeability, leukocyte
activation, and other inflammatory phenomena including cellular
proliferation resulting in hypercellularity. C5a also functions as
a chemotactic peptide that serves to attract pro-inflammatory
granulocytes to the site of complement activation.
[0016] C5a receptors are found on the surfaces of bronchial and
alveolar epithelial cells and bronchial smooth muscle cells. C5a
receptors have also been found on eosinophils, mast cells,
monocytes, neutrophils, and activated lymphocytes.
SUMMARY
[0017] The present disclosure relates to, inter alia, the
generation by the inventors of a series of humanized monoclonal
antibodies that specifically bind to free C5a protein (that is, C5a
that has been proteolytically cleaved from C5 protein), but not to
paralog protein fragments free C4a or free C3a [the antibodies are,
often, referred to herein as anti-C5a antibodies or anti-C5a
neoepitope antibodies]. As described herein and exemplified in the
working examples, the generated anti-C5a antibodies exhibit a high
affinity for free C5a. For example, all of the humanized anti-C5a
antibodies described herein bind to free C5a with a K.sub.D that is
less than 1.25 nanomolar. Many of the antibodies bind to free C5a
(e.g., free human C5a) with a K.sub.D that is less than 300
picomolar; several of the antibodies bind to free C5a with a
K.sub.D that is less than 100 picomolar. In addition, the humanized
anti-C5a antibodies described herein also inhibit C5a-mediated
signaling. Further structural and functional properties of the
antibodies described herein are elaborated on below and exemplified
in the working examples.
[0018] The inventors have also demonstrated, using an animal model
of rheumatoid arthritis (RA) and a surrogate anti-mouse C5a
antibody with properties similar to the humanized antibody
counterparts, efficacy of anti-C5a antibodies in treating RA. Also
shown in the working examples are experiments demonstrating the
positive therapeutic effects of a humanized anti-C5a antibody in an
animal model of human C5a-induced neutropenia.
[0019] Accordingly, the inventors believe that the anti-C5a
antibodies, or antigen-binding fragments thereof, described herein
are useful in a host of diagnostic and therapeutic methods related
to disorders in which C5a-mediated signaling contributes to
pathogenesis. For example, the inventors assert that the humanized
anti-C5a antibodies described herein are useful for treating or
preventing RA and other complement-associated disorders including,
but not limited to: atypical hemolytic uremic syndrome (aHUS),
age-related macular degeneration (AMD), sepsis, burn (e.g., severe
burn), antiphospholipid syndrome (APS), acute respiratory distress
syndrome (ARDS), inflammation-related pain, asthma, lupus
nephritis, intrauterine growth restriction (IUGR), HELLP syndrome
(Hemolytic anemia, Elevated Liver enzymes and Low Platelet count),
Goodpasture's syndrome, and chronic obstructive pulmonary disease
(COPD). Additional disorders that are particularly amenable to
treatment with a humanized anti-C5a antibody, or antigen-binding
fragment thereof, are known in the art and recited herein.
[0020] The humanized anti-C5a antibodies described herein feature a
number of advantages, e.g., over agents that bind to, and inhibit
cleavage of, full-length or mature C5. Like such agents, the
anti-C5a antibodies (and antigen-binding fragments thereof)
described herein are capable of inhibiting the anaphylatoxic
downstream effects of C5 activation as mediated through C5 fragment
C5a. That is, the anti-C5a antibodies described herein can inhibit
the C5a-mediated inflammatory response, which is known to play an
integral part in the pathogenesis of complement-associated
disorders such as, but not limited to, sepsis, RA, and asthma.
However, as the concentration of C5 in human serum is approximately
0.37 .mu.M (Rawal and Pangburn (2001) J Immunol 166(4):2635-2642),
the use of high concentrations and/or frequent administration of
anti-C5 antibodies is often necessary to effectively inhibit C5,
and thereby inhibit the C5a-mediated inflammatory response, in a
human. Unlike C5, C5a is present in blood at much lower
concentrations and is often restricted to specific areas of local
complement activation such as, e.g., the lungs in asthma patients,
the joints of RA patients, or the drusen in the eyes of patients
with AMD. Thus, the anti-C5a antibodies described herein can be
administered (e.g., locally administered to sites of complement
activation) to a human at a much lower dose and/or less frequently
than, e.g., an anti-C5 antibody, and effectively provide the same
or greater inhibition of C5a in a human. The ability to administer
a lower dose of the anti-C5a antibody, as compared to the required
dose of an anti-C5 antibody, also allows for additional delivery
routes such as, e.g., subcutaneous administration, intramuscular
administration, intrapulmonary delivery, and administration via the
use of biologically degradable microspheres. A lower concentration
of antigen C5a versus C5 also favors a longer half-life of the
anti-C5a antibody, as compared to, e.g., the half-life of a
therapeutic antibody that targets terminal complement, due to a
reduced contribution of antigen-mediated antibody clearance.
[0021] In addition, the anti-C5a antibodies described herein can
also be distinguished from therapeutic agents that inhibit terminal
complement (such as C5 inhibitors) by their safety profile. A
notable consequence of inhibiting terminal complement components
such as C5, CSb, C6, C7, C8, or C9 is decreased protection by the
host immune system against the encapsulated bacteria that terminal
complement ordinarily lyses--for example, Neisseria meningitides
and Neisseria gonorrhoeae. See, e.g., Haeney et al. (1980) Clin Exp
Immunol 40:16-24 and Brodsky (2009) Blood 113(26):6522-6527. As the
anti-C5a antibodies inhibit the C5a-mediated inflammatory response,
but do not prevent the formation of the terminal complement complex
that lyses those encapsulated bacteria, patients receiving a
therapeutic anti-C5a antibody described herein would not require a
protective vaccination, e.g., a vaccination against Neisseria
meningitides and Neisseria gonorrhoeae.
[0022] Accordingly, in one aspect, the disclosure features an
isolated antibody, or antigen-binding fragment thereof, that binds
to free C5a. In some embodiments, the antibody or antigen-binding
fragment thereof binds to free human C5a (hC5a; e.g., a human C5a
protein comprising, or consisting of, the amino acid sequence
depicted in SEQ ID NO:1). In some embodiments, the antibody can
bind to a desarginated form of free C5a, e.g., the desarginated
form of human C5a comprising, or consisting of, the amino acid
sequence depicted in SEQ ID NO:2. The antibody can bind to a
neoepitope of free C5a, which epitope is not present on uncleaved
C5 or is present on only a minor fraction of total uncleaved
C5.
[0023] While the disclosure is in no way limited to any particular
theory or mechanism of action, in some embodiments, the anti-C5a
antibody or antigen-binding fragment thereof binds to free C5a
(e.g., free hC5a) and may also bind to a subpopulation of
uncleaved, processed C5 (e.g., plasma C5) constituting less than 10
(e.g., less than 9.5, 9, 8.5, 8, 7.5, 7, 6.5, 6, 5.5, 5, 4.5, 4,
3.5, 3, 2.5, 2, 1.5, 1, 0.5, 0.4, 0.3, 0.2, or less than 0.1) % of
the total population of full length C5 in a sample (e.g., a blood
or plasma sample or a sample comprising recombinant full length
C5), which subpopulation is, in whole or in part, denatured such
that an otherwise occluded C5a neoepitope, to which the anti-C5a
antibody or fragment binds, is exposed. Thus, an anti-C5a antibody
or antigen-binding fragment thereof described herein can, in some
embodiments, bind to free C5a, but not to the uncleaved C5 protein
of the 90% or greater uncleaved, native C5 population. In some
embodiments, the above-described partially or fully denatured
subpopulation of C5 is inactive or has reduced activity (e.g., less
than 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20,
15, 10, 5% of the activity of fully-functional, full-length C5
protein) in any number of suitable assays useful for testing C5
activity, e.g., a hemolytic assay or a CH50eq assay (see below).
Suitable methods for testing the activity of the minor
subpopulation to which an anti-C5a antibody described herein may,
in some embodiments, bind are known in the art and described
herein.
[0024] In some embodiments, any of the anti-C5a antibodies or
antigen-binding fragments thereof described herein do not inhibit
C5 activity in an in vitro hemolysis assay or an in vitro CH50eq
assay even in the presence of at least, equal to, or greater than a
5 (e.g., 5.6, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55,
60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160,
170, 180, 190, or 200)-fold excess of the anti-C5a antibody or
antigen-binding fragment thereof to uncleaved C5 (e.g., uncleaved,
native C5). In some embodiments, any of the anti-C5a antibodies or
antigen-binding fragments thereof described herein do not inhibit
C5 activity in an in vitro hemolysis assay or an in vitro CH50eq
assay even in the presence of between about a 5-fold to 200-fold
(e.g., between about 5-fold and 100-fold, between about 10-fold and
100-fold, between about 20-fold and 100-fold, or between about
10-fold and 150-fold) excess of the anti-C5a antibody or
antigen-binding fragment thereof to uncleaved, native C5.
Inhibition, e.g., as it pertains to C5 activity, includes at least
a 5 (e.g., at least a 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45,
50, 55, or 60) % decrease in the activity of uncleaved, native C5
in, e.g., a hemolytic assay or CH50eq assay as compared to the
effect of a control antibody (or antigen-binding fragment thereof)
under similar conditions and at an equimolar concentration.
Substantial inhibition, as used herein, refers to inhibition of a
given activity (e.g., of C5 activity) of at least 40 (e.g., at
least 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95 or greater) %.
In some embodiments, the C5 is obtained from plasma (e.g., purified
from or present in plasma, e.g., human plasma).
[0025] In some embodiments, the antibody or antigen-binding
fragment thereof binds to a C5a protein (e.g., a human C5a protein)
with a K.sub.D that is less than 2 nM. In some embodiments, the
antibody or antigen-binding fragment thereof binds to a C5a protein
with a K.sub.D that is less than 1 nM [also referred to herein as
"subnanomolar affinity"].
[0026] In some embodiments, the anti-C5a antibody or
antigen-binding fragment thereof binds to free C5a with a
subnanomolar affinity [e.g., a K.sub.D of less than or equal to
9.9.times.10.sup.-10 (e.g., less than or equal to
9.times.10.sup.-10, 8.times.10.sup.-10, 7.times.10.sup.-10,
6.times.10.sup.-10, 5.times.10.sup.-10, 4.times.10.sup.-10,
3.times.10.sup.-10, 2.5.times.10.sup.-10, 2.times.10.sup.-10,
1.times.10.sup.-10, 8.0.times.10.sup.-10, 7.0.times.10.sup.-10,
6.0.times.10.sup.-11, 5.0.times.10.sup.-11, 4.0.times.10.sup.-11,
or 3.0.times.10.sup.-11) M] in the presence of a molar excess of
uncleaved, native C5 (e.g., purified and/or recombinant C5). In
some embodiments, any of the anti-C5a antibodies or antigen-binding
fragments thereof described herein have at least a 100 (e.g., at
least 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250,
275, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000,
5000, 6000, 7000, 8000, 9000, or 10000)-fold greater affinity
(e.g., represented by its K.sub.D) for free C5a than for uncleaved,
native C5 protein.
[0027] Thus, in another aspect, the disclosure features an antibody
or antigen-binding fragment thereof that (a) binds to free C5a
(e.g., hC5a) with a subnanomolar affinity and (b) binds to free C5a
with an affinity that is at least 100 (e.g., at least 110, 120,
130, 140, 150, 160, 170, 180, 190, 200, 225, 250, 275, 300, 400,
500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000,
8000, 9000, or 10000)-fold greater than its corresponding affinity
for uncleaved, native C5 protein. For example, an anti-C5a antibody
or antigen-binding fragment thereof described herein can, in some
embodiments, bind to free hC5a with a K.sub.D of 100 nM and to at
least a subpopulation of uncleaved human C5 protein with a K.sub.D
that is at least 100-fold higher (e.g., at least 10 nM).
[0028] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that binds to a free
human C5a polypeptide having the amino acid sequence depicted in
SEQ ID NO:1, wherein the antibody or antigen-binding fragment
thereof binds to the human C5a polypeptide with a K.sub.D that is
less than 1.25.times.10.sup.-9 M in the presence of a molar excess
(e.g., a 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45,
50, 60, 70, 80, 90, 100, 150, 200, 300, 400, or 500-fold molar
excess) of uncleaved, native human C5 over human C5a (hC5a). In
some embodiments, the antibody or antigen-binding fragment thereof
binds to a free hC5a polypeptide with a subnanomolar affinity
(e.g., any of the subnanomolar K.sub.D's recited herein) in the
presence of at least, or greater than, a 2-fold molar excess, but
no greater or less than a 500 (e.g., 500, 450, 400, 350, 300, 250,
200, 150, 100, 90, 80, 70, 60, 50, 40, 30, 25, 20, or 15)-fold
molar excess of uncleaved, native C5 over free hC5a. In some
embodiments, the antibody or antigen-binding fragment thereof binds
to a free hC5a polypeptide with a subnanomolar affinity (e.g., any
of the subnanomolar K.sub.D's recited herein) in the presence of
between 2-fold and 20-fold molar excess of uncleaved, native C5
over free hC5a. In some embodiments, an antibody or antigen-binding
fragment thereof binds to a free hC5a polypeptide with a
subnanomolar affinity (e.g., any of the subnanomolar K.sub.D's
recited herein) in the presence of between 10-fold and 20-fold
molar excess of uncleaved, native C5 over free hC5a. In some
embodiments, an antibody or antigen-binding fragment thereof binds
to a free hC5a polypeptide with a subnanomolar affinity (e.g., any
of the subnanomolar K.sub.D's recited herein) in the presence of
between 5-fold and 15-fold molar excess of uncleaved, native C5
over free hC5a. In some embodiments, an antibody or antigen-binding
fragment thereof binds to a free hC5a polypeptide with a
subnanomolar affinity (e.g., any of the subnanomolar K.sub.D's
recited herein) in the presence of at least 2-fold, but no greater
than a 20-fold molar excess of uncleaved, native C5 over free hC5a.
Such measurements can be in vitro measurements using, e.g.,
standard affinity determination techniques, many of which are
recited and/or described herein.
[0029] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that binds to a human
C5a polypeptide having the amino acid sequence depicted in SEQ ID
NO:1, wherein the antibody or antigen-binding fragment thereof
binds to the human C5a polypeptide with a K.sub.D that is less than
1.25.times.10.sup.-9 M and wherein the antibody or antigen-binding
fragment thereof does not substantially inhibit, as compared to an
equimolar amount of a control antibody or antigen-binding fragment
thereof, C5 activity even in the presence of less than, or equal
to, a 10-fold molar excess of the anti-C5a antibody or
antigen-binding fragment thereof to uncleaved, native C5.
[0030] In some embodiments of any of the anti-C5a antibodies or
antigen-binding fragments thereof described herein, the antibody or
antigen-binding fragment thereof binds to free human C5a and is
cross-reactive with free C5a from at least one non-human mammalian
species. For example, in some embodiments, an anti-C5a antibody (or
antigen-binding fragment thereof) binds to free C5a from human
(e.g., with subnanomolar affinity) and also binds to free C5a from
a non-human primate (e.g., cynomolgus macaque, rhesus macaque, ape,
baboon, chimpanzee, orangutan, or gorilla), a rodent (e.g., mouse,
rat, hamster, Guinea pig, or rabbit), cow, goat, donkey, pig, dog,
cat, or horse. In some embodiments, an anti-C5a antibody or
antigen-binding fragment thereof described herein binds to free
hC5a with a K.sub.D of less than or equal to 9.9.times.10.sup.-10
(e.g., less than or equal to 9.times.10.sup.-10,
8.times.10.sup.-10, 7.times.10.sup.-10, 6.times.10.sup.-10,
5.times.10.sup.-10, 4.times.10.sup.-10, 3.times.10.sup.-10,
2.5.times.10.sup.-10, 2.times.10.sup.-10, 1.times.10.sup.-10,
8.0.times.10.sup.-10, 7.0.times.10.sup.-10, 6.0.times.10.sup.-11,
5.0.times.10.sup.-11, 4.0.times.10.sup.-11, or
3.0.times.10.sup.-11) M and also binds to free C5a from cynomolgus
macaque (or another non-human primate species), wherein the
affinity (e.g., represented by its K.sub.D) for human C5a is no
more than 500 (e.g., no more than 5, 10, 20, 30, 40, 50, 60, 70,
80, 90, 100, 125, 150, 200, 250, 300, 350, 400, 450, or 475)-fold
greater than the affinity for cynomolgus macaque (or other
non-human primate species) C5a. For example, in some embodiments,
the anti-C5a antibody binds to free hC5a with an affinity that is
no more than 50-fold greater than the corresponding affinity of the
antibody for non-human primate C5a (e.g., a K.sub.D for free hC5a
of 100 nM and a K.sub.D for non-human primate C5a of no more than 5
nM). In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof described herein binds to free hC5a with a K.sub.D
of less than or equal to 9.9.times.10.sup.-10 (e.g., less than or
equal to 9.times.10.sup.-10, 8.times.10.sup.-10,
7.times.10.sup.-10, 6.times.10.sup.-10, 5.times.10.sup.-10,
4.times.10.sup.-10, 3.times.10.sup.-10, 2.5.times.10.sup.-10,
2.times.10.sup.-10, 1.times.10.sup.-10, 8.0.times.10.sup.-11,
7.0.times.10.sup.-11, 6.0.times.10.sup.-11, 5.0.times.10.sup.-11,
4.0.times.10.sup.-11, or 3.0.times.10.sup.-11) M and also binds to
C5a from a rodent (e.g., mouse, rat, or rabbit), wherein the
affinity (e.g., represented by its K.sub.D) for human C5a is no
more than 1000 (e.g., no more than 5, 10, 20, 30, 40, 50, 60, 70,
80, 90, 100, 125, 150, 200, 250, 300, 350, 400, 450, 475, 500, 550,
600, 650, 700, 750, 800, 850, 900, 950, or 975)-fold greater than
the affinity for rodent C5a. In some embodiments, any of the
anti-C5a antibodies or antigen-binding fragments thereof described
herein bind with subnanomolar affinity to both human C5a and to C5a
from a non-human mammal (e.g., a rodent or a non-human primate such
as cynomolgus macaque). An antibody or antigen-binding fragment
thereof can, in some embodiments, bind to human C5a and non-human
primate C5a with equal affinity (e.g., an equivalent K.sub.D).
[0031] For example, the disclosure features an antibody or
antigen-binding fragment thereof that binds to free human C5a with
subnanomolar affinity [e.g., a K.sub.D of less than or equal to
9.9.times.10.sup.-10 (e.g., less than or equal to
9.times.10.sup.-10, 8.times.10.sup.-10, 7.times.10.sup.-10,
6.times.10.sup.-10, 5.times.10.sup.-10, 4.times.10.sup.-10,
3.times.10.sup.-10, 2.5.times.10.sup.-10, 2.times.10.sup.-10,
1.times.10.sup.-10, 8.0.times.10.sup.-11, 7.0.times.10.sup.-11,
6.0.times.10.sup.-11, 5.0.times.10.sup.-11, 4.0.times.10.sup.-11,
or 3.0.times.10.sup.-11) M] and is cross-reactive with free C5a
from cynomolgus macaque (or other non-human primate), the antibody
or antigen-binding fragment thereof binding to cynomolgus macaque
(or other non-human primate) C5a with a K.sub.D of less than
10.times.10.sup.-9, 9.times.10.sup.-9, 8.times.10.sup.-9,
7.times.10.sup.-9, 6.times.10.sup.-9, 5.times.10.sup.-9,
4.times.10.sup.-9, 3.times.10.sup.-9, 2.times.10.sup.-9,
1.times.10.sup.-9, 9.9.times.10.sup.-10 (e.g., less than
9.times.10.sup.-10, 8.times.10.sup.-10, 7.times.10.sup.-10,
6.times.10.sup.-10, 5.times.10.sup.-10, 4.times.10.sup.-10,
3.times.10.sup.-10, 2.5.times.10.sup.-10, 2.times.10.sup.-10,
1.times.10.sup.-10, or 8.0.times.10.sup.-11) M], wherein the
affinity for human C5a is no more than 500 (e.g., no more than 5,
10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 200, 250, 300,
350, 400, 450, or 475)-fold greater than the affinity for
cynomolgus macaque (or non-human primate) C5a (e.g., K.sub.D for
human C5a of 100 nM and a K.sub.D for non-human primate C5a of no
more than 50 nM). Suitable methods for determining the affinity of
an antibody or antigen-binding fragment thereof for a given antigen
are known in the art and described and exemplified herein.
[0032] In some embodiments, the cross-reactive anti-C5a antibody or
antigen-binding fragment thereof functionally inhibits both free
hC5a and the non-human mammalian C5a to which it binds. For
example, an antibody inhibits by at least 70 (e.g., at least 75,
80, 85, 90, or 95 or greater) % human C5a-dependent human
neutrophil activation at a molar ratio of 1:1 (antigen-binding
site:C5a) and inhibits by at least 70 (e.g., at least 75, 80, 85,
90, or 95 or greater) % non-human mammalian C5a-dependent
neutrophil activation (the neutrophils being from the same species
as the non-human mammalian C5a to which the antibody binds) at a
molar ratio of 1:1 (antigen-binding site:C5a).
[0033] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that binds to a free
hC5a polypeptide having the amino acid sequence depicted in SEQ ID
NO:1, wherein the antibody or antigen-binding fragment thereof
binds to the human C5a polypeptide with a K.sub.D that is less than
1.25.times.10.sup.-9 M and wherein the antibody or antigen-binding
fragment thereof binds to both hC5a and to C5a from a non-human
mammalian species. The non-human mammalian species can be, e.g., a
non-human primate such as cynomolgus macaque, rhesus macaque, or
baboon. In some embodiments, the non-human mammalian species is a
rodent such as a mouse, rat, rabbit, Guinea pig, gerbil, or
hamster. In some embodiments, the antibody or antigen-binding
fragment thereof binds to hC5a with an affinity no greater than
100-fold higher than the corresponding affinity for C5a from the
non-human mammalian species. In some embodiments, the antibody or
antigen-binding fragment inhibits by at least 50% human
C5a-dependent human neutrophil activation at a molar ratio of 1:1
(antigen-binding site: C5a).
[0034] In some embodiments, the antibody or antigen-binding
fragment thereof binds to free C5a from a non-human primate (e.g.,
a cynomolgus macaque or rhesus macaque), the free C5a protein
having an amino acid sequence comprising, or consisting of, the
amino acid sequence depicted in SEQ ID NO:179 or SEQ ID NO:180.
[0035] As described in the working examples, the inventors have
also discovered a bivalent anti-C5a antibody, BNJ383, that binds to
free C5a (in this case human C5a) with high affinity and, with a
much lower affinity, uncleaved human C5 (hC5), wherein, in a
composition (e.g., an aqueous solution) under physiological
conditions at equilibrium, and in the presence of a molar excess of
uncleaved human C5 as compared to the molar amount of the
antigen-binding sites of the antibodies, at least 95% of the
plurality of antibodies each bind no more than one hC5 molecule.
The second antigen-binding site of the at least 95% of the
plurality of antibodies remains available (e.g., substantially
available) to bind to free C5a. While the disclosure is in no way
bound by any particular theory or mechanism of action, the
inventors believe that the bivalent anti-C5a antibody binds to
uncleaved C5 in such a way (e.g., at such an epitope) that steric
hindrance precludes, or at least substantially inhibits, the
binding of the second antigen-binding site of the anti-C5a antibody
to a second uncleaved C5 protein, although the antibody can easily
accommodate the binding to two hC5a molecules. Thus, the antibody,
even in a molar excess of uncleaved C5, retains the ability to bind
to free C5a with high affinity and thereby retains, even in that
molar excess, the ability to inhibit the pro-inflammatory activity
of C5a.
[0036] One of ordinary skill in the art would easily and readily
appreciate the myriad therapeutic benefits of such an anti-C5a
antibody. For example, as noted above, the concentration of
circulating C5 in human serum is very high. Thus, when introduced
into a mammal, an anti-C5a antibody that is capable of
simultaneously binding to two uncleaved C5 molecules would be
rapidly inactivated in the molar excess of C5 and would then no
longer be capable of binding to free C5a in the event of complement
activation. And, as with anti-C5 antibodies, use of high
concentrations and/or frequent administration of this type of
anti-C5a antibody would be necessary to effectively inhibit C5a, in
the event that it is produced. In contrast, the anti-C5a antibody
described herein that retains the ability to bind to free C5a, even
in a molar excess of uncleaved C5, can thus be administered to a
human at a much lower dose and/or less frequently than, e.g., an
anti-C5 antibody and effectively provide the same or greater
inhibition of C5a in the human.
[0037] Accordingly, in yet another aspect, the disclosure features
an isolated antibody comprising two antigen-binding sites, wherein
each antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein, in an aqueous solution
comprising: (i) a plurality of said antibodies and (ii) a molar
excess of hC5 as compared to the molar amount of the
antigen-binding sites, at equilibrium and under physiological
conditions, at least 95 (e.g., at least 95.5, 96, 96.5, 97, 97.5,
or 97.7) % of said plurality of antibodies bind no more than one
hC5 molecule, i.e., no more than 5% of the antibodies are binding
two molecules of hC5 at equilibrium.
[0038] In another aspect, the disclosure features an isolated
antibody comprising two antigen-binding sites, wherein each
antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein, at equilibrium and
under physiological conditions, in an aqueous solution comprising:
(i) a plurality of said antibodies and (ii) a molar excess of hC5
as compared to the molar amount of the antigen-binding sites (or
antibodies), at least 95% of said plurality of antibodies retain at
least one antigen-binding site available to bind free hC5a.
[0039] In another aspect, the disclosure features an isolated
antibody comprising two antigen-binding sites, wherein each
antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein, at equilibrium and
under physiological conditions, in an aqueous solution comprising:
(i) a plurality of said antibodies and (ii) a molar excess of hC5
as compared to the molar amount of the antigen-binding sites (or
antibodies), each antigen-binding site of no more than 5% of said
plurality of antibodies is bound to a hC5 molecule.
[0040] In some embodiments of any of the isolated antibodies
described herein, the molar excess is at least a two-fold (e.g., at
least a 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold,
9-fold, or even 10-fold) molar excess.
[0041] In some embodiments of any of the isolated antibodies
described herein, the physiological condition is 3.9 mM
NaH.sub.2PO.sub.4, 6.1 mM Na.sub.2HPO.sub.4, and 150 mM NaCl, at
pH7.0.
[0042] In some embodiments of any of the isolated antibodies
described herein, each antigen-binding site independently can bind
to free hC5a with a K.sub.D that is less than 1.25.times.10.sup.-9
M. In some embodiments, each antigen-binding site can independently
bind to free hC5a with a subnanomolar affinity (see above).
[0043] In some embodiments of any of the isolated antibodies
described herein, the isolated antibody comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:42 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:45.
[0044] In some embodiments of any of the isolated antibodies
described herein, the isolated antibody comprises: (i) a light
chain CDR1 comprising the amino acid sequence depicted in SEQ ID
NO:20; (ii) a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:21; (iii) a light chain CDR3 comprising the
amino acid sequence depicted in SEQ ID NO:22; (iv) a heavy chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:28;
(v) a heavy chain CDR2 comprising the amino acid sequence depicted
in SEQ ID NO:46; and (vi) a heavy chain CDR3 comprising the amino
acid sequence depicted in SEQ ID NO:47.
[0045] In some embodiments, the isolated antibody can comprise any
of the light chain CDR sets described herein, any of the light
chain variable regions described herein (e.g., any of the humanized
light chain variable regions), any of the heavy chain CDR sets
described herein, any of the heavy chain variable regions described
herein (e.g., any of the humanized heavy chain variable regions),
or any suitable combinations thereof. See, e.g., Tables 1 or 2.
[0046] In another aspect, the disclosure features a method for
treating a human afflicted with a complement-associated disorder
(e.g., a C5a-associated complement disorder), wherein the method
includes administering to the human any of the isolated antibodies
described herein in an amount sufficient to treat the
complement-associated disorder.
[0047] In another aspect, the disclosure features a method for
treating a human afflicted with a C5a-associated complement
disorder, wherein the method comprises administering to the human
at least 0.6 (e.g., at least 0.7, 0.8, 0.9, or 1) mg of any of the
isolated antibodies described herein per kg body weight of the
human to thereby partially or completely bind and sequester
nanogram levels of free C5a for greater than, equal to, or at least
12 (e.g., 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25)
days.
[0048] In another aspect, the disclosure features a method for
treating a human afflicted with a C5a-associated complement
disorder, wherein the method comprises administering to the human
at least 10 mg of any of the isolated antibodies described herein
per kg body weight of the human to thereby partially or completely
bind and sequester nanogram levels of free C5a for at least 24
days.
[0049] In another aspect, the disclosure features a method for
treating a human afflicted with a C5a-associated complement
disorder, wherein the method comprises administering to the human
any of the isolated antibodies described herein (or for example a
pharmaceutical composition comprising any of the isolated
antibodies described herein) in an amount sufficient to (a) achieve
molar Cmax values equal to or less than the physiologic molar
concentration of uncleaved hC5 and (b) partially or completely bind
and sequester pathophysiologic levels of free C5a.
[0050] In some embodiments of any of the methods described herein,
an antibody is administered to a subject (e.g., a human) in an
amount sufficient to achieve a molar Cmax value that is
substantially lower than the physiologic molar concentration of
uncleaved C5 (e.g., hC5).
[0051] In some embodiments of any of the methods described herein,
the Cmax value is, e.g., no greater than 80 nM (or approximately
0.6 mg/kg). In some embodiments, Cmax levels are no greater than 70
(e.g., 60, 50, 40, 30, or 20) nM. In some embodiments, the Cmax
value is no greater than approximately 100 nM. In some embodiments,
the Cmax value is no greater than 200 nM. In some embodiments of
any of the methods described herein, the Cmax value is, e.g., no
greater than 400 nM (or approximately 3 mg/kg). In some
embodiments, the Cmax value is no greater than 400 (e.g. 350, 300,
250, 200, 150, 100, 90, 80, 70, 60, 50, 40, 30, 20 or 10) nM. In
another aspect, the disclosure features a method for treating a
human afflicted with a C5a-associated complement disorder, wherein
the method comprises administering to the human any of the isolated
antibodies described herein (or for example a pharmaceutical
composition comprising any of the isolated antibodies described
herein) in an amount sufficient to (a) achieve molar Cmax values
equal to, less than, or substantially lower than the molar
physiologic concentration of uncleaved hC5 and (b) partially or
completely bind and sequester nanogram levels of free C5a for at
least 12 days (e.g., at least 24 days). Suitable Cmax values are
described above.
[0052] In some embodiments of any of the methods described herein,
the C5a-associated complement disorder can be, e.g., one selected
from the group consisting of sepsis, acute respiratory distress
syndrome (ARDS), septic shock, anti-phospholipid syndrome,
catastrophic anti-phospholipid syndrome, disseminated intravascular
coagulation, lupus nephritis, Goodpasture's Syndrome, burn or
severe burn, asthma, HELLP syndrome (Hemolytic anemia, Elevated
Liver enzymes and Low Platelet count), inflammation-induced pain,
C5a-mediated neutropenia, age-related macular degeneration (AMD),
chronic obstructive pulmonary disease, and rheumatoid
arthritis.
[0053] In yet another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, each antibody of the
plurality comprising two antigen-binding sites, wherein each
antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), and wherein, in the presence of
human C5 (hC5) and under physiological conditions, no more than 5%
of the antibodies of the plurality at equilibrium comprise two
antigen-binding sites simultaneously bound to uncleaved hC5.
[0054] In some embodiments of any of the compositions described
herein, the percentage of the plurality in any particular binding
configuration can be evaluated using high performance liquid
chromatography (HPLC). In some embodiments, the physiological
conditions in which the antibodies are evaluated comprises the
following conditions: incubation of hC5 (e.g., a molar excess
(e.g., a 2-fold molar excess) of hC5) with the plurality of
antibodies at 4.degree. C. for 84 hours in an aqueous solution
comprising 3.9 mM NaH.sub.2PO.sub.4, 6.1 mM Na.sub.2HPO.sub.4, and
150 mM NaCl, at pH7.0. For the purposes of this disclosure, the
solution obtained at 84 hours at 4.degree. C. is considered to be
at equilibrium.
[0055] In some embodiments of any of the compositions described
herein, no more than 5% of the antibodies of the plurality comprise
two antigen-binding sites simultaneously bound to uncleaved hC5
under physiological conditions and in the presence of at least a
2-fold molar excess of hC5 to antibody.
[0056] In some embodiments of any of the compositions described
herein, no more than 5% of the antibodies of the plurality comprise
two antigen-binding sites simultaneously bound to uncleaved hC5
molecules as evaluated using HPLC following incubation of the
plurality of antibodies with hC5 at 4.degree. C. for 84 hours in an
aqueous solution comprising 3.9 mM NaH.sub.2PO.sub.4, 6.1 mM
Na.sub.2HPO.sub.4, and 150 mM NaCl, at pH7.0.
[0057] In another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, each antibody of the
plurality comprising two antigen-binding sites, wherein each
antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), and wherein no more than 5% of
the antibodies of the plurality comprise two antigen-binding sites
simultaneously bound to uncleaved hC5 as evaluated (e.g., using
HPLC) following incubation of the plurality of antibodies with hC5
at 4.degree. C. for 84 hours in an aqueous solution comprising 3.9
mM NaH.sub.2PO.sub.4, 6.1 mM Na.sub.2HPO.sub.4, and 150 mM NaCl, at
pH7.0.
[0058] In yet another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, each antibody of the
plurality comprising a first antigen-binding site and a second
antigen-binding site, wherein each antigen-binding site
independently can bind to free human C5a (hC5a) or uncleaved human
C5 (hC5), wherein each antigen-binding site independently can bind
to the free hC5a polypeptide with a K.sub.D that is less than
1.25.times.10.sup.-9 M, and wherein, in the presence of human C5
(hC5) and as evaluated (e.g., using high performance liquid
chromatography (HPLC)) under physiological conditions, the two
antigen-binding sites of at least 95% of the plurality of
antibodies are occupied by uncleaved hC5 in the following
configurations: (i) the first antigen-binding site binds uncleaved
hC5 and the second antigen-binding site is unbound; or (ii) the
first antigen-binding site is unbound and the second
antigen-binding site binds uncleaved hC5.
[0059] In yet another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, each antibody of the
plurality comprising two antigen-binding sites, wherein each
antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), and wherein, in the presence of
human C5 (hC5) and as evaluated (e.g., using high performance
liquid chromatography (HPLC)) under physiological conditions, at
least 95% of the antibodies of the plurality comprise at least one
antigen-binding site capable of binding to free hC5a.
[0060] In some embodiments of any of the compositions described
herein, the plurality of antibodies is evaluated in the presence of
at least a 2-fold molar excess of hC5:antibody. In some embodiments
of any of the compositions described herein, the plurality of
antibodies is evaluated in the presence of at least a 2-fold molar
excess of hC5:antigen-binding sites.
[0061] In yet another aspect, the disclosure features an isolated
antibody comprising two antigen-binding sites, wherein the antibody
binds to free C5a or uncleaved C5, and wherein one of the
antigen-binding sites of the antibody remains available to bind
free C5a in the presence of a molar excess (e.g., at least or
greater than a 2-fold, 5-fold, 10-fold, 15-fold, or even a 20-fold
molar excess) of uncleaved C5.
[0062] In some embodiments, the antigen-binding sites have the same
specificity (e.g., the CDRs of each of the two antigen-binding
sites share identical amino acid sequences). In some embodiments,
free C5a is human C5a. In some embodiments, the antibody is
cross-reactive between human C5a and C5a from a non-human mammalian
species. The antibody can, in some embodiments, bind to free C5a
with a subnanomolar affinity. In some embodiments, the antibody has
an affinity for C5a that is at least 100-fold greater than its
corresponding affinity for uncleaved C5.
[0063] In another aspect, the disclosure features an isolated
antibody comprising two antigen-binding sites, wherein each
antigen-binding site independently binds to free human C5a (hC5a)
or uncleaved human C5 (hC5), and wherein, at any concentration of
uncleaved hC5 (e.g., in a molar excess of uncleaved hC5 over hC5a),
at least one of the antigen-binding sites of the antibody remains
available to bind to free hC5a (e.g., under human physiological
conditions, e.g., in human blood or serum).
[0064] In another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, wherein each
antibody of the plurality comprises two antigen-binding sites,
wherein each of the antigen-binding sites independently can bind to
free human C5a (hC5a) or uncleaved human C5 (hC5), and wherein, at
a molar ratio of 1:1 (antibody:hC5), no more than, or less than, 5
(e.g., no more than, or less than 4.9, 4.8, 4.7, 4.6, 4.5, 4.4,
4.3, 4.2, 4.1, 4.0, 3.9, 3.8, 3.7, 3.6, 3.5, 3.4, 3.3, 3.2, 3.1,
3.0, 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.1, 2.0, 1.9, 1.8,
1.7, 1.6, 1.5, 1.4, 1.3, 1.2, 1.1, or 1) % of the antibodies of the
plurality comprise two antigen-binding sites simultaneously bound
to uncleaved hC5. In some embodiments, each antigen-binding site
independently can bind to free hC5a with a K.sub.D that is less
than 1.25.times.10.sup.-9 M (or, for example, with subnanomolar
affinity).
[0065] In another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, wherein each
antibody of the plurality comprises two antigen-binding sites,
wherein each of the antigen-binding sites independently can bind to
free human C5a (hC5a) or uncleaved human C5 (hC5), and wherein, in
the presence of physiologic levels of uncleaved hC5, the antibodies
of the plurality partially or completely bind and sequester
nanogram levels of free C5a for greater than, equal to, or at least
12 (e.g., 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25)
days when administered to a human at doses of 1 mg/kg or
higher.
[0066] In another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, wherein each
antibody of the plurality comprises two antigen-binding sites,
wherein each of the antigen-binding sites independently can bind to
free human C5a (hC5a) or uncleaved human C5 (hC5), and wherein, in
the presence of physiologic levels of uncleaved hC5, the antibodies
of the plurality partially or completely bind and sequester
nanogram levels of free C5a for greater than, equal to, or at least
12 (e.g., 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25)
days when administered to a human at doses of 10 mg/kg or
higher.
[0067] In another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, wherein each
antibody of the plurality comprises two antigen-binding sites,
wherein each of the antigen-binding sites independently can bind to
free human C5a (hC5a) or uncleaved human C5 (hC5), and wherein, in
the presence of physiologic levels of uncleaved hC5, the antibodies
of the plurality partially or completely binds and sequesters
nanogram levels of free C5a for greater than, equal to, or at least
12 (e.g., 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25)
days when administered at doses achieving molar Cmax values
substantially lower than the molar physiologic concentration of
uncleaved hC5.
[0068] In another aspect, the disclosure features a composition
comprising a plurality of isolated antibodies, wherein each
antibody of the plurality comprises two antigen-binding sites,
wherein each of the antigen-binding sites independently can bind to
free human C5a (hC5a) or uncleaved human C5 (hC5), and wherein, in
the presence of physiologic levels of uncleaved hC5, the antibodies
of the plurality partially or completely bind and sequester
pathophysiologic levels of free C5a when administered at doses
achieving molar Cmax values substantially lower than the molar
physiologic concentration of un-cleaved hC5.
[0069] In another aspect, the disclosure features an isolated
antibody comprising a first antigen-binding site and a second
antigen-binding site, wherein each antigen-binding site
independently can bind to free human C5a (hC5a) or uncleaved human
C5 (hC5), and wherein, when both antigen-binding sites are
fully-occupied (and, e.g., under human physiological conditions,
e.g., in human blood or serum), the following binding
configurations are possible: (i) the first antigen-binding site
binds free hC5a and the second antigen-binding site binds uncleaved
hC5; (ii) the first antigen-binding site binds free hC5a and the
second antigen-binding site binds free hC5a; or (iii) the first
antigen-binding site binds uncleaved hC5 and the second
antigen-binding site binds free hC5a.
[0070] In yet another aspect, the disclosure features an isolated
antibody comprising a first antigen-binding site and a second
antigen-binding site, wherein each antigen-binding site
independently can bind to free human C5a (hC5a) or uncleaved human
C5 (hC5), wherein each antigen-binding site independently can bind
to free hC5a with a K.sub.D that is less than 1.25.times.10.sup.-9
M (or, for example, with subnanomolar affinity), and wherein, in a
physiological solution containing a plurality of the antibodies, at
least 95% of the antibodies are in the following configurations:
(i) the first antigen-binding site binds free hC5a and the second
antigen-binding site binds uncleaved hC5; (ii) the first
antigen-binding site binds free hC5a and the second antigen-binding
site binds free hC5a; (iii) the first antigen-binding site binds
uncleaved hC5 and the second antigen-binding site binds free hC5a;
(iv) the first antigen-binding site binds uncleaved hC5 and the
second antigen-binding site is unbound; (v) the first
antigen-binding site binds hC5a and the second antigen-binding site
is unbound; (vi) the first antigen-binding site is unbound and the
second antigen-binding site binds uncleaved hC5; (vii) the first
antigen-binding site is unbound and the second antigen-binding site
binds hC5a; and (viii) the first antigen-binding site is unbound
and the second antigen-binding site is unbound.
[0071] In another aspect, the disclosure features an isolated
antibody comprising two antigen-binding sites, wherein each
antigen-binding site independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), and wherein, in a molar excess
of uncleaved hC5 over hC5a, the antibody inhibits by at least 50%
hC5a-dependent human neutrophil activation at a molar ratio of 1:1
(antigen-binding site: hC5a).
[0072] In some embodiments of any of the antibodies described
herein, the configurations are possible under human physiological
conditions with fully-folded, native, human C5a and C5
proteins.
[0073] In some embodiments of any of the antibodies described
herein, the antibody binds to free hC5a with a K.sub.D that is less
than 1.25.times.10.sup.-9 M (or, for example, with subnanomolar
affinity).
[0074] In yet another aspect, the disclosure features an antibody
that (a) binds to free C5a (e.g., hC5a) with a subnanomolar
affinity and (b) binds to free C5a with an affinity that is at
least 100 (e.g., at least 110, 120, 130, 140, 150, 160, 170, 180,
190, 200, 225, 250, 275, 300, 400, 500, 600, 700, 800, 900, 1000,
2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or 10000)-fold
greater than its corresponding affinity for uncleaved C5 protein.
In a physiologic composition comprising a plurality of the
antibodies, for at least 95% of the antibodies, only one
antigen-binding site of the antibody binds to uncleaved C5 protein,
whereas the second antigen-binding site remains available to bind
to free C5a. (The hC5a can have the amino acid sequence depicted in
SEQ ID NO:1.)
[0075] In another aspect, the disclosure features a method for
treating a human afflicted with a C5a-associated complement
disorder, the method comprising administering to the human a
composition comprising a plurality of isolated antibodies, wherein
each antibody of the plurality comprises two antigen-binding sites,
wherein each of the antigen-binding sites independently can bind to
free human C5a (hC5a) or uncleaved human C5 (hC5), wherein at least
1 mg of the antibodies per kg body weight of the human is
administered to the human, and wherein administration of the
antibodies is effective to partially or completely bind and
sequester nanogram levels of free C5a for at least 12 days.
[0076] In another aspect, the disclosure features a method for
treating a human afflicted with a complement-associated disorder
(e.g., a C5a-associated complement disorder), the method comprising
administering to the human a composition comprising a plurality of
isolated antibodies, wherein each antibody of the plurality
comprises two antigen-binding sites, wherein each of the
antigen-binding sites independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein at least 10 mg of the
antibodies per kg body weight of the human is administered to the
human, and wherein administration of the antibodies is effective to
partially or completely bind and sequester nanogram levels of free
C5a for at least 24 days.
[0077] In another aspect, the disclosure features a method for
treating a human afflicted with a complement-associated disorder
(e.g., a C5a-associated complement disorder), the method comprising
administering to the human a composition comprising a plurality of
isolated antibodies, wherein each antibody of the plurality
comprises two antigen-binding sites, wherein each of the
antigen-binding sites independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein the antibodies are
administered at a dose sufficient to: (a) achieve molar Cmax values
substantially lower than the molar physiologic concentration of
uncleaved hC5 and (b) partially or completely bind and sequester
nanogram levels of free C5a for at least 12 days.
[0078] In another aspect, the disclosure features a method for
treating a human afflicted with a complement-associated disorder
(e.g., a C5a-associated complement disorder), the method comprising
administering to the human a composition comprising a plurality of
isolated antibodies, wherein each antibody of the plurality
comprises two antigen-binding sites, wherein each of the
antigen-binding sites independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein the antibodies are
administered at a dose sufficient to: (a) achieve molar Cmax values
substantially lower than the molar physiologic concentration of
uncleaved hC5 and (b) partially or completely bind and sequester
nanogram levels of free C5a for at least 24 days.
[0079] In another aspect, the disclosure features a method for
treating a human afflicted with a complement-associated disorder
(e.g., a C5a-associated complement disorder), the method comprising
administering to the human a composition comprising a plurality of
isolated antibodies, wherein each antibody of the plurality
comprises two antigen-binding sites, wherein each of the
antigen-binding sites independently can bind to free human C5a
(hC5a) or uncleaved human C5 (hC5), wherein the antibodies are
administered at a dose sufficient to: (a) achieve molar Cmax values
substantially lower than the molar physiologic concentration of
uncleaved hC5 and (b) partially or completely bind and sequester
pathophysiologic levels of free C5a.
[0080] It is understood that any of the compositions (e.g.,
comprising a plurality of antibodies) or isolated antibodies (e.g.,
that retain, in the presence of C5 or molar excess of C5, a free
Fab arm capable of binding to free C5a) described herein can be:
(a) formulated as pharmaceutical compositions in accordance with
the disclosure, (b) included in therapeutic kits (described
herein), or (c) included in the pre-filled syringes described
herein.
[0081] As described in the working examples provided herein, the
inventors have also discovered an antibody, BNJ383 (see below),
that not only binds with high affinity (subnanomolar affinity) to
free hC5a, but at concentrations in excess of uncleaved C5 also
inhibits terminal complement complex (TCC) formation in a dose
dependent manner. Even at concentrations of the anti-C5a antibody
in greater than 6.5-fold excess of C5, however, inhibition of TCC
is not complete. While the disclosure is by no means limited by any
particular theory or mechanism of action, the antibody may inhibit
TCC formation by binding to at least a fraction of uncleaved C5 and
preventing its cleavage and/or otherwise preventing the successful
association of C5 with additional TCC components. The inventors
appreciated that such an antibody is useful for treating
complement-associated disorders, e.g., in which C5a plays a
significant role and the C5b-containing TCC may play a less
substantial role. Such disorders can include, e.g., sepsis, acute
respiratory distress syndrome (ARDS), septic shock,
anti-phospholipid syndrome, catastrophic anti-phospholipid
syndrome, disseminated intravascular coagulation, lupus nephritis,
Goodpasture's Syndrome, burn or severe burn, asthma, HELLP syndrome
(Hemolytic anemia, Elevated Liver enzymes and Low Platelet count),
inflammation-induced pain, C5a-mediated neutropenia, age-related
macular degeneration (AMD), chronic obstructive pulmonary disease,
and rheumatoid arthritis.
[0082] The inventors also appreciated that use of such an anti-C5a
antibody to treat these conditions, among others, may provide an
even more beneficial safety profile as compared to use of terminal
complement inhibitory drugs. As noted above, one notable
consequence of inhibiting terminal complement components such as
C5, C5b, C6, C7, C8, or C9 is decreased protection by the host
immune system against the encapsulated bacteria that terminal
complement ordinarily lyses--for example, Neisseria meningitides
and Neisseria gonorrhoeae. As the anti-C5a antibodies described in
this section inhibit the C5a-mediated inflammatory response, but do
not completely inhibit the formation of the terminal complement
complex that lyses those encapsulated bacteria, patients receiving
a therapeutic anti-C5a antibody described herein may not require a
protective vaccination, e.g., a vaccination against Neisseria
meningitides and Neisseria gonorrhoeae. Partial inhibition of the
TCC, while not wholly abrogating terminal complement's
anti-microbial response, may in fact reduce TCC-induced
inflammation as tissue injury. The partial TCC inhibition, in
combination with inhibition of C5a, is believed to make the
anti-C5a antibody an even more potent anti-inflammatory
compound.
[0083] Accordingly, in another aspect, the disclosure features an
antibody or antigen-binding fragment thereof that binds to free
C5a, wherein the free C5a is human C5a having the amino acid
sequence depicted in SEQ ID NO:1, wherein the antibody inhibits the
binding of C5a to C5a receptor, and wherein the antibody partially
inhibits formation of the terminal complement complex (TCC).
Partial inhibition by an anti-C5a antibody or antigen-binding
fragment thereof described herein can be, e.g., a complement
activity that is, in the presence of the antibody, up to, or no
greater than, 80 (e.g., 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, or
25) % of the complement activity in the absence of the antibody or
antigen-binding fragment thereof. In some embodiments, the antibody
or antigen-binding fragment thereof binds to free C5a (e.g., free
hC5a) with a subnanomolar affinity. In some embodiments, the
antibody or antigen-binding fragment thereof has an affinity for
free C5a that is at least 100-fold greater than the corresponding
affinity of the antibody or antigen-binding fragment for uncleaved
C5. In some embodiments, the antibody or antigen-binding fragment
thereof inhibits by at least 50% formation of TCC at concentrations
exceeding 200 (e.g., 210, 220, 230, 240, 250, 260, 270, 280, 290,
300, 320, 340, 360, 380, or 400 or more) .mu.g/mL as measured using
a CH50eq assay. In some embodiments, the antibody or
antigen-binding fragment thereof inhibits by at least 50% classical
complement pathway activation at concentrations exceeding 200
(e.g., 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 320, 340,
360, 380, or 400 or more) .mu.g/mL as measured using the
Wieslab.RTM. Classical Pathway Complement Kit as described in the
working examples.
[0084] In another aspect, the disclosure features a method for
treating a human afflicted with a complement-associated disorder
(e.g., a C5a-associated complement disorder or a
complement-associated inflammatory disorder). The method includes
administering to the human an effective amount of an antibody or
antigen-binding fragment thereof that inhibits the binding of C5a
to C5a receptor, and wherein the antibody partially inhibits
formation of the terminal complement complex (TCC). See above. The
disorder can be any of those known in the art or described
herein.
[0085] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that binds to a human
C5a polypeptide having the amino acid sequence depicted in SEQ ID
NO:1, but does not bind to the alpha chain of uncleaved, native C5,
wherein the antibody or antigen-binding fragment thereof binds to
the human C5a polypeptide with a K.sub.D that is less than
1.25.times.10.sup.-9 M.
[0086] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that binds to a human
C5a polypeptide having the amino acid sequence depicted in SEQ ID
NO:1, but does not bind to the alpha chain of uncleaved, native C5,
wherein the antibody inhibits by at least 50% human C5a-dependent
human neutrophil activation at a molar ratio of 1:1
(antigen-binding site:C5a). In some embodiments, the antibody
inhibits by at least 50% human C5a-dependent human neutrophil
migration in an assay in which 0.4 nM of antibody is used to
inhibit the neutrophil-activation activity of 2 nM human C5a as
described in Example 5. In some embodiments, the antibody does not
comprise exemplary CDR pairing 3 depicted in Table 1. In some
embodiments, the antibody is not BNJ371.
[0087] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein binds to a human C5a polypeptide
having the amino acid sequence depicted in SEQ ID NO:2.
[0088] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising: a light chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:20; a light chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:21; and a
light chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:22.
[0089] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising: a light chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:20; a light chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:38; and a
light chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:22.
[0090] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising: a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:28; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:29; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:30.
[0091] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising: a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:28; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:67; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:30.
[0092] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising: a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:28; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:46; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:47.
[0093] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:37 or SEQ ID NO:36.
[0094] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:27 or SEQ ID NO:33.
[0095] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:37 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:27.
[0096] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:36 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:33.
[0097] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:19 or SEQ ID NO:17.
[0098] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:27 or SEQ ID NO:25.
[0099] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:19 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:27.
[0100] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:17 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:25.
[0101] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:42 or SEQ ID NO:40.
[0102] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:27 or SEQ ID NO:33.
[0103] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:42 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:27.
[0104] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:40 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:33.
[0105] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:17 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:33.
[0106] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising the amino acid sequence depicted in any one
of SEQ ID NO:45, SEQ ID NO:44, or SEQ ID NO:49.
[0107] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:19 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:45.
[0108] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:17 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:44.
[0109] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:17 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:49.
[0110] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:37 or SEQ ID NO:36.
[0111] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:45 or SEQ ID NO:49.
[0112] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:37 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:45.
[0113] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:36 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:49.
[0114] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:42 or SEQ ID NO:40.
[0115] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heavy chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:45 or SEQ ID NO:49.
[0116] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:42 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:45.
[0117] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a light chain
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO:40 and a heavy chain polypeptide comprising the amino acid
sequence depicted in SEQ ID NO:49.
[0118] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein binds to hC5a with a K.sub.D that
is less than 7.times.10.sup.-10 M.
[0119] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein binds to hC5a with a K.sub.D that
is less than 5.times.10.sup.-10 M. In some embodiments, an isolated
antibody or antigen-binding fragment thereof described herein binds
to hC5a with a K.sub.D that is less than 3.times.10.sup.-10 M.
[0120] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein binds to hC5a with a K.sub.D that
is less than 2.5.times.10.sub.-10 M.
[0121] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein binds to hC5a with a K.sub.D that
is less than 1.5.times.10.sup.-10 M.
[0122] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein binds to hC5a with a K.sub.D that
is less than 1.0.times.10.sup.-10 M. In some embodiments, an
isolated antibody or antigen-binding fragment thereof described
herein binds to hC5a with a K.sub.D that is less than
8.0.times.10.sup.-11 M.
[0123] In some embodiments, an antibody inhibits by at least 70
(e.g., at least 75, 80, 85, 90, or 95 or greater) % human
C5a-dependent human neutrophil activation at a molar ratio of 1:1
(antigen-binding site:C5a). In some embodiments, the antibody does
not comprise exemplary CDR pairing 3 depicted in Table 1. In some
embodiments, the antibody is not BNJ371.
[0124] In yet another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that comprises a light
chain CDR set as set forth in Table 3 or Table 7. For example, the
isolated antibody or antigen-binding fragment thereof can comprise
a light chain polypeptide comprising: (i) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:140; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:96; and a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:142; (ii) a light chain CDR1 comprising the
amino acid sequence depicted in SEQ ID NO:156; a light chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:157; and a
light chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:158; (iii) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:164; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:165; and a light
chain CDR3 comprising the amino acid sequence depicted in SEQ ID
NO:166; (iv) a light chain CDR1 comprising the amino acid sequence
depicted in SEQ ID NO:172; a light chain CDR2 comprising the amino
acid sequence depicted in SEQ ID NO:173; and a light chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:174; (v) a
light chain CDR1 comprising the amino acid sequence depicted in SEQ
ID NO:84; a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:85; and a light chain CDR3 comprising the
amino acid sequence depicted in SEQ ID NO:86; (vi) a light chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:92; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:89; and a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:93; (vii) a light chain CDR1 comprising the
amino acid sequence depicted in SEQ ID NO:88; a light chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:89; and a
light chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:90; (viii) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:95; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:96; and a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:97;
(ix) a light chain CDR1 comprising the amino acid sequence depicted
in SEQ ID NO:99; a light chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:100; and a light chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:101;
(x) a light chain CDR1 comprising the amino acid sequence depicted
in SEQ ID NO:84; a light chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:85; and a light chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:103; (xi)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:105; a light chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:106; and a light chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:107; (xii)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:92; a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:89; and a light chain CDR3 comprising the
amino acid sequence depicted in SEQ ID NO:108; (xiii) a light chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:20; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:110; and a light chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:111; or (xiv) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:20; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:21; and a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:113. In some embodiments, the antibody or
antigen-binding fragment thereof comprising the light chain CDR set
also comprises a heavy chain polypeptide comprising any one of the
heavy chain CDR sets as set forth in Table 8.
[0125] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that comprises a heavy
chain CDR set as set forth in Table 3 or Table 8. For example, in
some embodiments an isolated antibody or antigen-binding fragment
thereof described herein comprises a heavy chain polypeptide
comprising: (i) a heavy chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:115; a heavy chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:144; and a heavy
chain CDR3 comprising the amino acid sequence depicted in SEQ ID
NO:117; (ii) a heavy chain CDR1 comprising the amino acid sequence
depicted in SEQ ID NO:28; a heavy chain CDR2 comprising the amino
acid sequence depicted in SEQ ID NO:67; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:30; (iii)
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:160; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:161; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:162; (iv)
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:168; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:169; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:170; (v) a
heavy chain CDR1 comprising the amino acid sequence depicted in SEQ
ID NO:176; a heavy chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:177; and a heavy chain CDR3 comprising the
amino acid sequence depicted in SEQ ID NO:178; (vi) a heavy chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:115;
a heavy chain CDR2 comprising the amino acid sequence depicted in
SEQ ID NO:116; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (vii) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:119; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:120; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:121; (viii) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:115; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:123; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (ix) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:115; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:124; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (x) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:119; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:126; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:127; (xi) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:115; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:129; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (xii) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:131; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:132; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:133; (xiii) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:28; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:46; and a heavy chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:47; or (xiv) a heavy chain CDR1 comprising
the amino acid sequence depicted in SEQ ID NO:136; a heavy chain
CDR2 comprising the amino acid sequence depicted in SEQ ID NO:137;
and a heavy chain CDR3 comprising the amino acid sequence depicted
in SEQ ID NO:138. In some embodiments, the antibody or
antigen-binding fragment thereof comprising the heavy chain CDR set
also comprises a light chain polypeptide comprising any one of the
light chain CDR sets as set forth in Table 7.
[0126] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof comprising a light
chain CDR set from Table 7 and its cognate heavy chain CDR set as
set forth in Table 8. In another aspect, the disclosure features an
isolated antibody or antigen-binding fragment thereof comprising a
paired light chain and heavy chain CDR set as set forth in Table 3
or Table 9. For example, in some embodiments an isolated antibody,
or antigen-binding fragment thereof, described herein comprises:
(i) a light chain CDR1 comprising the amino acid sequence depicted
in SEQ ID NO:140; a light chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:96; a light chain CDR3 comprising
the amino acid sequence depicted in SEQ ID NO:142; a heavy chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:115;
a heavy chain CDR2 comprising the amino acid sequence depicted in
SEQ ID NO:144; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (ii) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:20; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:21; and a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:22; a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:28; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:67; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:30; (iii) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:156; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:157; a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:158;
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:160; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:161; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:162; (iv)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:164; a light chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:165; a light chain CDR3 comprising
the amino acid sequence depicted in SEQ ID NO:166; a heavy chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:168;
a heavy chain CDR2 comprising the amino acid sequence depicted in
SEQ ID NO:169; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:170; (v) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:172; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:173; a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:174; a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:176; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:177; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:178; (vi) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:88; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:89; a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:90; a
heavy chain CDR1 comprising the amino acid sequence depicted in SEQ
ID NO:119; a heavy chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:120; and a heavy chain CDR3 comprising the
amino acid sequence depicted in SEQ ID NO:121; (vii) a light chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:105;
a light chain CDR2 comprising the amino acid sequence depicted in
SEQ ID NO:106; a light chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:107; a heavy chain CDR1 comprising
the amino acid sequence depicted in SEQ ID NO:115; a heavy chain
CDR2 comprising the amino acid sequence depicted in SEQ ID NO:124;
and a heavy chain CDR3 comprising the amino acid sequence depicted
in SEQ ID NO:117; (viii) a light chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:84; a light chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:85; a
light chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:86; a heavy chain CDR1 comprising the amino acid sequence
depicted in SEQ ID NO:115; a heavy chain CDR2 comprising the amino
acid sequence depicted in SEQ ID NO:116; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:117; (ix)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:20; a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:110; a light chain CDR3 comprising the amino
acid sequence depicted in SEQ ID NO:111; a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:136; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:137; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:138; (x) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:20; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:21; a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:113; a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:28; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:46; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:47; (xi) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:99; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:100; a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:101;
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:119; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:126; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:127; (xii)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:95; a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:96; a light chain CDR3 comprising the amino
acid sequence depicted in SEQ ID NO:97; a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:115; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:144; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117;
(xiii) a light chain CDR1 comprising the amino acid sequence
depicted in SEQ ID NO:140; a light chain CDR2 comprising the amino
acid sequence depicted in SEQ ID NO:96; a light chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:142; a
heavy chain CDR1 comprising the amino acid sequence depicted in SEQ
ID NO:115; a heavy chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:123; and a heavy chain CDR3 comprising the
amino acid sequence depicted in SEQ ID NO:117; (xiv) a light chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:105;
a light chain CDR2 comprising the amino acid sequence depicted in
SEQ ID NO:106; a light chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:107; a heavy chain CDR1 comprising
the amino acid sequence depicted in SEQ ID NO:115; a heavy chain
CDR2 comprising the amino acid sequence depicted in SEQ ID NO:123;
and a heavy chain CDR3 comprising the amino acid sequence depicted
in SEQ ID NO:117; (xv) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:92; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:89; a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:108;
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:115; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:144; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:117; (xvi)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:92; a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:89; a light chain CDR3 comprising the amino
acid sequence depicted in SEQ ID NO:93; a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:115; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:123; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (xvii) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:92; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:89; a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:93; a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:115; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:144; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:117; (xviii) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:84; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:85; a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:103;
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:115; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:129; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:117; (xix)
a light chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:95; a light chain CDR2 comprising the amino acid sequence
depicted in SEQ ID NO:96; a light chain CDR3 comprising the amino
acid sequence depicted in SEQ ID NO:97; a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:115; a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:123; and a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:117; (xx) a light chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:84; a
light chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:85; a light chain CDR3 comprising the amino acid sequence
depicted in SEQ ID NO:103; a heavy chain CDR1 comprising the amino
acid sequence depicted in SEQ ID NO:115; a heavy chain CDR2
comprising the amino acid sequence depicted in SEQ ID NO:144; and a
heavy chain CDR3 comprising the amino acid sequence depicted in SEQ
ID NO:117; or (xxi) a light chain CDR1 comprising the amino acid
sequence depicted in SEQ ID NO:20; a light chain CDR2 comprising
the amino acid sequence depicted in SEQ ID NO:21; a light chain
CDR3 comprising the amino acid sequence depicted in SEQ ID NO:113;
a heavy chain CDR1 comprising the amino acid sequence depicted in
SEQ ID NO:131; a heavy chain CDR2 comprising the amino acid
sequence depicted in SEQ ID NO:132; and a heavy chain CDR3
comprising the amino acid sequence depicted in SEQ ID NO:133.
[0127] In some embodiments, an antibody or antigen-binding fragment
thereof comprises a paired light chain CDR set and heavy chain CDR
set as set forth in Table 3. In some embodiments, an antibody or
antigen-binding fragment thereof comprises a paired light chain CDR
set and heavy chain CDR set as set forth in Table 2. For example,
the disclosure features an antibody comprising: (i) a light chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:20;
(ii) a light chain CDR2 comprising the amino acid sequence depicted
in SEQ ID NO:21; and (iii) a light chain CDR3 comprising the amino
acid sequence depicted in SEQ ID NO:22; (iv) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:28; (v) a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:46; and (vi) a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:47.
[0128] In some embodiments, the antibody or antigen-binding
fragment thereof comprises a light chain variable region set forth
in Table 2, which light chain is paired with any one of the heavy
chain variable regions set forth in Table 2. For example, the
disclosure features an antibody (or an antigen-binding fragment
thereof) comprising: (a) a light chain variable region having an
amino acid sequence comprising the amino acid sequence depicted in
SEQ ID NO:42 and (b) a heavy chain variable region having an amino
acid sequence comprising the amino acid sequence depicted in SEQ ID
NO:45.
[0129] In some embodiments, an antibody or antigen-binding fragment
thereof described herein comprises: (i) a heavy chain variable
region framework region 1 comprising the amino acid sequence
depicted in SEQ ID NO:68 or SEQ ID NO:69; (ii) a heavy chain
variable region framework region 2 comprising the amino acid
sequence depicted in SEQ ID NO:70 or SEQ ID NO:71; and a heavy
chain variable region framework region 3 comprising the amino acid
sequence depicted in any one of SEQ ID NOs:72 to 74. In some
embodiments, the antibody or antigen-binding fragment thereof
comprises a heavy chain variable region framework region 4
comprising the amino acid sequence depicted in SEQ ID NO:75. In
some embodiments, the antibody or antigen-binding fragment thereof
comprises a heavy chain variable region comprising the amino acid
sequence depicted in any one of SEQ ID NOs:76 to 80. The antibody
heavy chain can comprise any of the heavy chain CDR sets described
herein. The heavy chain variable region can be, in some
embodiments, paired with the variable region polypeptide comprising
the amino acid sequence depicted in SEQ ID NO:16.
[0130] In some embodiments, an antibody or antigen-binding fragment
thereof binds to a non-human C5a protein. For example, the antibody
or antigen-binding fragment thereof can bind to mouse C5a and/or
desarginated mouse C5a protein. In some embodiments, an isolated
antibody or antigen-binding fragment thereof can bind to mouse C5a
(and/or desarginated mouse C5a) and comprise: (i) a light chain
CDR1 comprising the amino acid sequence depicted in SEQ ID NO:54;
(ii) a light chain CDR2 comprising the amino acid sequence depicted
in SEQ ID NO:55; (iii) a light chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:56; (iv) a heavy chain CDR1
comprising the amino acid sequence depicted in SEQ ID NO:62; (v) a
heavy chain CDR2 comprising the amino acid sequence depicted in SEQ
ID NO:63; and (vi) a heavy chain CDR3 comprising the amino acid
sequence depicted in SEQ ID NO:64. In some embodiments, the
anti-mouse C5a antibody can comprise a light chain polypeptide
comprising the amino acid sequence depicted in SEQ ID NO:59; and a
heavy chain polypeptide comprising the amino acid sequence depicted
in SEQ ID NO:66.
[0131] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein inhibits the interaction between
C5a and a C5a receptor. The C5a receptor can be, e.g., C5aR1 or
C5L2.
[0132] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein does not substantially inhibit
complement-mediated hemolysis of red blood cells in vitro and/or in
vivo.
[0133] In some embodiments, an isolated antibody (and accordingly
any antigen-binding fragment thereof) is a monoclonal antibody, a
humanized antibody, or a fully-human antibody.
[0134] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein is selected from the group
consisting of a recombinant antibody, a single chain antibody, a
diabody, an intrabody, a chimerized or chimeric antibody, a
deimmunized human antibody, an Fv fragment, an Fd fragment, an Fab
fragment, an Fab' fragment, and an F(ab').sub.2 fragment.
[0135] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein is multispecific (e.g.,
bispecific) in that the antibody or fragment binds to at least two
different epitopes. The two different epitopes can be, e.g., two
different epitopes from the same protein (e.g., C5a) or the
antibody can bind to a first epitope from a first protein (e.g.,
C5a) and a second epitope from a second protein.
[0136] In some embodiments, an isolated antibody or antigen-binding
fragment thereof described herein comprises a heterologous moiety.
The heterologous moiety can be, e.g., a sugar. For example, the
antibody or antigen-binding fragment thereof can be glycosylated.
The heterologous moiety can be, e.g., a detectable label such as,
but not limited to, a fluorescent label, a luminescent label, a
heavy metal label, a radioactive label, or an enzymatic label.
[0137] In some embodiments, an isolated anti-C5a antibody or
antigen-binding fragment thereof described herein is modified with
a moiety that improves the stabilization and/or retention of the
antibody in circulation. For example, the modification can be
PEGylation or hesylation. In another embodiment, the anti-C5a
antibody can contain an altered constant region that has reduced
(or no) effector function, as compared to the effector function of
its corresponding unaltered constant region. In some embodiments,
the anti-C5a antibody contains an altered constant region that has
between about 0 to about 20% of the effector function of the
unaltered constant region. Exemplary embodiments of such
decreased-effector function antibodies are described herein.
[0138] In another aspect, the disclosure features an isolated
antibody or antigen-binding fragment thereof that crossblocks the
binding of any one of the foregoing antibodies.
[0139] In yet another aspect, the disclosure features a
pharmaceutical composition comprising one or more of any of the
isolated antibodies or antigen-binding fragments thereof described
herein and a pharmaceutically-acceptable carrier, diluent, and/or
excipient.
[0140] In another aspect, the disclosure features: (i) a nucleic
acid encoding one or more of any of the antibodies or
antigen-binding fragments thereof described herein; (ii) a vector
comprising the nucleic acid; (iii) an expression vector comprising
the nucleic acid; and/or (iv) a cell comprising the vector or the
expression vector. In another aspect, the disclosure features a
method for producing a polypeptide (such as any of the antibodies
or antigen-binding fragments thereof described herein). The method
comprises culturing the aforementioned cell (comprising the
expression vector) under conditions and for a time sufficient to
allow expression by the cell of the antibody or antigen-binding
fragment encoded by the nucleic acid in the vector. The method can
also include isolated the antibody or antigen-binding fragment from
the cell or from the medium in which the cell is cultured.
[0141] In another aspect, the disclosure features an isolated
nucleic acid encoding any of the amino acid sequences described
herein or a polypeptide having an amino acid sequence comprising,
or consisting of, any of the amino acid sequences set forth herein.
The nucleic acid can be included in a vector, e.g., an expression
vector, and/or can be present in a cell.
[0142] In yet another aspect, the disclosure features a therapeutic
kit comprising: (i) one or more of the isolated antibodies or
antigen-binding fragments described herein (e.g., one or more of
any of the humanized antibodies or antigen-binding fragments
thereof described herein); and (ii) means for delivery of the
antibody or antigen-binding fragment to a subject. The means can be
suitable for, e.g., subcutaneous delivery, intraocular delivery, or
intraarticular delivery of the antibody or antigen-binding fragment
thereof to the subject. The means can be, e.g., a syringe, a
double-barreled syringe, or two separate syringes incorporated for
use in administering a therapeutic antibody or antigen-binding
fragment thereof, while drawing off knee fluid (e.g., for analysis)
in a push-pull fashion. In some embodiments, the means is for
ocular delivery and comprises a trans-scleral patch or a contact
lens, each of which comprises the antibody or antigen-binding
fragment thereof. In some embodiments, the means is suitable for
intrapulmonary delivery. For example, the means can be an inhaler
or a nebulizer. In some embodiments, the means is a pre-filled
syringe such as a pen device. The pre-filled syringe can contain,
e.g., at least one pharmaceutical unit dosage form of one or more
of the antibodies or antigen-binding fragments thereof provided
herein.
[0143] In some embodiments, the therapeutic kits described herein
can contain at least one additional active agent for use in
treating a complement-associated disorder in a subject. The
additional active agent can be, e.g., any of the additional agents
described herein.
[0144] In yet another aspect, the disclosure features a method for
treating or preventing a complement-associated disorder. The method
includes administering to a human in need thereof a therapeutic
antibody or antigen-binding fragment thereof described herein in an
amount sufficient to treat a complement-associated disorder
afflicting the human. The method can also include identifying the
subject as having a complement-associated disorder. The
complement-associated disorder can be, e.g., a
complement-associated inflammatory disorder, atypical hemolytic
uremic syndrome, age-related macular degeneration, rheumatoid
arthritis, sepsis, or antiphospholipid syndrome. In some
embodiments, the complement-associated disorder is a
complement-associated pulmonary disorder. For example, the
complement-associated pulmonary disorder can be, e.g., asthma or
chronic obstructive pulmonary disease. Other complement-associated
disorders amenable to treatment or prevention as set forth in the
method are described herein. The mode of administration, which can
vary depending on the type of complement-associated disorder to be
treated, can be, e.g., intravenous administration, intrapulmonary
administration, intraocular administration, subcutaneous
administration, or intraarticular administration.
[0145] In some embodiments, the antibody or antigen-binding
fragment thereof is administered to the human in an amount and with
a frequency sufficient to maintain a reduced level of systemic C5a
activity for the duration of the treatment. In some embodiments,
the methods can include after the administering, monitoring the
human for an improvement in one or more symptoms of the
complement-associated disorder.
[0146] In some embodiments, the methods can include administering
to the human one or more additional therapeutic agents.
[0147] In yet another aspect, the disclosure features an article of
manufacture, which comprises: (i) a container with a label and (ii)
a composition comprising an antibody or antigen-binding fragment
thereof described herein. The label can indicate that the
composition is to be administered to a human having, suspected of
having, or at risk for developing, a complement-associated
disorder. The article of manufacture can also include one or more
additional active agents.
[0148] As used throughout the present disclosure, the term
"antibody" refers to a whole or intact antibody (e.g., IgM, IgG,
IgA, IgD, or IgE) molecule that is generated by any one of a
variety of methods that are known in the art and described herein.
The term "antibody" includes a polyclonal antibody, a monoclonal
antibody, a chimerized or chimeric antibody, a humanized antibody,
a deimmunized human antibody, and a fully human antibody. The
antibody can be made in or derived from any of a variety of
species, e.g., mammals such as humans, non-human primates (e.g.,
monkeys, baboons, or chimpanzees), horses, cattle, pigs, sheep,
goats, dogs, cats, rabbits, guinea pigs, gerbils, hamsters, rats,
and mice. The antibody can be a purified or a recombinant
antibody.
[0149] As used herein, the term "antibody fragment,"
"antigen-binding fragment," or similar terms refer to a fragment of
an antibody that retains the ability to bind to an antigen (e.g.,
an epitope present in C5a, but not in the alpha chain of uncleaved,
native C5 protein), e.g., a single chain antibody (scFv), an Fd
fragment, an Fab fragment, an Fab' fragment, or an F(ab').sub.2
fragment. An scFv is a single polypeptide chain that includes both
the heavy and light chain variable regions of the antibody from
which the scFv is derived. In addition, diabodies (Poljak (1994)
Structure 2(12):1121-1123; Hudson et al. (1999) J Immunol Methods
23(1-2):177-189, the disclosures of both of which are incorporated
herein by reference in their entirety), minibodies, triabodies
(Schoonooghe et al. (2009) BMC Biotechnol 9:70), domain antibodies
(also known as "heavy chain immunoglobulins" or camelids; Holt et
al. (2003) Trends Biotechnol 21(11):484-490); and intrabodies
(Huston et al. (2001) Hum Antibodies 10(3-4):127-142; Wheeler et
al. (2003) Mol Ther 8(3):355-366; Stocks (2004) Drug Discov Today
9(22): 960-966, the disclosures of each of which are incorporated
herein by reference in their entirety) are included in the
definition of antibody fragments and can be incorporated into the
compositions, and used in the methods, described herein.
[0150] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this disclosure pertains. In
case of conflict, the present document, including definitions, will
control. Preferred methods and materials are described below,
although methods and materials similar or equivalent to those
described herein can also be used in the practice or testing of the
presently disclosed methods and compositions. All publications,
patent applications, patents, and other references mentioned herein
are incorporated by reference in their entirety.
[0151] Other features and advantages of the present disclosure,
e.g., methods for treating complement-associated disorders in a
subject, will be apparent from the following description, the
examples, and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0152] FIG. 1 is a Venn diagram depicting the degree of overlap of
the epitopes in human C5a bound by a select set of murine
anti-human C5a antibodies: 5an101 ME, 5an180 ME, 5an048 ME, 5an179
ME, and 5an178 ME.
[0153] FIG. 2 is a line graph depicting the antagonism of
C5a-mediating signaling in vitro using a neutrophil activation
assay. The Y-axis represents the optical density (OD) measurement
of a chromogenic substrate as a function of myeloperoxidase release
by freshly isolated human neutrophils. The X-axis represents the
concentration of antibody incubated with the cells. The humanized
antibodies tested--BNJ367, BNJ369, BNJ371, BNJ378, BNJ381, BNJ383,
and a humanized anti-C5 antibody--are identified in the inset
legend.
[0154] FIG. 3 is a line graph depicting the effect of several
therapeutic antibodies on joint inflammation in a mouse model of
rheumatoid arthritis. The Y-axis represents the thickness of the
initially inflamed knee joint in millimeters. The X-axis represents
the days after disease onset. The therapeutic antibodies
tested--5an195 ME (a mouse anti-mouse C5a antibody) and a control
antibody with the same Fc region as the anti-C5a antibody--are
identified in the inset legend.
[0155] FIG. 4 is a line graph depicting the effect of several
therapeutic antibodies on overall disease severity in a mouse model
of rheumatoid arthritis. The Y-axis represents the arthritis index.
The X-axis represents the days after disease onset. The therapeutic
antibodies tested--5an195 ME (a mouse anti-mouse C5a antibody) and
a control antibody with the same Fc region as the anti-C5a
antibody--are identified in the inset legend.
[0156] FIG. 5 sets forth a series of humanized heavy chain variable
region sequences. In order from uppermost to lowermost: the heavy
chain variable region of the BNJ345 humanized anti-C5a antibody
(SEQ ID NO:76); the heavy chain variable region of the BNJ346
humanized anti-C5a antibody (SEQ ID NO:77); the heavy chain
variable region of the BNJ347 humanized anti-C5a antibody (SEQ ID
NO:78); the heavy chain variable region of the BNJ354 humanized
anti-C5a antibody (SEQ ID NO:79); and the heavy chain variable
region of the BNJ350 humanized anti-C5a antibody (SEQ ID NO:80).
The skilled artisan will appreciate the delineation between heavy
chain framework regions 1, 2, 3, and 4 and the heavy chain CDRs 1,
2, and 3. Such delineations as defined by Kabat et al. (infra) are
shown in the figure. "HC FR1" refers to heavy chain variable region
framework region 1, "HC FR2" refers to heavy chain variable region
framework region 2, "HC FR3" refers to heavy chain variable region
framework region 3, and "HC FR4" refers to heavy chain variable
region framework region 4. "HC CDR1" refers to heavy chain variable
region complementarity determining region (CDR) 1, "HC CDR2" refers
to heavy chain variable region CDR2, and "HC CDR3" refers to heavy
chain variable region CDR3.
[0157] FIG. 6 is a line graph depicting the percentage of
circulating neutrophils in the blood of mice following
administration of hC5a to the mice. On the Y-axis, neutrophil
counts are expressed as a percentage of "baseline," which is the
neutrophil count at time 0 (or 100% neutrophils). The X-axis
represents time in minutes. Mouse cohorts were intravenously
administered a control antibody [anti-anthrax protective antigen
63, IgG2/G4 isotype] ("control"; five mice) or the anti-human C5a
antibody BNJ383 at one of the following doses: 24 mg/kg (five
mice); 12 mg/kg (five mice); 6 mg/kg (five mice); and 3 mg/kg (five
mice) and then later were administrated hC5a. See Example 13. Six
mice, "sham," were not administered human C5a.
[0158] FIG. 7 is a bar graph depicting the myeloperoxidase (MPO)
level in the plasma of mice before and following administration of
human C5a to the mice. The Y-axis represents the concentration
(ng/mL) of MPO in mouse plasma. The X-axis represents time in
minutes. Mouse cohorts were intravenously administered a control
antibody [anti-anthrax protective antigen 63, IgG2/G4 isotype]
("control"; eight mice) or the anti-human C5a antibody BNJ383 at
one of the following doses: 24 mg/kg (five mice); 12 mg/kg (five
mice); 6 mg/kg (five mice); and 3 mg/kg (five mice) and then later
were administrated hC5a. Four mice, "sham," were not administered
human C5a.
[0159] FIG. 8 is a line graph depicting the change in human C5a
level in plasma of mice (administered human C5a) in the presence or
absence of different concentrations of an anti-hC5a antibody
(BNJ383). The Y-axis represents the concentration (ng/mL) of hC5a
in mouse plasma. The X-axis represents time in minutes. Mouse
cohorts were intravenously administered a control antibody
[anti-anthrax protective antigen 63, IgG2/G4 isotype] ("control";
six mice) or the anti-human C5a antibody BNJ383 at one of the
following doses: 24 mg/kg (three mice); 12 mg/kg (three mice); 6
mg/kg (three mice); and 3 mg/kg (three mice) and then later were
administrated hC5a. Four mice, "sham," were not administered human
C5a.
[0160] FIG. 9 is a line graph depicting the competition for binding
to human C5a in vitro. 250 pM of ruthenium-labeled anti-C5a
antibody (BNJ383) was incubated with 1 nM biotinylated hC5a, along
with various concentrations (e.g., 400, 133, 44.4, 14.8, 4.9, 1.6,
and 0.5 nM) of one of the following: (a) human C5a desarg protein
in phosphate-buffered saline, (b) human plasma, (c) cynomolgus
macaque plasma, (d) Balb/C (mouse) plasma, or (e) DBA/2J (mouse)
plasma. With respect to the plasma components (b), (c), (d), and
(e), the concentration refers to the approximate final
concentration of C5 antigen in the incubation mixture. The Y-axis
represents arbitrary fluorescence units as a function of the amount
of ruthenium-labeled anti-C5a antibody detected. The X-axis
represents concentration (nM) of the antigen competitor.
[0161] FIG. 10 is a line graph depicting the effect of several
complement inhibitory proteins on the alternative pathway (AP) of
complement. The Y-axis represents the percentage of AP complement
activity as compared to baseline (BL; the level of activity in the
absence of a complement inhibitor). The X-axis represents the
concentration of a given complement inhibitor (IM). The effects of
the anti-hC5a antibody, BNJ383, along with an anti-C5 antibody on
AP activity were each evaluated.
[0162] FIG. 11 is a line graph depicting the effect of several
complement inhibitory proteins on the classical pathway (CP) of
complement. The Y-axis represents the percentage of CP complement
activity as compared to baseline (BL; the level of activity in the
absence of a complement inhibitor). The X-axis represents the
concentration of a given complement inhibitor (.mu.M). The effects
of the anti-hC5a antibody, BNJ383, along with an anti-C5 antibody
on CP activity were each evaluated.
[0163] FIGS. 12A, 12B, 12C, and 12D are a series of chromatographs
depicting the retention times of the anti-C5a antibody (BNJ383) and
an anti-hC5 antibody in the presence or absence of hC5 protein. For
all of the panels, the X-axis represents retention time in minutes
and the Y-axis represents the absorbance units at 214 nm
wavelength. In each panel, the inlayed subpanel depicts an enhanced
view of the featured peaks.
[0164] FIG. 12A depicts the retention time for BNJ383 in the
absence of hC5 protein.
[0165] FIG. 12B depicts the retention time for the anti-C5 antibody
in the absence of hC5 protein.
[0166] FIG. 12C depicts the retention time for BNJ383 in the
presence of hC5 (2.1-fold molar excess of hC5 over BNJ383). From
right to left, the enumerated peaks represent: (a) uncomplexed
BNJ383 or hC5; (b) BNJ383 with one antigen-binding site bound to
uncleaved hC5; and (c) a minor fraction consistent with dual
occupancy of BNJ383 with uncleaved hC5.
[0167] FIG. 12D depicts the retention time for the anti-C5 antibody
in the presence of an equimolar amount of hC5. From right to left,
the enumerated peaks represent: (a) uncomplexed anti-C5 antibody or
hC5; (b) the anti-C5 antibody with one antigen-binding site bound
to uncleaved hC5; and (c) the anti-C5 antibody bound to two
uncleaved C5 molecules.
[0168] FIG. 13 is a line graph depicting the binding of the
anti-C5a antibody BNJ383 to hC5a desarg in the presence of hC5
using an ELISA. The X-axis represents the concentration (ng/mL) of
the antibody. The Y-axis represents the optical density at 450 nm
wavelength.
[0169] FIG. 14 is a scatter plot depicting the concentration of
free C5a/C5a desarg present in the plasma of cynomolgus macaques as
a function of the plasma concentration of anti-C5a antibody
(BNJ383). The Y-axis depicts the concentration (pg/mL) of C5a/C5a
desarg detected in plasma samples from cynomolgus macaques at time
points ranging from 1 day to 30 days following a single dose
intravenous administration of BNJ383 at 1 mg/kg, 10 mg/kg, 100
mg/kg, 250 mg/kg, or 400 mg/kg body weight of the animals. The
X-axis represents the concentration of the BNJ383 (.mu.g/mL) in
each of the samples.
[0170] FIG. 15A is a scatter plot depicting the percentage of
hemolytic activity in serum samples relative to baseline values
(Y-axis) initiated via the classical pathway as a function of the
concentration of anti-C5a antibody (BNJ383) in circulation
(X-axis).
[0171] FIG. 15B is a scatter plot depicting the percentage of
terminal complement complex formation initiated via the classical
pathway in serum samples measured by a CH50eq assay relative to
baseline values (Y-axis) as a function of the concentration of
anti-C5a antibody (BNJ383) in circulation (X-axis).
[0172] FIG. 15C is a scatter plot depicting the percentage of
terminal complement complex formation initiated via the classical
pathway in serum samples measured by a CCP assay relative to
baseline values (Y-axis) as a function of the concentration of
anti-C5a antibody (BNJ383) in circulation (X-axis).
DETAILED DESCRIPTION
[0173] The present disclosure provides antibodies and
antigen-binding fragments thereof that bind to free C5a (e.g., free
human C5a), compositions containing the antibodies or their
fragments, and methods for using any of the foregoing to treat or
prevent complement-associated disorders such as, but not limited
to, aHUS, macular degeneration (e.g., AMD), RA, sepsis,
antiphospholipid syndrome, burn (e.g., severe burn), Goodpasture's
syndrome, lupus nephritis, or a complement-associated pulmonary
disorder such as asthma or chronic obstructive pulmonary disease
(COPD). The disclosure also provides anti-C5a antibodies (and
fragments thereof) that are cross-reactive between free C5a from
human and free C5a from a non-human mammalian species such as a
non-human primate (e.g., cynomolgus macaque or rhesus macaque).
While in no way intended to be limiting, exemplary antibodies (and
antigen-binding fragments), compositions (e.g., pharmaceutical
compositions and formulations), and methods for using the
compositions are elaborated on below and exemplified in the working
Examples.
Anti-C5a Antibodies and Antigen-Binding Fragments Thereof
[0174] The disclosure provides antibodies that bind to complement
component C5a. As discussed above, the proform of C5, a 1676 amino
acid residue precursor protein, is processed by a series of
proteolytic cleavage events. The first 18 peptides (numbered -18 to
-1) constitute a signal peptide that is cleaved from the precursor
protein. The remaining 1658 amino acid protein is cleaved in two
places to form the alpha and beta chains. The first cleavage event
occurs between amino acid residues 655 and 656. The second cleavage
occurs between amino acid residues 659 and 660. The two cleavage
events result in the formation of three distinct polypeptide
fragments: (i) a fragment comprising amino acids 1 to 655, which is
referred to as the beta chain; (ii) a fragment comprising amino
acids 660 to 1658, which is referred to as the alpha chain; and
(iii) a tetrapeptide fragment consisting of amino acids 656 to 659.
The alpha chain and the beta chain polypeptide fragments are
connected to each other via disulfide bond and constitute the
mature C5 protein. The CP or AP C5 convertase activates mature C5
by cleaving the alpha chain between residues 733 and 734, which
results in the liberation of C5a fragment (amino acids 660 to 733).
The remaining portion of mature C5 is fragment CSb, which contains
the residues 734 to 1658 of the alpha chain disulfide bonded to the
beta chain.
[0175] In vivo, C5a is rapidly metabolized by a serum enzyme,
carboxypeptidase B, to a 73 amino acid form termed "C5a desarg,"
which has lost the carboxyterminal arginine residue. Accordingly,
in some embodiments, an antibody that binds to free C5a also binds
to desarginated C5a. In some embodiments, an antibody that binds to
C5a does not bind to desarginated C5a.
[0176] In some embodiments, the anti-C5a antibody binds to a
neoepitope present in C5a, i.e., an epitope that becomes exposed
upon the liberation of C5a from the alpha chain fragment of mature
C5. That is, in some embodiments, an anti-C5a antibody described
herein binds to C5a and/or C5a desarg, but not to uncleaved, native
(fully-folded) C5.
[0177] As described above, in some embodiments, the anti-C5a
antibody or antigen-binding fragment thereof can bind to a
subpopulation of uncleaved, processed C5 (e.g., plasma C5)
constituting less than 10 (e.g., less than 9.5, 9, 8.5, 8, 7.5, 7,
6.5, 6, 5.5, 5, 4.5, 4, 3.5, 3, 2.5, 2, 1.5, 1, 0.5, 0.4, 0.3, 0.2,
or less than 0.1) % of the total population of full length C5 in a
sample (e.g., a blood or plasma sample or a sample comprising
recombinant full length C5), which subpopulation is in whole, or in
part, denatured such that an otherwise occluded C5a neoepitope is
exposed. Thus, an anti-C5a antibody or antigen-binding fragment
thereof described herein can, in some embodiments, bind to free
C5a, but not to C5 of the 90% or greater uncleaved, native C5
population. In some embodiments, the partially or fully denatured
subpopulation is inactive or has reduced activity (e.g., less than
90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10,
5% of the activity of fully-functional, full-length C5 protein) in
any number of suitable assays useful for testing C5 activity, e.g.,
a hemolytic assay or a CH50eq assay. Suitable methods for testing
the activity of the minor subpopulation to which an anti-C5a
antibody described herein may, in some embodiments, bind are known
in the art and described herein.
[0178] In some embodiments, the anti-C5a antibody binds to a
mammalian (e.g., human) C5a protein. For example, the anti-C5a
antibody can bind to a human C5a protein having the following amino
acid sequence:
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTE
CCVVASQLRANISHKDMQLGR (SEQ ID NO:1). In some embodiments, an
anti-C5a antibody can bind to a desarginated human C5a protein
having the following amino acid sequence:
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTE
CCVVASQLRANISHKDMQLG (SEQ ID NO:2). An anti-C5a antibody described
herein can bind to both full-length human C5a and desarginated
human C5a.
[0179] In some embodiments, the antibody can bind to human C5a at
an epitope within or overlapping with a structural fragment of the
protein having the amino acid sequence: TLQKKIEEIAAKYK (SEQ ID
NO:3); HSVVKKCCYDGAC (SEQ ID NO:4); VNNDE (SEQ ID NO:5); TCEQRAAR
(SEQ ID NO:6); ISLG (SEQ ID NO:7); PRCIKAFTECCVVASQLRANIS (SEQ ID
NO:8); HKDMQLG (SEQ ID NO:9); or HKDMQLGR (SEQ ID NO:10). See,
e.g., Cook et al. (2010) Acta Cryst D 66:190-197. In some
embodiments, the antibody can bind to C5a at an epitope within or
overlapping with the amino acid sequence of a peptide fragment of
C5a comprising at least two of the paired cysteine residues. For
example, an anti-C5a antibody can bind to fragment comprising, or
consisting of, the amino acid sequence: CCYDGACVNNDETC (SEQ ID
NO:11); CYDGACVNNDETCEQRAARISLGPRCIKAFTEC (SEQ ID NO:12; and
CEQRAARISLGPRCIKAFTECC (SEQ ID NO:13), wherein, in each of the
peptide fragments, the first and final cysteine residues are paired
by disulfide bonds. In some embodiments, an anti-C5a antibody
described herein can bind to a human C5a protein at an epitope
within, or overlapping with, the amino acid sequence:
YDGACVNNDETCEQRAAR (SEQ ID NO:14) or CYDGACVNNDETCEQRAA (SEQ ID
NO:15). In some embodiments, an antibody can bind to a human C5a
protein or fragment thereof containing an amino acid sequence that
contains, or consists of, at least four (e.g., at least four, five,
six, seven, eight, nine, 10, 11, 12, 13, 14, 15, 16, or 17 or more)
consecutive amino acids depicted in any one of SEQ ID NOs:1 to 15.
In some embodiments, an anti-C5a antibody described herein binds to
a ternary epitope comprising two or more (e.g., at least two,
three, or four) discontinuous peptide regions of C5a protein, e.g.,
two or more discontinuous C5a peptide regions joined together by
way of a disulfide linkage.
[0180] Methods for identifying the epitope to which a particular
antibody (e.g., an anti-C5a antibody) binds are also known in the
art. For example, the binding epitope within C5a (or desarginated
C5a) to which an anti-C5a antibody binds can be identified by
measuring the binding of the antibody to several (e.g., three,
four, five, six, seven, eight, nine, 10, 15, 20, or 30 or more)
overlapping peptide fragments of a complement component C5a protein
(e.g., several overlapping fragments of a human C5a protein having
the amino acid sequence depicted in SEQ ID NO:1 or SEQ ID NO:2).
Each of the different overlapping peptides is then bound to a
unique address on a solid support, e.g., separate wells of a
multi-well assay plate. Next, the anti-C5a antibody is interrogated
by contacting it to each of the peptides in the assay plate for an
amount of time and under conditions that allow for the antibody to
bind to its epitope. Unbound anti-C5a antibody is removed by
washing each of the wells. Next, a detectably-labeled secondary
antibody that binds to the anti-C5a antibody, if present in a well
of the plate, is contacted to each of the wells, and unbound
secondary antibody is removed by washing steps. The presence or
amount of the detectable signal produced by the detectably-labeled
secondary antibody in a well is an indication that the anti-C5a
antibody binds to the particular peptide fragment associated with
the well. See, e.g., Harlow and Lane (supra), Benny K. C. Lo
(supra), and U.S. Patent Application Publication No. 20060153836,
the disclosure of which is incorporated by reference in its
entirety. A particular epitope to which an antibody binds can also
be identified using BIAcore chromatographic techniques (see, e.g.,
Pharmacia BIAtechnology Handbook, "Epitope Mapping," Section 6.3.2
(May 1994); and Johne et al. (1993) J Immunol Methods
160:20191-8).
[0181] In some embodiments, an anti-C5a antibody described herein
contains a specific set of light chain complementarity determining
regions (CDRs) and/or a specific set of heavy chain CDRs. For
example, in some embodiments an anti-C5a antibody or
antigen-binding fragment thereof described herein can comprise a
light chain CDR set obtained from a light chain polypeptide
comprising the amino acid sequence depicted in any one of SEQ ID
NOs:19, 37, or 42. In some embodiments, an anti-C5a antibody or
antigen-binding fragment thereof described herein can comprise a
heavy chain CDR set obtained from a heavy chain polypeptide
comprising the amino acid sequence depicted in SEQ ID NO:27 or 45.
Exemplary light chain and heavy chain CDR sets obtained from the
aforementioned light chain variable regions and heavy chain
variable regions are described below in more detail (see Table
1).
[0182] The exact boundaries of CDRs, and framework regions, have
been defined differently according to different methods. In some
embodiments, the positions of the CDRs or framework regions within
a light or heavy chain variable domain can be as defined by Kabat
et al. [(1991) "Sequences of Proteins of Immunological Interest."
NIH Publication No. 91-3242, U.S. Department of Health and Human
Services, Bethesda, Md.]. In such cases, the CDRs can be referred
to as "Kabat CDRs" (e.g., "Kabat LCDR2" or "Kabat HCDR1"). In some
embodiments, the positions of the CDRs of a light or heavy chain
variable region can be as defined by Chothia et al. (1989) Nature
342:877-883. Accordingly, these regions can be referred to as
"Chothia CDRs" (e.g., "Chothia LCDR2" or "Chothia HCDR3"). In some
embodiments, the positions of the CDRs of the light and heavy chain
variable regions can be as defined by a Kabat-Chothia combined
definition. In such embodiments, these regions can be referred to
as "combined Kabat-Chothia CDRs." In some embodiments, the
positions of the CDRs and/or framework regions within a light or
heavy chain variable domain can be as defined by Honnegger and
Pluckthun (2001) J Mol Biol 309: 657-670. Identification of the
CDRs within a light chain or heavy chain variable region using the
aforementioned definitions is well known in the art of antibody
engineering. For example, Thomas et al. [(1996) Mol Immunol
33(17/18):1389-1401] exemplifies the identification of light chain
and heavy chain CDR boundaries according to Kabat and Chothia
definitions.
[0183] Accordingly, in some embodiments an anti-C5a antibody or
antigen-binding fragment thereof described herein can comprise a
Kabat-defined, a Chothia-defined, or a combined
Kabat-Chothia-defined light chain CDR set obtained from a light
chain polypeptide comprising the amino acid sequence depicted in
any one of SEQ ID NOs:19, 37, or 42. In some embodiments, an
anti-C5a antibody or antigen-binding fragment thereof described
herein can comprise a Kabat-defined, a Chothia-defined, or a
combined Kabat-Chothia-defined heavy chain CDR set obtained from a
heavy chain polypeptide comprising the amino acid sequence depicted
in SEQ ID NO:27 or 45.
[0184] In some embodiments, an anti-C5a antibody described herein
comprises a light chain variable region containing one or more of:
a light chain CDR1 comprising or consisting of the following amino
acid sequence: RASESVDSYGNSFMH (SEQ ID NO:20); a light chain CDR2
comprising or consisting of the following amino acid sequence:
RASNLES (SEQ ID NO:21); and a light chain CDR3 comprising or
consisting of the following amino acid sequence: QQSNEDPYT (SEQ ID
NO:22). In some embodiments, an anti-C5a antibody described herein
comprises a light chain variable region containing each of a light
chain CDR1 comprising or consisting of the following amino acid
sequence: RASESVDSYGNSFMH (SEQ ID NO:20); a light chain CDR2
comprising or consisting of the following amino acid sequence:
RASNLES (SEQ ID NO:21); and a light chain CDR3 comprising or
consisting of the following amino acid sequence: QQSNEDPYT (SEQ ID
NO:22). Exemplary anti-C5a antibodies comprising such a light chain
variable domain include, e.g., the BNJ364, BNJ367, BNJ378, BNJ366,
BNJ369, and BNJ383 anti-C5a antibodies described herein (vide
infra; Table 2).
[0185] In some embodiments, an anti-C5a antibody described herein
comprises a light chain variable region containing one or more of:
a light chain CDR1 comprising or consisting of the following amino
acid sequence: RASESVDSYGNSFMH (SEQ ID NO:20); a light chain CDR2
comprising or consisting of the following amino acid sequence:
WASTRES (SEQ ID NO:38); and a light chain CDR3 comprising or
consisting of the following amino acid sequence: QQSNEDPYT (SEQ ID
NO:22). In some embodiments, an anti-C5a antibody described herein
comprises a light chain variable region containing each of a light
chain CDR1 comprising or consisting of the following amino acid
sequence: RASESVDSYGNSFMH (SEQ ID NO:20); a light chain CDR2
comprising or consisting of the following amino acid sequence:
WASTRES (SEQ ID NO:38); and a light chain CDR3 comprising or
consisting of the following amino acid sequence: QQSNEDPYT (SEQ ID
NO:22). Exemplary anti-C5a antibodies comprising such a light chain
variable domain include, e.g., the BNJ371 and BNJ381 anti-C5a
antibodies described herein (vide infra; Table 2).
[0186] In some embodiments, an anti-C5a antibody described herein
comprises a heavy chain variable region containing one or more of:
a heavy chain CDR1 comprising or consisting of the following amino
acid sequence: DYSMD (SEQ ID NO:28); a heavy chain CDR2 comprising
or consisting of the following amino acid sequence:
AINPNSGGTNYNQKFKD (SEQ ID NO:29); and a heavy chain CDR3 comprising
or consisting of the following amino acid sequence: SGSYDGYYAMDY
(SEQ ID NO:30). In some embodiments, an anti-C5a antibody described
herein comprises a heavy chain variable region containing each of a
heavy chain CDR1 comprising or consisting of the following amino
acid sequence: DYSMD (SEQ ID NO:28); a heavy chain CDR2 comprising
or consisting of the following amino acid sequence:
AINPNSGGTNYNQKFKD (SEQ ID NO:29); and a heavy chain CDR3 comprising
or consisting of the following amino acid sequence: SGSYDGYYAMDY
(SEQ ID NO:30). Exemplary anti-C5a antibodies comprising such a
heavy chain variable domain include, e.g., the BNJ364, BNJ367,
BNJ371, and BNJ378 anti-C5a antibodies described herein (vide
infra; Table 2).
[0187] In some embodiments, an anti-C5a antibody described herein
comprises a heavy chain variable region containing one or more of:
a heavy chain CDR1 comprising or consisting of the following amino
acid sequence: DYSMD (SEQ ID NO:28); a heavy chain CDR2 comprising
or consisting of the following amino acid sequence:
AIHLNTGYTNYNQKFKG (SEQ ID NO:46); and a heavy chain CDR3 comprising
or consisting of the following amino acid sequence: GFYDGYSPMDY
(SEQ ID NO:47). In some embodiments, an anti-C5a antibody described
herein comprises a heavy chain variable region containing each of a
heavy chain CDR1 comprising or consisting of the following amino
acid sequence: DYSMD (SEQ ID NO:28); a heavy chain CDR2 comprising
or consisting of the following amino acid sequence:
AIHLNTGYTNYNQKFKG (SEQ ID NO:46); and a heavy chain CDR3 comprising
or consisting of the following amino acid sequence: GFYDGYSPMDY
(SEQ ID NO:47). Exemplary anti-C5a antibodies comprising such a
heavy chain variable domain include, e.g., the BNJ366, BNJ369,
BNJ381, and BNJ383 anti-C5a antibodies described herein (vide
infra; Table 2).
[0188] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof described herein can contain a heavy chain CDR2
region comprising the amino acid sequence: AINPNSGGTNYSQKFKD (SEQ
ID NO:67). For example, an anti-C5a antibody described herein can
comprise a heavy chain variable region containing one or more of: a
heavy chain CDR1 comprising or consisting of the following amino
acid sequence: DYSMD (SEQ ID NO:28); a heavy chain CDR2 comprising
or consisting of the following amino acid sequence:
AINPNSGGTNYSQKFKD (SEQ ID NO:67); and a heavy chain CDR3 comprising
or consisting of the following amino acid sequence: SGSYDGYYAMDY
(SEQ ID NO:30). In some embodiments, an anti-C5a antibody described
herein comprises a heavy chain variable region containing each of a
heavy chain CDR1 comprising or consisting of the following amino
acid sequence: DYSMD (SEQ ID NO:28); a heavy chain CDR2 comprising
or consisting of the following amino acid sequence:
AINPNSGGTNYSQKFKD (SEQ ID NO:67); and a heavy chain CDR3 comprising
or consisting of the following amino acid sequence: SGSYDGYYAMDY
(SEQ ID NO:30). An example of an anti-C5a antibody described
herein, which contains such a heavy chain polypeptide and binds to
human C5a with a K.sub.D that is less than 1 nM is the 5an101 ME
antibody described below.
[0189] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof described herein contains one of the exemplary
light chain CDR set and heavy chain CDR set pairings 1 to 4
depicted in Table 1.
TABLE-US-00001 TABLE 1 Exemplary Heavy and Light Chain CDR Pairings
Exemplary Exemplary Antibodies CDR Light Chain Heavy Chain with
such Pairings CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 Pairings 1 SIN: 20 SIN:
21 SIN: 22 SIN: 28 SIN: 29 SIN: 30 BNJ364, BNJ367, BNJ378 2 SIN: 20
SIN: 21 SIN: 22 SIN: 28 SIN: 46 SIN: 47 BNJ366, BNJ369, BNJ383 3
SIN: 20 SIN: 38 SIN: 22 SIN: 28 SIN: 29 SIN: 30 BNJ371 4 SIN: 20
SIN: 38 SIN: 22 SIN: 28 SIN: 46 SIN: 47 BNJ381 "SIN" refers to "SEQ
ID NO."
The amino acid sequences represented by the SEQ ID NOs in Table 1
are set forth in Table 2.
[0190] In some embodiments, the anti-C5a antibody does not comprise
exemplary CDR pairing 3. In some embodiments, the anti-C5a antibody
is not BNJ371.
[0191] In some embodiments, the light chain polypeptide of an
anti-C5a antibody described herein can be a .lamda. light chain
polypeptide (e.g., a fully human or humanized .lamda. light chain
polypeptide). In some embodiments, the light chain polypeptide of
an anti-C5a antibody described herein is a .kappa. light chain
polypeptide (e.g., a fully human or humanized .kappa. light chain
polypeptide). The amino acid sequences of numerous light chain
polypeptides (e.g., numerous human light chain polypeptides) are
well-known in the art and set forth in, e.g., Kabat et al. (1991),
supra. Exemplary .kappa. light chain polypeptide amino acid
sequences are set forth in Table 2.
[0192] In some embodiments, an anti-C5a antibody described herein
can comprise a light chain constant region. For example, the light
chain constant region can be a .lamda. light chain polypeptide
constant region or a .kappa. light chain constant region. The amino
acid sequence for a number of human .lamda. and .kappa. light chain
constant regions are known in the art and described in, e.g., Kabat
et al. (1991), supra. Exemplary .kappa. light chain polypeptide
amino acid sequences are set forth in Table 2.
[0193] The heavy chain polypeptide can comprise a constant region
(e.g., a heavy chain constant region 1 (CH1), heavy chain constant
region 2 (CH2), heavy chain constant region 3 (CH3), a heavy chain
constant region 4 (CH4), or a combination of any of the foregoing).
The heavy chain polypeptide can comprise an Fc portion of an
immunoglobulin molecule. The Fc region can be, e.g., an Fc region
from an IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgE, or IgD
immunoglobulin molecule or a combination of portions of each of
these. To be clear, the anti-C5a antibodies described herein can
be, e.g., of IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgE, or IgD isotype.
The amino acid sequences for a number of human heavy chain constant
regions are known in the art and described in, e.g., Kabat et al.
(1991), supra.
[0194] In some embodiments, the heavy chain polypeptide can
comprise a hybrid constant region, or a portion thereof, such as a
G2/G4 hybrid constant region (see e.g., Burton et al. (1992) Adv
Immun 51:1-18; Canfield et al. (1991) J Exp Med 173:1483-1491; and
Mueller et al. (1997) Mol Immunol 34(6):441-452). For example (and
in accordance with Kabat numbering), the IgG1 and IgG4 constant
regions comprise G.sub.249G.sub.250 residues whereas the IgG2
constant region does not comprise residue 249, but does comprise
G.sub.250. In a G2/G4 hybrid constant region, where the 249-250
region comes from the G2 sequence, the constant region can be
further modified to introduce a glycine residue at position 249 to
produce a G2/G4 fusion having G.sub.249/G.sub.250. Other constant
domain hybrids that comprise G.sub.249/G.sub.250 can also be part
of engineered antibodies in accordance with the disclosure.
Exemplary heavy chain polypeptide amino acid sequences are set
forth in Table 2.
[0195] The anti-C5a antibody can be, e.g., one of the specific
antibodies exemplified in the working examples: BNJ364, BNJ367,
BNJ378, BNJ366, BNJ369, BNJ383, BNJ371, or BNJ381. The amino acid
sequences for these exemplified anti-C5a antibodies, which can be
used in conjunction with any of the methods described herein, are
set forth in Table 2.
TABLE-US-00002 TABLE 2 Amino Acid Sequences for Select Humanized
Anti-C5a Antibodies SIN: Ab Description Amino Acid Sequence 16
BNJ364 Full light
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPP
chain
KLLIYRASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTV-
AAP sequence with
SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
signal peptide KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 17 BNJ364 Full
light
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
chain
GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS-
VVCL sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH-
QGLS without signal SPVTKSFNRGEC peptide 18 BNJ364 Light chain
MVLQTQVFISLLLWISGAYG variable region sequence signal peptide 19
BNJ364 Light chain
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
variable GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ364 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 21 BNJ364 Light chain RASNLES variable region
sequence Kabat LCDR2 22 BNJ364 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ364 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 24
BNJ364 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAINPNSGGTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYW
sequence with
GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
signal peptide
SGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLN
GKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESN
GQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK 25
BNJ364 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
chain
DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSSASTKGPSVFP-
L sequence
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS-
NFGTQT without signal
YTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE
peptide
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIE-
KTI
SKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 26 BNJ364 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 27
BNJ364 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
variable DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSS
region sequence 28 BNJ364 Heavy chain DYSMD variable region
sequence Kabat HCDR1 29 BNJ364 Heavy chain AINPNSGGTNYNQKFKD
variable region sequence Kabat HCDR2 30 BNJ364 Heavy chain
SGSYDGYYAMDY variable region sequence Kabat HCDR3 31 BNJ364 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS
sequence
NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQP-
ENNYKT TPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 16
BNJ367 Full light
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPP
chain
KLLIYRASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTV-
AAP sequence with
SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
signal peptide KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 17 BNJ367 Full
light
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
chain
GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS-
VVCL sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH-
QGLS without signal SPVTKSFNRGEC peptide 18 BNJ367 Light chain
MVLQTQVFISLLLWISGAYG variable region sequence signal peptide 19
BNJ367 Light chain
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
variable GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ367 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 21 BNJ367 Light chain RASNLES variable region
sequence Kabat LCDR2 22 BNJ367 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ367 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 32
BNJ367 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAINPNSGGTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYW
sequence with
GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
signal peptide
SGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 33
BNJ367 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
chain
DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSSASTKGPSVFP-
L sequence
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS-
NFGTQT without signal
YTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQE
peptide
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE-
KTI
SKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 26 BNJ367 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 27
BNJ367 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
variable DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSS
region sequence 28 BNJ367 Heavy chain DYSMD variable region
sequence Kabat HCDR1 29 BNJ367 Heavy chain AINPNSGGTNYNQKFKD
variable region sequence Kabat HCDR2 30 BNJ367 Heavy chain
SGSYDGYYAMDY variable region sequence Kabat HCDR3 34 BNJ367 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS
sequence
NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP-
ENNYKT TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 35
BNJ371 Full light
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPP
chain
KLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTV-
AAP
sequence with
SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
signal peptide KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 36 BNJ371 Full
light
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYWASTRESGVPDRFSG
chain
SGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA-
SVVC sequence
LLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT-
HQGL without signal SSPVTKSFNRGEC peptide 18 BNJ371 Light chain
MVLQTQVFISLLLWISGAYG variable region sequence signal peptide 37
BNJ371 Light chain
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYWASTRESGVPDRFSG
variable SGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ371 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 38 BNJ371 Light chain WASTRES variable region
sequence Kabat LCDR2 22 BNJ371 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ371 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 32
BNJ371 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAINPNSGGTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYW
sequence with
GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
signal peptide
SGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 33
BNJ371 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
chain
DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSSASTKGPSVFP-
L sequence
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS-
NFGTQT without signal
YTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQE
peptide
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE-
KTI
SKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 26 BNJ371 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 27
BNJ371 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
variable DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSS
region sequence 28 BNJ371 Heavy chain DYSMD variable region
sequence Kabat HCDR1 29 BNJ371 Heavy chain AINPNSGGTNYNQKFKD
variable region sequence Kabat HCDR2 30 BNJ371 Heavy chain
SGSYDGYYAMDY variable region sequence Kabat HCDR3 34 BNJ371 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS
sequence
NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP-
ENNYKT TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 39
BNJ378 Full light
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASESVDSYGNSFMHWYQQKPG
chain
KAPKWYRASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSNEDPYTFGGGTKVEIKRT-
VA sequence with
APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
signal peptide LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 40 BNJ378 Full
light
DIQMTQSPSSLSASVGDRVTITCRASESVDSYGNSFMHWYQQKPGKAPKWYRASNLESGVPSRFSGS
chain
GSGTDFTLTISSLQPEDFATYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS-
VVCL sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH-
QGLS without signal SPVTKSFNRGEC peptide 41 BNJ378 Light chain
MDMRVPAQLLGLLLLWLRGARC variable region sequence signal peptide 42
BNJ378 Light chain
DIQMTQSPSSLSASVGDRVTITCRASESVDSYGNSFMHWYQQKPGKAPKWYRASNLESGVPSRFSGS
variable GSGTDFTLTISSLQPEDFATYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ378 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 21 BNJ378 Light chain RASNLES variable region
sequence Kabat LCDR2 22 BNJ378 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ378 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 32
BNJ378 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAINPNSGGTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYW
sequence with
GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
signal peptide
SGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 33
BNJ378 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
chain
DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSSASTKGPSVFP-
L sequence
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS-
NFGTQT without signal
YTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQE
peptide
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE-
KTI
SKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 26 BNJ378 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 27
BNJ378 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAINPNSGGTNYNQKFK
variable DRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSGSYDGYYAMDYWGQGTTVTVSS
region sequence 28 BNJ378 Heavy chain DYSMD variable region
sequence Kabat HCDR1 29 BNJ378 Heavy chain AINPNSGGTNYNQKFKD
variable region sequence Kabat HCDR2 30 BNJ378 Heavy chain
SGSYDGYYAMDY variable region sequence Kabat HCDR3 34 BNJ378 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMIS-
RTPEV region
TCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS
sequence
NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP-
ENNYKT TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 16
BNJ366 Full light
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPP
chain
KLLIYRASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTV-
AAP sequence with
SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
signal peptide KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 17 BNJ366 Full
light
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
chain
GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS-
VVCL sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH-
QGLS without signal SPVTKSFNRGEC
peptide 18 BNJ366 Light chain MVLQTQVFISLLLWISGAYG variable region
sequence signal peptide 19 BNJ366 Light chain
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
variable GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ366 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 21 BNJ366 Light chain RASNLES variable region
sequence Kabat LCDR2 22 BNJ366 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ366 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 43
BNJ366 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAIHLNTGYTNYNQKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWG
sequence with
QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
signal peptide
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG
KEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNG
QPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 44
BNJ366 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
chain
GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSSASTKGPSVFPL-
A sequence
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSN-
FGTQTY without signal
TCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP
peptide
EVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKT-
ISK
TKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 26 BNJ366 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 45
BNJ366 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
variable GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSS
region sequence 28 BNJ366 Heavy chain DYSMD variable region
sequence Kabat HCDR1 46 BNJ366 Heavy chain AIHLNTGYTNYNQKFKG
variable region sequence Kabat HCDR2 47 BNJ366 Heavy chain
GFYDGYSPMDY variable region sequence Kabat HCDR3 31 BNJ366 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS
sequence
NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQP-
ENNYKT TPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 16
BNJ369 Full light
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPP
chain
KLLIYRASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTV-
AAP sequence with
SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
signal peptide KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 17 BNJ369 Full
light
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
chain
GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS-
VVCL sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH-
QGLS without signal SPVTKSFNRGEC peptide 18 BNJ369 Light chain
MVLQTQVFISLLLWISGAYG variable region sequence signal peptide 19
BNJ369 Light chain
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYRASNLESGVPDRFSGS
variable GSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ369 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 21 BNJ369 Light chain RASNLES variable region
sequence Kabat LCDR2 22 BNJ369 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ369 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 48
BNJ369 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAIHLNTGYTNYNQKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWG
sequence with
QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
signal peptide
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG
KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNG
QPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 49
BNJ369 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
chain
GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSSASTKGPSVFPL-
A sequence
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSN-
FGTQTY without signal
TCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP
peptide
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT-
ISK
AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 26 BNJ369 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 45
BNJ369 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
variable GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSS
region sequence 28 BNJ369 Heavy chain DYSMD variable region
sequence Kabat HCDR1 46 BNJ369 Heavy chain AIHLNTGYTNYNQKFKG
variable region sequence Kabat HCDR2 47 BNJ369 Heavy chain
GFYDGYSPMDY variable region sequence Kabat HCDR3 34 BNJ369 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS
sequence
NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP-
ENNYKT TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 35
BNJ381 Full light
MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPP
chain
KLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTV-
AAP sequence with
SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
signal peptide KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 36 BNJ381 Full
light
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKWYWASTRESGVPDRFSG
chain
SGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA-
SVVC sequence
LLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT-
HQGL without signal SSPVTKSFNRGEC peptide 18 BNJ381 Light chain
MVLQTQVFISLLLWISGAYG variable region sequence signal peptide 37
BNJ381 Light chain
DIVMTQSPDSLAVSLGERATINCRASESVDSYGNSFMHWYQQKPGQPPKLLIYWASTRESGVPDRFSG
variable SGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGGGTKVEIKR
region sequence 20 BNJ381 Light chain RASESVDSYGNSFMH variable
region sequence Kabat LCDR1 38 BNJ381 Light chain WASTRES variable
region sequence Kabat LCDR2 22 BNJ381 Light chain QQSNEDPYT
variable region sequence Kabat LCDR3 23 BNJ381 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 48
BNJ381 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAIHLNTGYTNYNQKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWG
sequence with
QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
signal peptide
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG
KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNG
QPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 49
BNJ381 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
chain
GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSSASTKGPSVFPL-
A sequence
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSN-
FGTQTY without signal
TCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP
peptide
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT-
ISK
AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 26 BNJ381 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 45
BNJ381 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
variable GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSS
region sequence 28 BNJ381 Heavy chain DYSMD variable region
sequence Kabat HCDR1 46 BNJ381 Heavy chain AIHLNTGYTNYNQKFKG
variable region sequence Kabat HCDR2 47 BNJ381 Heavy chain
GFYDGYSPMDY variable region sequence Kabat HCDR3 34 BNJ381 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS
sequence
NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP-
ENNYKT TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 39
BNJ383 Full light
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASESVDSYGNSFMHWYQQKPG
chain
KAPKWYRASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSNEDPYTFGGGTKVEIKRT-
VA sequence with
APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
signal peptide LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 40 BNJ383 Full
light
DIQMTQSPSSLSASVGDRVTITCRASESVDSYGNSFMHWYQQKPGKAPKWYRASNLESGVPSRFSGS
chain
GSGTDFTLTISSLQPEDFATYYCQQSNEDPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS-
VVCL sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH-
QGLS without signal SPVTKSFNRGEC peptide 41 BNJ383 Light chain
MDMRVPAQLLGLLLLWLRGARC variable region sequence signal peptide 42
BNJ383 Light chain
DIQMTQSPSSLSASVGDRVTITCRASESVDSYGNSFMHWYQQKPGKAPKWYRASNLESGVPSRFSGS
variable GSGTDFTLTISSLQPEDFATYYCQQSNEDPYTFGGGTKVEIKR region
sequence 20 BNJ383 Light chain RASESVDSYGNSFMH variable region
sequence Kabat LCDR1 21 BNJ383 Light chain RASNLES variable region
sequence Kabat LCDR2 22 BNJ383 Light chain QQSNEDPYT variable
region sequence Kabat LCDR3 23 BNJ383 Light chain
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
constant STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC region sequence 48
BNJ383 Full heavy
MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLE
chain
WMGAIHLNTGYTNYNQKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWG
sequence with
QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
signal peptide
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG
KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNG
QPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 49
BNJ383 Full heavy
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
chain
GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSSASTKGPSVFPL-
A sequence
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSN-
FGTQTY without signal
TCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP
peptide
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT-
ISK
AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 26 BNJ383 Heavy chain
MDWTWRVFCLLAVAPGAHS variable region sequence signal peptide 45
BNJ383 Heavy chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSMDWVRQAPGQGLEWMGAIHLNTGYTNYNQKFK
variable GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGFYDGYSPMDYWGQGTTVTVSS
region sequence 28 BNJ383 Heavy chain DYSMD variable region
sequence Kabat HCDR1 46 BNJ383 Heavy chain AIHLNTGYTNYNQKFKG
variable region sequence Kabat HCDR2 47 BNJ383 Heavy chain
GFYDGYSPMDY variable region sequence Kabat HCDR3 34 BNJ383 Heavy
chain
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
constant
TVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMI-
SRTPEV region
TCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS
sequence
NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP-
ENNYKT TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
''SIN'' refers to SEQ ID NO. ''Ab'' in Table 2 refers to the
alphanumeric designation assigned to a given antibody. Each of the
antibodies is exemplified in the working examples.
[0196] In some embodiments, an anti-C5a antibody described herein
comprises a Chothia-defined light chain CDR set or a combined
Kabat-Chothia-defined light chain CDR set obtained from any of the
light chain variable regions described in Tables 2 or 3. In some
embodiment, an anti-C5a antibody, or antigen-binding fragment
thereof, described herein comprises a Chothia-defined heavy chain
CDR set or a combined Kabat-Chothia-defined heavy chain CDR set
obtained from any of the heavy chain variable regions described in
Tables 2 or 3.
[0197] In preferred embodiments, an anti-C5a antibody described
herein binds to C5a, but not to native, full-length C5. In some
embodiments, an anti-C5a antibody binds to C5a, but does not bind
to the alpha chain of uncleaved, native C5. As used herein,
"uncleaved C5" refers to a C5 protein that has not been cleaved
into fragments C5a and C5b by an AP or CP C5 convertase. An
exemplary amino acid sequence for a human C5 alpha chain is set
forth in Haviland et al. (1991), supra, the sequence of which is
incorporated herein by reference in its entirety.
[0198] In some embodiments, an anti-C5a antibody described herein
does not bind to paralogs of human C5 such as human C3a or human
C4a.
[0199] The disclosure also features antibodies that crossblock
binding of an anti-C5a antibody described herein (e.g., crossblocks
any one of BNJ364, BNJ367, BNJ378, BNJ366, BNJ369, BNJ371, BNJ381,
or BNJ383). As used herein, the term "crossblocking antibody"
refers to an antibody that lowers the amount of binding (or
prevents binding) of an anti-C5a antibody to an epitope on a
complement component C5a protein relative to the amount of binding
of the anti-C5a antibody to the epitope in the absence of the
crossblocking antibody. Suitable methods for determining whether a
first antibody crossblocks binding of a second antibody to an
epitope are known in the art. For example, crossblocking antibodies
can be identified by comparing the binding of the BNJ364 monoclonal
anti-C5a antibody in the presence and absence of a test antibody.
Decreased binding of the BNJ364 antibody in the presence of the
test antibody as compared to binding of the BNJ364 antibody in the
absence of the test antibody indicates the test antibody is a
crossblocking antibody.
[0200] In some embodiments, the binding of an antibody to C5a can
inhibit the biological activity of C5a. Methods for measuring C5a
activity include, e.g., chemotaxis assays, radioimmunoassays
(RIAs), or enzyme-linked immunospecific assays (ELISA) (see, e.g.,
Ward and Zvaifler (1971) J Clin Invest 50(3):606-16 and Wurzner et
al. (1991) Complement Inflamm 8:328-340). In some embodiments, the
binding of an antibody or antigen-binding fragment thereof to C5a
can inhibit C5a-mediated neutrophil activation in vitro. Suitable
methods for determining whether an anti-C5a antibody inhibits
C5a-mediated neutrophil activation in vitro, or the extent to which
the antibody inhibits activation, are known in the art and
exemplified in the working examples below. For example, human
neutrophils obtained from healthy donors can be isolated and
contacted with isolated human C5a in the presence or absence of a
test anti-C5a antibody. C5a-dependent activation of human
neutrophils can be measured as a function of myeloperoxidase (MPO)
release from the cells in the presence of C5a. An inhibition of the
amount of MPO released from the cells in the presence of C5a and
the test antibody, as compared to the amount of MPO released from
cells in the presence of C5a and a control antibody, indicates that
the test antibody inhibits C5a-mediated neutrophil activation.
[0201] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof does not inhibit (or does not substantially
inhibit) the activity of complement component C5, as compared to
the level of inhibition (if any) observed by a corresponding
control antibody or antigen-binding fragment thereof (i.e., an
antibody that does not bind to free C5a or C5). C5 activity can be
measured as a function of its cell-lysing ability in a subject's
body fluids. The cell-lysing ability, or a reduction thereof, of C5
can be measured by methods well known in the art such as, for
example, by a conventional hemolytic assay such as the hemolysis
assay described by Kabat and Mayer (eds), "Experimental
Immunochemistry, 2.sup.nd Edition," 135-240, Springfield, Ill., CC
Thomas (1961), pages 135-139, or a conventional variation of that
assay such as the chicken erythrocyte hemolysis method as described
in, e.g., Hillmen et al. (2004) N Engl J Med 350(6):552.
[0202] In some embodiments, C5 activity, or inhibition thereof, is
quantified using a CH50eq assay. The CH50eq assay is a method for
measuring the total classical complement activity in serum. This
test is a lytic assay, which uses antibody-sensitized erythrocytes
as the activator of the classical complement pathway and various
dilutions of the test serum to determine the amount required to
give 50% lysis (CHSO). The percent hemolysis can be determined, for
example, using a spectrophotometer. The CH50eq assay provides an
indirect measure of terminal complement complex (TCC) formation,
since the TCC themselves are directly responsible for the hemolysis
that is measured.
[0203] The assay is well known and commonly practiced by those of
skill in the art. Briefly, to activate the classical complement
pathway, undiluted serum samples (e.g., human serum samples) are
added to microassay wells containing the antibody-sensitized
erythrocytes to thereby generate TCC. Next, the activated sera are
diluted in microassay wells, which are coated with a capture
reagent (e.g., an antibody that binds to one or more components of
the TCC). The TCC present in the activated samples bind to the
monoclonal antibodies coating the surface of the microassay wells.
The wells are washed and, to each well, is added a detection
reagent that is detectably labeled and recognizes the bound TCC.
The detectable label can be, e.g., a fluorescent label or an
enzymatic label. The assay results are expressed in CHSO unit
equivalents per milliliter (CHSO U Eq/mL).
[0204] Additional methods for detecting and/or measuring C5
activity in vitro are set forth and exemplified in the working
examples.
[0205] In some embodiments, the binding of an antibody to C5a can
inhibit the interaction between C5a and C5aR1. Suitable methods for
detecting and/or measuring the interaction between C5a and C5aR1
(in the presence and absence of an antibody) are known in the art
and described in, e.g., Mary and Boulay (1993) Eur J Haematol
51(5):282-287; Kaneko et al. (1995) Immunology 86(1):149-154;
Giannini et al. (1995) J Biol Chem 270(32):19166-19172; and U.S.
Patent Application Publication No. 20060160726. For example, the
binding of detectably labeled (e.g., radioactively labeled) C5a to
C5aR1-expressing peripheral blood mononuclear cells can be
evaluated in the presence and absence of an antibody. A decrease in
the amount of detectably-labeled C5a that binds to C5aR1 in the
presence of the antibody, as compared to the amount of binding in
the absence of the antibody, is an indication that the antibody
inhibits the interaction between C5a and C5aR1.
[0206] In some embodiments, the binding of an antibody to C5a can
inhibit the interaction between C5a and C5L2. Methods for detecting
and/or measuring the interaction between C5a and C5L2 are known in
the art and described in, e.g., Ward (2009) J Mol Med 87(4):375-378
and Chen et al. (2007) Nature 446(7132):203-207. Additional methods
for evaluating the biological effect of an anti-C5a antibody
described herein are exemplified in the working examples below.
[0207] In some embodiments, the anti-C5a antibody specifically
binds to a human complement component C5a protein (e.g., the human
C5a protein having the amino acid sequence depicted in SEQ ID NO:1
or SEQ ID NO:2). The terms "specific binding," "specifically
binds," and like grammatical terms, as used herein, refer to two
molecules forming a complex (e.g., a complex between an antibody
and a complement component C5a protein) that is relatively stable
under physiologic conditions. Typically, binding is considered
specific when the association constant (k.sub.a) is higher than
10.sup.6 M.sup.-1 s.sup.-1. Thus, an antibody can specifically bind
to a C5a protein with a k.sub.a of at least (or greater than)
10.sup.6 (e.g., at least or greater than 10.sup.7, 10.sup.8,
10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, or
10.sup.15 or higher) M.sup.-1 s.sup.-1. In some embodiments, an
anti-C5a antibody described herein has a dissociation constant
(k.sub.d) of less than or equal to 10.sup.-3 (e.g.,
8.times.10.sup.-4, 5.times.10.sup.-4, 2.times.10.sup.-4, 10.sup.-4,
or 10.sup.-5) s.sup.-1.
[0208] In some embodiments, an anti-C5a antibody described herein
has a K.sub.D of less than 10.sup.-8, 10.sup.-9, 10.sup.-10,
10.sup.-11, or 10.sup.-12 M. The equilibrium constant K.sub.D is
the ratio of the kinetic rate constants--k.sub.d/k.sub.a. In some
embodiments, an anti-C5a antibody described herein has a K.sub.D of
less than 1.25.times.10.sup.-9 M. Examples of anti-C5a antibodies
that bind to C5a with a K.sub.D that is less than
1.25.times.10.sup.-9 M include, e.g., the BNJ364, BNJ367, BNJ371,
BNJ378, BNJ366, BNJ369, BNJ381, and BNJ383 anti-C5a antibodies.
[0209] In some embodiments, an anti-C5a antibody described herein
has a K.sub.D of less than 1.times.10.sup.-9 M. Examples of
anti-C5a antibodies that bind to C5a with a K.sub.D that is less
than 10.sup.-9 M include, e.g., the BNJ364, BNJ367, BNJ378, BNJ366,
BNJ369, BNJ381, and BNJ383 anti-C5a antibodies.
[0210] In some embodiments, an anti-C5a antibody described herein
has a K.sub.D of less than 5.times.10.sup.-10 M. Examples of
anti-C5a antibodies that bind to C5a with a K.sub.D that is less
than 5.times.10.sup.-10 M include, e.g., the BNJ367, BNJ378,
BNJ366, BNJ369, BNJ381, and BNJ383 anti-C5a antibodies.
[0211] In some embodiments, an anti-C5a antibody described herein
has a K.sub.D of less than 2.times.10.sup.-10 M. Examples of
anti-C5a antibodies that bind to C5a with a K.sub.D that is less
than 2.times.10.sup.-10 M include, e.g., the BNJ367, BNJ366,
BNJ369, BNJ381, and BNJ383 anti-C5a antibodies.
[0212] In some embodiments, an anti-C5a antibody described herein
has a K.sub.D of less than 1.times.10.sup.-10 M. Examples of
anti-C5a antibodies that bind to C5a with a K.sub.D that is less
than 1.times.10.sup.-10 M include, e.g., the BNJ369, BNJ381, and
BNJ383 anti-C5a antibodies.
[0213] In some embodiments, an anti-C5a antibody described herein
has a K.sub.D of less than 7.5.times.10.sup.-11 M. Examples of
anti-C5a antibodies that bind to C5a with a K.sub.D that is less
than 7.5.times.10.sup.-11 M include, e.g., the BNJ369 and BNJ383
anti-C5a antibodies.
[0214] Methods for determining the affinity of an antibody for a
protein antigen are known in the art. For example, the affinity of
an antibody for a protein antigen can be quantified using a variety
of techniques such as, but not limited to, Western blot, dot blot,
Biolayer Interferometry, Surface Plasmon Resonance (SPR) method
(e.g., BIAcore system; Pharmacia Biosensor AB, Uppsala, Sweden and
Piscataway, N.J.), or enzyme-linked immunospecific assays (ELISA).
See, e.g., Harlow and Lane (1988) "Antibodies: A Laboratory Manual"
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.;
Benny K. C. Lo (2004) "Antibody Engineering: Methods and
Protocols," Humana Press (ISBN: 1588290921); Borrebaek (1992)
"Antibody Engineering, A Practical Guide," W.H. Freeman and Co.,
NY; Borrebaek (1995) "Antibody Engineering," 2.sup.nd Edition,
Oxford University Press, NY, Oxford; Johne et al. (1993) J Immunol
Meth 160:191-198; Jonsson et al. (1993) Ann Biol Clin 51:19-26; and
Jonsson et al. (1991) Biotechniques 11:620-627.
[0215] Any of the light chain CDR sets or light chain variable
regions described herein can be paired with any of the heavy chain
CDR sets or heavy chain variable regions described herein. It is
well within the purview of the ordinarily skilled artisan to, e.g.,
confirm (test) that an anti-C5a antibody generated by such a
pairing possesses the desired affinity or activity. Suitable
methods for confirming the activity and/or affinity of an anti-C5a
antibody are described herein.
[0216] In some embodiments, the anti-C5a antibodies described
herein bind to both human C5a (hC5a) and C5a from a non-human
mammal such as a non-human primate (e.g., cynomolgus macaque). In
some embodiments, an anti-C5a antibody or antigen-binding fragment
thereof described herein does not bind to paralogs of human C5a
such as C3a or C4a from the same non-human mammalian species.
[0217] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof described herein binds to free hC5a and a
cynomolgus macaque C5a protein comprising, or consisting of, the
following amino acid sequence: MLQEKIEEIAAKYKHLVVKK CCYDGVRINH
DETCEQRAAR ISVGPRCVKA FTECCVVASQLRANNSHKDLQLGR (SEQ ID NO:179). In
some embodiments, an anti-C5a antibody or antigen-binding fragment
thereof described herein binds to free hC5a and a rhesus macaque
C5a protein comprising, or consisting of, the amino acid sequence
depicted in SEQ ID NO:179.
[0218] In some embodiments, an antibody, or an antigen-binding
fragment thereof, can bind to a desarginated form of C5a protein
from a non-human mammalian species (e.g., a non-human primate
species). For example, the antibody or antigen-binding fragment
thereof can bind to a free C5a-desarg protein from cynomolgus
macaque or rhesus macaque, the protein comprising, or consisting
of, the following amino acid sequence: MLQEKIEEIAAKYKHLVVKK
CCYDGVRINH DETCEQRAAR ISVGPRCVKA FTECCVVASQLRANNSHKDLQLG (SEQ ID
NO:180).
[0219] In some embodiments, the anti-C5a antibodies described
herein bind to mouse C5a (i.e., the free C5a from mouse). In some
embodiments, the anti-C5a antibodies described herein bind to mouse
C5a, but not to human C5a. In some embodiments, an anti-C5a
antibody described herein does not bind to uncleaved, native
(fully-folded) mouse C5. In some embodiments, an anti-C5a antibody
described herein does not bind to paralogs of mouse C5a such as
mouse C3a or mouse C4a.
[0220] An anti-mouse C5a antibody, or an antigen-binding fragment
thereof, can bind to a mouse C5a protein comprising, or consisting
of, the following amino acid sequence:
LRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCT
IANKIRKESPHKPVQLGR (SEQ ID NO:51). See also, e.g., Wetsel et al.
(1987) Biochem 26:737-743. In some embodiments, an anti-mouse C5a
antibody, or an antigen-binding fragment thereof, can bind to a
desarginated form of mouse C5a protein comprising, or consisting
of, the following amino acid sequence:
LRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCT
IANKIRKESPHKPVQLG (SEQ ID NO:52). In some embodiments, the
anti-mouse C5a antibody binds to both the full-length mouse C5a
protein and the desarginated form of the mouse C5a protein.
[0221] An anti-mouse C5a antibody described herein can, e.g.,
contain a light chain CDR set obtained from a light chain variable
region polypeptide comprising the following amino acid sequence:
EIVLTQSPAIMSASLGEKVTMSCRASSSVNYIYWYQQKSDASPKLWIYYTSNLAP GVPARF
SGSGSGNSYSLTIS SMEGEDAATYYCQQFTS SPLTFGVGTKLELKR (SEQ ID NO:53).
For example, an anti-mouse C5a antibody can contain: (i) a
Kabat-defined light chain CDR1 comprising, or consisting of, the
following amino acid sequence: RASSSVNYIY (SEQ ID NO:54); (ii) a
Kabat-defined light chain CDR2 comprising, or consisting of, the
following amino acid sequence: YTSNLAP (SEQ ID NO:55); and/or (iii)
a Kabat-defined light chain CDR3 comprising, or consisting of, the
following amino acid sequence: QQFTSSPLT (SEQ ID NO:56).
[0222] The anti-mouse C5a antibody can contain a light chain
constant region, e.g., the mouse kappa light chain constant region
comprising, or consisting of, the following amino acid sequence:
ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSW
TDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID
NO:57).
[0223] In some embodiments, an anti-mouse C5a antibody described
herein can contain an amino-terminal signal peptide, e.g., a signal
peptide comprising, or consisting of, the following amino acid
sequence: MGWSCIILFLVATATGVHS (SEQ ID NO:58).
[0224] In some embodiments, an anti-mouse C5a antibody described
herein can contain a light chain polypeptide comprising, or
consisting of, the following amino acid sequence:
REIVLTQSPAIMSASLGEKVTMSCRASSSVNYIYWYQQKSDASPKLWIYYTSNLA PGVPARF
SGSGSGNSYSLTIS SMEGEDAATYYCQQFTS SPLTFGVGTKLELKRAD
AAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTD
QDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID NO:59) or
MGWSCIILFLVATATGVHSREIVLTQSPAIMSASLGEKVTMSCRASSSVNYIYWY
QQKSDASPKLWIYYTSNLAPGVPARF SGSGSGNSYSLTIS SMEGEDAATYYCQQF
TSSPLTFGVGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVK
WKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS
TSPIVKSFNRNEC (SEQ ID NO:60). In some embodiments, an anti-mouse
C5a antibody described herein contains a light chain polypeptide
comprising amino acids 2 to 214 of SEQ ID NO:59. In some
embodiments, an anti-mouse C5a antibody described herein contains a
light chain polypeptide comprising amino acids 1 to 19 and 21 to
233 of SEQ ID NO:60.
[0225] An anti-mouse C5a antibody described herein can, e.g.,
contain a heavy chain CDR set obtained from a heavy chain variable
region polypeptide comprising the following amino acid sequence:
LEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYINWVKQSHGKSLEWIGYIYP
NDGDTNYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARPYYSDYGM DYWGQGTSVTVSS
(SEQ ID NO:61). For example, an anti-mouse C5a antibody can
contain: (i) a Kabat-defined heavy chain CDR1 comprising, or
consisting of, the following amino acid sequence: DYYYIN (SEQ ID
NO:62); (ii) a Kabat-defined heavy chain CDR2 comprising, or
consisting of, the following amino acid sequence: YIYPNDGDTNYNQKFKG
(SEQ ID NO:63); and/or (iii) a Kabat-defined heavy chain CDR3
comprising, or consisting of, the following amino acid sequence:
PYYSDYGMDY (SEQ ID NO:64).
[0226] The anti-mouse C5a antibody can contain a heavy chain
constant region. In some embodiments, an anti-mouse C5a antibody
described herein can contain an amino-terminal signal peptide,
e.g., a signal peptide comprising, or consisting of, the following
amino acid sequence: MGWSCIILFLVATATGVHS (SEQ ID NO:65).
[0227] In some embodiments, an anti-mouse C5a antibody described
herein can contain a heavy chain polypeptide comprising, or
consisting of, the following amino acid sequence:
LEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYINWVKQSHGKSLEWIGYIYP
NDGDTNYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARPYYSDYGM DYWGQGTSVTVSS
(SEQ ID NO:66) or
MGWSCIILFLVATATGVHSLEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYI
NWVKQSHGKSLEWIGYIYPNDGDTNYNQKFKGKATLTVDKSSSTAYMELRSLT
SEDSAVYYCARPYYSDYGMDYWGQGTSVTVSS (SEQ ID NO:67). In some
embodiments, an anti-mouse C5a antibody described herein contains a
heavy chain polypeptide comprising amino acids 2 to 121 of SEQ ID
NO:66. In some embodiments, an anti-mouse C5a antibody described
herein contains a heavy chain polypeptide comprising amino acids 1
to 19 and 21 to 140 of SEQ ID NO:67. In some embodiments, an
anti-mouse C5a antibody described herein contains a heavy chain
constant region polypeptide comprising one or more amino acid
substitutions from the above described sequence.
[0228] In some embodiments, an anti-mouse C5a antibody described
herein contains a light chain polypeptide comprising: (i) a light
chain CDR1 comprising, or consisting of, the amino acid sequence
depicted in SEQ ID NO:54; (ii) a light chain CDR2 comprising, or
consisting of, the amino acid sequence depicted in SEQ ID NO:55;
and (iii) a light chain CDR3 comprising, or consisting of, the
amino acid sequence depicted in SEQ ID NO:56; (iv) a heavy chain
CDR1 comprising, or consisting of, the amino acid sequence depicted
in SEQ ID NO:62; (v) a heavy chain CDR2 comprising, or consisting
of, the amino acid sequence depicted in SEQ ID NO:63; and/or (vi) a
heavy chain CDR3 comprising, or consisting of, the amino acid
sequence depicted in SEQ ID NO:64.
[0229] In some embodiments, an anti-mouse C5a antibody described
herein contains a light chain polypeptide comprising, or consisting
of, the amino acid sequence depicted in SEQ ID NO:59 and a heavy
chain polypeptide comprising, or consisting of, the amino acid
sequence depicted in SEQ ID NO:66.
[0230] In some embodiments, an anti-C5a antibody described herein
can bind to human C5a and to mouse C5a.
Methods for Producing the Anti-C5a Antibodies and Antigen-Binding
Fragments Thereof
[0231] The disclosure also features methods for producing any of
the anti-C5a antibodies or antigen-binding fragments thereof
described herein. In some embodiments, methods for preparing an
antibody described herein can include immunizing a subject (e.g., a
non-human mammal) with an appropriate immunogen. Suitable
immunogens for generating any of the antibodies described herein
are set forth herein. For example, to generate an antibody that
binds to C5a, a skilled artisan can immunize a suitable subject
(e.g., a non-human mammal such as a rat, a mouse, a gerbil, a
hamster, a dog, a cat, a pig, a goat, a horse, or a non-human
primate) with a full-length C5a polypeptide such as a full-length
C5a polypeptide comprising the amino acid sequence depicted in SEQ
ID NO:1 or the desarginated form of C5a (e.g., the human C5a desarg
comprising the amino acid sequence depicted in SEQ ID NO:2). In
some embodiments, the non-human mammal is C5 deficient, e.g., a
C5-deficient mouse described in, e.g., Levy and Ladda (1971) Nat
New Biol 229(2):51-52; Crocker et al. (1974) J Clin Pathol
27(2):122-124; Wetsel et al. (1990) J Biol Chem 265:2435-2440; and
Jungi and Pepys (1981) Immunology 43(2):271-279. Human C5a can be
purified from human serum as described in, e.g., McCarthy and
Henson (1979) J Immunol 123(6):2511-2517 and Manderino et al.
(1982) J Immunol Methods 53(1):41-50. See also the working
examples. Human C5a can also be generated in vitro as described in,
e.g., Vallota and Muller-Eberhard (1973) J Exp Med 137:1109.
Purified human C5a is also commercially available from, e.g.,
Complement Technology, Inc. (catalog number A144; Tyler, Tex.).
Recombinant C5a can also be generated by one of ordinary skill in
the art as described in, e.g., Tothe et al. (1994) Prot Sci
3:1159-1168.
[0232] A suitable subject (e.g., a non-human mammal) can be
immunized with the appropriate antigen along with subsequent
booster immunizations a number of times sufficient to elicit the
production of an antibody by the mammal. The immunogen can be
administered to a subject (e.g., a non-human mammal) with an
adjuvant. Adjuvants useful in producing an antibody in a subject
include, but are not limited to, protein adjuvants; bacterial
adjuvants, e.g., whole bacteria (BCG, Corynebacterium parvum or
Salmonella minnesota) and bacterial components including cell wall
skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol
extractable residue (MER) of tubercle bacillus, complete or
incomplete Freund's adjuvant; viral adjuvants; chemical adjuvants,
e.g., aluminum hydroxide, and iodoacetate and cholesteryl
hemisuccinate. Other adjuvants that can be used in the methods for
inducing an immune response include, e.g., cholera toxin and
parapoxvirus proteins. See also Bieg et al. (1999) Autoimmunity
31(1):15-24. See also, e.g., Lodmell et al. (2000) Vaccine
18:1059-1066; Johnson et al. (1999) J Med Chem 42:4640-4649;
Baldridge et al. (1999) Methods 19:103-107; and Gupta et al. (1995)
Vaccine 13(14): 1263-1276.
[0233] In some embodiments, the methods include preparing a
hybridoma cell line that secretes a monoclonal antibody that binds
to the immunogen. For example, a suitable mammal such as a
laboratory mouse is immunized with a C5a polypeptide as described
above. Antibody-producing cells (e.g., B cells of the spleen) of
the immunized mammal can be isolated two to four days after at
least one booster immunization of the immunogen and then grown
briefly in culture before fusion with cells of a suitable myeloma
cell line. The cells can be fused in the presence of a fusion
promoter such as, e.g., vaccinia virus or polyethylene glycol. The
hybrid cells obtained in the fusion are cloned, and cell clones
secreting the desired antibodies are selected. For example, spleen
cells of Balb/c mice immunized with a suitable immunogen can be
fused with cells of the myeloma cell line PAI or the myeloma cell
line Sp2/0-Ag 14. After the fusion, the cells are expanded in
suitable culture medium, which is supplemented with a selection
medium, for example HAT medium, at regular intervals in order to
prevent normal myeloma cells from overgrowing the desired hybridoma
cells. The obtained hybrid cells are then screened for secretion of
the desired antibodies, e.g., an antibody that binds to C5a and
inhibits the interaction between C5a and a C5a receptor (e.g.,
C5aR1).
[0234] In some embodiments, a skilled artisan can identify an
anti-C5a antibody from a non-immune biased library as described in,
e.g., U.S. Pat. No. 6,300,064 (to Knappik et al.; Morphosys AG) and
Schoonbroodt et al. (2005) Nucleic Acids Res 33(9):e81.
[0235] In some embodiments, the methods described herein can
involve, or be used in conjunction with, e.g., phage display
technologies, bacterial display, yeast surface display, eukaryotic
viral display, mammalian cell display, and cell-free (e.g.,
ribosomal display) antibody screening techniques (see, e.g., Etz et
al. (2001) J Bacteriol 183:6924-6935; Cornelis (2000) Curr Opin
Biotechnol 11:450-454; Klemm et al. (2000) Microbiology
146:3025-3032; Kieke et al. (1997) Protein Eng 10:1303-1310; Yeung
et al. (2002) Biotechnol Prog 18:212-220; Boder et al. (2000)
Methods Enzymology 328:430-444; Grabherr et al. (2001) Comb Chem
High Throughput Screen 4:185-192; Michael et al. (1995) Gene Ther
2:660-668; Pereboev et al. (2001) J Virol 75:7107-7113; Schaffitzel
et al. (1999) J Immunol Methods 231:119-135; and Hanes et al.
(2000) Nat Biotechnol 18:1287-1292).
[0236] Methods for identifying antibodies using various phage
display methods are known in the art. In phage display methods,
functional antibody domains are displayed on the surface of phage
particles which carry the polynucleotide sequences encoding them.
Such phage can be utilized to display antigen-binding domains of
antibodies, such as Fab, Fv, or disulfide-bond stabilized Fv
antibody fragments, expressed from a repertoire or combinatorial
antibody library (e.g., human or murine). Phage used in these
methods are typically filamentous phage such as fd and M13. The
antigen binding domains are expressed as a recombinantly fused
protein to any of the phage coat proteins pIII, pVIII, or pIX. See,
e.g., Shi et al. (2010) JMB 397:385-396. Examples of phage display
methods that can be used to make the immunoglobulins, or fragments
thereof, described herein include those disclosed in Brinkman et
al. (1995) J Immunol Methods 182:41-50; Ames et al. (1995) J
Immunol Methods 184:177-186; Kettleborough et al. (1994) Eur J
Immunol 24:952-958; Persic et al. (1997) Gene 187:9-18; Burton et
al. (1994) Advances in Immunology 57:191-280; and PCT publication
nos. WO 90/02809, WO 91/10737, WO 92/01047, WO 92/18619, WO
93/11236, WO 95/15982, and WO 95/20401. Suitable methods are also
described in, e.g., U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484;
5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908;
5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108.
[0237] In some embodiments, the phage display antibody libraries
can be generated using mRNA collected from B cells from the
immunized mammals. For example, a splenic cell sample comprising B
cells can be isolated from mice immunized with C5a polypeptide as
described above. mRNA can be isolated from the cells and converted
to cDNA using standard molecular biology techniques. See, e.g.,
Sambrook et al. (1989) "Molecular Cloning: A Laboratory Manual,
2.sup.nd Edition," Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y.; Harlow and Lane (1988), supra; Benny K. C. Lo (2004),
supra; and Borrebaek (1995), supra. The cDNA coding for the
variable regions of the heavy chain and light chain polypeptides of
immunoglobulins are used to construct the phage display library.
Methods for generating such a library are described in, e.g., Merz
et al. (1995) J Neurosci Methods 62(1-2):213-9; Di Niro et al.
(2005) Biochem J 388(Pt 3):889-894; and Engberg et al. (1995)
Methods Mol Biol 51:355-376.
[0238] In some embodiments, a combination of selection and
screening can be employed to identify an antibody of interest from,
e.g., a population of hybridoma-derived antibodies or a phage
display antibody library. Suitable methods are known in the art and
are described in, e.g., Hoogenboom (1997) Trends in Biotechnology
15:62-70; Brinkman et al. (1995), supra; Ames et al. (1995), supra;
Kettleborough et al. (1994), supra; Persic et al. (1997), supra;
and Burton et al. (1994), supra. For example, a plurality of
phagemid vectors, each encoding a fusion protein of a bacteriophage
coat protein (e.g., pIII, pVIII, or pIX of M13 phage) and a
different antigen-combining region are produced using standard
molecular biology techniques and then introduced into a population
of bacteria (e.g., E. coli). Expression of the bacteriophage in
bacteria can, in some embodiments, require use of a helper phage.
In some embodiments, no helper phage is required (see, e.g.,
Chasteen et al. (2006) Nucleic Acids Res 34(21):e145). Phage
produced from the bacteria are recovered and then contacted to,
e.g., a target antigen bound to a solid support (immobilized).
Phage may also be contacted to antigen in solution, and the complex
is subsequently bound to a solid support.
[0239] In some embodiments, the immobilized phage are the phage of
interest. Accordingly, the unbound phage are removed by washing the
support. Following the wash step, bound phage are then eluted from
the solid support, e.g., using a low pH buffer or a free target
antigen competitor, and recovered by infecting bacteria. In some
embodiments, the phage that are not immobilized are the phage of
interest. In such embodiments, the population of phage can be
contacted to the antigen two or more times to deplete from the
population any of the phage that bind to the support. Unbound phage
are then collected and used for subsequent screening steps.
[0240] To enrich the phage population for phage particles that
contain antibodies having a higher affinity for the target antigen
(while reducing the proportion of phage that may bind to the
antigen non-specifically), the eluted phage (described above) can
be used to re-infect a population of bacterial host cells. The
expressed phage are then isolated from the bacteria and again
contacted to a target antigen. The concentration of antigen, pH,
temperature and inclusion of detergents and adjuvants during
contact can be modulated to enrich for higher affinity antibody
fragments. The unbound phage are removed by washing the solid
support. The number or cycles, duration, pH, temperature and
inclusion of detergents and adjuvants during washing can also be
modulated to enrich for higher affinity antibody fragments.
Following the wash step, bound phage are then eluted from the solid
support. Anywhere from one to six iterative cycles of panning may
be used to enrich for phage containing antibodies having higher
affinity for the target antigen. In some embodiments, a deselection
step can also be performed in conjunction with any of the panning
approaches described herein.
[0241] Individual phage of the population can be isolated by
infecting bacteria and then plating at a density to allow formation
of monoclonal antibodies.
[0242] For example, to identify using phage display techniques an
antibody that binds to C5a, but not to C5, the following panning
approach can be employed. The population can first be contacted to
a surface containing bound native, full-length human C5. The
process can be repeated two or more times, each time collecting the
unbound phage. The population can also be contacted to a solid
support containing surface-bound C4 and/or C3 proteins. Unbound
phage from the foregoing steps are then contacted to a surface
containing bound C5a or desarginated C5a. Phage that bind to C5a
are eluted from the surface and recovered by infecting bacteria.
Iterative rounds of phage selection may be performed. After one to
six rounds of selection, individual recovered phagemid can be
screened for expression of antibody fragments with the desired
specificity and affinity.
[0243] A subpopulation of antibodies screened using the above
methods can be characterized for their specificity and binding
affinity for a particular immunogen (e.g., C5a) using any
immunological or biochemical based method known in the art. For
example, specific binding of an antibody to C5a, as compared to
native, full-length C5, may be determined for example using
immunological or biochemical based methods such as, but not limited
to, an ELISA assay, SPR assays, immunoprecipitation assay, affinity
chromatography, and equilibrium dialysis as described above.
Immunoassays which can be used to analyze immunospecific binding
and cross-reactivity of the antibodies include, but are not limited
to, competitive and non-competitive assay systems using techniques
such as Western blots, MA, ELISA (enzyme linked immunosorbent
assay), "sandwich" immunoassays, immunoprecipitation assays,
immunodiffusion assays, agglutination assays, complement-fixation
assays, immunoradiometric assays, fluorescent immunoassays, and
protein A immunoassays. Such assays are routine and well known in
the art.
[0244] Antibodies can also be assayed using any SPR-based assays
known in the art for characterizing the kinetic parameters of the
interaction of the antibody with C5a. Any SPR instrument
commercially available including, but not limited to, BIAcore
Instruments (Biacore AB; Uppsala, Sweden); lAsys instruments
(Affinity Sensors; Franklin, Massachussetts); IBIS system (Windsor
Scientific Limited; Berks, UK), SPR-CELLIA systems (Nippon Laser
and Electronics Lab; Hokkaido, Japan), and SPR Detector Spreeta
(Texas Instruments; Dallas, Tex.) can be used in the methods
described herein. See, e.g., Mullett et al. (2000) Methods 22:
77-91; Dong et al. (2002) Reviews in Mol Biotech 82: 303-323;
Fivash et al. (1998) Curr Opin Biotechnol 9: 97-101; and Rich et al
(2000) Curr Opin Biotechnol 11: 54-61.
[0245] It is understood that the above methods can also be used to
determine if, e.g., an anti-C5a antibody does not bind to
full-length, native C5, C3, and/or C4 proteins. The above methods
can also be used to determine if an antibody that binds to C5a also
inhibits the interaction between C5a and a C5a receptor. The above
methods can also be used to determine if an antibody that binds to
C5a also inhibits the activity of C5a.
[0246] As described in the above references, after phage selection,
the antibody coding regions from the phage can be isolated and used
to generate whole antibodies, including human antibodies, or any
desired fragments, and expressed in any desired host, including
mammalian cells, insect cells, plant cells, yeast, and bacteria,
e.g., as described in detail below. For example, techniques to
recombinantly produce Fab, Fab' and F(ab').sub.2 fragments can also
be employed using methods known in the art such as those disclosed
in PCT publication no. WO 92/22324; Mullinax et al. (1992)
BioTechniques 12(6):864-869; and Sawai et al. (1995) Am J Repr
Immunol 34:26-34; and Better et al. (1988) Science 240:1041-1043.
Examples of techniques which can be used to produce single-chain
Fvs and antibodies include those described in U.S. Pat. Nos.
4,946,778 and 5,258,498; Huston et al. (1991) Methods in Enzymology
203:46-88; Shu et al. (1993) Proc Nat Acad Sci USA 90:7995-7999;
and Skerra et al. (1988) Science 240:1038-1040.
[0247] Phage display technology can also be used to, e.g., increase
the affinity of an antibody for its cognate antigen. The
technology, referred to as affinity maturation, can employ
mutagenesis or CDR walking and re-selection to identify antibodies
that bind with higher affinity to an antigen as compared to the
initial or parental antibody. See, e.g., Glaser et al. (1992) J
Immunol 149:3903-3913. Libraries can be constructed consisting of a
pool of variant clones, each differing by one or more amino acid
substitutions. Mutants with increased binding affinity for the
antigen can be selected for by contacting the immobilized mutants
with labeled antigen or any combination of methods described above.
Any screening method known in the art can be used to identify
mutant antibodies with increased affinity to the antigen (e.g., SPR
or ELISA techniques).
[0248] In some embodiments, epitope mapping can be used to
identify, e.g., the region of C5a that interacts with an antibody,
e.g., a region of C5a that binds to C5aR1. Methods for identifying
the epitope to which a particular antibody binds are also known in
the art and are described above.
[0249] The antibodies and fragments thereof identified herein can
be or can be made "chimeric." Chimeric antibodies and
antigen-binding fragments thereof comprise portions from two or
more different species (e.g., mouse and human). Chimeric antibodies
can be produced with mouse variable regions of desired specificity
fused to human constant domains (for example, U.S. Pat. No.
4,816,567). In this manner, non-human antibodies can be modified to
make them more suitable for human clinical application (e.g.,
methods for treating or preventing a complement-mediated disorder
in a subject).
[0250] The monoclonal antibodies of the present disclosure include
"humanized" forms of the non-human (e.g., mouse) antibodies.
Humanized or CDR-grafted mAbs are particularly useful as
therapeutic agents for humans because they are not cleared from the
circulation as rapidly as mouse antibodies and do not typically
provoke an adverse immune reaction. Generally, a humanized antibody
has one or more amino acid residues introduced into it from a
non-human source. These non-human amino acid residues are often
referred to as "import" residues, which are typically taken from an
"import" variable domain. Methods of preparing humanized antibodies
are generally well known in the art. For example, humanization can
be essentially performed following the method of Winter and
co-workers (see, e.g., Jones et al. (1986) Nature 321:522-525;
Riechmann et al. (1988) Nature 332:323-327; and Verhoeyen et al.
(1988) Science 239:1534-1536), by substituting rodent frameworks or
CDR sequences for the corresponding sequences of a human antibody.
Also see, e.g., Staelens et al. (2006) Mol Immunol 43:1243-1257. In
some embodiments, humanized forms of non-human (e.g., mouse)
antibodies are human antibodies (recipient antibody) in which the
CDR region amino acid residues of the non-human antibody (e.g.,
mouse, rat, rabbit, or non-human primate antibody) having the
desired specificity, affinity, and binding capacity are grafted
onto the framework scaffold of a human antibody. Additional
humanization methods are described below in the working
examples.
[0251] Methods for grafting CDR sequences from a donor antibody
(e.g., a non-human antibody) to the framework regions of an
acceptor antibody (e.g., a human antibody) are well known in the
art and are described in, e.g., Jones et al. (1986) Nature
321:522-525; Verhoeyen et al. (1988) Science 239(4847):1534-1536;
Riechmann et al. (1988) Nature 332:323-327; Queen et al. (1989)
Proc Natl Acad Sci USA 86:10029-10033; PCT publication no. WO
93/011237; Kettleborough et al. (1991) Protein Engineering, Design
and Selection 4:773-783; Benny K. C. Lo (2004) "Antibody
Engineering: Methods and Protocols," Humana Press (ISBN:
1588290921); Borrebaek (1992) "Antibody Engineering, A Practical
Guide," W.H. Freeman and Co., NY; and Borrebaek (1995) "Antibody
Engineering," 2.sup.nd Edition, Oxford University Press, NY,
Oxford. For example, CDRs from a donor antibody can be grafted onto
framework regions of an acceptor antibody using overlap extension
polymerase chain reaction (PCR) techniques as described in, e.g.,
Daugherty et al. (1991) Nucleic Acids Res 19(9):2471-2476; Roguska
et al. (1996) Protein Engineering 9(10):895-904; and Yazaki et al.
(2004) Protein Engineering, Design & Selection
17(5):481-489.
[0252] In embodiments where the selected CDR amino acid sequences
are short sequences (e.g., fewer than 10-15 amino acids in length),
nucleic acids encoding the CDRs can be chemically synthesized as
described in, e.g., Shiraishi et al. (2007) Nucleic Acids Symposium
Series 51(1):129-130 and U.S. Pat. No. 6,995,259. For a given
nucleic acid sequence encoding an acceptor antibody, the region of
the nucleic acid sequence encoding the CDRs can be replaced with
the chemically synthesized nucleic acids using standard molecular
biology techniques. The 5' and 3' ends of the chemically
synthesized nucleic acids can be synthesized to comprise sticky end
restriction enzyme sites for use in cloning the nucleic acids into
the nucleic acid encoding the variable region of the donor
antibody.
[0253] In some instances, one or more framework region amino acid
residues of the human immunoglobulin are also replaced by
corresponding amino acid residues of the non-human antibody (so
called "back mutations"). In addition, phage display libraries can
be used to vary amino acids at chosen positions within the antibody
sequence. The properties of a humanized antibody are also affected
by the choice of the human framework. Furthermore, humanized and
chimerized antibodies can be modified to comprise residues that are
not found in the recipient antibody or in the donor antibody in
order to further improve antibody properties, such as, for example,
affinity or effector function.
[0254] Fully human antibodies are also provided in the disclosure.
The term "human antibody" includes antibodies having variable and
constant regions (if present) derived from human immunoglobulin
sequences, preferably human germline sequences. Human antibodies
can include amino acid residues not encoded by human germline
immunoglobulin sequences (e.g., mutations introduced by random or
site-specific mutagenesis in vitro or by somatic mutation in vivo).
However, the term "human antibody" does not include antibodies in
which CDR sequences derived from another mammalian species, such as
a mouse, have been grafted onto human framework sequences (i.e.,
humanized antibodies). Fully human or human antibodies may be
derived from transgenic mice carrying human antibody genes
(carrying the variable (V), diversity (D), joining (J), and
constant (C) exons) or from human cells. For example, it is now
possible to produce transgenic animals (e.g., mice) that are
capable, upon immunization, of producing a full repertoire of human
antibodies in the absence of endogenous immunoglobulin production.
See, e.g., Jakobovits et al. (1993) Proc Natl Acad Sci USA 90:2551;
Jakobovits et al. (1993) Nature 362:255-258; Bruggemann et al.
(1993) Year in Immunol. 7:33; and Duchosal et al. (1992) Nature
355:258. Transgenic mouse strains can be engineered to contain gene
sequences from unrearranged human immunoglobulin genes. One example
of such a mouse is the HuMAb Mouse.RTM. (Medarex, Inc.), which
contains human immunoglobulin transgene miniloci that encode
unrearranged human .mu. heavy and .kappa. light chain
immunoglobulin sequences, together with targeted mutations that
inactivate the endogenous .mu. and .kappa. chain loci. See, e.g.,
Lonberg, et al. (1994) Nature 368(6474):856-859. The preparation
and use of HuMab mice, and the genomic modifications carried by
such mice, are further described in Taylor et al. (1992) Nucleic
Acids Res 20:6287-6295; Chen, J. et al. (1993) International
Immunology 5: 647-656; Tuaillon et al. (1993) Proc Natl Acad Sci
USA 90:3720-3724; Choi et al. (1993) Nature Genetics 4:1 17-123;
Tuaillon et al. (1994) J Immunol 152:2912-2920; Taylor et al.
(1994) International Immunology 6:579-591; and Fishwild et al.
(1996) Nature Biotechnol 14:845-851. An alternative transgenic
mouse system for expressing human immunoglobulin genes is referred
to as the Xenomouse (Abgenix, Inc.) and is described in, e.g., U.S.
Pat. Nos. 6,075,181; 6,114,598; 6,150,584; and 6,162,963. Like the
HuMAb Mouse.RTM. system, the Xenomouse system involves disruption
of the endogenous mouse heavy and light chain genes and insertion
into the genome of the mouse transgenes carrying unrearranged human
heavy and light chain immunoglobulin loci that contain human
variable and constant region sequences. Other systems known in the
art for expressing human immunoglobulin genes include the KM
Mouse.RTM. system, described in detail in PCT Publication WO
02/43478 and the TC mouse system described in Tomizuka et al.
(2000) Proc Natl Acad Sci USA 97:722-727.
[0255] The human sequences may code for both the heavy and light
chains of human antibodies and would function correctly in the
mice, undergoing rearrangement to provide a wide antibody
repertoire similar to that in humans. The transgenic mice can be
immunized with the target protein immunogen to create a diverse
array of specific antibodies and their encoding RNA. Nucleic acids
encoding the antibody chain components of such antibodies may then
be cloned from the animal into a display vector. Typically,
separate populations of nucleic acids encoding heavy and light
chain sequences are cloned, and the separate populations then
recombined on insertion into the vector, such that any given copy
of the vector receives a random combination of a heavy and a light
chain. The vector is designed to express antibody chains so that
they can be assembled and displayed on the outer surface of a
display package containing the vector. For example, antibody chains
can be expressed as fusion proteins with a phage coat protein from
the outer surface of the phage. Thereafter, display packages can be
selected and screened for display of antibodies binding to a
target.
[0256] In addition, the phage-display libraries screened above can
include human antibodies (Hoogenboom et al. (1992) J Mol Biol
227:381; Marks et al. (1991) J Mol Biol 222:581-597; and Vaughan et
al. (1996) Nature Biotech 14:309). Synthetic phage libraries can be
created which use randomized combinations of synthetic human
antibody V-regions. By selection on antigen, fully human antibodies
can be made in which the V-regions are very human-like in nature.
See, e.g., U.S. Pat. Nos. 6,794,132; 6,680,209; 4,634,666; and
Ostberg et al. (1983) Hybridoma 2:361-367, the contents of each of
which are incorporated herein by reference in their entirety.
[0257] For the generation of human antibodies, also see Mendez et
al. (1998) Nature Genetics 15:146-156 and Green and Jakobovits
(1998) J Exp Med 188:483-495, the disclosures of which are hereby
incorporated by reference in their entirety. Human antibodies are
further discussed and delineated in U.S. Pat. Nos. 5,939,598;
6,673,986; 6,114,598; 6,075,181; 6,162,963; 6,150,584; 6,713,610;
and 6,657,103 as well as U.S. Patent Publication Nos. 20030229905
A1, 20040010810 A1, 20040093622 A1, 20060040363 A1, 20050054055 A1,
20050076395 A1, and 20050287630 A1. See also International
Publication Nos. WO 94/02602, WO 96/34096, and WO 98/24893, and
European Patent No. EP 0 463 151 B1. The disclosures of each of the
above-cited patents, applications, and references are hereby
incorporated by reference in their entirety.
[0258] In an alternative approach, others, including GenPharm
International, Inc., have utilized a "minilocus" approach. In the
minilocus approach, an exogenous Ig locus is mimicked through the
inclusion of pieces (individual genes) from the Ig locus. Thus, one
or more V.sub.H genes, one or more D.sub.H genes, one or more
J.sub.H genes, a mu constant region, and a second constant region
(preferably a gamma constant region) are formed into a construct
for insertion into an animal. This approach is described in, e.g.,
U.S. Pat. Nos. 5,545,807; 5,545,806; 5,625,825; 5,625,126;
5,633,425; 5,661,016; 5,770,429; 5,789,650; and U.S. Pat. Nos.
5,814,318; 5,591,669; 5,612,205; 5,721,367; 5,789,215; 5,643,763;
5,569,825; 5,877,397; 6,300,129; 5,874,299; 6,255,458; and
7,041,871, the disclosures of which are hereby incorporated by
reference in their entirety. See also European Patent No. 0 546 073
B1, International Patent Publication Nos. WO 92/03918, WO 92/22645,
WO 92/22647, WO 92/22670, WO 93/12227, WO 94/00569, WO 94/25585, WO
96/14436, WO 97/13852, and WO 98/24884, the disclosures of each of
which are hereby incorporated by reference in their entirety. See
further Taylor et al. (1992) Nucleic Acids Res 20: 6287; Chen et
al. (1993) Int Immunol 5: 647; Tuaillon et al. (1993) Proc Natl
Acad Sci USA 90: 3720-4; Choi et al. (1993) Nature Genetics 4: 117;
Lonberg et al. (1994) Nature 368: 856-859; Taylor et al. (1994)
International Immunology 6: 579-591; Tuaillon et al. (1995) J.
Immunol 154: 6453-65; Fishwild et al. (1996) Nature Biotechnology
14: 845; and Tuaillon et al. (2000) Eur J Immunol. 10: 2998-3005,
the disclosures of each of which are hereby incorporated by
reference in their entirety.
[0259] In certain embodiments, de-immunized forms of the
antibodies, or antigen-binding fragments described herein are
provided. De-immunized antibodies or antigen-binding fragments
thereof are antibodies that have been modified so as to render the
antibody or antigen-binding fragment thereof non-immunogenic, or
less immunogenic, to a given species. De-immunization can be
achieved by modifying the antibody or antigen-binding fragment
thereof utilizing any of a variety of techniques known to those
skilled in the art (see, e.g., PCT Publication Nos. WO 04/108158
and WO 00/34317). For example, an antibody or antigen-binding
fragment thereof may be de-immunized by identifying potential T
cell epitopes and/or B cell epitopes within the amino acid sequence
of the antibody or antigen-binding fragment thereof and removing
one or more of the potential T cell epitopes and/or B cell epitopes
from the antibody or antigen-binding fragment thereof, for example,
using recombinant techniques. The modified antibody or
antigen-binding fragment thereof may then optionally be produced
and tested to identify antibodies or antigen-binding fragments
thereof that have retained one or more desired biological
activities, such as, for example, binding affinity, but have
reduced immunogenicity. Methods for identifying potential T cell
epitopes and/or B cell epitopes may be carried out using techniques
known in the art, such as, for example, computational methods (see
e.g., PCT Publication No. WO 02/069232), in vitro or in silico
techniques, and biological assays or physical methods (such as, for
example, determination of the binding of peptides to MHC molecules,
determination of the binding of peptide:MHC complexes to the T cell
receptors from the species to receive the antibody or
antigen-binding fragment thereof, testing of the protein or peptide
parts thereof using transgenic animals with the MHC molecules of
the species to receive the antibody or antigen-binding fragment
thereof, or testing with transgenic animals reconstituted with
immune system cells from the species to receive the antibody or
antigen-binding fragment thereof, etc.). In various embodiments,
the de-immunized antibodies described herein include de-immunized
antigen-binding fragments, Fab, Fv, scFv, Fab' and F(ab').sub.2,
monoclonal antibodies, murine antibodies, fully human antibodies,
engineered antibodies (such as, for example, chimeric, single
chain, CDR-grafted, humanized, and artificially selected
antibodies), synthetic antibodies and semi-synthetic
antibodies.
[0260] In the therapeutic embodiments of the present disclosure,
bispecific antibodies are contemplated. Bispecific antibodies are
monoclonal, preferably human or humanized, antibodies that have
binding specificities for at least two different antigens. In the
present case, one of the binding specificities is for C5a, the
other one is for any other antigen.
[0261] Methods for making bispecific antibodies are within the
purview of those skilled in the art. Traditionally, the recombinant
production of bispecific antibodies is based on the co-expression
of two immunoglobulin heavy-chain/light-chain pairs, where the two
heavy chain/light-chain pairs have different specificities
(Milstein and Cuello (1983) Nature 305:537-539). Antibody variable
domains with the desired binding specificities (antibody-antigen
combining sites) can be fused to immunoglobulin constant domain
sequences. The fusion of the heavy chain variable region is
preferably is with an immunoglobulin heavy-chain constant domain,
including at least part of the hinge, C.sub.H2, and C.sub.H3
regions. DNAs encoding the immunoglobulin heavy-chain fusions and,
if desired, the immunoglobulin light chain, are inserted into
separate expression vectors, and are co-transfected into a suitable
host organism. For further details of illustrative currently known
methods for generating bispecific antibodies see, e.g., Suresh et
al. (1986) Methods in Enzymology 121:210; PCT Publication No. WO
96/27011; Brennan et al. (1985) Science 229:81; Shalaby et al., J
Exp Med (1992) 175:217-225; Kostelny et al. (1992) J Immunol
148(5):1547-1553; Hollinger et al. (1993) Proc Natl Acad Sci USA
90:6444-6448; Gruber et al. (1994) J Immunol 152:5368; and Tutt et
al. (1991) J Immunol 147:60. Bispecific antibodies also include
cross-linked or heteroconjugate antibodies. Heteroconjugate
antibodies may be made using any convenient cross-linking methods.
Suitable cross-linking agents are well known in the art, and are
disclosed in U.S. Pat. No. 4,676,980, along with a number of
cross-linking techniques.
[0262] Various techniques for making and isolating bispecific
antibody fragments directly from recombinant cell culture have also
been described. For example, bispecific antibodies have been
produced using leucine zippers. See, e.g., Kostelny et al. (1992) J
Immunol 148(5):1547-1553. The leucine zipper peptides from the Fos
and Jun proteins may be linked to the Fab' portions of two
different antibodies by gene fusion. The antibody homodimers may be
reduced at the hinge region to form monomers and then re-oxidized
to form the antibody heterodimers. This method can also be utilized
for the production of antibody homodimers. The "diabody" technology
described by Hollinger et al. (1993) Proc Natl Acad Sci USA
90:6444-6448 has provided an alternative mechanism for making
bispecific antibody fragments. The fragments comprise a heavy-chain
variable domain (VH) connected to a light-chain variable domain
(VL) by a linker which is too short to allow pairing between the
two domains on the same chain. Accordingly, the VH and VL domains
of one fragment are forced to pair with the complementary VL and VH
domains of another fragment, thereby forming two antigen-binding
sites. Another strategy for making bispecific antibody fragments by
the use of single-chain Fv (scFv) dimers has also been reported.
See, e.g., Gruber et al. (1994) J Immunol 152:5368. Alternatively,
the antibodies can be "linear antibodies" as described in, e.g.,
Zapata et al. (1995) Protein Eng. 8(10):1057-1062. Briefly, these
antibodies comprise a pair of tandem Fd segments
(V.sub.H-C.sub.H1-V.sub.H-C.sub.H1) which form a pair of antigen
binding regions. Linear antibodies can be bispecific or
monospecific.
[0263] Antibodies with more than two valencies (e.g., trispecific
antibodies) are contemplated and described in, e.g., Tutt et al.
(1991) J Immunol 147:60.
[0264] The disclosure also embraces variant forms of multi-specific
antibodies such as the dual variable domain immunoglobulin (DVD-Ig)
molecules described in Wu et al. (2007) Nat Biotechnol
25(11):1290-1297. The DVD-Ig molecules are designed such that two
different light chain variable domains (VL) from two different
parent antibodies are linked in tandem directly or via a short
linker by recombinant DNA techniques, followed by the light chain
constant domain. Similarly, the heavy chain comprises two different
heavy chain variable domains (VH) linked in tandem, followed by the
constant domain C.sub.H1 and Fc region. Methods for making DVD-Ig
molecules from two parent antibodies are further described in,
e.g., PCT Publication Nos. WO 08/024188 and WO 07/024715. The
disclosure also provides camelid or dromedary antibodies (e.g.,
antibodies derived from Camelus bactrianus, Calelus dromaderius, or
lama paccos). Such antibodies, unlike the typical two-chain
(fragment) or four-chain (whole antibody) antibodies from most
mammals, generally lack light chains. See U.S. Pat. No. 5,759,808;
Stijlemans et al. (2004) J Biol Chem 279:1256-1261; Dumoulin et al.
(2003) Nature 424:783-788; and Pleschberger et al. (2003)
Bioconjugate Chem 14:440-448. Engineered libraries of camelid
antibodies and antibody fragments are commercially available, for
example, from Ablynx (Ghent, Belgium). As with other antibodies of
non-human origin, an amino acid sequence of a camelid antibody can
be altered recombinantly to obtain a sequence that more closely
resembles a human sequence, i.e., the nanobody can be "humanized"
to thereby further reduce the potential immunogenicity of the
antibody.
[0265] In some embodiments, the anti-C5a antibodies described
herein comprise an altered heavy chain constant region that has
reduced (or no) effector function relative to its corresponding
unaltered constant region. Effector functions involving the
constant region of the anti-C5a antibody may be modulated by
altering properties of the constant or Fc region. Altered effector
functions include, for example, a modulation in one or more of the
following activities: antibody-dependent cellular cytotoxicity
(ADCC), complement-dependent cytotoxicity (CDC), apoptosis, binding
to one or more Fc-receptors, and pro-inflammatory responses.
Modulation refers to an increase, decrease, or elimination of an
effector function activity exhibited by a subject antibody
containing an altered constant region as compared to the activity
of the unaltered form of the constant region. In particular
embodiments, modulation includes situations in which an activity is
abolished or completely absent.
[0266] An altered constant region with altered FcR binding affinity
and/or ADCC activity and/or altered CDC activity is a polypeptide
which has either an enhanced or diminished FcR binding activity
and/or ADCC activity and/or CDC activity compared to the unaltered
form of the constant region. An altered constant region which
displays increased binding to an FcR binds at least one FcR with
greater affinity than the unaltered polypeptide. An altered
constant region which displays decreased binding to an FcR binds at
least one FcR with lower affinity than the unaltered form of the
constant region. Such variants which display decreased binding to
an FcR may possess little or no appreciable binding to an FcR,
e.g., 0 to 50% (e.g., less than 50, 49, 48, 47, 46, 45, 44, 43, 42,
41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25,
24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8,
7, 6, 5, 4, 3, 2, or 1%) of the binding to the FcR as compared to
the level of binding of a native sequence immunoglobulin constant
or Fc region to the FcR. Similarly, an altered constant region that
displays modulated ADCC and/or CDC activity may exhibit either
increased or reduced ADCC and/or CDC activity compared to the
unaltered constant region. For example, in some embodiments, the
anti-C5a antibody comprising an altered constant region can exhibit
approximately 0 to 50% (e.g., less than 50, 49, 48, 47, 46, 45, 44,
43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27,
26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10,
9, 8, 7, 6, 5, 4, 3, 2, or 1%) of the ADCC and/or CDC activity of
the unaltered form of the constant region. An anti-C5a antibody
described herein comprising an altered constant region displaying
reduced ADCC and/or CDC may exhibit reduced or no ADCC and/or CDC
activity as exemplified herein.
[0267] In certain embodiments, the altered constant region has at
least one amino acid substitution, insertion, and/or deletion,
compared to a native sequence constant region or to the unaltered
constant region, e.g. from about one to about one hundred amino
acid substitutions, insertions, and/or deletions in a native
sequence constant region or in the constant region of the parent
polypeptide. In some embodiments, the altered constant region
herein will possess at least about 70% homology (similarity) or
identity with the unaltered constant region and in some instances
at least about 75% and in other instances at least about 80%
homology or identity therewith, and in other embodiments at least
about 85%, 90% or 95% homology or identity therewith. The altered
constant region may also contain one or more amino acid deletions
or insertions. Additionally, the altered constant region may
contain one or more amino acid substitutions, deletions, or
insertions that results in altered post-translational
modifications, including, for example, an altered glycosylation
pattern (e.g., the addition of one or more sugar components, the
loss of one or more sugar components, or a change in composition of
one or more sugar components relative to the unaltered constant
region).
[0268] Antibodies with altered or no effector functions may be
generated by engineering or producing antibodies with variant
constant, Fc, or heavy chain regions; recombinant DNA technology
and/or cell culture and expression conditions may be used to
produce antibodies with altered function and/or activity. For
example, recombinant DNA technology may be used to engineer one or
more amino acid substitutions, deletions, or insertions in regions
(such as, for example, Fc or constant regions) that affect antibody
function including effector functions. Alternatively, changes in
post-translational modifications, such as, e.g., glycosylation
patterns, may be achieved by manipulating the cell culture and
expression conditions by which the antibody is produced. Suitable
methods for introducing one or more substitutions, additions, or
deletions into an Fc region of an antibody are well known in the
art and include, e.g., standard DNA mutagenesis techniques as
described in, e.g., Sambrook et al. (1989) "Molecular Cloning: A
Laboratory Manual, 2.sup.nd Edition," Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, N.Y.; Harlow and Lane (1988), supra;
Borrebaek (1992), supra; Johne et al. (1993), supra; PCT
publication no. WO 06/53301; and U.S. Pat. No. 7,704,497.
[0269] In some embodiments, an anti-C5a antibody described herein
exhibits reduced or no effector function. In some embodiments, an
anti-C5a antibody comprises a hybrid constant region, or a portion
thereof, such as a G2/G4 hybrid constant region (see e.g., Burton
et al. (1992) Adv Immun 51:1-18; Canfield et al. (1991) J Exp Med
173:1483-1491; and Mueller et al. (1997) Mol Immunol
34(6):441-452). See above.
[0270] In addition to using a G2/G4 construct as described above,
an anti-C5a antibody described herein having reduced effector
function may be produced by introducing other types of changes in
the amino acid sequence of certain regions of the antibody. Such
amino acid sequence changes include but are not limited to the
Ala-Ala mutation described in, e.g., PCT Publication nos. WO
94/28027 and WO 98/47531; and Xu et al. (2000) Cell Immunol
200:16-26. Thus, in some embodiments, an anti-C5a antibody with one
or more mutations within the constant region including the Ala-Ala
mutation has reduced or no effector function. According to these
embodiments, the constant region of the antibody can comprise a
substitution to an alanine at position 234 or a mutation to an
alanine at position 235. Additionally, the altered constant region
may contain a double mutation: a mutation to an alanine at position
234 and a second mutation to an alanine at position 235. In one
embodiment, an anti-C5a antibody comprises an IgG4 framework,
wherein the Ala-Ala mutation would describe a mutation(s) from
phenylalanine to alanine at position 234 and/or a mutation from
leucine to alanine at position 235. In another embodiment, the
anti-C5a antibody comprises an IgG1 framework, wherein the Ala-Ala
mutation would describe a mutation(s) from leucine to alanine at
position 234 and/or a mutation from leucine to alanine at position
235. An anti-C5a antibody may alternatively or additionally carry
other mutations, including the point mutation K322A in the CH2
domain (Hezareh et al. (2001) J Virol 75:12161-12168). An antibody
with said mutation(s) in the constant region may furthermore be a
blocking or non-blocking antibody.
[0271] Additional substitutions that, when introduced into a heavy
chain constant region, result in decreased effector function are
set forth in, e.g., Shields et al. (2001) J Biol Chem
276(9):6591-6604. See particularly Table 1 ("Binding of human IgG1
variants to human FcRn and Fc.gamma.R) of Shields et al., the
disclosure of which is incorporated herein by reference in its
entirety. By screening a library of anti-IgE antibodies, each
antibody of the library differing by one or more substitutions in
the heavy chain constant region, for binding to a panel of Fc
receptors (including FcRn, Fc.gamma.RI, Fc.gamma.RIIA,
Fc.gamma.RIIB, and Fc.gamma.RIIIA), the authors identified a number
of substitutions that modulate specific Fc-Fc receptor
interactions. For example, a variant IgG2a heavy chain constant
region in which the CH2 domain contains a D265A substitution (heavy
chain amino acid numbering according to Kabat et al. (supra))
results in a complete loss of interaction between the variant
constant region and IgG Fc receptors Fc.gamma.RIIB, Fc.gamma.RI11,
Fc.gamma.RI, and Fc.gamma.RIV. Shields et al. (2001) at page 6595,
Table 1. See also Baudino et al. (2008) J Immunol 181:6664-6669
(supra).
[0272] Changes within the hinge region also affect effector
functions. For example, deletion of the hinge region may reduce
affinity for Fc receptors and may reduce complement activation
(Klein et al. (1981) Proc Natl Acad Sci USA 78: 524-528). The
present disclosure therefore also relates to antibodies with
alterations in the hinge region.
[0273] In some embodiments, an anti-C5a antibody may contain an
altered constant region exhibiting enhanced or reduced complement
dependent cytotoxicity (CDC). Modulated CDC activity may be
achieved by introducing one or more amino acid substitutions,
insertions, or deletions in an Fc region of the antibody. See,
e.g., U.S. Pat. No. 6,194,551. Alternatively or additionally,
cysteine residue(s) may be introduced in the Fc region, thereby
allowing interchain disulfide bond formation in this region. The
homodimeric antibody thus generated may have improved or reduced
internalization capability and/or increased or decreased
complement-mediated cell killing. See, e.g., Caron et al. (1992) J
Exp Med 176:1191-1195 and Shopes (1992) Immunol 148:2918-2922; PCT
publication nos. WO 99/51642 and WO 94/29351; Duncan and Winter
(1988) Nature 322:738-40; and U.S. Pat. Nos. 5,648,260 and
5,624,821.
[0274] Another potential means of modulating effector function of
antibodies includes changes in glycosylation, which is summarized
in, e.g., Raju (2003) BioProcess International 1(4):44-53.
According to Wright and Morrison, the microheterogeneity of human
IgG oligosaccharides can affect biological functions such as CDC
and ADCC, binding to various Fc receptors, and binding to Clq
protein. (1997) TIBTECH 15:26-32. Glycosylation patterns of
antibodies can differ depending on the producing cell and the cell
culture conditions (Raju, supra). Such differences can lead to
changes in both effector function and pharmacokinetics. See, e.g.,
Israel et al. (1996) Immunology 89(4):573-578; Newkirk et al.
(1996) Clin Exp Immunol 106(2):259-264. Differences in effector
function may be related to the IgG's ability to bind to the
Fc.gamma. receptors (Fc.gamma.Rs) on the effector cells. Shields et
al. have shown that IgG, with alterations in amino acid sequence
that have improved binding to Fc.gamma.R, can exhibit up to 100%
enhanced ADCC using human effector cells. (2001) J Biol Chem
276(9):6591-6604. While these alterations include changes in amino
acids not found at the binding interface, both the nature of the
sugar component as well as its structural pattern may also
contribute to the differences observed. In addition, the presence
or absence of fucose in the oligosaccharide component of an IgG can
improve binding and ADCC. See, e.g., Shields et al. (2002) J Biol
Chem 277(30):26733-26740. An IgG that lacked a fucosylated
carbohydrate linked to Asn.sup.297 exhibited normal receptor
binding to the Fc.gamma.RI receptor. In contrast, binding to the
Fc.gamma.RIIIA receptor was improved 50-fold and accompanied by
enhanced ADCC, especially at lower antibody concentrations.
[0275] Shinkawa et al. demonstrated that an antibody to the human
IL-5 receptor produced in a rat hybridoma showed more than 50%
higher ADCC when compared to the antibody produced in Chinese
hamster ovary cells (CHO) (Shinkawa et al. (2003) J Biol Chem
278(5):3466-73). Monosaccharide composition and oligosaccharide
profiling showed that the rat hybridoma-produced IgG had a lower
content of fucose than the CHO-produced protein. The authors
concluded that the lack of fucosylation of an IgG1 has a critical
role in enhancement of ADCC activity.
[0276] A different approach was taken by Umana et al. who changed
the glycosylation pattern of chCE7, a chimeric IgG1
anti-neuroblastoma antibody. (1999) Nat Biotechnol 17(2):176-180).
Using tetracycline, they regulated the activity of a
glycosyltransferase enzyme (GnTIII) which bisects oligosaccharides
that have been implicated in ADCC activity. The ADCC activity of
the parent antibody was barely above background level. Measurement
of ADCC activity of the chCE7 produced at different tetracycline
levels showed an optimal range of GnTIII expression for maximal
chCE7 in vitro ADCC activity. This activity correlated with the
level of constant region-associated, bisected complex
oligosaccharide. Newly optimized variants exhibited substantial
ADCC activity. Similarly, Wright and Morrison produced antibodies
in a CHO cell line deficient in glycosylation and showed that
antibodies produced in this cell line were incapable of
complement-mediated cytolysis. (1994) J Exp Med 180:1087-1096.
Thus, as known alterations that affect effector function include
modifications in the glycosylation pattern or a change in the
number of glycosylated residues, the present disclosure relates to
an anti-C5a antibody wherein glycosylation is altered to either
enhance or decrease effector function(s) including ADCC and CDC.
Altered glycosylation includes a decrease or increase in the number
of glycosylated residues as well as a change in the pattern or
location of glycosylated residues.
[0277] Still other approaches exist for altering the effector
function of antibodies. For example, antibody-producing cells can
be hypermutagenic, thereby generating antibodies with randomly
altered polypeptide residues throughout an entire antibody
molecule. See, e.g., PCT publication no. WO 05/011735.
Hypermutagenic host cells include cells deficient in DNA mismatch
repair. Antibodies produced in this manner may be less antigenic
and/or have beneficial pharmacokinetic properties. Additionally,
such antibodies may be selected for properties such as enhanced or
decreased effector function(s). Additional details of molecular
biology techniques useful for preparing an antibody or
antigen-binding fragment thereof described herein are set forth
below.
[0278] Recombinant Antibody Expression and Purification
[0279] The antibodies or antigen-binding fragments thereof
described herein can be produced using a variety of techniques
known in the art of molecular biology and protein chemistry. For
example, a nucleic acid encoding one or both of the heavy and light
chain polypeptides of an antibody can be inserted into an
expression vector that contains transcriptional and translational
regulatory sequences, which include, e.g., promoter sequences,
ribosomal binding sites, transcriptional start and stop sequences,
translational start and stop sequences, transcription terminator
signals, polyadenylation signals, and enhancer or activator
sequences. The regulatory sequences include a promoter and
transcriptional start and stop sequences. In addition, the
expression vector can include more than one replication system such
that it can be maintained in two different organisms, for example
in mammalian or insect cells for expression and in a prokaryotic
host for cloning and amplification.
[0280] Several possible vector systems are available for the
expression of cloned heavy chain and light chain polypeptides from
nucleic acids in mammalian cells. One class of vectors relies upon
the integration of the desired gene sequences into the host cell
genome. Cells which have stably integrated DNA can be selected by
simultaneously introducing drug resistance genes such as E. coli
gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or
Tn5 neo (Southern and Berg (1982) Mot Appl Genet 1:327). The
selectable marker gene can be either linked to the DNA gene
sequences to be expressed, or introduced into the same cell by
co-transfection (Wigler et al. (1979) Cell 16:77). A second class
of vectors utilizes DNA elements which confer autonomously
replicating capabilities to an extrachromosomal plasmid. These
vectors can be derived from animal viruses, such as bovine
papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA,
79:7147), cytomegalovirus, polyoma virus (Deans et al. (1984) Proc
Natl Acad Sci USA 81:1292), or SV40 virus (Lusky and Botchan (1981)
Nature 293:79).
[0281] The expression vectors can be introduced into cells in a
manner suitable for subsequent expression of the nucleic acid. The
method of introduction is largely dictated by the targeted cell
type, discussed below. Exemplary methods include CaPO.sub.4
precipitation, liposome fusion, cationic liposomes,
electroporation, viral infection, dextran-mediated transfection,
polybrene-mediated transfection, protoplast fusion, and direct
microinjection.
[0282] Appropriate host cells for the expression of antibodies or
antigen-binding fragments thereof include yeast, bacteria, insect,
plant, and mammalian cells. Of particular interest are bacteria
such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia
pastoris, insect cells such as SF9, mammalian cell lines (e.g.,
human cell lines), as well as primary cell lines.
[0283] In some embodiments, an antibody or fragment thereof can be
expressed in, and purified from, transgenic animals (e.g.,
transgenic mammals). For example, an antibody can be produced in
transgenic non-human mammals (e.g., rodents) and isolated from milk
as described in, e.g., Houdebine (2002) Curr Opin Biotechnol
13(6):625-629; van Kuik-Romeijn et al. (2000) Transgenic Res
9(2):155-159; and Pollock et al. (1999) J Immunol Methods 231(1-2):
147-157.
[0284] The antibodies and fragments thereof can be produced from
the cells by culturing a host cell transformed with the expression
vector containing nucleic acid encoding the antibodies or
fragments, under conditions, and for an amount of time, sufficient
to allow expression of the proteins. Such conditions for protein
expression will vary with the choice of the expression vector and
the host cell, and will be easily ascertained by one skilled in the
art through routine experimentation. For example, antibodies
expressed in E. coli can be refolded from inclusion bodies (see,
e.g., Hou et al. (1998) Cytokine 10:319-30). Bacterial expression
systems and methods for their use are well known in the art (see
Current Protocols in Molecular Biology, Wiley & Sons, and
Molecular Cloning--A Laboratory Manual--3rd Ed., Cold Spring Harbor
Laboratory Press, New York (2001)). The choice of codons, suitable
expression vectors and suitable host cells will vary depending on a
number of factors, and may be easily optimized as needed. An
antibody (or fragment thereof) described herein can be expressed in
mammalian cells or in other expression systems including but not
limited to yeast, baculovirus, and in vitro expression systems
(see, e.g., Kaszubska et al. (2000) Protein Expression and
Purification 18:213-220).
[0285] Following expression, the antibodies and fragments thereof
can be isolated. The term "purified" or "isolated" as applied to
any of the proteins (antibodies or fragments) described herein
refers to a polypeptide that has been separated or purified from
components (e.g., proteins or other naturally-occurring biological
or organic molecules) which naturally accompany it, e.g., other
proteins, lipids, and nucleic acid in a prokaryote expressing the
proteins. Typically, a polypeptide is purified when it constitutes
at least 60 (e.g., at least 65, 70, 75, 80, 85, 90, 92, 95, 97, or
99) %, by weight, of the total protein in a sample.
[0286] An antibody or fragment thereof can be isolated or purified
in a variety of ways known to those skilled in the art depending on
what other components are present in the sample. Standard
purification methods include electrophoretic, molecular,
immunological, and chromatographic techniques, including ion
exchange, hydrophobic, affinity, and reverse-phase HPLC
chromatography. For example, an antibody can be purified using a
standard anti-antibody column (e.g., a protein-A or protein-G
column). Ultrafiltration and diafiltration techniques, in
conjunction with protein concentration, are also useful. See, e.g.,
Scopes (1994) "Protein Purification, 3.sup.rd edition,"
Springer-Verlag, New York City, N.Y. The degree of purification
necessary will vary depending on the desired use. In some
instances, no purification of the expressed antibody or fragments
thereof will be necessary.
[0287] Methods for determining the yield or purity of a purified
antibody or fragment thereof are known in the art and include,
e.g., Bradford assay, UV spectroscopy, Biuret protein assay, Lowry
protein assay, amido black protein assay, high pressure liquid
chromatography (HPLC), mass spectrometry (MS), and gel
electrophoretic methods (e.g., using a protein stain such as
Coomassie Blue or colloidal silver stain).
[0288] In some embodiments, endotoxin can be removed from the
antibodies or fragments. Methods for removing endotoxin from a
protein sample are known in the art and exemplified in the working
examples. For example, endotoxin can be removed from a protein
sample using a variety of commercially available reagents
including, without limitation, the ProteoSpin.TM. Endotoxin Removal
Kits (Norgen Biotek Corporation), Detoxi-Gel Endotoxin Removal Gel
(Thermo Scientific; Pierce Protein Research Products),
MiraCLEAN.RTM. Endotoxin Removal Kit (Mirus), or
Acrodisc.TM.--Mustang.RTM. E membrane (Pall Corporation).
[0289] Methods for detecting and/or measuring the amount of
endotoxin present in a sample (both before and after purification)
are known in the art and commercial kits are available. For
example, the concentration of endotoxin in a protein sample can be
determined using the QCL-1000 Chromogenic kit (BioWhittaker), the
limulus amebocyte lysate (LAL)-based kits such as the
Pyrotell.RTM., Pyrotell.RTM.-T, Pyrochrome.RTM., Chromo-LAL, and
CSE kits available from the Associates of Cape Cod
Incorporated.
[0290] While in no way intended to be limiting, exemplary methods
for generating the antibodies described herein are set forth in the
working Examples.
[0291] Modification of the Antibodies or Antigen-Binding Fragments
Thereof
[0292] The antibodies or antigen-binding fragments thereof can be
modified following their expression and purification. The
modifications can be covalent or non-covalent modifications. Such
modifications can be introduced into the antibodies or fragments
by, e.g., reacting targeted amino acid residues of the polypeptide
with an organic derivatizing agent that is capable of reacting with
selected side chains or terminal residues. Suitable sites for
modification can be chosen using any of a variety of criteria
including, e.g., structural analysis or amino acid sequence
analysis of the antibodies or fragments.
[0293] In some embodiments, the antibodies or antigen-binding
fragments thereof can be conjugated to a heterologous moiety. The
heterologous moiety can be, e.g., a heterologous polypeptide, a
therapeutic agent (e.g., a toxin or a drug), or a detectable label
such as, but not limited to, a radioactive label, an enzymatic
label, a fluorescent label, a heavy metal label, a luminescent
label, or an affinity tag such as biotin or streptavidin. Suitable
heterologous polypeptides include, e.g., an antigenic tag (e.g.,
FLAG (DYKDDDDK (SEQ ID NO:50)), polyhistidine (6-His; HHHHHH (SEQ
ID NO:81), hemagglutinin (HA; YPYDVPDYA (SEQ ID NO:82)),
glutathione-S-transferase (GST), or maltose-binding protein (MBP))
for use in purifying the antibodies or fragments. Heterologous
polypeptides also include polypeptides (e.g., enzymes) that are
useful as diagnostic or detectable markers, for example,
luciferase, a fluorescent protein (e.g., green fluorescent protein
(GFP)), or chloramphenicol acetyl transferase (CAT). Suitable
radioactive labels include .sup.32P, .sup.33P, .sup.14C, .sup.125I,
.sup.131I, .sup.35S, and .sup.3H. Suitable fluorescent labels
include, without limitation, fluorescein, fluorescein
isothiocyanate (FITC), green fluorescent protein (GFP), DyLight.TM.
488, phycoerythrin (PE), propidium iodide (PI), PerCP, PE-Alexa
Fluor.RTM. 700, Cy5, allophycocyanin, and Cy7. Luminescent labels
include, e.g., any of a variety of luminescent lanthanide (e.g.,
europium or terbium) chelates. For example, suitable europium
chelates include the europium chelate of diethylene triamine
pentaacetic acid (DTPA) or
tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA). Enzymatic
labels include, e.g., alkaline phosphatase, CAT, luciferase, and
horseradish peroxidase.
[0294] Two proteins (e.g., an antibody and a heterologous moiety)
can be cross-linked using any of a number of known chemical cross
linkers. Examples of such cross linkers are those which link two
amino acid residues via a linkage that includes a "hindered"
disulfide bond. In these linkages, a disulfide bond within the
cross-linking unit is protected (by hindering groups on either side
of the disulfide bond) from reduction by the action, for example,
of reduced glutathione or the enzyme disulfide reductase. One
suitable reagent,
4-succinimidyloxycarbonyl-.alpha.-methyl-.alpha.(2-pyridyldithio)
toluene (SMPT), forms such a linkage between two proteins utilizing
a terminal lysine on one of the proteins and a terminal cysteine on
the other. Heterobifunctional reagents that cross-link by a
different coupling moiety on each protein can also be used. Other
useful cross-linkers include, without limitation, reagents which
link two amino groups (e.g.,
N-5-azido-2-nitrobenzoyloxysuccinimide), two sulfhydryl groups
(e.g., 1,4-bis-maleimidobutane), an amino group and a sulfhydryl
group (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester), an
amino group and a carboxyl group (e.g.,
4-[p-azidosalicylamido]butylamine), and an amino group and a
guanidinium group that is present in the side chain of arginine
(e.g., p-azidophenyl glyoxal monohydrate).
[0295] In some embodiments, a radioactive label can be directly
conjugated to the amino acid backbone of the antibody.
Alternatively, the radioactive label can be included as part of a
larger molecule (e.g., .sup.125I in
meta-[.sup.125I]iodophenyl-N-hydroxysuccinimide ([.sup.125I]mIPNHS)
which binds to free amino groups to form meta-iodophenyl (mIP)
derivatives of relevant proteins (see, e.g., Rogers et al. (1997) J
Nucl Med 38:1221-1229) or chelate (e.g., to DOTA or DTPA) which is
in turn bound to the protein backbone. Methods of conjugating the
radioactive labels or larger molecules/chelates containing them to
the antibodies or antigen-binding fragments described herein are
known in the art. Such methods involve incubating the proteins with
the radioactive label under conditions (e.g., pH, salt
concentration, and/or temperature) that facilitate binding of the
radioactive label or chelate to the protein (see, e.g., U.S. Pat.
No. 6,001,329).
[0296] Methods for conjugating a fluorescent label (sometimes
referred to as a "fluorophore") to a protein (e.g., an antibody)
are known in the art of protein chemistry. For example,
fluorophores can be conjugated to free amino groups (e.g., of
lysines) or sulfhydryl groups (e.g., cysteines) of proteins using
succinimidyl (NHS) ester or tetrafluorophenyl (TFP) ester moieties
attached to the fluorophores. In some embodiments, the fluorophores
can be conjugated to a heterobifunctional cross-linker moiety such
as sulfo-SMCC. Suitable conjugation methods involve incubating an
antibody protein, or fragment thereof, with the fluorophore under
conditions that facilitate binding of the fluorophore to the
protein. See, e.g., Welch and Redvanly (2003) "Handbook of
Radiopharmaceuticals: Radiochemistry and Applications," John Wiley
and Sons (ISBN 0471495603).
[0297] In some embodiments, the antibodies or fragments can be
modified, e.g., with a moiety that improves the stabilization
and/or retention of the antibodies in circulation, e.g., in blood,
serum, or other tissues. For example, the antibody or fragment can
be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug
Chem 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries
Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug
Delivery Reviews 54:459-476 or HESylated (Fresenius Kabi, Germany;
see, e.g., Pavisi{hacek over (c)} et al. (2010) Int J Pharm
387(1-2):110-119). The stabilization moiety can improve the
stability, or retention of, the antibody (or fragment) by at least
1.5 (e.g., at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more)
fold.
[0298] In some embodiments, the antibodies or antigen-binding
fragments thereof described herein can be glycosylated. In some
embodiments, an antibody or antigen-binding fragment thereof
described herein can be subjected to enzymatic or chemical
treatment, or produced from a cell, such that the antibody or
fragment has reduced or absent glycosylation. Methods for producing
antibodies with reduced glycosylation are known in the art and
described in, e.g., U.S. Pat. No. 6,933,368; Wright et al. (1991)
EMBO J 10(10):2717-2723; and Co et al. (1993) Mol Immunol
30:1361.
Pharmaceutical Compositions
[0299] Compositions containing an antibody or an antigen-binding
fragment thereof described herein can be formulated as a
pharmaceutical composition, e.g., for administration to a subject
for the treatment or prevention of a complement-associated
disorder. The pharmaceutical compositions will generally include a
pharmaceutically acceptable carrier. As used herein, a
"pharmaceutically acceptable carrier" refers to, and includes, any
and all solvents, dispersion media, coatings, antibacterial and
antifungal agents, isotonic and absorption delaying agents, and the
like that are physiologically compatible. The compositions can
include a pharmaceutically acceptable salt, e.g., an acid addition
salt or a base addition salt (see, e.g., Berge et al. (1977) J
Pharm Sci 66: 1-19).
[0300] The compositions can be formulated according to standard
methods. Pharmaceutical formulation is a well-established art, and
is further described in, e.g., Gennaro (2000) "Remington: The
Science and Practice of Pharmacy," 20.sup.th Edition, Lippincott,
Williams & Wilkins (ISBN: 0683306472); Ansel et al. (1999)
"Pharmaceutical Dosage Forms and Drug Delivery Systems," 7.sup.th
Edition, Lippincott Williams & Wilkins Publishers (ISBN:
0683305727); and Kibbe (2000) "Handbook of Pharmaceutical
Excipients American Pharmaceutical Association," 3.sup.rd Edition
(ISBN: 091733096X). In some embodiments, a composition can be
formulated, for example, as a buffered solution at a suitable
concentration and suitable for storage at 2-8.degree. C. (e.g.,
4.degree. C.). In some embodiments, a composition can be formulated
for storage at a temperature below 0.degree. C. (e.g., -20.degree.
C. or -80.degree. C.). In some embodiments, the composition can be
formulated for storage for up to 2 years (e.g., one month, two
months, three months, four months, five months, six months, seven
months, eight months, nine months, 10 months, 11 months, 1 year,
11/2 years, or 2 years) at 2-8.degree. C. (e.g., 4.degree. C.).
Thus, in some embodiments, the compositions described herein are
stable in storage for at least 1 year at 2-8.degree. C. (e.g.,
4.degree. C.).
[0301] The pharmaceutical compositions can be in a variety of
forms. These forms include, e.g., liquid, semi-solid and solid
dosage forms, such as liquid solutions (e.g., injectable and
infusible solutions), dispersions or suspensions, tablets, pills,
powders, liposomes and suppositories. The preferred form depends,
in part, on the intended mode of administration and therapeutic
application. For example, compositions containing an antibody or
fragment intended for systemic or local delivery can be in the form
of injectable or infusible solutions. Accordingly, the compositions
can be formulated for administration by a parenteral mode (e.g.,
intravenous, subcutaneous, intraperitoneal, or intramuscular
injection). "Parenteral administration," "administered
parenterally," and other grammatically equivalent phrases, as used
herein, refer to modes of administration other than enteral and
topical administration, usually by injection, and include, without
limitation, intravenous, intranasal, intraocular, intramuscular,
intraarterial, intrathecal, intracapsular, intraorbital,
intracardiac, intradermal, intraperitoneal, transtracheal,
subcutaneous, subcuticular, intraarticular, subcapsular,
subarachnoid, intraspinal, epidural, intracerebral, intracranial,
intracarotid and intrasternal injection and infusion.
[0302] The compositions can be formulated as a solution,
microemulsion, dispersion, liposome, or other ordered structure
suitable for stable storage at high concentration. Sterile
injectable solutions can be prepared by incorporating an antibody
(or a fragment of the antibody) described herein in the required
amount in an appropriate solvent with one or a combination of
ingredients enumerated above, as required, followed by filtered
sterilization. Generally, dispersions are prepared by incorporating
an antibody or fragment described herein into a sterile vehicle
that contains a basic dispersion medium and the required other
ingredients from those enumerated above. In the case of sterile
powders for the preparation of sterile injectable solutions,
methods for preparation include vacuum drying and freeze-drying
that yield a powder of an antibody, or an antigen-binding fragment
thereof, described herein plus any additional desired ingredient
(see below) from a previously sterile-filtered solution thereof.
The proper fluidity of a solution can be maintained, for example,
by the use of a coating such as lecithin, by the maintenance of the
required particle size in the case of dispersion and by the use of
surfactants. Prolonged absorption of injectable compositions can be
brought about by including in the composition a reagent that delays
absorption, for example, monostearate salts, and gelatin.
[0303] The anti-C5a antibodies, or antigen-binding fragments
thereof, described herein can also be formulated in immunoliposome
compositions. Liposomes containing the antibody can be prepared by
methods known in the art such as, e.g., the methods described in
Epstein et al. (1985) Proc Natl Acad Sci USA 82:3688; Hwang et al.
(1980) Proc Natl Acad Sci USA 77:4030; and U.S. Pat. Nos. 4,485,045
and 4,544,545. Liposomes with enhanced circulation time are
disclosed in, e.g., U.S. Pat. No. 5,013,556.
[0304] In certain embodiments, an antibody or an antigen-binding
fragment thereof can be prepared with a carrier that will protect
the compound against rapid release, such as a controlled release
formulation, including implants and microencapsulated delivery
systems. Biodegradable, biocompatible polymers can be used, such as
ethylene vinyl acetate, polyanhydrides, polyglycolic acid,
collagen, polyorthoesters, and polylactic acid.
[0305] Many methods for the preparation of such formulations are
known in the art. See, e.g., J. R. Robinson (1978) "Sustained and
Controlled Release Drug Delivery Systems," Marcel Dekker, Inc., New
York.
[0306] In some embodiments, an antibody or antigen-binding fragment
described herein can be formulated in a composition suitable for
intrapulmonary administration (e.g., for administration via
nebulizer; see below) to a mammal such as a human. Methods for
preparing such compositions are well known in the art and described
in, e.g., U.S. patent application publication no. 20080202513; U.S.
Pat. Nos. 7,112,341 and 6,019,968; and PCT application publication
nos. WO 00/061178 and WO 06/122257, the disclosures of each of
which are incorporated herein by reference in their entirety. Dry
powder inhaler formulations and suitable systems for administration
of the formulations are described in, e.g., U.S. patent application
publication no. 20070235029, PCT Publication No. WO 00/69887; and
U.S. Pat. No. 5,997,848.
[0307] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof described herein can be formulated in a
composition suitable for delivery to the eye. In some embodiments,
one or more of the anti-C5a antibodies (or antigen-binding
fragments thereof) described herein can be administered locally,
for example, by way of topical application or intravitreal
injection. For example, in some embodiments, the anti-C5a
antibodies can be formulated for administration by way of an eye
drop.
[0308] The therapeutic preparation for treating the eye can contain
one or more of the anti-C5a antibodies in a concentration from
about 0.01 to about 1% by weight, preferably from about 0.05 to
about 0.5% in a pharmaceutically acceptable solution, suspension or
ointment. The preparation will preferably be in the form of a
sterile aqueous solution containing, e.g., additional ingredients
such as, but not limited to, preservatives, buffers, tonicity
agents, antioxidants and stabilizers, nonionic wetting or
clarifying agents, and viscosity-increasing agents.
[0309] Suitable preservatives for use in such a solution include
benzalkonium chloride, benzethonium chloride, chlorobutanol,
thimerosal and the like. Suitable buffers include, e.g., boric
acid, sodium and potassium bicarbonate, sodium and potassium
borates, sodium and potassium carbonate, sodium acetate, and sodium
biphosphate, in amounts sufficient to maintain the pH at between
about pH 6 and pH 8, and preferably, between about pH 7 and pH 7.5.
Suitable tonicity agents are dextran 40, dextran 70, dextrose,
glycerin, potassium chloride, propylene glycol, and sodium
chloride.
[0310] Suitable antioxidants and stabilizers include sodium
bisulfite, sodium metabisulfite, sodium thiosulfite, and thiourea.
Suitable wetting and clarifying agents include polysorbate 80,
polysorbate 20, poloxamer 282 and tyloxapol. Suitable
viscosity-increasing agents include dextran 40, dextran 70,
gelatin, glycerin, hydroxyethylcellulose,
hydroxmethylpropylcellulose, lanolin, methylcellulose, petrolatum,
polyethylene glycol, polyvinyl alcohol, polyvinylpyrrolidone, and
carboxymethylcellulose. The preparation can be administered
topically to the eye of the subject in need of treatment (e.g., a
subject afflicted with AMD) by conventional methods, e.g., in the
form of drops, or by bathing the eye in a therapeutic solution,
containing one or more anti-C5a antibodies.
[0311] In addition, a variety of devices have been developed for
introducing drugs into the vitreal cavity of the eye. For example,
U.S. patent application publication no. 20020026176 describes a
pharmaceutical-containing plug that can be inserted through the
sclera such that it projects into the vitreous cavity to deliver
the pharmaceutical agent into the vitreous cavity. In another
example, U.S. Pat. No. 5,443,505 describes an implantable device
for introduction into a suprachoroidal space or an avascular region
for sustained release of drug into the interior of the eye. U.S.
Pat. Nos. 5,773,019 and 6,001,386 each disclose an implantable drug
delivery device attachable to the scleral surface of an eye. The
device comprises an inner core containing an effective amount of a
low solubility agent covered by a non-bioerodible polymer that is
permeable to the low solubility agent. During operation, the low
solubility agent permeates the bioerodible polymer cover for
sustained release out of the device. Additional methods and devices
(e.g., a transscleral patch and delivery via contact lenses) for
delivery of a therapeutic agent to the eye are described in, e.g.,
Ambati and Adamis (2002) Prog Retin Eye Res 21(2):145-151; Ranta
and Urtti (2006) Adv Drug Delivery Rev 58(11):1164-1181; Barocas
and Balachandran (2008) Expert Opin Drug Delivery 5(1):1-10(10);
Gulsen and Chauhan (2004) Invest Opthalmol Vis Sci 45:2342-2347;
Kim et al. (2007) Ophthalmic Res 39:244-254; and PCT publication
no. WO 04/073551, the disclosures of which are incorporated herein
by reference in their entirety.
[0312] Nucleic acids encoding an antibody (or an antigen-binding
fragment thereof) can be incorporated into a gene construct to be
used as a part of a gene therapy protocol to deliver nucleic acids
that can be used to express and produce agents within cells (see
below). Expression constructs of such components may be
administered in any therapeutically effective carrier, e.g., any
formulation or composition capable of effectively delivering the
component gene to cells in vivo. Approaches include insertion of
the subject gene in viral vectors including recombinant
retroviruses, adenovirus, adeno-associated virus, lentivirus, and
herpes simplex virus-1 (HSV-1), or recombinant bacterial or
eukaryotic plasmids. Viral vectors can transfect cells directly;
plasmid DNA can be delivered with the help of, for example,
cationic liposomes (lipofectin) or derivatized (e.g., antibody
conjugated), polylysine conjugates, gramicidin S, artificial viral
envelopes or other such intracellular carriers, as well as direct
injection of the gene construct or CaPO.sub.4 precipitation (see,
e.g., WO04/060407) carried out in vivo. (See also, "Ex vivo
Approaches," below.) Examples of suitable retroviruses include pLJ,
pZIP, pWE and pEM which are known to those skilled in the art (see,
e.g., Eglitis et al. (1985) Science 230:1395-1398; Danos and
Mulligan (1988) Proc Natl Acad Sci USA 85:6460-6464; Wilson et al.
(1988) Proc Natl Acad Sci USA 85:3014-3018; Armentano et al. (1990)
Proc. Natl. Acad. Sci. USA 87:6141-6145; Huber et al. (1991) Proc
Natl Acad Sci USA 88:8039-8043; Ferry et al. (1991) Proc Natl Acad
Sci USA 88:8377-8381; Chowdhury et al. (1991) Science
254:1802-1805; van Beusechem et al. (1992) Proc Natl Acad Sci USA
89:7640-7644; Kay et al. (1992) Human Gene Therapy 3:641-647; Dai
et al. (1992) Proc Natl Acad Sci USA 89:10892-10895; Hwu et al.
(1993) J Immunol. 150:4104-4115; U.S. Pat. Nos. 4,868,116 and
4,980,286; PCT Publication Nos. WO89/07136, WO89/02468, WO89/05345,
and WO92/07573). Another viral gene delivery system utilizes
adenovirus-derived vectors (see, e.g., Berkner et al. (1988)
BioTechniques 6:616; Rosenfeld et al. (1991) Science 252:431-434;
and Rosenfeld et al. (1992) Cell 68:143-155). Suitable adenoviral
vectors derived from the adenovirus strain Ad type 5 d1324 or other
strains of adenovirus (e.g., Ad2, Ad3, Ad7, etc.) are known to
those skilled in the art. Yet another viral vector system useful
for delivery of the subject gene is the adeno-associated virus
(AAV). See, e.g., Flotte et al. (1992) Am J Respir Cell Mot Biol
7:349-356; Samulski et al. (1989) J Virol 63:3822-3828; and
McLaughlin et al. (1989) J Virol 62:1963-1973.
[0313] In some embodiments, an antibody, or antigen-binding
fragment thereof, described herein can be formulated with one or
more additional active agents useful for treating or preventing a
complement-associated disorder in a subject. Additional agents for
treating a complement-associated disorder in a subject will vary
depending on the particular disorder being treated, but can
include, without limitation, an antihypertensive (e.g., an
angiotensin-converting enzyme inhibitor), an anticoagulant, a
corticosteroid (e.g., prednisone), or an immunosuppressive agent
(e.g., vincristine or cyclosporine A). Examples of anticoagulants
include, e.g., warfarin (Coumadin), heparin, phenindione,
fondaparinux, idraparinux, and thrombin inhibitors (e.g.,
argatroban, lepirudin, bivalirudin, or dabigatran). An antibody or
fragment thereof described herein can also be formulated with a
fibrinolytic agent (e.g., ancrod, .epsilon.-aminocaproic acid,
antiplasmin-a.sub.1, prostacyclin, and defibrotide) for the
treatment of a complement-mediated disorder. In some embodiments,
an antibody can be formulated with a lipid-lowering agent such as
an inhibitor of hydroxymethylglutaryl CoA reductase. In some
embodiments, an antibody can be formulated with, or for use with,
an anti-CD20 agent such as rituximab (Rituxan.TM.; Biogen Idec,
Cambridge, Mass.). In some embodiments, e.g., for the treatment of
RA, the antibody or antigen-binding fragment thereof can be
formulated with one or both of infliximab (Remicade.RTM.; Centocor,
Inc.) and methotrexate (Rheumatrex.RTM., Trexall.RTM.). In some
embodiments, an antibody or an antigen-binding fragment thereof
described herein can be formulated with a non-steroidal
anti-inflammatory drug (NSAID). Many different NSAIDS are
available, some over the counter including ibuprofen (Advil.RTM.,
Motrin.RTM., Nuprin.RTM.) and naproxen (Alleve.RTM.) and many
others are available by prescription including meloxicam
(Mobic.RTM.), etodolac (Lodine.RTM.), nabumetone (Relafen.RTM.),
sulindac (Clinoril.RTM.), tolementin (Tolectin.RTM.), choline
magnesium salicylate (Trilasate.RTM.), diclofenac (Cataflam.RTM.,
Voltaren.RTM., Arthrotec.RTM.), Diflusinal (Dolobid.RTM.),
indomethicin (Indocin.RTM.), Ketoprofen (Orudis.RTM.,
Oruvail.RTM.), oxaprozin (Daypro.RTM.), and piroxicam
(Feldene.RTM.). In some embodiments an antibody or a fragment
thereof can be formulated for use with an anti-hypertensive, an
anti-seizure agent (e.g., magnesium sulfate), or an anti-thrombotic
agent. Anti-hypertensives include, e.g., labetalol, hydralazine,
nifedipine, calcium channel antagonists, nitroglycerin, or sodium
nitroprussiate. See, e.g., Mihu et al. (2007) J Gasrointestin Liver
Dis 16(4):419-424. Anti-thrombotic agents include, e.g., heparin,
antithrombin, prostacyclin, or low dose aspirin.
[0314] In some embodiments, an antibody or antigen-binding fragment
thereof can be formulated for administration to a subject along
with intravenous gamma globulin therapy (IVIG), plasmapheresis, or
plasma exchange. In some embodiments, an anti-C5a antibody or
antigen-binding fragment thereof can be formulated for use before,
during, or after, a kidney transplant.
[0315] When an antibody or antigen-binding fragment thereof is to
be used in combination with a second active agent, the agents can
be formulated separately or together. For example, the respective
pharmaceutical compositions can be mixed, e.g., just prior to
administration, and administered together or can be administered
separately, e.g., at the same or different times (see below).
[0316] As described above, a composition can be formulated such
that it includes a therapeutically effective amount of an anti-C5a
antibody or antigen-binding fragment thereof described herein. In
some embodiments, a composition can be formulated to include a
sub-therapeutic amount of the antibody (or fragment) and a
sub-therapeutic amount of one or more additional active agents such
that the components in total are therapeutically effective for
treating or preventing a complement-associated disorder. Methods
for determining a therapeutically effective dose of an agent such
as a therapeutic antibody are known in the art and described
herein.
Applications
[0317] The antibodies, antigen-binding fragments thereof,
conjugates, and compositions of any of the foregoing can be used in
a number of diagnostic and therapeutic applications. For example,
detectably-labeled anti-C5a antibodies (e.g., anti-human C5a
antibodies or anti-mouse C5a antibodies) can be used in assays to
detect the presence or amount of C5a present in a biological
sample. Determining the amount of C5a in a sample, e.g., a patient
blood sample, can be useful to evaluate the level of complement
activation in the sample. Suitable methods for using the antibodies
in diagnostic assays are known in the art and include, without
limitation, ELISA, fluorescence resonance energy transfer
applications, Western blot, and dot blot techniques. See, e.g.,
Sambrook et al., supra and Ausubel et al., supra.
[0318] In some embodiments, the antibodies and antigen-binding
fragments described herein can be used as positive controls in
assays designed to identify additional novel compounds for treating
complement-mediated disorders. For example, an anti-C5a antibody
that inhibits C5a activity can be used as a positive control in an
assay to identify additional compounds (e.g., small molecules,
aptamers, or antibodies) that inhibit C5a or C5a-dependent C5a
receptor signaling.
[0319] In some embodiments, the cross-reactive anti-C5a antibodies
or antigen-binding fragments thereof (e.g., cross-reactive with
human C5a and, e.g., cynomolgus macaque C5a) described herein can
be used for pre-clinical testing in non-human mammals, e.g.,
pharmacokinetic or pharmacodynamic studies in non-human primates.
Accordingly, a researcher wishing to evaluate the efficacy of an
anti-C5a antibody in treating a complement-associate disorder of
interest (e.g., RA or sepsis) can use a cross-reactive anti-C5a
antibody described herein in an appropriate non-human primate model
of the disease. If the researcher, for example, establishes
efficacy of the antibody in the non-human primate model, these
results may provide sufficient proof-of-concept support for
regulatory approval for use of the antibody in treating humans.
Alternatively, or in addition, a researcher may administer the
cross-reactive antibody to a non-human primate to study, e.g.,
antibody clearance and/or pharmacodynamics properties. Based on
such studies using the cross-reactive antibody, the researcher can
better approximate the dose required to treat human disease.
[0320] In some embodiments, the anti-mouse C5a antibodies or
antigen-binding fragments thereof described herein, as well as
antibodies that crossreact with human and mouse C5a, can be used as
a surrogate antibody in mouse models of human disease. This can be
especially useful where a humanized anti-human C5a antibody does
not cross-react with mouse C5a and/or is likely to cause an
anti-human antibody response in a mouse to which the humanized
antibody is administered. Accordingly, a researcher wishing to
study the effect of an anti-C5a antibody in treating a disease
(e.g., ischemia-reperfusion injury) can use an anti-mouse C5a
antibody described herein in an appropriate mouse model of the
disease. If the researcher can establish efficacy in the mouse
model of disease using the anti-mouse C5a antibody, the results may
establish proof-of-concept for use of an anti-human C5a antibody in
treating the disease in humans. The working examples disclose an
exemplary study using an anti-mouse C5a antibody surrogate in a
mouse model of RA establishing proof-of-concept for the use of an
anti-human C5a antibody to treat RA in man.
[0321] The anti-C5a antibodies described herein can also be used in
methods for purifying C5a from a sample (e.g., a biological
sample). In some embodiments, an anti-C5a antibody can be
immobilized on a solid phase support using methods well known in
the art. A sample containing the antigen to be purified, in this
case C5a, is contacted to the antibody on the solid support under
conditions and for a time sufficient to allow the antigen to bind
to the antibody. The solid support is then washed one or more times
with a suitable buffer to remove unbound material. The solid
support can be then contacted with a second buffer that results in
the release of the antigen from the antibody. The released antigen
is then collected and characterized (e.g., for purity and activity)
using well known methods in the art.
[0322] The anti-C5a antibodies and antigen-binding fragments
thereof described herein can also be used in therapeutic methods as
elaborated on below.
[0323] Methods for Treatment
[0324] The above-described compositions are useful in, inter alia,
methods for treating or preventing a variety of
complement-associated disorders in a subject. The compositions can
be administered to a subject, e.g., a human subject, using a
variety of methods that depend, in part, on the route of
administration. The route can be, e.g., intravenous injection or
infusion (IV), subcutaneous injection (SC), intraperitoneal (IP)
injection, or intramuscular injection (IM).
[0325] Administration can be achieved by, e.g., local infusion,
injection, or by means of an implant. The implant can be of a
porous, non-porous, or gelatinous material, including membranes,
such as sialastic membranes, or fibers. The implant can be
configured for sustained or periodic release of the composition to
the subject. See, e.g., U.S. Patent Application Publication No.
20080241223; U.S. Pat. Nos. 5,501,856; 4,863,457; and 3,710,795;
EP488401; and EP 430539, the disclosures of each of which are
incorporated herein by reference in their entirety. The composition
can be delivered to the subject by way of an implantable device
based on, e.g., diffusive, erodible, or convective systems, e.g.,
osmotic pumps, biodegradable implants, electrodiffusion systems,
electroosmosis systems, vapor pressure pumps, electrolytic pumps,
effervescent pumps, piezoelectric pumps, erosion-based systems, or
electromechanical systems.
[0326] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof is therapeutically delivered to a subject by way
of local administration. As used herein, "local administration" or
"local delivery," refers to delivery that does not rely upon
transport of the composition or agent to its intended target tissue
or site via the vascular system. For example, the composition may
be delivered by injection or implantation of the composition or
agent or by injection or implantation of a device containing the
composition or agent. Following local administration in the
vicinity of a target tissue or site, the composition or agent, or
one or more components thereof, may diffuse to the intended target
tissue or site.
[0327] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof can be locally administered to a joint (e.g., an
articulated joint). For example, in embodiments where the
complement-associated disorder is arthritis, the complement
inhibitor can be administered directly to a joint (e.g., into a
joint space) or in the vicinity of a joint. Examples of
intraarticular joints to which an anti-C5a antibody or
antigen-binding fragment thereof can be locally administered
include, e.g., the hip, knee, elbow, wrist, sternoclavicular,
temperomandibular, carpal, tarsal, ankle, and any other joint
subject to arthritic conditions. An anti-C5a antibody or
antigen-binding fragment thereof can also be administered to bursa
such as, e.g., acromial, bicipitoradial, cubitoradial, deltoid,
infrapatellar, ischial, and any other bursa known in the art of
medicine.
[0328] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof can be locally administered to the eye. As used
herein, the term "eye" refers to any and all anatomical tissues and
structures associated with an eye. The eye has a wall composed of
three distinct layers: the outer sclera, the middle choroid layer,
and the inner retina. The chamber behind the lens is filled with a
gelatinous fluid referred to as the vitreous humor. At the back of
the eye is the retina, which detects light. The cornea is an
optically transparent tissue, which conveys images to the back of
the eye. The cornea includes one pathway for the permeation of
drugs into the eye. Other anatomical tissue structures associated
with the eye include the lacrimal drainage system, which includes a
secretory system, a distributive system and an excretory system.
The secretory system comprises secretors that are stimulated by
blinking and temperature change due to tear evaporation and reflex
secretors that have an efferent parasympathetic nerve supply and
secrete tears in response to physical or emotional stimulation. The
distributive system includes the eyelids and the tear meniscus
around the lid edges of an open eye, which spread tears over the
ocular surface by blinking, thus reducing dry areas from
developing.
[0329] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof is administered to the posterior chamber of the
eye. In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof is administered intravitreally. In some
embodiments, an anti-C5a antibody or antigen-binding fragment
thereof is administered trans-sclerally.
[0330] In some embodiments, e.g., in embodiments for treatment or
prevention of a complement-associated pulmonary disorder such as
COPD or asthma, an anti-C5a antibody or antigen-binding fragment
thereof described herein can also be administered to a subject by
way of the lung. Pulmonary drug delivery may be achieved by
inhalation, and administration by inhalation herein may be oral
and/or nasal. Examples of pharmaceutical devices for pulmonary
delivery include metered dose inhalers, dry powder inhalers (DPIs),
and nebulizers. For example, an anti-C5a antibody or an
antigen-binding fragment thereof can be administered to the lungs
of a subject by way of a dry powder inhaler. These inhalers are
propellant-free devices that deliver dispersible and stable dry
powder formulations to the lungs. Dry powder inhalers are well
known in the art of medicine and include, without limitation: the
TurboHaler.RTM. (AstraZeneca; London, England) the AIR.RTM. inhaler
(Alkermes.RTM.; Cambridge, Mass.); Rotahaler.RTM. (GlaxoSmithKline;
London, England); and Eclipse.TM. (Sanofi-Aventis; Paris, France).
See also, e.g., PCT Publication Nos. WO 04/026380, WO 04/024156,
and WO 01/78693. DPI devices have been used for pulmonary
administration of polypeptides such as insulin and growth hormone.
In some embodiments, an anti-C5a antibody or an antigen-binding
fragment thereof can be intrapulmonarily administered by way of a
metered dose inhaler. These inhalers rely on a propellant to
deliver a discrete dose of a compound to the lungs. Examples of
compounds administered by metered dose inhalers include, e.g.,
Astovent.RTM. (Boehringer-Ingelheim; Ridgefield, Conn.) and
Flovent.RTM. (GlaxoSmithKline). See also, e.g., U.S. Pat. Nos.
6,170,717; 5,447,150; and 6,095,141.
[0331] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof can be administered to the lungs of a subject by
way of a nebulizer. Nebulizers use compressed air to deliver a
compound as a liquefied aerosol or mist. A nebulizer can be, e.g.,
a jet nebulizer (e.g., air or liquid-jet nebulizers) or an
ultrasonic nebulizer. Additional devices and intrapulmonary
administration methods are set forth in, e.g., U.S. Patent
Application Publication Nos. 20050271660 and 20090110679, the
disclosures of each of which are incorporated herein by reference
in their entirety.
[0332] In some embodiments, the antibodies or antigen-binding
fragments thereof provided herein are present in unit dosage form,
which can be particularly suitable for self-administration. A
formulated product of the present disclosure can be included within
a container, typically, for example, a vial, cartridge, prefilled
syringe or disposable pen. A doser such as the doser device
described in U.S. Pat. No. 6,302,855 may also be used, for example,
with an injection system of the present disclosure.
[0333] An injection system of the present disclosure may employ a
delivery pen as described in U.S. Pat. No. 5,308,341. Pen devices,
most commonly used for self-delivery of insulin to patients with
diabetes, are well known in the art. Such devices can comprise at
least one injection needle (e.g., a 31 gauge needle of about 5 to 8
mm in length), are typically pre-filled with one or more
therapeutic unit doses of a therapeutic solution, and are useful
for rapidly delivering the solution to a subject with as little
pain as possible.
[0334] One medication delivery pen includes a vial holder into
which a vial of insulin or other medication may be received. The
vial holder is an elongate generally tubular structure with
proximal and distal ends. The distal end of the vial holder
includes mounting means for engaging a double-ended needle cannula.
The proximal end also includes mounting means for engaging a pen
body which includes a driver and dose setting apparatus. A
disposable medication (e.g., a high concentration solution of an
anti-C5a antibody or antigen-binding fragment thereof) containing
vial for use with the prior art vial holder includes a distal end
having a pierceable elastomeric septum that can be pierced by one
end of a double-ended needle cannula. The proximal end of this vial
includes a stopper slidably disposed in fluid tight engagement with
the cylindrical wall of the vial. This medication delivery pen is
used by inserting the vial of medication into the vial holder. A
pen body then is connected to the proximal end of the vial holder.
The pen body includes a dose setting apparatus for designating a
dose of medication to be delivered by the pen and a driving
apparatus for urging the stopper of the vial distally for a
distance corresponding to the selected dose. The user of the pen
mounts a double-ended needle cannula to the distal end of the vial
holder such that the proximal point of the needle cannula pierces
the septum on the vial. The patient then selects a dose and
operates the pen to urge the stopper distally to deliver the
selected dose. The dose selecting apparatus returns to zero upon
injection of the selected dose. The patient then removes and
discards the needle cannula, and keeps the medication delivery pen
in a convenient location for the next required medication
administration. The medication in the vial will become exhausted
after several such administrations of medication. The patient then
separates the vial holder from the pen body. The empty vial may
then be removed and discarded. A new vial can be inserted into the
vial holder, and the vial holder and pen body can be reassembled
and used as explained above. Accordingly, a medication delivery pen
generally has a drive mechanism for accurate dosing and ease of
use.
[0335] A dosage mechanism such as a rotatable knob allows the user
to accurately adjust the amount of medication that will be injected
by the pen from a prepackaged vial of medication. To inject the
dose of medication, the user inserts the needle under the skin and
depresses the knob once as far as it will depress. The pen may be
an entirely mechanical device or it may be combined with electronic
circuitry to accurately set and/or indicate the dosage of
medication that is injected into the user. See U.S. Pat. No.
6,192,891.
[0336] In some embodiments, the needle of the pen device is
disposable and the kits include one or more disposable replacement
needles. Pen devices suitable for delivery of the any one of the
presently featured antibodies or antigen-binding fragments thereof
are also described in, e.g., U.S. Pat. Nos. 6,277,099; 6,200,296;
and 6,146,361, the disclosures of each of which are incorporated
herein by reference in their entirety. A microneedle-based pen
device is described in, e.g., U.S. Pat. No. 7,556,615, the
disclosure of which is incorporated herein by reference in its
entirety. See also the Precision Pen Injector (PPI) device,
Molly.TM., manufactured by Scandinavian Health Ltd.
[0337] The present disclosure also presents controlled-release or
extended-release formulations suitable for chronic and/or
self-administration of a medication such as an anti-C5a antibody or
an antigen-binding fragment thereof described herein. The various
formulations can be administered to a patient in need of treatment
with the medication as a bolus or by continuous infusion over a
period of time.
[0338] In some embodiments, a high concentration anti-C5a antibody
(or antigen-binding fragment thereof) described herein is
formulated for sustained-release, extended-release, timed-release,
controlled-release, or continuous-release administration. In some
embodiments, depot formulations are used to administer the antibody
to the subject in need thereof. In this method, the antibody is
formulated with one or more carriers providing a gradual release of
active agent over a period of a number of hours or days. Such
formulations are often based upon a degrading matrix which
gradually disperses in the body to release the active agent.
[0339] In some embodiments, a C5a-binding fragment (e.g., a single
chain antibody, a diabody, or a Fab' fragment) of an anti-C5a
antibody described herein is administered by way of intrapulmonary
administration to a subject in need thereof. For example, a single
chain antibody form of any of the anti-C5a antibodies described
herein can be delivered by way of a nebulizer or an inhaler to a
subject (e.g., a human) afflicted with a complement-associated
pulmonary disorder such as asthma or COPD.
[0340] A suitable dose of an antibody or fragment thereof described
herein, which dose is capable of treating or preventing a
complement-associated disorder in a subject, can depend on a
variety of factors including, e.g., the age, sex, and weight of a
subject to be treated and the particular inhibitor compound used.
For example, a different dose of a whole anti-C5a antibody may be
required to treat a subject with RA as compared to the dose of a
C5a-binding Fab' antibody fragment required to treat the same
subject. Other factors affecting the dose administered to the
subject include, e.g., the type or severity of the
complement-mediated disorder. For example, a subject having RA may
require administration of a different dosage of an anti-C5a
antibody than a subject with AMD.
[0341] Other factors can include, e.g., other medical disorders
concurrently or previously affecting the subject, the general
health of the subject, the genetic disposition of the subject,
diet, time of administration, rate of excretion, drug combination,
and any other additional therapeutics that are administered to the
subject. It should also be understood that a specific dosage and
treatment regimen for any particular subject will also depend upon
the judgment of the treating medical practitioner (e.g., doctor or
nurse).
[0342] An antibody described herein can be administered as a fixed
dose, or in a milligram per kilogram (mg/kg) dose. In some
embodiments, the dose can also be chosen to reduce or avoid
production of antibodies or other host immune responses against one
or more of the active antibodies in the composition. While in no
way intended to be limiting, exemplary dosages of an antibody, such
as an anti-C5a antibody include, e.g., 1-1000 .mu.g/kg, 1-100
.mu.g/kg, 0.5-50 .mu.g/kg, 0.1-100 .mu.g/kg, 0.5-25 .mu.g/kg, 1-20
.mu.g/kg, and 1-10 .mu.g/kg, 1-100 mg/kg, 0.5-50 mg/kg, 0.1-100
mg/kg, 0.5-25 mg/kg, 1-20 mg/kg, 0.100 mg/kg to 1 mg/kg, and 1-10
mg/kg. Exemplary dosages of an antibody or antigen-binding fragment
thereof described herein include, without limitation, 0.1 .mu.g/kg,
0.5 .mu.g/kg, 1.0 .mu.g/kg, 2.0 .mu.g/kg, 4 .mu.g/kg, and 8
.mu.g/kg, 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 4 mg/kg, 8
mg/kg, and 20 mg/kg.
[0343] A pharmaceutical composition can include a therapeutically
effective amount of an anti-C5a antibody or antigen-binding
fragment thereof described herein. Such effective amounts can be
readily determined by one of ordinary skill in the art based, in
part, on the effect of the administered antibody, or the
combinatorial effect of the antibody and one or more additional
active agents, if more than one agent is used. A therapeutically
effective amount of an antibody or fragment thereof described
herein can also vary according to factors such as the disease
state, age, sex, and weight of the individual, and the ability of
the antibody (and one or more additional active agents) to elicit a
desired response in the individual, e.g., amelioration of at least
one condition parameter, e.g., amelioration of at least one symptom
of the complement-mediated disorder. For example, a therapeutically
effective amount of an anti-C5a antibody can inhibit (lessen the
severity of or eliminate the occurrence of) and/or prevent a
particular disorder, and/or any one of the symptoms of the
particular disorder known in the art or described herein. A
therapeutically effective amount is also one in which any toxic or
detrimental effects of the composition are outweighed by the
therapeutically beneficial effects.
[0344] Suitable human doses of any of the antibodies or fragments
thereof described herein can further be evaluated in, e.g., Phase I
dose escalation studies. See, e.g., van Gurp et al. (2008) Am J
Transplantation 8(8):1711-1718; Hanouska et al. (2007) Clin Cancer
Res 13(2, part 1):523-531; and Hetherington et al. (2006)
Antimicrobial Agents and Chemotherapy 50(10): 3499-3500.
[0345] The terms "therapeutically effective amount" or
"therapeutically effective dose," or similar terms used herein are
intended to mean an amount of an agent (e.g., an anti-C5a antibody
or an antigen-binding fragment thereof) that will elicit the
desired biological or medical response (e.g., an improvement in one
or more symptoms of a complement-associated disorder). In some
embodiments, a composition described herein contains a
therapeutically effective amount of an antibody, or antigen-binding
fragment thereof, which specifically binds to a neo-epitope present
in C5a. In some embodiments, the composition contains any of the
antibodies or antigen-binding fragments thereof described herein
and one or more (e.g., two, three, four, five, six, seven, eight,
nine, 10, or 11 or more) additional therapeutic agents such that
the composition as a whole is therapeutically effective. For
example, a composition can contain an anti-C5a antibody described
herein and an immunosuppressive agent, wherein the antibody and
agent are each at a concentration that when combined are
therapeutically effective for treating or preventing a
complement-associated disorder (e.g., a complement-associated
inflammatory disorder such as COPD, asthma, sepsis, or RA) in a
subject.
[0346] Toxicity and therapeutic efficacy of such compositions can
be determined by known pharmaceutical procedures in cell cultures
or experimental animals (e.g., animal models of any of the
complement-mediated disorders described herein). Use of an anti-C5a
antibody in an animal model of RA is exemplified in the working
examples. These procedures can be used, e.g., for determining the
LD.sub.50 (the dose lethal to 50% of the population) and the
ED.sub.50 (the dose therapeutically effective in 50% of the
population). The dose ratio between toxic and therapeutic effects
is the therapeutic index and it can be expressed as the ratio
LD.sub.50/ED.sub.50. An antibody or antigen-binding fragment
thereof that exhibits a high therapeutic index is preferred. While
compositions that exhibit toxic side effects may be used, care
should be taken to design a delivery system that targets such
compounds to the site of affected tissue and to minimize potential
damage to normal cells and, thereby, reduce side effects.
[0347] The data obtained from the cell culture assays and animal
studies can be used in formulating a range of dosage for use in
humans. The dosage of such antibodies or antigen-binding fragments
thereof lies generally within a range of circulating concentrations
of the antibodies or fragments that include the ED.sub.50 with
little or no toxicity. The dosage may vary within this range
depending upon the dosage form employed and the route of
administration utilized. For an anti-C5a antibody described herein,
the therapeutically effective dose can be estimated initially from
cell culture assays. A dose can be formulated in animal models to
achieve a circulating plasma concentration range that includes the
IC.sub.50 (i.e., the concentration of the antibody which achieves a
half-maximal inhibition of symptoms) as determined in cell culture.
Such information can be used to more accurately determine useful
doses in humans. Levels in plasma may be measured, for example, by
high performance liquid chromatography. In some embodiments, e.g.,
where local administration (e.g., to the eye or a joint) is
desired, cell culture or animal modeling can be used to determine a
dose required to achieve a therapeutically effective concentration
within the local site.
[0348] In some embodiments, the methods can be performed in
conjunction with other therapies for complement-associated
disorders. For example, the composition can be administered to a
subject at the same time, prior to, or after, plasmapheresis, IVIG
therapy, or plasma exchange. See, e.g., Appel et al. (2005) J Am
Soc Nephrol 16:1392-1404. In some embodiments, the composition can
be administered to a subject at the same time, prior to, or after,
a kidney transplant.
[0349] A "subject," as used herein, can be any mammal. For example,
a subject can be a human, a non-human primate (e.g., monkey,
baboon, or chimpanzee), a horse, a cow, a pig, a sheep, a goat, a
dog, a cat, a rabbit, a guinea pig, a gerbil, a hamster, a rat, or
a mouse. In some embodiments, the subject is an infant (e.g., a
human infant).
[0350] As used herein, a subject "in need of prevention," "in need
of treatment," or "in need thereof," refers to one, who by the
judgment of an appropriate medical practitioner (e.g., a doctor, a
nurse, or a nurse practitioner in the case of humans; a
veterinarian in the case of non-human mammals), would reasonably
benefit from a given treatment (such as treatment with a
composition comprising an anti-C5a antibody).
[0351] The term "preventing" is art-recognized, and when used in
relation to a condition, is well understood in the art, and
includes administration of a composition which reduces the
frequency of, or delays the onset of, symptoms of a medical
condition in a subject relative to a subject which does not receive
the composition. Thus, prevention of a complement-associated
disorder such as asthma includes, for example, reducing the extent
or frequency of coughing, wheezing, or chest pain in a population
of patients receiving a prophylactic treatment relative to an
untreated control population, and/or delaying the occurrence of
coughing or wheezing in a treated population versus an untreated
control population, e.g., by a statistically and/or clinically
significant amount.
[0352] As described above, the antibodies and biologically-active
fragments described herein can be used to treat a variety of
complement-associated disorders such as, but not limited to:
rheumatoid arthritis (RA); lupus nephritis; ischemia-reperfusion
injury; atypical hemolytic uremic syndrome (aHUS); typical or
infectious hemolytic uremic syndrome (tHUS); dense deposit disease
(DDD); paroxysmal nocturnal hemoglobinuria (PNH); multiple
sclerosis (MS); macular degeneration (e.g., age-related macular
degeneration (AMD)); hemolysis, elevated liver enzymes, and low
platelets (HELLP) syndrome; sepsis; dermatomyositis; diabetic
retinopathy; thrombotic thrombocytopenic purpura (TTP); spontaneous
fetal loss; Pauci-immune vasculitis; epidermolysis bullosa;
recurrent fetal loss; multiple sclerosis (MS); and traumatic brain
injury. See, e.g., Holers (2008) Immunological Reviews 223:300-316
and Holers and Thurman (2004) Molecular Immunology 41:147-152. In
some embodiments, the complement-mediated disorder is a
complement-mediated vascular disorder such as, but not limited to,
a cardiovascular disorder, myocarditis, a cerebrovascular disorder,
a peripheral (e.g., musculoskeletal) vascular disorder, a
renovascular disorder, a mesenteric/enteric vascular disorder,
revascularization to transplants and/or replants, vasculitis,
Henoch-Schonlein purpura nephritis, systemic lupus
erythematosus-associated vasculitis, vasculitis associated with
rheumatoid arthritis, immune complex vasculitis, Takayasu's
disease, capillary leak syndrome, dilated cardiomyopathy, diabetic
angiopathy, thorasic-abdominal aortic aneurism, Kawasaki's disease
(arteritis), venous gas embolus (VGE), and restenosis following
stent placement, rotational atherectomy, and percutaneous
transluminal coronary angioplasty (PTCA). (See, e.g., U.S. patent
application publication no. 20070172483.) In some embodiments, the
complement-associated disorder is myasthenia gravis,
cold-agglutinin disease (CAD), paroxysmal cold hemoglobinuria
(PCH), dermatomyositis, scleroderma, warm autoimmune hemolytic
anemia, Graves' disease, Hashimoto's thyroiditis, type I diabetes,
psoriasis, pemphigus, autoimmune hemolytic anemia (AIHA),
idiopathic thrombocytopenic purpura (ITP), Goodpasture syndrome,
antiphospholipid syndrome (APS), Degos disease, and catastrophic
APS (CAPS).
[0353] In some embodiments, an anti-C5a antibody or antigen-binding
fragment thereof described herein, alone or in combination with a
second anti-inflammatory agent, can be used to treat an
inflammatory disorder such as, but not limited to, RA (above),
inflammatory bowel disease, sepsis (above), septic shock, acute
lung injury, disseminated intravascular coagulation (DIC), or
Crohn's disease. In some embodiments, the second anti-inflammatory
agent can be one selected from the group consisting of NSAIDs,
corticosteroids, methotrexate, hydroxychloroquine, anti-TNF agents
such as etanercept and infliximab, a B cell depleting agent such as
rituximab, an interleukin-1 antagonist, or a T cell costimulatory
blocking agent such as abatacept.
[0354] In some embodiments, the complement-associated disorder is a
complement-associated neurological disorder such as, but not
limited to, amyotrophic lateral sclerosis (ALS), brain injury,
Alzheimer's disease, and chronic inflammatory demyelinating
neuropathy.
[0355] Complement-associated disorders also include
complement-associated pulmonary disorders such as, but not limited
to, asthma, bronchitis, a chronic obstructive pulmonary disease
(COPD), an interstitial lung disease, .alpha.-1 anti-trypsin
deficiency, emphysema, bronchiectasis, bronchiolitis obliterans,
alveolitis, sarcoidosis, pulmonary fibrosis, and collagen vascular
disorders.
[0356] In the case of complement-associated hemolytic disorders
such as PNH, CAD, and PCH, a medical practitioner will appreciate
that C5 fragment C5b (by way of the terminal complement complex)
contributes significantly to the pathogenesis of these disorders.
See, e.g., Kaplan (2002) Curr Opin Investig Drugs 3(7):1017-23;
Hill (2005) Clin Adv Hematol Oncol 3(11):849-50; and Rother et al.
(2007) Nature Biotechnology 25(11):1256-1488. Accordingly, a
medical practitioner may elect to administer one or more of the
anti-C5a antibodies described herein in conjunction with one or
more additional therapies for the hemolytic disorder such as a
complement inhibitor that prevents formation of the C5b-9 terminal
complement complex. In some embodiments of the methods described
herein, the complement-associated disorder is not a
complement-associated hemolytic disorder. In some embodiments, an
anti-C5a antibody or an antigen-binding fragment thereof is
administered to a subject to treat, prevent, or ameliorate at least
one symptom of a complement-associated inflammatory response (e.g.,
the complement-associated inflammatory response aspect of a
complement-associated disorder) in a subject. For example, an
anti-C5a antibody described herein can be used to treat, prevent,
and/or ameliorate one or more symptoms associated with a
complement-associated inflammatory response such as graft
rejection/graft-versus-host disease (GVHD), reperfusion injuries
(e.g., following cardiopulmonary bypass or a tissue transplant),
and tissue damage following other forms of traumatic injury such as
a burn (e.g., a severe burn), blunt trauma, spinal injury, or
frostbite. See, e.g., Park et al. (1999) Anesth Analg 99(1):42-48;
Tofukuji et al. (1998) J Thorac Cardiovasc Surg 116(6):1060-1068;
Schmid et al. (1997) Shock 8(2):119-124; and Bless et al. (1999) Am
J Physiol 276(1):L57-L63.
[0357] In some embodiments, an anti-C5a antibody or an
antigen-binding fragment thereof described herein can be
administered to a subject as a monotherapy. Alternatively, as
described above, the antibody or fragment thereof can be
administered to a subject as a combination therapy with another
treatment, e.g., another treatment for a complement-associated
disorder or a complement-associated inflammatory response. For
example, the combination therapy can include administering to the
subject (e.g., a human patient) one or more additional agents
(e.g., anti-coagulants, anti-hypertensives, or anti-inflammatory
drugs (e.g., steroids)) that provide a therapeutic benefit to a
subject who has, or is at risk of developing, sepsis. In another
example, the combination therapy can include administering to the
subject one or more additional agents (e.g., an anti-IgE antibody,
an anti-IL-4 antibody, an anti-IL-5 antibody, or an anti-histamine)
that provide therapeutic benefit to a subject who has, is at risk
of developing, or is suspected of having a complement-associated
pulmonary disorder such as COPD or asthma. In some embodiments, an
anti-C5a antibody and the one or more additional active agents are
administered at the same time. In other embodiments, the anti-C5a
antibody is administered first in time and the one or more
additional active agents are administered second in time. In some
embodiments, the one or more additional active agents are
administered first in time and the anti-C5a antibody is
administered second in time.
[0358] An anti-C5a antibody or an antigen-binding fragment thereof
described herein can replace or augment a previously or currently
administered therapy. For example, upon treating with an anti-C5a
antibody or antigen-binding fragment thereof, administration of the
one or more additional active agents can cease or diminish, e.g.,
be administered at lower levels. In some embodiments,
administration of the previous therapy can be maintained. In some
embodiments, a previous therapy will be maintained until the level
of the anti-C5a antibody reaches a level sufficient to provide a
therapeutic effect. The two therapies can be administered in
combination.
[0359] Monitoring a subject (e.g., a human patient) for an
improvement in a complement-associated disorder (e.g., sepsis,
severe burn, RA, lupus nephritis, Goodpasture syndrome, or asthma),
as defined herein, means evaluating the subject for a change in a
disease parameter, e.g., an improvement in one or more symptoms of
a given disorder. The symptoms of complement-associated disorders
are well known in the art of medicine. In some embodiments, the
evaluation is performed at least one (1) hour, e.g., at least 2, 4,
6, 8, 12, 24, or 48 hours, or at least 1 day, 2 days, 4 days, 10
days, 13 days, 20 days or more, or at least 1 week, 2 weeks, 4
weeks, 10 weeks, 13 weeks, 20 weeks or more, after an
administration. The subject can be evaluated in one or more of the
following periods: prior to beginning of treatment; during the
treatment; or after one or more elements of the treatment have been
administered. Evaluation can include evaluating the need for
further treatment, e.g., evaluating whether a dosage, frequency of
administration, or duration of treatment should be altered. It can
also include evaluating the need to add or drop a selected
therapeutic modality, e.g., adding or dropping any of the
treatments for a complement-associated disorder described
herein.
Therapeutic and Diagnostic Kits
[0360] The disclosure also features therapeutic and diagnostic kits
containing, among other things, one or more of the anti-C5a
antibodies, and/or antigen-binding fragments thereof, described
herein. The therapeutic kits can contain, e.g., a suitable means
for delivery of the antibody or antigen-binding fragment to a
subject. In some embodiments, the means is suitable for
subcutaneous delivery of the antibody or antigen-binding fragment
thereof to the subject. The means can be, e.g., a syringe or an
osmotic pump. That is, a therapeutic kit described herein can
contain a syringe pre-filled with an anti-C5a antibody or
antigen-binding fragment thereof (e.g., a pen device containing the
antibody or fragment) described herein or the kit can contain a
pump (e.g., an osmotic pump) and one or more disposable cassettes
configured for use with the pump, the cassettes pre-filled with an
anti-C5a antibody or antigen-binding fragment thereof described
herein (e.g., prefilled with an aqueous solution containing the
anti-C5a antibody or antigen-binding fragment thereof). In another
example, the kit can contain a transscleral or implantable delivery
device (e.g., a plug) that is pre-filled with (or otherwise
contains) a solution containing an anti-C5a antibody or
antigen-binding fragment thereof described herein.
[0361] In some embodiments, the means for delivering an anti-C5a
antibody or antigen-binding fragment thereof is a pen device for
drug delivery.
[0362] In some embodiments, the means is suitable for
intrapulmonary delivery of the antibody or antigen-binding fragment
thereof to a subject, e.g., for use in treatment or prevention of a
complement-associated pulmonary disorder such as, but not limited
to, COPD or asthma. Accordingly, the means can be, e.g., an oral or
nasal inhaler (see above). The inhaler can be, e.g., a metered dose
inhaler (MDI), dry powder inhaler (DPI), or a nebulizer. Such a kit
can also, optionally, include instructions for administering (e.g.,
self-administration of) the anti-C5a antibody or antigen-binding
fragment thereof to a subject.
[0363] The therapeutic kits can include, e.g., one or more
additional active agents for treating or preventing a
complement-associated disorder and/or ameliorating a symptom
thereof. For example, therapeutic kits designed for use in treating
or preventing a complement-associated pulmonary disorder can
include one or more additional active agents including, but not
limited to, another antibody therapeutic (e.g., an anti-IgE
antibody, an anti-IL-4 antibody, or an anti-IL-5 antibody), a small
molecule anti-IgE inhibitor (e.g., montelukast sodium), a
sympathomimetic (e.g., albuterol), an antibiotic (e.g.,
tobramycin), a deoxyribonuclease (e.g., pulmozyme), an
anticholinergic drug (e.g., ipratropium bromide), a corticosteroid
(e.g., dexamethasone), a .beta.-adrenoreceptor agonist, a
leukotriene inhibitor (e.g., zileuton), a 5-lipoxygenase inhibitor,
a phosphodiesterase (PDE) inhibitor, a CD23 antagonist, an IL-13
antagonist, a cytokine release inhibitor, a histamine H1 receptor
antagonist, an anti-histamine, an anti-inflammatory agent (e.g.,
cromolyn sodium or any other anti-inflammatory agent known in the
art or described herein), or a histamine release inhibitor.
[0364] In some embodiments, the means can be suitable for
intraocular administration of an anti-C5a antibody, or an
antigen-binding fragment thereof, described herein to a subject in
need thereof, e.g., a subject afflicted with AMD or any other
complement-associated ocular disorder. The means can be, e.g., a
syringe, a trans-scleral patch, or even a contact lens containing
the antibody or fragment. The means can, in some embodiments, be an
eye dropper, wherein the anti-C5a antibody or antigen-binding
fragment thereof is formulated for such administration. Such
therapeutic kits can also include, e.g., one or more additional
therapeutic agents for use in treating complement-associated
disorder of the eye. The therapeutic agents can be, e.g.,
bevacizumab or the Fab fragment of bevacizumab, ranibizimab, both
sold by Roche Pharmaceuticals, Inc., or pegaptanib sodium
(Mucogen.RTM.; Pfizer, Inc.). Such a kit can also, optionally,
include instructions for administering the anti-C5a antibody or
antigen-binding fragment thereof to a subject.
[0365] In some embodiments, the means can be suitable for
intraarticular administration of an anti-C5a antibody, or
antigen-binding fragment thereof, described herein to a subject in
need thereof, e.g., a subject afflicted with RA. The means can be,
e.g., a syringe or a double-barreled syringe. See, e.g., U.S. Pat.
Nos. 6,065,645 and 6,698,622. A double-barreled syringe is useful
for administering to a joint two different compositions with only
one injection. Two separate syringes may be incorporated for use in
administering the therapeutic while drawing off knee fluid for
analysis (tapping) in a push-pull fashion. Additional therapeutic
agents that can be administered with the anti-C5a antibodies or
fragments in conjunction with the double-barreled syringe, or which
can otherwise be generally included in the therapeutic kits
described herein, include, e.g., NSAIDs, corticosteroids,
methotrexate, hydroxychloroquine, anti-TNF agents such as
etanercept and infliximab, a B cell depleting agent such as
rituximab, an interleukin-1 antagonist, or a T cell costimulatory
blocking agent such as abatacept. Such a kit can also, optionally,
include instructions for administering the anti-C5a antibody or
antigen-binding fragment thereof to a subject. It will be
appreciated that the disclosure embraces kits comprising one or
more of the anti-C5a antibodies described herein and one or more
anti-inflammatory agents selected from the group consisting of
NSAIDs, corticosteroids, methotrexate, hydroxychloroquine, anti-TNF
agents such as etanercept and infliximab, a B cell depleting agent
such as rituximab, an interleukin-1 antagonist, or a T cell
costimulatory blocking agent such as abatacept. The antibodies and
agents can be, e.g., formulated separately or together. The kits
can be used to treat an inflammatory condition such as RA, Crohn's
disease, inflammatory bowel disease, or any other inflammatory
disorder known in the art or recited herein.
[0366] Also featured are diagnostic kits containing the anti-C5a
antibodies or antigen-binding fragments thereof described herein.
For example, the kits can contain a detectably-labeled form of an
anti-C5a antibody (e.g., an anti-C5a antibody or an anti-mouse C5a
antibody) described herein for use in detecting or quantitating the
amount of C5a in a biological sample. In some embodiments, the kits
can contain isolated C5a protein (e.g., one or both of human and
mouse C5a protein) and/or a control sample comprising one or both
of human and mouse C5a protein. In some embodiments, the kit
contains a multi-well plate coated with a first anti-C5a antibody
having a first specificity. The kit also contains a second anti-C5a
antibody (e.g., a detectably-labeled second anti-C5a antibody)
having a second specificity. Such a kit is designed for use in
capturing, with the first antibody bound to the plate, C5a protein
(e.g., human C5a protein) in a sample (e.g., a biological sample)
contacted to the plate and then detecting the captured C5a protein
using the second antibody. In some embodiments, diagnostic kits
include both an anti-mouse C5a antibody and an anti-human C5a
antibody described herein. In some embodiments, the diagnostic kits
include an anti-C5a antibody that binds to both mouse C5a and human
C5a.
[0367] The following examples are intended to illustrate, not
limit, the invention.
EXAMPLES
Example 1
Immunization Methods
[0368] The presently described anti-C5a antibodies are humanized
forms of murine antibodies generated under the following
immunization protocol. Immunizations to raise antibodies against
human desarginated C5a were performed on four mice including two
mice of the strain DBA/2J and two mice of the strain A/J. These
strains were selected because they carry the allele Hc.sup.0, which
makes them deficient in endogenous C5. All immunizations were
repeated at 14 day intervals for a total of three immunizations.
All animals received a subcutaneous booster immunization of
approximately 50 .mu.g of purified C5a in 200 .mu.L of adjuvant
emulsion approximately 14 days after the last immunization and 5 to
7 days before harvesting. Titering of serum from immunized mice,
using an ELISA assay, showed that the mice exhibited a strong
antibody response against the human desarginated C5a immunogen.
Example 2
Determining the Specificity of the Mouse Antibodies for Human
C5a
[0369] A subset of five mouse anti-human C5a Fabs that were
representative of neoepitope selective Fabs were converted to full
length mouse IgG2a antibodies designated as--5an048 ME, 5an101 ME,
5an178 ME, 5an179 ME, and 5an180 ME. These antibodies were
evaluated for specificity using Biolayer Interferometry on an Octet
(ForteBio Inc.). (The amino acid sequences of the light chain and
heavy chain CDR sets of each antibody, as defined by Kabat, are set
forth in Table 3.) Briefly, human C5a, human C5a des Arg, human
full-length C5, or C5a paralogs human C3a and human C4a were
conjugated to biotin at a stoichiometry of <1(biotin):1
(antibody) through amine groups and immobilized on a streptavidin
tip. Loaded tips were then exposed to a solution containing 20 nM
of anti-C5a IgG antibody. Each of the antibodies bound to C5a and
desarginated C5a. None of the anti-C5a IgG antibodies bound to C3a
or to C4a. However, 5an178 ME and 5an179 ME each bound to
full-length human C5. A small amount of binding was observed
between 5an048 ME and full-length human C5. However, the binding of
5an048 ME to C5 was much less than the binding observed to C5a.
[0370] These results confirmed that mouse anti-human C5a
antibodies--5an048 ME, 5an101 ME, and 5an180 ME--bound to a
neoepitope on C5a that was occluded in native, full-length C5 or
generated after the cleavage of C5 into fragments C5a and CSb. The
results also indicated that the three antibodies were selective for
human C5a as compared to paralogs C3a or C4a.
TABLE-US-00003 TABLE 3 Amino Acid Sequences for Five Murine
Anti-Human C5a Antibodies Ab SIN: Description Amino Acid Sequence
5an048ME 151 V.sub.L Amino Acid EIVLTQSPAIMSASPGEKVTMTCRASSSVSSS
Sequence YLHWYQQKSGASPKLWIYSTSNLASGVPAR
FSGSGSGTSYSLTISSVEAEDAATYYCQQYS GYPLTFGGGTKLEIKR 140 Light Chain
CDR1 RASSSVSSSYLH 96 Light Chain CDR2 STSNLAS 142 Light Chain CDR3
QQYSGYPLT 152 V.sub.H Amino Acid EVRLQQSGPELVKPGASVRISCKASGYTFN
Sequence DYYYMNWVKQSHGKSLEWIGYIFPKTGGT
HYNQRFKGKATLTVDKSSSTAYMELRSLTS EDSAVYYCASGPFAYWGQGTLVTVSA 115 Heavy
Chain CDR1 DYYYMN 144 Heavy Chain CDR2 YIFPKTGGTHYNQRFKG 117 Heavy
Chain CDR3 GPFAY 5an101ME 153 V.sub.L Amino Acid
DIVMTQSPASLAVSLGQRATISCRASESVDS Sequence
YGNSFMHWYQQKPGQPPKLLIYRASNLESG IPARFSGSGSRTDFTLTINPVEADDVATYYC
QQSNEDPYTFGGGTKLEIKR 20 Light Chain CDR1 RASESVDSYGNSFMH 21 Light
Chain CDR2 RASNLES 22 Light Chain CDR3 QQSNEDPYT 154 V.sub.H Amino
Acid EVQLQQSGPELVKPGSSVKISCKASGYTFTD Sequence
YSMDWVKQSHGKSLEWIGAINPNSGGTNY SQKFKDKATLTVDKSSSTAYMELRSLTSED
SAVYYCASSGSYDGYYAMDYWGQGTSVT VSS 28 Heavy Chain CDR1 DYSMD 67 Heavy
Chain CDR2 AINPNSGGTNYSQKFKD 30 Heavy Chain CDR3 SGSYDGYYAMDY
5an180ME 155 V.sub.L Amino Acid DIQMTQSPASLSASVGETVTITCRASENIYSY
Sequence LAWYQQKQGKSPQLLVYNAKTLAEGVPSR
FSGSGSGTQFSLKINSLQPEDFGSYYCQHHY GTPYTFGGGTKLEIKR 156 Light Chain
CDR1 RASENIYSYLA 157 Light Chain CDR2 NAKTLAE 158 Light Chain CDR3
QHHYGTPYT 159 V.sub.H Amino Acid EVQLQQPGAEIVRPGASVKLSCRASGYTFT
Sequence DYWMNWVKQRPGQGLEWIGTIDPSDSYTI
YNQKFKGKATLTVDTSSTTAYIQLSSLTSED SAVYFCARGEDYDVSSYTMDYWGQGTSVT VSS
160 Heavy Chain CDR1 DYWMN 161 Heavy Chain CDR2 TIDPSDSYTIYNQKFKG
162 Heavy Chain CDR3 GEDYDVSSYTMDY 5an178ME 163 V.sub.L Amino Acid
EIVLTQSPASLAVSLGQRATISCSASESVEYF Sequence
GTSLMQWYQQKPGQPPKLLIYAASNVESG VPARFSGSGSGTDFSLNIHPVEEDDIAMYFC
QQSRKVPWTFGGGTKLEIKR 164 Light Chain CDR1 SASESVEYFGTSLMQ 165 Light
Chain CDR2 AASNVES 166 Light Chain CDR3 QQSRKVPWT 167 V.sub.H Amino
Acid EVKLVESGGGLVQPGGSRKLSCAASGFTFS Sequence
DYGMVWVRQAPGKGLEWVAFISSGSSNIY YADTVKGRFTISRDNPKNTLFLQMNSLRSE
DTAIYYCGRAFSFYYGYDYWGQGTTLTVSS 168 Heavy Chain CDR1 DYGMV 169 Heavy
Chain CDR2 FISSGSSNIYYADTVKG 170 Heavy Chain CDR3 AFSFYYGYDY
5an179ME 171 V.sub.L Amino Acid DVVMTQTPLSLPVSLGDQASISCRSSQSLVH
Sequence SNGNTYLHWYLQKPGQSPKLLIYKVSNRFS
GVPDRFSGSGSGTDFTLKISRVEAEDLGVYF CSQSTHVPLTFGAGTKLELKR 172 Light
Chain CDR1 RSSQSLVHSNGNTYLH 173 Light Chain CDR2 KVSNRFS 174 Light
Chain CDR3 SQSTHVPLT 175 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVRMSCKASGYTFT Sequence
SYLIHWVKQKPGQGLEWIGYIYPFNDGTKN NENFKGKATLTSDKSSSTVYMEVSSLTSEDS
AVYYCARSHGPHYYGGSYGYHFDYWGQG TTLTVSS 176 Heavy Chain CDR1 SYLIH 177
Heavy Chain CDR2 YIYPFNDGTKNNENFKG 178 Heavy Chain CDR3
SHGPHYYGGSYGYHFDY ''SIN'' in the Table refers to ''SEQ ID NO.''
*CDR amino acid sequence defined according to Kabat et al.
(supra).
[0371] A series of sandwich assays were performed by Octet on the
selected subset of mouse anti-human C5a IgG2a antibodies to
determine the degree of overlap of the C5a epitopes for each of the
five representative IgG2a antibodies. Briefly, a first antibody was
biotinylated and immobilized on a streptavidin coated tip on the
Octet platform. Next, human C5a was captured from a 20 nM solution
on the immobilized antibody. The tip carrying the antibody-C5a
complex was then exposed to a solution containing 20 nM of an
unlabeled second anti-C5a IgG antibody. The elicitation of an
additional association profile in the sensogram would indicate that
the two antibodies bound C5a simultaneously in a ternary complex
and that the binding epitopes for the two antibodies were
non-overlapping. A failure to obtain a second association profile
upon addition of the second antibody would indicate that the two
antibodies bound C5a in a competitive manner, i.e., the epitope on
C5a to which the second antibody bound was occluded after binding
by the first antibody. In contrast to non-competitive binding,
competitive binding does not necessarily indicate that the first
and second antibodies recognized the same, or even overlapping,
epitopes on human C5a. Using this approach the binding sites of the
five representative anti-C5a antibodies were assigned to 4 distinct
epitopes on human C5a (FIG. 1). Antibodies 5an048 ME, 5an180 ME,
and 5an101 ME competed with each other. While 5an048 and 5an180
also competed with the non-neoepitope selective 5an179 ME, 5an101
ME did not, which indicated that 5an048 ME and 5an180 ME recognize
a neoepitope that is different than the epitope recognized by
5an101 ME. In addition, while the non-neoepitope selective antibody
5an178 ME competed with non-neoepitope selective 5an179 ME, only
the latter competed with 5an180 ME and 5an048 ME, showing that
5an179 ME and 5an178 ME bind different epitopes that are accessible
both in C5 and C5a. The results also indicate that some
combinations of the antibodies could be used in sandwich-based
assays to detect and/or quantify the amount of C5a in a sample.
Example 3
Humanization of Select Mouse Anti-Human C5a Antibodies
[0372] The variable regions of two related mouse anti-human C5a
antibodies--5an101 ME and 5an185 ME--were selected for humanization
as full length IgG antibodies. Humanization of light and heavy
chain variable regions was based on identifying individual
framework regions from human antibodies (with a preference given to
germline v-genes) with a high degree of sequence identity to the
original murine parent antibody. Methods for identifying suitable
candidate framework regions are described in U.S. Pat. No.
7,393,648 to Rother and Wu. Definitions of framework (FW) and
complementarity determining regions (CDRs) were performed according
to methods described by Kabat, Chothia and IMGT.RTM. (International
ImmunoGenetics Information System; France). Briefly, database
queries were performed independently for both the light and heavy
chain variable regions with a variety of antibody fragments
including: intact murine variable region from FW1 through FW4,
intact murine variable regions excluding CDRs and all possible
fragments of murine variable regions including one, two or three
frameworks with or without their flanking CDRs. Human frameworks
were selected from this candidate pool based on their overall
sequence identity to the original murine antibodies and fragments
thereof. Routine molecular biological methods were employed to
assemble small combinatorial libraries, of less than 10.sup.3
members, in which each set of murine CDRs were flanked by all
possible combinations of selected human frameworks. These humanized
antibodies were expressed as soluble Fabs and evaluated for binding
to desarginated C5a using ELISA. Fabs that bound to C5a were then
subjected to DNA sequence analysis.
[0373] From these binders a subset of six humanized Fabs were
reformatted as full length IgGs (human IgG2 or human IgG2/G4).
Additional humanization was performed in two antibodies (BNJ371 and
BNJ381) by replacing murine residues in CDR2 of the light chain
with their corresponding human germline amino acids. The amino acid
sequences of the humanized anti-C5a antibodies--BNJ364, BNJ367,
BNJ371, BNJ378, BNJ366, BNJ369, BNJ381, and BNJ383--are set forth
in Table 2 above.
Example 4
Determining the Affinity of the Humanized Anti-Human C5a Antibodies
for C5a
[0374] The humanized antibodies were subjected to BIAcore analysis
to quantify their respective affinities for human C5a. See, e.g.,
Karlsson and Larsson (2004) Methods Mol Biol 248:389-415. Briefly,
each of the humanized antibodies were screened with 3-4
concentrations of human C5a (antigen) using a capture technique.
The antibodies were captured by an Anti-Fc (human) directly
immobilized on a CM5 sensor chip with various concentrations in the
range from 0.6 nM to 5.9 nM of human C5a passed over the sensor
chip surface. The surface was regenerated with 20 mM HCl, 0.02% P20
after each cycle to remove bound antibody and antigen. The data was
evaluated using Biacore BIAevaluation software using a 1:1 Langmuir
Model Fit (Rmax:Global Fit; RI:Local Fit). Kinetics information
such as (k.sub.a: Association Rate constant), (k.sub.d:Dissociation
Rate constant) and K.sub.D (Equilibrium Dissociation constant) was
obtained from the fit. The results of the analyses are set forth in
Table 4. These experiments were for screening purposes with a
minimal number of analyte concentrations (3 to 4) with 1 duplicate.
Therefore, the approximate kinetics values are reported in Table
4.
TABLE-US-00004 TABLE 4 Affinity Measurements for Select Humanized
Anti-C5a Antibodies Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D
(M) Designation (.times.10.sup.6) (.times.10.sup.-4)
(.times.10.sup.-12) .chi..sup.2 BNJ364 0.991 6.38 644 0.819 BNJ367
3.94 7.78 198 0.848 BNJ371 2.38 28.2 1180 9.52 BNJ378 1.93 5.76 298
3.63 BNJ366 1.05 1.58 150 1.23 BNJ369 4.19 2.23 53.1 0.642 BNJ381
2.57 2.09 81.5 1.93 BNJ383 2.12 1.5 70.4 2.52
[0375] All of the humanized antibodies specifically bound to human
C5a with a K.sub.D less than 1.20 nanomolar. All of the antibodies
with the exception of BNJ371 bound to human C5a with a K.sub.D less
than 1 nanomolar. Three of the antibodies, BNJ369, BNJ381, and
BNJ383 bound to human C5a with a K.sub.D less than 100
picomolar.
Example 5
Anti-C5a Antibodies Inhibit C5a-Mediated Signaling In Vitro
[0376] An in vitro neutrophil activation assay was used to evaluate
the activity of the humanized antibodies. The assay is generally
described in, e.g., Paczkowski et al. (1999) Br J Pharmacol
128(7):1461-1466, and serves to quantitate the amount of
myeloperoxidase (MPO) produced by neutrophils as a measure of
neutrophil activation. Briefly, polymorphonuclear cells, the
majority of which being neutrophils, were isolated using density
centrifugation (mono-poly resolving medium catalogue number:
91698049; MP Biochemicals; Solon, Ohio) from whole blood from a
healthy donor. The cells were washed once with phosphate-buffered
saline (PBS) and the red blood cells (RBC) removed from the cell
population by lysis in a hypotonic solution (ACK lysis buffer
catalogue number 10-548E; Lonza). After two more washes with PBS,
the RBC-free cells were resuspended at a concentration of
4.times.10.sup.6 cells/mL in Hank's Balanced Salt Solution (HBSS;
Mediatech, catalogue number: 21-023-CV), which was supplemented
with calcium and magnesium and further supplemented with 0.1%
gelatin (Sigma Aldrich; St. Louis, Mo.) [hereinafter the assay
buffer].
[0377] Cytochalasin B (Sigma Aldrich) was added to the cell
suspension in an amount sufficient to reach a concentration of 10
.mu.g/mL. The suspension was then incubated for 10 minutes at
37.degree. C. 100 .mu.L of cells was added to wells of U-bottomed
96-well plates. The wells of the plate were grouped into several
different sets. Each of several of the different sets of wells
contained an anti-C5a antibody: each well of set 1 contained a
humanized antibody that binds to uncleaved, native C5, but not to
free C5a; each well of set 2 contained the BNJ367 humanized
anti-C5a antibody; each well of set 3 contained the BNJ369
humanized anti-C5a antibody; each well of set 4 contained the
BNJ371 humanized anti-C5a antibody; each well of set 5 contained
the BNJ378 humanized anti-C5a antibody; each well of set 6
contained the BNJ381 humanized anti-C5a antibody; and each well of
set 7 contained the BNJ383 humanized anti-C5a antibody. Each well
of an eighth set of wells contained no antibody. A range of
antibody concentrations was evaluated in each set of wells, the
range including 0.08 nM, 0.4 nM, 2 nM, and 10 nM antibody.
[0378] C5a (obtained from Complement Technologies, Inc.) was
evaluated at a concentration of 2 nM. A 10.times. working
concentration of 20 nM was prepared in the aforementioned assay
buffer and 20 .mu.L was added to each well. After addition of C5a
to the wells, the plate was incubated for 10 minutes at 37.degree.
C. Following the incubation, 60 lit of PBS was added to each well
of the plate. The plates were subjected to centrifugation at 1200
rpm (approximately 335.times.g) for 10 minutes at room temperature.
100 .mu.L of the supernatant from each well was transferred to the
corresponding well of a second plate. 25 .mu.L of substrate (Sigma
Aldrich catalogue number T0440) was added to each well of the
second plate and the peroxidase reaction was allowed to develop for
approximately two to five minutes. The reaction was terminated by
the addition of 25 .mu.L of IN HCl. The OD at 450 nM was
recorded.
[0379] As shown in FIG. 2, all of the humanized anti-C5a antibodies
inhibited neutrophil activation in vitro. These results indicate
that the humanized anti-C5a antibodies described herein are potent
inhibitors of C5a-mediated signaling in vitro and support the
conclusion by the inventors that the antibodies are useful for
treating a variety of complement-associated disorders (e.g.,
complement-associated inflammatory disorders) in humans.
Example 6
Characterization of a Surrogate Mouse Anti-Mouse C5a Antibody
[0380] A series of sandwich assays were performed on a selected
mouse anti-mouse C5a IgG antibody--5an195 ME--to determine the
specificity of the antibody for C5a. Briefly, the wells of an assay
plate were coated with the 5an195 ME antibody. The plate was washed
thoroughly to remove unbound antibody. Next, wells containing
5an195 ME were contacted with mouse C5a for a time and under
conditions sufficient to allow the antigen to bind to the antibody.
Unbound protein was removed with washing. Following the wash step,
the wells were further contacted with a solution containing a
second, biotinylated anti-C5a antibody. The wells were again washed
to remove any unbound second antibody. The amount of binding of the
second antibody to the well was quantified using
streptavidin-conjugated horseradish peroxidase (HRP). The amount of
binding of the second antibody was a function of the binding of C5a
to 5an195 ME.
[0381] In a parallel experiment, a set of 5an195 ME-coated wells
were incubated with full-length mouse C5 protein, rather than C5a.
Following a wash step, the wells were contacted with a solution
containing a second antibody: a biotinylated anti-mouse C5
antibody. The amount of binding of the second antibody, as a
function of the amount of C5 bound by 5an195 ME, was quantified
using the streptavidin-conjugated HRP construct. A lack of binding
of the second antibody indicates that 5an195 ME does not bind to
full-length mouse C5.
[0382] While 5an195 ME bound to C5a in a dose-dependent manner, no
binding between the antibody and full-length mouse C5 was detected
using this assay. These results indicate that 5an195 ME binds to a
neo-epitope present in C5a.
[0383] The relative binding affinity of 5an195 ME for mouse C5a was
further quantified using BIAcore. The kinetics of 5an195 ME were
measured using a capture technique. The antibody was captured by an
Anti-Fc (mouse) directly immobilized on a CM5 sensor chip with
various concentrations between and inclusive of 0.4 nM and 25 nM of
mouse C5a passed over the sensor chip surface. Duplicates of each
concentration were also run. The surface of the chip was
regenerated with 10 mM glycine HCl pH 1.7 after each cycle to
remove bound antibody and antigen. The data were evaluated using
Biacore BIAevaluation software using a 1:1 Langmuir Model Fit
(Rmax:Global Fit; RI:Local Fit).
[0384] Kinetics information such as k.sub.a (Association Rate
constant), k.sub.d (Dissociation Rate constant) and K.sub.D
(Equilibrium Dissociation constant) was obtained from the fit. The
results of the kinetics analyses are shown in Table 5.
TABLE-US-00005 TABLE 5 Measured Kinetics of 5an195ME for Mouse C5a
Parameter: k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) .chi..sup.2
5an195ME 8.47 .times. 10.sup.5 1.27 .times. 10.sup.-3 1.5 .times.
10.sup.-9 1.17
[0385] These results indicate that the mouse anti-mouse C5a
antibody is not only specific for C5a, as compared to full-length
mouse C5, but also that the antibody binds with high affinity to
mouse C5a.
Example 7
Use of the Surrogate Anti-Mouse C5a Antibody 5an195 ME in an RA
Animal Model
[0386] The 5an195 ME anti-mouse C5a antibody was evaluated in a
mouse model of collagen-induced arthritis. Male DBA/1LacJ mice (9
to 12 weeks old) were immunized by intradermal injection at the
base of the tail with 300 .mu.g of bovine type II collagen
emulsified with equal volumes of Freund's complete adjuvant. The
procedure was repeated two weeks after the first immunization. Mice
were inspected daily to identify inflammation at an initial knee
joint. Once the initial inflammation was identified, mice were
intraperitoneally administered three times/week the 5an195 ME
anti-mouse C5a antibody (40 mg/kg) or a control antibody (40
mg/kg). The thickness of the initially inflamed joint (in mm) was
measured daily to day 12.
[0387] As shown in FIG. 3, 5an195 ME reduced knee joint thickness
as compared to the control antibody. 5an195 ME appeared to provide
the benefit of maintaining a knee joint thickness below 4.5 mm.
[0388] In addition to evaluating the ability of the 5an195 ME
antibody to reduce swelling of the initially inflamed knee joint,
the ability of the 5an195 ME anti-C5a antibody to prevent migration
of inflammation to new joints was also evaluated. The number of
newly recruited joints was measured daily from day 1 to day 12. The
results of the experiment are set forth in Table 6.
TABLE-US-00006 TABLE 6 Efficacy of 5an195ME in RA Model Number of
Number of Average Number joints newly inflamed number of newly of
inflamed joints inflamed joints Treatment Mice on day 1 on day 12
per mouse Control Ab 6 7 12 2 5an195ME 6 7 2 0.3
[0389] As shown in Table 6, mice treated with 5an195 ME had
markedly fewer newly inflamed joints as compared with control Ab
treated animals by day 12. 5an195 ME-treated mice also had on
average markedly fewer newly inflamed joints.
[0390] The arthritis in the mice was also monitored and defined
using a clinical score/arthritis index. Each limb was graded daily
according to an established scoring system (0, normal joint; 1,
mild/moderate visible erythema and swelling; 2, severe erythema and
swelling affecting an entire paw or joint; 3, deformed paw or joint
with ankylosis.), with a maximum score of twenty-four per animal.
See, e.g., Wang et al. (2000) J Immunol 164:4340-4347. As shown in
FIG. 4, mice treated with the anti-mouse C5a antibody 5an195 ME
exhibited a marked reduction in clinical score (average score of
less than 1), as compared to mice treated with the control antibody
(average score above 6), over the course of the study.
[0391] In summary, these results indicate that the surrogate
anti-mouse C5a is effective in treating RA--both at an initial
joint and the migration of inflammation to secondary joints--in the
mouse model of disease. The results also strongly suggest that a
therapeutic anti-human C5a antibody, such as any of the humanized
anti-C5a antibodies described herein, is useful for treating humans
with RA.
Example 8
Use of an Anti-C5a Antibody to Treat Rheumatoid Arthritis
[0392] A human patient is identified by a medical practitioner as
having rheumatoid arthritis in a single articulated joint. The
patient is shortly thereafter administered intraarticularly or
intraperitoneally a composition containing a humanized anti-C5a
antibody described herein in an amount sufficient to reduce
C5a-mediated C5aR1 signaling locally within the joint space. The
patient and medical practitioner observe a substantial improvement
in at least two known symptoms of rheumatoid arthritis following
the treatment. The patient receives intravenously administered
"maintenance doses" of the antibody every month to prevent
reoccurrence of the symptoms, to prevent the progression of RA at
the single joint, or to prevent the migration of RA symptoms to a
second joint.
Example 9
Use of an Anti-C5a Antibody to Treat Sepsis
[0393] A human patient is identified by a medical practitioner as
having sepsis. The patient is shortly thereafter administered a
composition containing a humanized anti-C5a antibody described
herein at a dose of approximately 600 to 900 mg by way of
intravenous infusion. The patient and medical practitioner observe
a substantial improvement in at least two known symptoms of sepsis
during the treatment. The patient receives intravenously
administered "maintenance doses" of the antibody every two weeks
until the patient leaves the hospital.
Example 10
Use of an Anti-C5a Antibody to Treat Complement-Associated
Pulmonary Inflammatory Disorders
[0394] A human patient is identified by a medical practitioner as
having a severe form of COPD. Once every two weeks for four weeks
the patient is administered a composition containing a humanized
anti-C5a antibody at a dose of approximately 600 mg to 900 mg by
intravenous infusion. The patient and medical practitioner observe
a substantial improvement in at least two known symptoms of COPD
during the initial treatment. For example, the patient receiving
the anti-C5a antibody has a reduced frequency and/or severity of
COPD-related exacerbations. The patient continues to receive
intravenously administered "maintenance doses" of the antibody
every two weeks to maintain the reduced frequency and/or severity
of COPD-related exacerbations.
[0395] A human patient is identified by a medical practitioner as
having a severe form of asthma. The patient is prescribed a
therapeutic, humanized anti-C5a antibody to be administered by way
of an inhaler. During the next attack of bronchospasms, the patient
self-administers the anti-C5a antibody in an amount sufficient to
reduce the C5a-mediated inflammatory response in the lungs of the
patient. The patient continues to use the inhaler as needed to
prevent or lessen the severity of asthma attacks.
Example 11
Additional Anti-C5a Antibodies Identified from the Immunized
Mice
[0396] Several additional antibodies were obtained from the
immunized mice (see Example 1) and further identified by ELISA as
capable of binding to human C5a. The additional antibodies include
15 unique light chain CDR sets (set forth in Table 7) and 14 unique
heavy chain CDR sets (as set forth in Table 8).
TABLE-US-00007 TABLE 7 Amino Acid Sequences of Several Unique
V.sub.L and Kabat-defined Light Chain CDR sequences from Additional
Murine Anti-human C5a Antibodies Ab SIN: Description Amino Acid
Sequence* 5an110 83 V.sub.L Amino Acid
DIVMTQSQKFMSTSVGDRVSVTCKASQNVGT Sequence
NVAWYQQKPGQSPKALIYSASYRYSGVPDRF TGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYP
FTFGSGTKLEIKR 84 Light Chain CDR1 KASQNVGTNVA 85 Light Chain CDR2
SASYRYS 86 Light Chain CDR3 QQYNSYPFT 5an177 87 V.sub.L Amino Acid
EIVLTQSPAIMSASPGEKVTMTCSASSSVSYMH Sequence
WYQQKSGTSPKRWIYDTSKLASGVPARFSGS GSGTSYSLTISSMEAEDAATYYCQQWSSNPLT
FGAGTKLELKR 88 Light Chain CDR1 SASSSVSYMH 89 Light Chain CDR2
DTSKLAS 90 Light Chain CDR3 QQWSSNPLT 5anG12 91 V.sub.L Amino Acid
QIVLTQSPAIMSASPGEKVTMTCSASSSISYMH Sequence
WYQQKPGTSPKRWIYDTSKLASGVPARFSGS GSGTSYSLTISSMEAEDAATYYCHQRSSYPWT
FGGGTKLEIKR 92 Light Chain CDR1 SASSSISYMH 89 Light Chain CDR2
DTSKLAS 93 Light Chain CDR3 HQRSSYPWT 5an052 94 V.sub.L Amino Acid
QIVLTQSPAIMSASPGEKVTLTCSASSSVSSSYL Sequence
YWYQQKPGSSPKLWIYSTSNLASGVPARFSGS GSGTSYSLTISTVEAEDAASYFCHQWSSYPPTF
GGGTKLEIKR 95 Light Chain CDR1 SASSSVSSSYLY 96 Light Chain CDR2
STSNLAS 97 Light Chain CDR3 HQWSSYPPT 5an107 98 V.sub.L Amino Acid
DIQMTQSPAPMLVSVGETVTITCRGSENIYSNL Sequence
AWYQQKQGKSPQLLVYAATNLADGVPSRFSG SGSGTQYSLKINSLQSEDFGSYYCQHFWGTPR
TFGGGTKLEIKR 99 Light Chain CDR1 RGSENIYSNLA 100 Light Chain CDR2
AATNLAD 101 Light Chain CDR3 QHFWGTPRT 5anE11 102 V.sub.L Amino
Acid DIVMTQSQKFMSTSVGDRVSVTCKASQNVGT Sequence
NVAWYQQKPGQSPKALIYSASYRYSGVPDRF TGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYP
WTFGGGTKLEIKR 84 Light Chain CDR1 KASQNVGTNVA 85 Light Chain CDR2
SASYRYS 103 Light Chain CDR3 QQYNSYPWT 5an054 104 V.sub.L Amino
Acid QIVLTQSPVIMSASPGEKVTMTCSASSSVSYM Sequence
YWYQQKPGSSPRLLIYDTSNLASGVPVRFSGS GSGTSYSLTISRMEAEDAATYYCQQWSSYPPT
FGAGTKLELKR 105 Light Chain CDR1 SASSSVSYMY 106 Light Chain CDR2
DTSNLAS 107 Light Chain CDR3 QQWSSYPPT 5anG10 141 V.sub.L Amino
Acid QIVLTQSPAIMSASPGEKVTMTCSASSSISYMH Sequence
WYQQKPGTSPKRWIYDTSKLASGVPARFSGS GSGTSYSLTISSMEAEDAATYYCHQRRSYPWT
FGGGTKLEIKR 92 Light Chain CDR1 SASSSISYMH 89 Light Chain CDR2
DTSKLAS 108 Light Chain CDR3 HQRRSYPWT 5an188 109 V.sub.L Amino
Acid DIVLTQSPASLAVSLGQRATISCRASESVDSYG Sequence
NSFMHWYQQKPGQPPKLLIYLASNLESGVPAR FSGSGSRTDFTLTIDPVEADDAATYYCQQNNE
DPLTFGAGTKLELKR 20 Light Chain CDR1 RASESVDSYGNSFMH 110 Light Chain
CDR2 LASNLES 111 Light Chain CDR3 QQNNEDPLT 5an185 112 V.sub.L
Amino Acid DIVLTQSPASLAVSLGQRATISCRASESVDSYG Sequence
NSFMHWYQQKPGQPPKLLIYRASNLESGIPAR FSGSGSRTDFTLTINPVEADDVATYYCQQSNE
DPLTFGAGTKLELKR 20 Light Chain CDR1 RASESVDSYGNSFMH 21 Light Chain
CDR2 RASNLES 113 Light Chain CDR3 QQSNEDPLT ''SIN'' in the Table
refers to ''SEQ ID NO.'' *CDR amino acid sequences are defined
according to Kabat et al. (supra).
TABLE-US-00008 TABLE 8 Amino Acid Sequences of Several Unique
V.sub.H and Kabat-defined Heavy Chain CDR sequences from Additional
Murine Anti-human C5a Antibodies Ab SIN: Description Amino Acid
Sequence* 5an110 114 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVKISCKASGYTFSDY Sequence
YYMNWVKKSHGKSLEWIGYIFPKTGGTNYS QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 116 Heavy Chain
CDR2 YIFPKTGGTNYSQRFKG 117 Heavy Chain CDR3 GPFAY 5an177 118
V.sub.H Amino Acid EVKLVESGGGLVKPGGSLKLSCAASGITFSSY Sequence
YMAWVRQTPDKRLEWVATISSGGSYTYYPD NVKGRFTISRDNAKNTLYLQMSSLKSEDTAM
YYCTRYYEDDAMDYWGQGTSVTVSS 119 Heavy Chain CDR1 SYYMA 120 Heavy
Chain CDR2 TISSGGSYTYYPDNVKG 121 Heavy Chain CDR3 YYEDDAMDY 5an055
122 V.sub.H Amino Acid EVQLQQSGPELVKPGASVKISCKASGYTFSDY Sequence
YYIVINWVKKSHGKSLEWIGYIFPKTGGTNYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 123 Heavy Chain
CDR2 YIFPKTGGTNYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an054 145
V.sub.H Amino Acid EVQLQQSGPELVKPGASVKISCKASGYTFTDY Sequence
YYMNWVKQSHGKSLEWIGYIFPNTGGTTYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 124 Heavy Chain
CDR2 YIFPNTGGTTYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an107 125
V.sub.H Amino Acid EVKLVESGGGLVKPGGSLKLSCAASGYTFSS Sequence
YYMAWVRQTPDKRLEWVATISSGGSYTYYR DNVKGRFTISRDNAKNTLYLQMSSLKSEDTA
MYYCTRYFEDYPMDYWGQGTSVTVSS 119 Heavy Chain CDR1 SYYMA 126 Heavy
Chain CDR2 TISSGGSYTYYRDNVKG 127 Heavy Chain CDR3 YFEDYPMDY 5an111
128 V.sub.H Amino Acid EVQLQQSGPELGKPGASGKISCKASGYTFTDY Sequence
YYMNWVKQSHGKSLEWIGYIFPNTGGTSYN QRFKDKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 129 Heavy Chain
CDR2 YIFPNTGGTSYNQRFKD 117 Heavy Chain CDR3 GPFAY 5an183 130
V.sub.H Amino Acid EVQLQQPGSVLVRPGATVKLSCKASGFTFTSS Sequence
WMHWAKQRPGQGLEWIGEIHTSGHTNYNEK FKGKATLTLDTSSSTAYVDISSLTSEDSAVYY
CARGGLRRGYAMDYWGQGTSVTVSS 131 Heavy Chain CDR1 SSWMH 132 Heavy
Chain CDR2 EIHTSGHTNYNEKFKG 133 Heavy Chain CDR3 GGLRRGYAMDY 5an185
134 V.sub.H Amino Acid EVQPQQSGPELVKPGSSVKISCKASGYTFTDY Sequence
SMDWVKQSHGKSLEWIGAIHLNTGYTNYNQ KFKGKATLTVDKSSSTAYMELRSLTSEDSAV
YYCARGFYDGYSPMDYWGQGTSVTVSS 28 Heavy Chain CDR1 DYSMD 46 Heavy
Chain CDR2 AIHLNTGYTNYNQKFKG 47 Heavy Chain CDR3 GFYDGYSPMDY 5an188
135 V.sub.H Amino Acid EVQLQQSGAELVKPGTSVKLSCKASGYTFTS Sequence
YWMEIWVKQRPGQGLEYIGEIHPSSGHTNYH EKFKSKATLTVDKSSSTAYMQLSSLTSEDSAV
YYCARASLLRAYAMDYWGQGTSVTVSS 136 Heavy Chain CDR1 SYWMH 137 Heavy
Chain CDR2 EIHPSSGHTNYHEKFKS 138 Heavy Chain CDR3 ASLLRAYAMDY
''SIN'' in the Table refers to ''SEQ ID NO.'' *CDR amino acid
sequences are defined according to Kabat et al. (supra).
[0397] V.sub.L and V.sub.H pairings giving rise to the 5an177 ME,
5an054 ME, 5an110 ME, 5an188 ME, 5an185 ME, and 5an107 ME
antibodies are evident from Tables 7 and 8. Additional exemplary
pairings of the heavy chain and light chain variable regions and/or
CDR sets are set forth in Table 9 below.
TABLE-US-00009 TABLE 9 Amino Acid Sequences for Additional Mouse
Anti-Human C5a Antibodies CDR Sets Ab SIN: Description Amino Acid
Sequence* 5an047 139 V.sub.L Amino Acid
EIVLTQSPAIMSASPGEKVTMTCRASSSVSSSY Sequence
LHWYQQKSGASPKLWIYSTSNLASGVPARFS GSGSGTSYSLTISSVEAEDAATYYCQQYSGYP
LTFGAGTKLELKR 140 Light Chain CDR1 RASSSVSSSYLH 96 Light Chain CDR2
STSNLAS 142 Light Chain CDR3 QQYSGYPLT 143 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVRISCKASGYTFSDY Sequence
YYMNWVKKSHGKSLEWIGYIFPKTGGTHYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 144 Heavy Chain
CDR2 YIFPKTGGTHYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an181 139
V.sub.L Amino Acid EIVLTQSPAIMSASPGEKVTMTCRASSSVSSSY Sequence
LHWYQQKSGASPKLWIYSTSNLASGVPARFS GSGSGTSYSLTISSVEAEDAATYYCQQYSGYP
LTFGAGTKLELKR 140 Light Chain CDR1 RASSSVSSSYLH 96 Light Chain CDR2
STSNLAS 142 Light Chain CDR3 QQYSGYPLT 122 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVKISCKASGYTFSDY Sequence
YYMNWVKKSHGKSLEWIGYIFPKTGGTNYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 123 Heavy Chain
CDR2 YIFPKTGGTNYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an109 146
V.sub.L Amino Acid EIVLTQSPAIMSASPGEKVTMTCSASSSVSYM Sequence
YWYQQKPGSSPRLLIYDTSNLASGVPVRFSGS GSGTSYSLTISRMEAEDAATYYCQQWSSYPP
TFGGGTKLEIKR 105 Light Chain CDR1 SASSSVSYMY 106 Light Chain CDR2
DTSNLAS 107 Light Chain CDR3 QQWSSYPPT 122 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVKISCKASGYTFSDY Sequence
YYMNWVKKSHGKSLEWIGYIFPKTGGTNYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 123 Heavy Chain
CDR2 YIFPKTGGTNYNQRFKG 117 Heavy Chain CDR3 GPFAY 5anG10 141
V.sub.L Amino Acid QIVLTQSPAIIVISASPGEKVTMTCSASSSISYM Sequence
HWYQQKPGTSPKRWIYDTSKLASGVPARFSG SGSGTSYSLTISSMEAEDAATYYCHQRRSYP
WTFGGGTKLEIKR 92 Light Chain CDR1 SASSSISYMEI 89 Light Chain CDR2
DTSKLAS 108 Light Chain CDR3 HQRRSYPWT 147 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVRISCKASGYTFND Sequence
YYYMNWVKQSHGKSLEWIGYIFPKTGGTHY NQRFKGKATLTVDKSSSTAYMELRSLTSEDS
AVYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 144 Heavy Chain
CDR2 YIFPKTGGTHYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an053 148
V.sub.L Amino Acid EIVLTQSPVIMSASPGEKVTMICSASSSISYMH Sequence
WYQQKPGTSPKRWIYDTSKLASGVPARFSGS GSGTSYSLTISIMEAEDAATYYCHQRSSYPWT
FGGGTKLEIKR 92 Light Chain CDR1 SASSSISYMEI 89 Light Chain CDR2
DTSKLAS 93 Light Chain CDR3 HQRSSYPWT 149 V.sub.H Amino Acid
EVQMQQSGPELVKPGASVKISCKASGYTFSD Sequence
YYYIVINWVKKSHGKSLEWIGYIFPKTGGTNY NQRFKGKATLTVDKSSSTAYMELRSLTSEDS
AVYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 123 Heavy Chain
CDR2 YIFPKTGGTNYNQRFKG 117 Heavy Chain CDR3 GPFAY 5anG12 91 V.sub.L
Amino Acid QIVLTQSPAIMSASPGEKVTMTCSASSSISYM Sequence
HWYQQKPGTSPKRWIYDTSKLASGVPARFSG SGSGTSYSLTISSMEAEDAATYYCHQRSSYPW
TFGGGTKLEIKR 92 Light Chain CDR1 SASSSISYMEI 89 Light Chain CDR2
DTSKLAS 93 Light Chain CDR 3HQRSSYPWT 147 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVRISCKASGYTFND Sequence
YYYMNWVKQSHGKSLEWIGYIFPKTGGTHY NQRFKGKATLTVDKSSSTAYMELRSLTSEDS
AVYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 144 Heavy Chain
CDR2 YIFPKTGGTHYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an052 94 V.sub.L
Amino Acid QIVLTQSPAIMSASPGEKVTLTCSASSSVSSSY Sequence
LYWYQQKPGSSPKLWIYSTSNLASGVPARFS GSGSGTSYSLTISTVEAEDAASYFCHQWSSYP
PTFGGGTKLEIKR 95 Light Chain CDR1 SASSSVSSSYLY 96 Light Chain CDR2
STSNLAS 97 Light Chain CDR3 HQWSSYPPT 147 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVRISCKASGYTFND Sequence
YYYMNWVKQSHGKSLEWIGYIFPKTGGTHY NQRFKGKATLTVDKSSSTAYMELRSLTSEDS
AVYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 144 Heavy Chain
CDR2 YIFPKTGGTHYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an111 102
V.sub.L Amino Acid DIVMTQSQKFMSTSVGDRVSVTCKASQNVGT Sequence
NVAWYQQKPGQSPKALIYSASYRYSGVPDRF TGSGSGTDFTLTISNVQSEDLAEYFCQQYNSY
PWTFGGGTKLEIKR 84 Light Chain CDR1 KASQNVGTNVA 85 Light Chain CDR2
SASYRYS 103 Light Chain CDR3 QQYNSYPWT 128 V.sub.H Amino Acid
EVQLQQSGPELGKPGASGKISCKASGYTFTDY Sequence
YYMNWVKQSHGKSLEWIGYIFPNTGGTSYN QRFKDKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 129 Heavy Chain
CDR2 YIFPNTGGTSYNQRFKD 117 Heavy Chain CDR3 GPFAY 5an055 150
V.sub.L Amino Acid EIVLTQSPAIMSASPGEKVTLTCSASSSVSSSY Sequence
LYWYQQKPGSSPKLWIYSTSNLASGVPARFS GSGSGTSYSLTISSMEAEDAASYFCHQWSSYP
PTFGGGTKLEIKR 95 Light Chain CDR1 SASSSVSSSYLY 96 Light Chain CDR2
STSNLAS 97 Light Chain CDR3 HQWSSYPPT 122 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVKISCKASGYTFSDY Sequence
YYMINWVKKSHGKSLEWIGYIFPKTGGTNYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 123 Heavy Chain
CDR2 YIFPKTGGTNYNQRFKG 117 Heavy Chain CDR3 GPFAY 5anE11 102
V.sub.L Amino Acid DIVMTQSQKFMSTSVGDRVSVTCKASQNVGT Sequence
NVAWYQQKPGQSPKALIYSASYRYSGVPDRF TGSGSGTDFTLTISNVQSEDLAEYFCQQYNSY
PWTFGGGTKLEIKR 84 Light Chain CDR1 KASQNVGTNVA 85 Light Chain CDR2
SASYRYS 103 Light Chain CDR3 QQYNSYPWT 143 V.sub.H Amino Acid
EVQLQQSGPELVKPGASVRISCKASGYTFSDY Sequence
YYMNWVKKSHGKSLEWIGYIFPKTGGTHYN QRFKGKATLTVDKSSSTAYMELRSLTSEDSA
VYYCASGPFAYWGQGTLVTVSA 115 Heavy Chain CDR1 DYYYMN 144 Heavy Chain
CDR2 YIFPKTGGTHYNQRFKG 117 Heavy Chain CDR3 GPFAY 5an183 112
V.sub.L Amino Acid DIVLTQSPASLAVSLGQRATISCRASESVDSY Sequence
GNSFMEIWYQQKPGQPPKLLIYRASNLESGIP ARFSGSGSRTDFTLTINPVEADDVATYYCQQS
NEDPLTFGAGTKLELKR 20 Light Chain CDR1 RASESVDSYGNSFMH 21 Light
Chain CDR2 RASNLES 113 Light Chain CDR3 QQSNEDPLT 130 V.sub.H Amino
Acid EVQLQQPGSVLVRPGATVKLSCKASGFTFTSS Sequence
WMHWAKQRPGQGLEWIGEIHTSGHTNYNEK FKGKATLTLDTSSSTAYVDISSLTSEDSAVYY
CARGGLRRGYAMDYWGQGTSVTVSS 131 Heavy Chain CDR1 SSWMH 132 Heavy
Chain CDR2 EIHTSGHTNYNEKFKG 133 Heavy Chain CDR3 GGLRRGYAMDY
''SIN'' in the Table refers to ''SEQ ID NO.'' *CDR amino acid
sequences are defined according to Kabat et al. (supra).
Example 12
Additional Humanized Anti-Human C5a Antibodies
[0398] Several additional humanized anti-C5a antibody heavy chain
variable regions were generated, all of which when paired with a
common light chain variable region (the light chain having the
amino acid sequence depicted in SEQ ID NO:16) bound to human C5a
with a K.sub.D of less than 1 nM as determined by Biacore analysis
(see above for methodology). All of these additional humanized
antibodies bound specifically to human C5a, but did not bind to
native, fully-folded human C5, C4a, or C3a as determined by Octet
analysis (see above for methodology). The additional humanized
antibodies contained: (i) a heavy chain variable region framework
region 1 containing one of the following amino acid sequences:
QVQLVQSGAEVKKPGASVKVSCKASGYTFT (SEQ ID NO:68) or
QVQLVQSGSELKKPGASVKVSCKASGYTFT (SEQ ID NO:69); (ii) a heavy chain
variable region framework region 2 containing one of the following
amino acid sequences: WVRQAPGQGLEWMG (SEQ ID NO:70) or
WVRQASGKGLEWVG (SEQ ID NO:71); (iii) a heavy chain variable region
framework region 3 containing one of the following amino acid
sequences: RVTITRDTSASTAYMELSSLRSEDTAVYYCAR (SEQ ID NO:72);
RVTITADESTSTAYMELSSLRSEDTAVYYCAR (SEQ ID NO:73); or
RVTITRDRSMSTAYMELSSLRSEDTAMYYCAR (SEQ ID NO:74); and a heavy chain
variable region framework region 4 containing the following amino
acid sequence: WGQGTTVTVSS (SEQ ID NO:75). Exemplary additional
humanized heavy chain variable regions comprising one or more of
the additional humanized framework sets described in this section
are set forth in FIG. 5.
Example 13
Use of an Anti-Human C5a Antibody in a Mouse Neutropenia Model
[0399] A murine model of C5a-neutropenia was utilized to evaluate
the efficacy of an anti-human free C5a antibody in vivo. To induce
neutropenia, purified, native human C5a (hC5a) was administered by
way of intravenous tail vein injection to Balb/c mice. The number
of circulating neutrophils was evaluated up to five minutes after
administration of hC5a.
[0400] Administration of 300 .mu.g/kg of hC5a was consistently
found to induce neutrophil activation as measured by the
myeloperoxidase (MPO) release assay (see Example 5 for use with
serum as compared to cell culture supernatant, supra) and
neutropenia (a reduction in the number of circulating neutrophils).
In addition, plasma levels of hC5a and the human anti-C5a antibody
BNJ383 (when administered to the mice, infra) were also measured to
establish the pharmacodynamic response (see below).
[0401] Peripheral blood neutrophil counts were examined before
challenge with hC5a or vehicle control. Compared to sham-treated
control mice (1.37.+-.0.09.times.10.sup.6/mL), neutrophil counts in
mice treated with anti-human free C5a antibody
(1.32.+-.0.13.times.10.sup.6 per mL at 24 mg/kg; P>0.05) or
isotype control mAb (1.31.+-.0.10.times.10.sup.6 per mL at 24
mg/kg; P>0.05) remained the same. These results indicated that
antibody alone did not induce changes in circulating neutrophil
counts.
[0402] To evaluate the efficacy of an anti-C5a antibody to inhibit
hC5a-induced neutropenia in mice, different dosages (24 mg/kg, 12
mg/kg, 6 mg/kg, and 3 mg/kg) of the anti-human C5a antibody BNJ383
were administered to Balb/c mice 24 hours prior to hC5a injection.
Administration of the anti-C5a antibody 24 hours ahead of hC5a
allowed for the pharmacodynamics properties of the antibody to be
studied during the .beta.-phase of antibody elimination from the
mice.
[0403] As shown in FIG. 6, neutrophil counts after treatment are
expressed as a percentage of "baseline" (where the count at time 0
equals 100%). In sham-treated control mice, the neutrophil counts
were 79.02.+-.5.71%, 67.42.+-.3.23%, and 59.54.+-.2.11% of baseline
at 1, 3 and 5 minutes post hC5a administration, respectively. The
isotype control antibody-treated mice demonstrated a significant
reduction (P<0.01) in the neutrophil count to 6.76.+-.0.81% at 1
minute, 6.68.+-.0.81% at 3 minutes, and 8.29.+-.0.79% at 5 minutes
after intravenous injection of hC5a. The anti-C5a antibody
exhibited a dose-dependent effect on hC5a-induced neutropenia. At
the highest dose, 24 mg/kg, the anti-C5a antibody completely
blocked the neutropenia. Neutrophil counts were 70.35.+-.8.64% at 1
minute, 63.35.+-.6.08% at 3 minutes, and 59.65.+-.6.51% at 5
minutes, which was comparable to the neutrophil levels in
sham-treated control animals at the same time points. The lower
doses of 12 mg/kg or 6 mg/kg of the anti-C5a antibody also
significantly inhibited neutrophil depletion (12 mg/kg:
42.61.+-.5.12% at 1 minute, 45.33.+-.8.29% at 3 minutes, and
41.02.+-.7.08% at 5 minutes, P<0.01; 6 mg/kg: 18.00.+-.3.8 at 1
minute, 26.20.+-.4.44% at 3 minutes, and 28.03.+-.4.51% at 5
minutes, P<0.05) following administration of hC5a, as compared
to the isotype control antibody group (6.76.+-.0.81% at 1 minute,
6.68.+-.0.81% at 3 minutes, and 8.29.+-.0.79% at 5 minutes). The
isotype control antibody is an antibody that binds anthrax
protective antigen 63 and contains a human IgG2/4 isotype Fc
region. Administration of the lowest dose of the anti-C5a antibody
(3 mg/kg) did not significantly reduce neutropenia (6.28.+-.0.88%
at 1 minute, 6.71.+-.2.14% at 3 minutes, and 8.75.+-.2.98% at 5
minutes, P>0.05). See FIG. 6.
[0404] Anti-Human C5a Antibody Inhibits hC5a-Induced MPO Release In
Vivo
[0405] As discussed above, human C5a activates neutrophils through
cross-reactive binding of the mouse C5a receptor. Myeloperoxidase
(MPO) release is a consequence of neutrophil activation through C5a
binding to C5aR. See Darren et al. (2004) Mol Pharm 65(4):868-879.
Intravenous injection of recombinant human C5a into the mouse can
induce neutropenia and activate neutrophils in circulation. The
ability of an anti-human free C5a antibody to inhibit MPO release
due to neutrophil activation in vivo was evaluated using the
anti-C5a antibody to bind free hC5a and prevent binding to the
murine C5aR.
[0406] An in vivo experiment (in which human C5a was administered
to mice) was performed as described above. The level of plasma MPO
at time 0 was 79.25.+-.22.88 ng/mL in the sham-treated control
group. Five minutes after intravenous injection of vehicle buffer,
MPO levels were not significantly changed (77.46.+-.21.21 ng/mL,
P>0.05). Prior to intravenous injection of hC5a, MPO levels in
isotype control antibody-treated (75.17.+-.14.66 ng/mL) or anti-C5a
antibody-treated animals (87.57.+-.14.86 ng/mL) were comparable
with the levels observed in the sham-treated control animals. After
intravenous injection of hC5a, MPO levels at all doses of C5a were
raised and remained at significantly higher levels at 5 minutes
(FIG. 7).
[0407] When compared to isotype control antibody-treated animals
(221.00.+-.51.02 ng/mL), the anti-hC5a antibody-treated animals
showed dose-dependent reduction of MPO levels (114.83.+-.23.26
ng/mL, P<0.05, in 24 mg/kg cohort; 104.80.+-.29.83 ng/mL,
P<0.05, in 12 mg/kg cohort; and 126.90.+-.36.40 ng/mL, P=0.08,
in 6 mg/kg cohort). The MPO levels of low dose (3 mg/kg) anti-C5a
antibody-treated animals (176.55.+-.23.05 ng/mL) were not
significantly different from isotype control antibody-treated
animals (P>0.05).
[0408] An Anti-C5a Antibody Reduces Circulating hC5a Levels in
Mice
[0409] As noted above, C5a is a potent inflammatory peptide with
several biological functions. These above studies demonstrated that
human C5a cross-reacts with murine C5aR on neutrophils since
intravenous injection of recombinant human C5a can induce
neutropenia. While this disclosure is in no way limited by any
particular theory or mechanism of action, the anti-C5a antibody may
be inhibiting human C5a-induced neutropenia by forming complexes
with hC5a and preventing hC5a from binding to the murine C5aR
expressed on the cell surface. hC5a levels were measured in the
plasma of mice before and 1, 3, and 5 minutes after intravenous
administration of hC5a to confirm that the effects of the anti-hC5a
antibody in vivo were due to its binding-dependent inhibition of
hC5a.
[0410] An experiment was performed as described above using the
mouse-hC5a-induced neutropenia model. hC5a was not detected in
plasma in any group of mice prior to administration of hC5a at time
0, using an enzyme-linked immunosorbent assay (ELISA). The level of
hC5a in plasma, however, increased to a peak at 1 minute
(7783.50.+-.327.73 ng/mL), then reduced to 4788.38.+-.260.51 ng/mL
at 3 minutes, and then to 3855.75.+-.298.99 ng/mL at 5 minutes
following intravenous injection of hC5a (in isotype control
mAb-treated mouse). Compared to control antibody-treated mice, the
level of hC5a in mice treated with 24 mg/kg of the anti-C5a
antibody exhibited a 43, 30, and 23-fold decline at 1 minute
(178.4.+-.14.14 ng/mL), 3 minutes (158.4.+-.10.43 ng/mL), and 5
minutes (167.2.+-.15.61 ng/mL), respectively. The level of hC5a in
plasma from the 12 mg/kg and 6 mg/kg cohorts were 235.00.+-.22.33
and 609.20.+-.78.75 ng/mL at 1 minute, 210.80.+-.19.59 and
527.60.+-.52.25 ng/mL at 3 minutes, 192.20.+-.7.40 and
505.00.+-.45.96 ng/mL at 5 minutes, respectively. The
anti-C5a-treated mice exhibited significantly reduced hC5a levels
in a dose-dependent manner during neutropenia following intravenous
injection of hC5a (P<0.001). Although the mice receiving the
lowest dose of anti-C5a antibody (3 mg/kg) were not spared from
hC5a-induced neutropenia, the mice nonetheless had a significant
reduction in plasma hC5a (3130.40.+-.433.58 ng/mL at 1 minute;
1932.00.+-.268.92 ng/mL at 3 minutes; 1593.00.+-.169.68 ng/mL at 5
minutes) as compared to plasma hC5a levels found in isotype control
antibody-treated mice (P<0.05). See FIG. 8. These data indicated
that administration of anti-C5a antibody to mice significantly
decreased the concentration of free hC5a in plasma, resulting in
greatly ameliorated hC5a-induced neutropenia.
[0411] Taken together, these results presented in this section
indicated that an anti-human C5a antibody described herein can
inhibit the biological effect of human C5a in an in vivo disease
setting and provide strong evidence that the antibodies (and
antigen-binding fragments thereof) are useful in, among other
things, treating or preventing complement-associated disorders such
as any of those recited herein.
Example 14
Anti-Human C5a Antibody Crossreacts with C5a from Non-Human
Primates
[0412] Several humanized anti-hC5a antibodies were tested for their
ability to crossreact with C5a from one or more non-human mammalian
species. As noted above, the benefits of such an anti-C5a antibody
are numerous, e.g., the ability of a research or medical
practitioner to model the efficacy of a therapeutic anti-C5a
antibody in a non-human disease model prior to administering the
antibody to humans. Testing in non-human mammals can also allow for
determination or approximation of the appropriate dosage of an
anti-C5a antibody required for efficacy in humans.
[0413] Briefly, BNJ369, BNJ366, BNJ364, and BNJ383 (described
above) were evaluated to determine whether they could
co-immunoprecipitate C5a protein in the activated serum from
several non-human primates including baboon, rhesus macaque, and
cynomolgus macaque. The serum was activated by addition of zymosan.
Following an overnight incubation of each antibody with activated
serum, the antibodies were separated from the solution phase using
protein A-conjugated agarose beads. The beads were washed
thoroughly and then boiled in sodium dodecyl sulfate-polyacrylamide
gel electrophoresis (SDS-PAGE) sample buffer containing
.beta.-mercaptoethanol. The boiled samples were then subjected to
SDS-PAGE. Non-human primate C5a was detected by western blot using
the commercially-available anti-C5a neoepitope antibody #2942
(Abcam, Cambridge, Mass.). Each of the antibodies tested was
capable of immunoprecipitating C5a (or C5a desarg) from baboon,
rhesus macaque, and cynomolgus macaque indicating that the antibody
is crossreactive with C5a from these species as well as with human
C5a.
[0414] The determination of binding affinity parameters to
cynomolgus macaque C5a was determined as described above. Briefly,
the BNJ383 antibody was screened against 3-4 concentrations of
recombinant cynomolgus macaque C5a (antigen) using a capture
technique as described above. The antibody was captured by an
Anti-Fc (human) directly immobilized on a CM5 sensor chip with
various concentrations in the range from 0.6 nM to 5.9 nM of
cynomolgus C5a passed over the sensor chip surface. The surface was
regenerated with 20 mM HCl, 0.02% surfactant P20 (Biacore) after
each cycle to remove bound antibody and antigen. The data was
evaluated using Biacore BIAevaluation software using a 1:1 Langmuir
Model Fit (Rmax:Global Fit; RI:Local Fit). These experiments were
for screening purposes with a minimal number of analyte
concentrations (3 to 4) with 1 duplicate. The approximate K.sub.D
of the antibody for cynomolgus macaque C5a is 3.3 nM. See Table
10.
TABLE-US-00010 TABLE 10 Affinity Determination for non-Human C5a
Proteins k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D(M) Species
(.times.10.sup.6) (.times.10.sup.-4) (.times.10.sup.-12)
.chi..sup.2 Human 0.77 8.32 108 1.23 Cynomolgus macaque 1.28 42.3
3300 1.45 Mouse 2.8 10.6 379* 2.38 *This is only an approximation
of the K.sub.D based on the quality of the curve fit.
[0415] The BNJ383 antibody was also screened against 3-4
concentrations of recombinant mouse C5a (antigen) using a capture
technique as described above to determine its affinity for mouse
protein. The antibody was captured, as described above, by an
anti-Fc (human) directly immobilized on a CM5 sensor chip with
various concentrations in the range from 0.6 nM to 5.9 nM of mouse
C5a passed over the sensor chip surface. The surface was
regenerated with 20 mM HCl, 0.02% P20 after each cycle to remove
bound antibody and antigen. The data were evaluated using Biacore
BIAevaluation software using a 1:1 Langmuir Model Fit (Rmax:Global
Fit; RI:Local Fit).
[0416] The above results indicated that several of the humanized
anti-hC5a antibodies described herein are crossreactive with C5a
from several non-human primate species including cynomolgus
macaque, rhesus macaque, and baboon. The BNJ383 antibody, e.g.,
also crossreacts with mouse C5a. Furthermore, the results described
in this section indicate that an anti-human C5a antibody, such as
BNJ383, is useful not only in clinical applications for treating
complement-associated disorders, but also in a variety of
pre-clinical applications in non-human mammals, which are necessary
for, or supportive of, approval of clinical use in humans.
Example 15
Competition for Binding to C5a
[0417] An experiment was performed to evaluate the binding of an
anti-C5a antibody described herein, BNJ383, in the presence of
potentially competitive antigens. Briefly, ruthenium-labeled BNJ383
(250 pM) was incubated for two hours at room temperature with 1 nM
biotinylated C5a, along with various concentrations (e.g., 400,
133, 44.4, 14.8, 4.9, 1.6, and 0.5 nM) of one of the following: (a)
human C5a desarg protein in phosphate-buffered saline, (b) human
plasma, (c) cynomolgus macaque plasma, (d) Balb/C (mouse) plasma,
or (e) DBA/2J (mouse) plasma. With respect to the plasma components
(b), (c), (d), and (e), the concentration refers to the approximate
final concentration of C5 antigen in the incubation mixture.
[0418] Following the incubation period, the samples were contacted
to respective individual wells of a streptavidin-coated assay plate
under conditions that allowed for the binding of biotinylated C5a
to the streptavidin in the wells of the plate. The wells were
washed thoroughly to remove unbound material. The amount of binding
of BNJ383 to C5a in the presence of competitor was determined by
detecting the amount of signal produced from the detectable
ruthenium label. The results are shown in FIG. 9.
[0419] Whereas human C5a desarg was an effective competitor, there
was virtually no competition observed in the presence of mouse
serum (17% reduction in detectable signal observed at approximately
a 400:1 ratio of Balb/C mouse plasma-derived C5 to biotinylated
human C5a and 25% reduction in detectable signal observed at
approximately a 400:1 ratio of DBA2/J plasma-derived C5 to
biotinylated human C5a). No change in the level of binding of
BNJ383 to biotinylated human C5a was observed at up to
approximately a 15:1 ratio of human or cynomolgus macaque
plasma-derived C5 to biotinylated human C5a.
[0420] As noted above, while the disclosure is in no way limited to
any particular theory or mechanism of action, the inventors
hypothesize that the anti-C5a antibody may bind to a subpopulation
of uncleaved, processed C5 (e.g., plasma C5) constituting less than
10% of the total population of full length C5 in a sample (e.g., a
plasma sample), which subpopulation is in whole or in part
denatured such that an otherwise occluded C5a neoepitope, to which
the anti-C5a antibody or fragment binds, is exposed. Thus, it is
believed that the antibody does not bind to a fully functional
and/or fully functional species of C5 and thus does not truly bind
to uncleaved, native C5. Human plasma is at least an approximately
30 to 100-fold weaker competitor for binding to biotinylated C5a
than human C5a desarg.
[0421] Notwithstanding these considerations, these results further
indicate that anti-human C5a antibodies described herein, such as
BNJ383, preferentially bind to free human C5a even in the presence
of up to approximately 20-fold excess of uncleaved, but not
necessarily entirely native, plasma-derived human C5 protein.
Example 16
Effect of Anti-C5a Antibody on AP and CP Activity In Vitro
[0422] An experiment was performed to evaluate the effect of an
anti-C5a antibody described herein (BNJ383) on alternative pathway
(AP) complement activity in vitro using pooled normal human serum
(PNHS). The experiment utilized the Wieslab.RTM. Alternative
Pathway Complement Kit (Wieslab.RTM. COWL AP330, Euro-Diagnostica,
Sweden) and the associated protocol was followed with only routine
optimization well within the purview of one of ordinary skill in
the art. Briefly aliquots of the PNHS were incubated in wells of a
lipopolysaccharide-coated plate for one hour (at 37.degree. C.)
along with various concentrations (0.778, 0.389, 0.194, 0.097,
0.049, 0.024, 0.012, 0.006, 0.003, and 0.002 .mu.M) of an anti-hC5
antibody or an anti-hC5a antibody (BNJ383). The anti-C5 antibody
inhibits the cleavage of human C5 into fragments C5a and CSb. As a
negative control, several wells were incubated with PNHS under the
same conditions, but in the absence of anti-hC5 antibody or
anti-hC5a antibody.
[0423] Following the incubation, the wells were washed thoroughly
with kit-supplied 1.times. wash buffer. The level of alternative
pathway complement activation was measured by absorbance at 405 nm,
following contact of each well with a kit-supplied enzyme conjugate
(an anti-C5b-9 antibody conjugated to alkaline phosphatase) and
fluorogenic substrate (which is operated upon by the enzyme) and
incubation for 30 minutes at room temperature. The results are
shown in FIG. 10.
[0424] While the anti-C5 antibody inhibited alternative pathway
complement activity completely at concentrations greater than 0.1
the anti-hC5a antibody did not significantly inhibit complement
activity even at the highest concentration tested.
[0425] An experiment was performed to evaluate the effect of an
anti-C5a antibody described herein (BNJ383) on classical pathway
(CP) complement activity in vitro using PNHS. The experiment
utilized the Wieslab.RTM. Classical Pathway Complement Kit
(Wieslab.RTM. COMPL CP310, Euro-Diagnostica, Sweden) and the
associated protocol was followed with only routine optimization
well within the purview of the ordinarily-skilled artisan. Briefly
aliquots of the PNHS were incubated in wells of a human IgM
antibody-coated plate for one hour (at 37.degree. C.) along with
various concentrations (7.2, 3.6, 1.8, 0.9, 0.45, 0.2, 0.1, 0.05,
0.02, or 0.01 .mu.M) of an anti-hC5 antibody or an anti-hC5a
antibody (BNJ383). The anti-C5 antibody inhibits the cleavage of
human C5 into fragments C5a and C5b. As a control, several wells
were incubated with PNHS under the same conditions, but in the
absence of anti-hC5 antibody or anti-hC5a antibody.
[0426] Following the incubation, the wells were washed thoroughly
with kit-supplied 1.times. wash buffer. The level of alternative
pathway complement activation was measured by absorbance at 405 nm,
following contact of each well with a kit-supplied enzyme conjugate
(an anti-C5b-9 antibody conjugated to alkaline phosphatase) and
fluorogenic substrate (which is operated upon by the enzyme) and
incubation for 30 minutes at room temperature. The results are
shown in FIG. 11.
[0427] While the anti-C5 antibody inhibited classical pathway
complement activity completely at concentrations greater than 0.1
the anti-hC5a antibody did not significantly inhibit complement
activity even at the highest concentration tested.
[0428] Taken together, these results indicate that, in vitro, the
anti-hC5a antibody, BNJ383, did not significantly affect C5b-9
generation (terminal complement activation) driven by either the
classical or alternative pathway of complement, thus giving further
evidence that the anti-hC5a antibodies described herein
specifically target the free C5a anaphylatoxin arm of complement
activation.
Example 17
Anti-C5a Antibody Retains an Unoccupied Antigen-Binding Site
Available to Bind to C5a Even in the Presence of a Molar Excess of
hC5
[0429] The anti-C5a antibody BNJ383 (set forth above) was incubated
at 4.degree. C. for 84 hours in the presence of a 2.1-fold molar
excess of human C5 (hC5) to allow for complete antibody:C5 complex
formation. A parallel experiment was performed using an antibody
that binds to human C5 at a 2:1 stoichiometry (hereinafter the
anti-C5 antibody). Antibody:C5 complexes were resolved on a TSK.TM.
G4000 SW size exclusion column (Tosoh, Tokyo) using a Waters.TM.
2690/5 HPLC system with a Waters.TM. W2487 dual wavelength detector
to determine the occupancy of binding sites. Peaks were monitored
at a wavelength of 214 nm. The mobile phase for the HPLC analysis
contained the following buffer composition: 3.9 mM
NaH.sub.2PO.sub.4, 6.1 mM Na.sub.2HPO.sub.4, and 150 mM NaCl, at
pH7.0. The flow rate was 1.0 ml per minute and the run time was 20
minutes. Data were acquired and analyzed with Waters Empower.TM. 2
chromatography software.
[0430] As depicted in FIG. 12, BNJ383 alone (FIG. 12A) and hC5
alone (FIG. 12B) each resolve as a single peak centered around 10.2
minutes and >95% of the anti-C5a antibody:hC5 complexes resolve
as a single peak centered around 9.2 minutes (FIG. 12C). In
contrast, complexes of hC5 and the anti-C5 antibody resolve in two
peaks centered at 8.6 min (39%) and 9.2 min (61%) (FIG. 12D). Thus,
even in a molar excess of hC5, 95.2% of the BNJ383 has a free Fab
arm that may be capable of binding to human C5a.
[0431] These samples were further examined to determine if the
BNJ383 antibody retained the ability to bind C5a in the presence of
saturating concentrations of C5. Free antibody or antibody:C5
complexes were titrated from 500 to 0.5 ng/mL on a streptavidin
coated plate to which biotin conjugated hC5a was immobilized.
Captured antibody was detected with an anti-human Fc antibody
conjugated to horse radish peroxidase. The results depicted in FIG.
13 demonstrate that even BNJ383 complexed with hC5 is capable of
binding C5a and that the concentration of antibody available to
bind C5a is not detectably diminished in the presence of saturating
C5. Thus, the results described herein indicate that the antibody,
even in the presence of a molar excess of uncleaved C5, retains the
ability to bind to free C5a with high affinity and thereby retains,
even in that molar excess, the ability to inhibit the
pro-inflammatory activity of C5a.
Example 18
BNJ383 is a Potent Antagonist of C5a but is an Incomplete/Partial
Antagonist of Terminal Complement Complex Formation In Vivo
[0432] Cynomolgus macaques were administered intravenously a single
dose of the BNJ383 anti-C5a antibody at 1 mg/kg, 10 mg/kg, 100
mg/kg 250 mg/kg or 400 mg/kg. Plasma samples were collected from
the macaques at time points ranging from 1 day to 30 days following
the administration of the antibody. Levels of C5a/C5a desarg in
plasma were determined by an electrochemiluminescent (ECL) assay in
which a free C5a/C5a desarg was captured on a microtiter plate
coated with an antibody specific for a neoepitope on C5a/C5a desarg
and detected with a non-competitive C5a antibody conjugated to a
ruthenate containing ECL moiety and read on a SECTOR 2400.TM. plate
reader (MesoScale Discovery). Circulating antibody concentrations
were determined by and enzyme linked immunosorbent assay (ELISA) in
which free antibody (BNJ383) was captured on a microtiter plate
coated with human C5a desarg and detected with a mouse anti-human
antibody conjugated to horseradish peroxidase (HRP).
[0433] As shown in FIG. 14, like the results described in Example
13, circulating concentrations of BNJ383 as low as 10 .mu.g/mL
deplete plasma C5a/C5a desarg levels to below detectable limits in
cynomolgus monkeys. These results also underscore that the
antibody, even in the presence of a molar excess of uncleaved C5,
retains the ability to bind to free C5a with high affinity and
thereby retains, even in that molar excess, the ability to inhibit
the pro-inflammatory activity of C5a.
[0434] To determine whether BNJ383 had an effect on hemolytic
activity of macaque serum, the antibody was evaluated in an in
vitro red blood cell hemolysis assay.
[0435] The red blood cell hemolysis assay is generally described in
detail in, e.g., Rinder et al. (1995) J Clin Invest 96:1564-1572.
Briefly, serum samples obtained from macaques administered BNJ383
(as described above) were added to multiple wells of a 96 well
assay plate such that the concentration of the serum in each well
was approximately 10%. The serum samples, by virtue of the time
points in which they were obtained, contained various
concentrations of the BNJ383 antibody. The hemolytic activity of
serum from macaques not receiving BNJ383 served as a negative
control and as the baseline hemolytic activity level.
[0436] Chicken erythrocytes (Lampire Biological Laboratories,
Piperville, Pa.) were washed and resuspended in buffer at a final
concentration of 5.times.10.sup.7 cells/mL. The erythrocytes were
sensitized to lysis by incubating the cells with an anti-chicken
red blood cell polyclonal antibody composition. The sensitized
erythrocytes were added to the wells of the 96 well plate and the
plate was incubated at 37.degree. C. for 30 minutes. Hemoglobin
release was measured by apparent absorbance at 415 nm using a
microplate reader.
[0437] As shown in FIG. 15A, even high concentrations of BNJ383 did
not substantially inhibit erythrocyte hemolysis under these ex vivo
hemolytic assay experimental conditions.
[0438] The BNJ383 antibody was also evaluated to determine if it
had an effect on complement activation of macaque serum using an ex
vivo CH50eq assay. The CH50eq assay is a method for measuring the
total classical complement activity in serum. This test is an
enzyme linked immunosorbent assay, which uses human gammaglobulins
and mouse monoclonal antibodies as the activator of the classical
complement pathway and captures the terminal complement complex
(TCC) generated on a microtiter well coated with a TCC neoepitope
specific antibody. Captured TCC is detected with a goat anti-TCC
antibody conjugated to horse radish peroxidase. The CH50eq assay
provides a direct measure of terminal complement complex (TCC)
formation.
[0439] As shown in FIG. 15B, high concentrations of BNJ383 present
in the macaque serum were capable of substantially inhibiting TCC
formation under these ex vivo conditions. These results indicate
that the BNJ383 antibody is not only capable of binding to and
sequestering free C5a but is also capable of, as a function of
concentration, partially or substantially inhibiting TCC
formation.
[0440] An ex vivo experiment was also performed to evaluate the
effect of BNJ383 on classical pathway (CP) complement activity
using the macaque serum samples described above. The experiment
utilized the Wieslab.RTM. Classical Pathway Complement Kit
(Wieslab.RTM. COMPL CP310, Euro-Diagnostica, Sweden) and the
associated protocol was followed with only routine optimization
well within the purview of the ordinarily-skilled artisan. Briefly
aliquots of the macaque serum samples were incubated in wells of a
human IgM antibody-coated plate for one hour. As a control, several
wells were incubated under the same conditions with serum from
macaques not administered the BNJ383 antibody.
[0441] Following the incubation, the wells were washed thoroughly
with kit-supplied 1.times. wash buffer. The level of alternative
pathway complement activation was measured by absorbance at 405 nm,
following contact of each well with a kit-supplied enzyme conjugate
(an anti-C5b-9 antibody conjugated to alkaline phosphatase) and
fluorogenic substrate (which is operated upon by the enzyme) and
incubation for 30 minutes at room temperature. The results are
shown in FIG. 15C.
[0442] The anti-hC5a antibody did significantly, though not
completely, inhibit complement activity in a dose-dependent manner.
Taken together, the results described herein indicate that BNJ383
is not only a potent antagonist of C5a, but is also an
incomplete/partial antagonist of terminal complement complex
formation in vivo. Thus, the antibody and antibodies sharing its
properties are useful for treating a variety of
complement-associated disorders in which C5a-mediated inflammation
is the primary contributor to deleterious pathological effects and
TCC may play a less significant or even beneficial role in the
pathology.
[0443] While the present disclosure has been described with
reference to the specific embodiments thereof, it should be
understood by those skilled in the art that various changes may be
made and equivalents may be substituted without departing from the
true spirit and scope of the disclosure. In addition, many
modifications may be made to adapt a particular situation,
material, composition of matter, process, process step or steps, to
the objective, spirit and scope of the present disclosure. All such
modifications are intended to be within the scope of the
disclosure.
Sequence CWU 1
1
181174PRTHomo sapiens 1Thr Leu Gln Lys Lys Ile Glu Glu Ile Ala Ala
Lys Tyr Lys His Ser 1 5 10 15 Val Val Lys Lys Cys Cys Tyr Asp Gly
Ala Cys Val Asn Asn Asp Glu 20 25 30 Thr Cys Glu Gln Arg Ala Ala
Arg Ile Ser Leu Gly Pro Arg Cys Ile 35 40 45 Lys Ala Phe Thr Glu
Cys Cys Val Val Ala Ser Gln Leu Arg Ala Asn 50 55 60 Ile Ser His
Lys Asp Met Gln Leu Gly Arg 65 70 273PRTHomo sapiens 2Thr Leu Gln
Lys Lys Ile Glu Glu Ile Ala Ala Lys Tyr Lys His Ser 1 5 10 15 Val
Val Lys Lys Cys Cys Tyr Asp Gly Ala Cys Val Asn Asn Asp Glu 20 25
30 Thr Cys Glu Gln Arg Ala Ala Arg Ile Ser Leu Gly Pro Arg Cys Ile
35 40 45 Lys Ala Phe Thr Glu Cys Cys Val Val Ala Ser Gln Leu Arg
Ala Asn 50 55 60 Ile Ser His Lys Asp Met Gln Leu Gly 65 70
314PRTHomo sapiens 3Thr Leu Gln Lys Lys Ile Glu Glu Ile Ala Ala Lys
Tyr Lys 1 5 10 413PRTHomo sapiens 4His Ser Val Val Lys Lys Cys Cys
Tyr Asp Gly Ala Cys 1 5 10 55PRTHomo sapiens 5Val Asn Asn Asp Glu 1
5 68PRTHomo sapiens 6Thr Cys Glu Gln Arg Ala Ala Arg 1 5 74PRTHomo
sapiens 7Ile Ser Leu Gly 1 822PRTHomo sapiens 8Pro Arg Cys Ile Lys
Ala Phe Thr Glu Cys Cys Val Val Ala Ser Gln 1 5 10 15 Leu Arg Ala
Asn Ile Ser 20 97PRTHomo sapiens 9His Lys Asp Met Gln Leu Gly 1 5
108PRTHomo sapiens 10His Lys Asp Met Gln Leu Gly Arg 1 5
1114PRTHomo sapiens 11Cys Cys Tyr Asp Gly Ala Cys Val Asn Asn Asp
Glu Thr Cys 1 5 10 1233PRTHomo sapiens 12Cys Tyr Asp Gly Ala Cys
Val Asn Asn Asp Glu Thr Cys Glu Gln Arg 1 5 10 15 Ala Ala Arg Ile
Ser Leu Gly Pro Arg Cys Ile Lys Ala Phe Thr Glu 20 25 30 Cys
1322PRTHomo sapiens 13Cys Glu Gln Arg Ala Ala Arg Ile Ser Leu Gly
Pro Arg Cys Ile Lys 1 5 10 15 Ala Phe Thr Glu Cys Cys 20
1418PRTHomo sapiens 14Tyr Asp Gly Ala Cys Val Asn Asn Asp Glu Thr
Cys Glu Gln Arg Ala 1 5 10 15 Ala Arg 1518PRTHomo sapiens 15Cys Tyr
Asp Gly Ala Cys Val Asn Asn Asp Glu Thr Cys Glu Gln Arg 1 5 10 15
Ala Ala 16238PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 16Met Val Leu Gln Thr Gln Val Phe
Ile Ser Leu Leu Leu Trp Ile Ser 1 5 10 15 Gly Ala Tyr Gly Asp Ile
Val Met Thr Gln Ser Pro Asp Ser Leu Ala 20 25 30 Val Ser Leu Gly
Glu Arg Ala Thr Ile Asn Cys Arg Ala Ser Glu Ser 35 40 45 Val Asp
Ser Tyr Gly Asn Ser Phe Met His Trp Tyr Gln Gln Lys Pro 50 55 60
Gly Gln Pro Pro Lys Leu Leu Ile Tyr Arg Ala Ser Asn Leu Glu Ser 65
70 75 80 Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp
Phe Thr 85 90 95 Leu Thr Ile Ser Ser Leu Gln Ala Glu Asp Val Ala
Val Tyr Tyr Cys 100 105 110 Gln Gln Ser Asn Glu Asp Pro Tyr Thr Phe
Gly Gly Gly Thr Lys Val 115 120 125 Glu Ile Lys Arg Thr Val Ala Ala
Pro Ser Val Phe Ile Phe Pro Pro 130 135 140 Ser Asp Glu Gln Leu Lys
Ser Gly Thr Ala Ser Val Val Cys Leu Leu 145 150 155 160 Asn Asn Phe
Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn 165 170 175 Ala
Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser 180 185
190 Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala
195 200 205 Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His
Gln Gly 210 215 220 Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly
Glu Cys 225 230 235 17218PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 17Asp Ile Val Met Thr Gln
Ser Pro Asp Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Glu Arg Ala Thr
Ile Asn Cys Arg Ala Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn
Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45
Lys Leu Leu Ile Tyr Arg Ala Ser Asn Leu Glu Ser Gly Val Pro Asp 50
55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser 65 70 75 80 Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln
Gln Ser Asn 85 90 95 Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr Lys
Val Glu Ile Lys Arg 100 105 110 Thr Val Ala Ala Pro Ser Val Phe Ile
Phe Pro Pro Ser Asp Glu Gln 115 120 125 Leu Lys Ser Gly Thr Ala Ser
Val Val Cys Leu Leu Asn Asn Phe Tyr 130 135 140 Pro Arg Glu Ala Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser 145 150 155 160 Gly Asn
Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 165 170 175
Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 180
185 190 His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
Pro 195 200 205 Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215
1820PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 18Met Val Leu Gln Thr Gln Val Phe Ile Ser Leu Leu
Leu Trp Ile Ser 1 5 10 15 Gly Ala Tyr Gly 20 19112PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
19Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly 1
5 10 15 Glu Arg Ala Thr Ile Asn Cys Arg Ala Ser Glu Ser Val Asp Ser
Tyr 20 25 30 Gly Asn Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly
Gln Pro Pro 35 40 45 Lys Leu Leu Ile Tyr Arg Ala Ser Asn Leu Glu
Ser Gly Val Pro Asp 50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser 65 70 75 80 Ser Leu Gln Ala Glu Asp Val
Ala Val Tyr Tyr Cys Gln Gln Ser Asn 85 90 95 Glu Asp Pro Tyr Thr
Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg 100 105 110
2015PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 20Arg Ala Ser Glu Ser Val Asp Ser Tyr Gly Asn Ser
Phe Met His 1 5 10 15 217PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 21Arg Ala Ser Asn Leu Glu Ser
1 5 229PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 22Gln Gln Ser Asn Glu Asp Pro Tyr Thr 1 5
23106PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 23Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln 1 5 10 15 Leu Lys Ser Gly Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr 20 25 30 Pro Arg Glu Ala Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser 35 40 45 Gly Asn Ser Gln Glu
Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 50 55 60 Tyr Ser Leu
Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 65 70 75 80 His
Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro 85 90
95 Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 100 105
24466PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 24Met Asp Trp Thr Trp Arg Val Phe Cys Leu Leu
Ala Val Ala Pro Gly 1 5 10 15 Ala His Ser Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys 20 25 30 Pro Gly Ala Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Thr Phe 35 40 45 Thr Asp Tyr Ser Met
Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu 50 55 60 Glu Trp Met
Gly Ala Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr Asn 65 70 75 80 Gln
Lys Phe Lys Asp Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser 85 90
95 Thr Val Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
100 105 110 Tyr Tyr Cys Ala Arg Ser Gly Ser Tyr Asp Gly Tyr Tyr Ala
Met Asp 115 120 125 Tyr Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser
Ala Ser Thr Lys 130 135 140 Gly Pro Ser Val Phe Pro Leu Ala Pro Cys
Ser Arg Ser Thr Ser Glu 145 150 155 160 Ser Thr Ala Ala Leu Gly Cys
Leu Val Lys Asp Tyr Phe Pro Glu Pro 165 170 175 Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr 180 185 190 Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val 195 200 205 Val
Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn 210 215
220 Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg
225 230 235 240 Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro Pro
Val Ala Gly 245 250 255 Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile 260 265 270 Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu 275 280 285 Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 290 295 300 Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg 305 310 315 320 Val Val
Ser Val Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys 325 330 335
Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu 340
345 350 Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr 355 360 365 Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
Val Ser Leu 370 375 380 Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ser Val Glu Trp 385 390 395 400 Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Met 405 410 415 Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 420 425 430 Lys Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 435 440 445 Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 450 455 460
Gly Lys 465 25447PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 25Gln Val Gln Leu Val Gln Ser Gly
Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser Met Asp Trp
Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Ala
Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr Asn Gln Lys Phe 50 55 60
Lys Asp Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr 65
70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Arg Ser Gly Ser Tyr Asp Gly Tyr Tyr Ala Met
Asp Tyr Trp Gly 100 105 110 Gln Gly Thr Thr Val Thr Val Ser Ser Ala
Ser Thr Lys Gly Pro Ser 115 120 125 Val Phe Pro Leu Ala Pro Cys Ser
Arg Ser Thr Ser Glu Ser Thr Ala 130 135 140 Ala Leu Gly Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val 145 150 155 160 Ser Trp Asn
Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala 165 170 175 Val
Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val 180 185
190 Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His
195 200 205 Lys Pro Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg Lys
Cys Cys 210 215 220 Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala
Gly Pro Ser Val 225 230 235 240 Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr 245 250 255 Pro Glu Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu 260 265 270 Val Gln Phe Asn Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 275 280 285 Thr Lys Pro
Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser 290 295 300 Val
Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 305 310
315 320 Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr
Ile 325 330 335 Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro 340 345 350 Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu 355 360 365 Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ser Val Glu Trp Glu Ser Asn 370 375 380 Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Met Leu Asp Ser 385 390 395 400 Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 405 410 415 Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420 425 430
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440
445 2619PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 26Met Asp Trp Thr Trp Arg Val Phe Cys Leu Leu Ala
Val Ala Pro Gly 1 5 10 15 Ala His Ser 27121PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
27Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp
Tyr 20 25 30 Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45 Gly Ala Ile Asn Pro Asn Ser Gly Gly Thr Asn
Tyr Asn Gln Lys Phe 50 55 60 Lys Asp Arg Val Thr Met Thr Arg Asp
Thr Ser Thr Ser Thr Val Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Ser Gly Ser
Tyr Asp Gly Tyr Tyr Ala Met Asp Tyr Trp Gly 100 105 110 Gln Gly Thr
Thr Val Thr Val Ser Ser 115 120 285PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide
28Asp
Tyr Ser Met Asp 1 5 2917PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 29Ala Ile Asn Pro Asn Ser Gly
Gly Thr Asn Tyr Asn Gln Lys Phe Lys 1 5 10 15 Asp 3012PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 30Ser
Gly Ser Tyr Asp Gly Tyr Tyr Ala Met Asp Tyr 1 5 10
31326PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 31Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Cys Ser Arg 1 5 10 15 Ser Thr Ser Glu Ser Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30 Phe Pro Glu Pro Val Thr Val
Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45 Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60 Leu Ser Ser
Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr 65 70 75 80 Tyr
Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90
95 Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro
100 105 110 Pro Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp 115 120 125 Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val Val Val Asp 130 135 140 Val Ser His Glu Asp Pro Glu Val Gln Phe
Asn Trp Tyr Val Asp Gly 145 150 155 160 Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Phe Asn 165 170 175 Ser Thr Phe Arg Val
Val Ser Val Leu Thr Val Val His Gln Asp Trp 180 185 190 Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro 195 200 205 Ala
Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 210 215
220 Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn
225 230 235 240 Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile 245 250 255 Ser Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr 260 265 270 Thr Pro Pro Met Leu Asp Ser Asp Gly
Ser Phe Phe Leu Tyr Ser Lys 275 280 285 Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys 290 295 300 Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 305 310 315 320 Ser Leu
Ser Pro Gly Lys 325 32466PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 32Met Asp Trp Thr Trp Arg
Val Phe Cys Leu Leu Ala Val Ala Pro Gly 1 5 10 15 Ala His Ser Gln
Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys 20 25 30 Pro Gly
Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe 35 40 45
Thr Asp Tyr Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu 50
55 60 Glu Trp Met Gly Ala Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr
Asn 65 70 75 80 Gln Lys Phe Lys Asp Arg Val Thr Met Thr Arg Asp Thr
Ser Thr Ser 85 90 95 Thr Val Tyr Met Glu Leu Ser Ser Leu Arg Ser
Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Ser Gly Ser Tyr
Asp Gly Tyr Tyr Ala Met Asp 115 120 125 Tyr Trp Gly Gln Gly Thr Thr
Val Thr Val Ser Ser Ala Ser Thr Lys 130 135 140 Gly Pro Ser Val Phe
Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu 145 150 155 160 Ser Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro 165 170 175
Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr 180
185 190 Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser
Val 195 200 205 Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr
Thr Cys Asn 210 215 220 Val Asp His Lys Pro Ser Asn Thr Lys Val Asp
Lys Thr Val Glu Arg 225 230 235 240 Lys Cys Cys Val Glu Cys Pro Pro
Cys Pro Ala Pro Pro Val Ala Gly 245 250 255 Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 260 265 270 Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu 275 280 285 Asp Pro
Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 290 295 300
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg 305
310 315 320 Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys 325 330 335 Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro
Ser Ser Ile Glu 340 345 350 Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr 355 360 365 Thr Leu Pro Pro Ser Gln Glu Glu
Met Thr Lys Asn Gln Val Ser Leu 370 375 380 Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 385 390 395 400 Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val 405 410 415 Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp 420 425
430 Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His
435 440 445 Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Leu 450 455 460 Gly Lys 465 33447PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
33Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp
Tyr 20 25 30 Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45 Gly Ala Ile Asn Pro Asn Ser Gly Gly Thr Asn
Tyr Asn Gln Lys Phe 50 55 60 Lys Asp Arg Val Thr Met Thr Arg Asp
Thr Ser Thr Ser Thr Val Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Ser Gly Ser
Tyr Asp Gly Tyr Tyr Ala Met Asp Tyr Trp Gly 100 105 110 Gln Gly Thr
Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser 115 120 125 Val
Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala 130 135
140 Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val
145 150 155 160 Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr
Phe Pro Ala 165 170 175 Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser
Ser Val Val Thr Val 180 185 190 Pro Ser Ser Asn Phe Gly Thr Gln Thr
Tyr Thr Cys Asn Val Asp His 195 200 205 Lys Pro Ser Asn Thr Lys Val
Asp Lys Thr Val Glu Arg Lys Cys Cys 210 215 220 Val Glu Cys Pro Pro
Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val 225 230 235 240 Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 245 250 255
Pro Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp Pro Glu 260
265 270 Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys 275 280 285 Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg
Val Val Ser 290 295 300 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys 305 310 315 320 Cys Lys Val Ser Asn Lys Gly Leu
Pro Ser Ser Ile Glu Lys Thr Ile 325 330 335 Ser Lys Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 340 345 350 Pro Ser Gln Glu
Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 355 360 365 Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 370 375 380
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 385
390 395 400 Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys
Ser Arg 405 410 415 Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met
His Glu Ala Leu 420 425 430 His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Leu Gly Lys 435 440 445 34326PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
34Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg 1
5 10 15 Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp
Tyr 20 25 30 Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala
Leu Thr Ser 35 40 45 Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser 50 55 60 Leu Ser Ser Val Val Thr Val Pro Ser
Ser Asn Phe Gly Thr Gln Thr 65 70 75 80 Tyr Thr Cys Asn Val Asp His
Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95 Thr Val Glu Arg Lys
Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro 100 105 110 Pro Val Ala
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 115 120 125 Thr
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 130 135
140 Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly
145 150 155 160 Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Phe Asn 165 170 175 Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
Leu His Gln Asp Trp 180 185 190 Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys Gly Leu Pro 195 200 205 Ser Ser Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu 210 215 220 Pro Gln Val Tyr Thr
Leu Pro Pro Ser Gln Glu Glu Met Thr Lys Asn 225 230 235 240 Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 245 250 255
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 260
265 270 Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Arg 275 280 285 Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val
Phe Ser Cys 290 295 300 Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu 305 310 315 320 Ser Leu Ser Leu Gly Lys 325
35238PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 35Met Val Leu Gln Thr Gln Val Phe Ile Ser Leu
Leu Leu Trp Ile Ser 1 5 10 15 Gly Ala Tyr Gly Asp Ile Val Met Thr
Gln Ser Pro Asp Ser Leu Ala 20 25 30 Val Ser Leu Gly Glu Arg Ala
Thr Ile Asn Cys Arg Ala Ser Glu Ser 35 40 45 Val Asp Ser Tyr Gly
Asn Ser Phe Met His Trp Tyr Gln Gln Lys Pro 50 55 60 Gly Gln Pro
Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser 65 70 75 80 Gly
Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr 85 90
95 Leu Thr Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys
100 105 110 Gln Gln Ser Asn Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr
Lys Val 115 120 125 Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe
Ile Phe Pro Pro 130 135 140 Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala
Ser Val Val Cys Leu Leu 145 150 155 160 Asn Asn Phe Tyr Pro Arg Glu
Ala Lys Val Gln Trp Lys Val Asp Asn 165 170 175 Ala Leu Gln Ser Gly
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser 180 185 190 Lys Asp Ser
Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala 195 200 205 Asp
Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly 210 215
220 Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230
235 36218PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 36Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu
Ala Val Ser Leu Gly 1 5 10 15 Glu Arg Ala Thr Ile Asn Cys Arg Ala
Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn Ser Phe Met His Trp
Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile Tyr
Trp Ala Ser Thr Arg Glu Ser Gly Val Pro Asp 50 55 60 Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80 Ser
Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln Ser Asn 85 90
95 Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg
100 105 110 Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp
Glu Gln 115 120 125 Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu
Asn Asn Phe Tyr 130 135 140 Pro Arg Glu Ala Lys Val Gln Trp Lys Val
Asp Asn Ala Leu Gln Ser 145 150 155 160 Gly Asn Ser Gln Glu Ser Val
Thr Glu Gln Asp Ser Lys Asp Ser Thr 165 170 175 Tyr Ser Leu Ser Ser
Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 180 185 190 His Lys Val
Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro 195 200 205 Val
Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215 37112PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
37Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly 1
5 10 15 Glu Arg Ala Thr Ile Asn Cys Arg Ala Ser Glu Ser Val Asp Ser
Tyr 20 25 30 Gly Asn Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly
Gln Pro Pro 35 40 45 Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu
Ser Gly Val Pro Asp 50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser 65 70 75 80 Ser Leu Gln Ala Glu Asp Val
Ala Val Tyr Tyr Cys Gln Gln Ser Asn 85 90 95 Glu Asp Pro Tyr Thr
Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg 100 105 110
387PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 38Trp Ala Ser Thr Arg Glu Ser 1 5
39240PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 39Met Asp Met Arg Val Pro Ala Gln Leu
Leu Gly Leu Leu Leu Leu Trp 1 5 10 15 Leu Arg Gly Ala Arg Cys Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser 20 25 30 Leu Ser Ala Ser Val
Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser 35 40 45 Glu Ser Val
Asp Ser Tyr Gly Asn Ser Phe Met His Trp Tyr Gln Gln 50 55 60 Lys
Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Arg Ala Ser Asn Leu 65 70
75 80 Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp 85 90 95 Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe
Ala Thr Tyr 100 105 110 Tyr Cys Gln Gln Ser Asn Glu Asp Pro Tyr Thr
Phe Gly Gly Gly Thr 115 120 125 Lys Val Glu Ile Lys Arg Thr Val Ala
Ala Pro Ser Val Phe Ile Phe 130 135 140 Pro Pro Ser Asp Glu Gln Leu
Lys Ser Gly Thr Ala Ser Val Val Cys 145 150 155 160 Leu Leu Asn Asn
Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val 165 170 175 Asp Asn
Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln 180 185 190
Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser 195
200 205 Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr
His 210 215 220 Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg
Gly Glu Cys 225 230 235 240 40218PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 40Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val
Thr Ile Thr Cys Arg Ala Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly
Asn Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro 35 40
45 Lys Leu Leu Ile Tyr Arg Ala Ser Asn Leu Glu Ser Gly Val Pro Ser
50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser 65 70 75 80 Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ser Asn 85 90 95 Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr
Lys Val Glu Ile Lys Arg 100 105 110 Thr Val Ala Ala Pro Ser Val Phe
Ile Phe Pro Pro Ser Asp Glu Gln 115 120 125 Leu Lys Ser Gly Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe Tyr 130 135 140 Pro Arg Glu Ala
Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser 145 150 155 160 Gly
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 165 170
175 Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys
180 185 190 His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser
Ser Pro 195 200 205 Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215
4122PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 41Met Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu
Leu Leu Leu Trp 1 5 10 15 Leu Arg Gly Ala Arg Cys 20
42112PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 42Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn Ser Phe Met His Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro 35 40 45 Lys Leu Leu Ile Tyr
Arg Ala Ser Asn Leu Glu Ser Gly Val Pro Ser 50 55 60 Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80 Ser
Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Asn 85 90
95 Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg
100 105 110 43465PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 43Met Asp Trp Thr Trp Arg Val Phe
Cys Leu Leu Ala Val Ala Pro Gly 1 5 10 15 Ala His Ser Gln Val Gln
Leu Val Gln Ser Gly Ala Glu Val Lys Lys 20 25 30 Pro Gly Ala Ser
Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe 35 40 45 Thr Asp
Tyr Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu 50 55 60
Glu Trp Met Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn Tyr Asn 65
70 75 80 Gln Lys Phe Lys Gly Arg Val Thr Met Thr Arg Asp Thr Ser
Thr Ser 85 90 95 Thr Val Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu
Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Gly Phe Tyr Asp Gly
Tyr Ser Pro Met Asp Tyr 115 120 125 Trp Gly Gln Gly Thr Thr Val Thr
Val Ser Ser Ala Ser Thr Lys Gly 130 135 140 Pro Ser Val Phe Pro Leu
Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser 145 150 155 160 Thr Ala Ala
Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175 Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185
190 Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val
195 200 205 Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys
Asn Val 210 215 220 Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys Thr
Val Glu Arg Lys 225 230 235 240 Cys Cys Val Glu Cys Pro Pro Cys Pro
Ala Pro Pro Val Ala Gly Pro 245 250 255 Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser 260 265 270 Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp 275 280 285 Pro Glu Val
Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 290 295 300 Ala
Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val 305 310
315 320 Val Ser Val Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys
Glu 325 330 335 Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro
Ile Glu Lys 340 345 350 Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr 355 360 365 Leu Pro Pro Ser Arg Glu Glu Met Thr
Lys Asn Gln Val Ser Leu Thr 370 375 380 Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ser Val Glu Trp Glu 385 390 395 400 Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu 405 410 415 Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 420 425 430
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 435
440 445 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly 450 455 460 Lys 465 44446PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 44Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser Met
Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45
Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn Tyr Asn Gln Lys Phe 50
55 60 Lys Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val
Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Gly Phe Tyr Asp Gly Tyr Ser Pro Met
Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Val Thr Val Ser Ser Ala
Ser Thr Lys Gly Pro Ser Val 115 120 125 Phe Pro Leu Ala Pro Cys Ser
Arg Ser Thr Ser Glu Ser Thr Ala Ala 130 135 140 Leu Gly Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser 145 150 155 160 Trp Asn
Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175
Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180
185 190 Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His
Lys 195 200 205 Pro Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg Lys
Cys Cys Val 210 215 220 Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala
Gly Pro Ser Val Phe 225 230 235 240 Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro 245 250 255 Glu Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val 260 265 270 Gln Phe Asn Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 275 280 285 Lys Pro
Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val 290 295 300
Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys 305
310 315 320 Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser 325 330 335 Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro 340 345 350 Ser Arg Glu Glu Met Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val 355 360 365 Lys Gly Phe Tyr Pro Ser Asp Ile
Ser Val Glu Trp Glu Ser Asn Gly 370 375 380 Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Met Leu Asp Ser Asp 385 390 395 400 Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp 405 410 415 Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His 420 425
430 Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440
445 45120PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 45Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser Met Asp Trp Val Arg Gln
Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Ala Ile His Leu
Asn Thr Gly Tyr Thr Asn Tyr Asn Gln Lys Phe 50 55 60 Lys Gly Arg
Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr 65 70 75 80 Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Arg Gly Phe Tyr Asp Gly Tyr Ser Pro Met Asp Tyr Trp Gly Gln
100 105 110 Gly Thr Thr Val Thr Val Ser Ser 115 120
4617PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 46Ala Ile His Leu Asn Thr Gly Tyr Thr Asn Tyr Asn
Gln Lys Phe Lys 1 5 10 15 Gly 4711PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 47Gly Phe Tyr Asp Gly Tyr
Ser Pro Met Asp Tyr 1 5 10 48465PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 48Met Asp Trp Thr Trp
Arg Val Phe Cys Leu Leu Ala Val Ala Pro Gly 1 5 10 15 Ala His Ser
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys 20 25 30 Pro
Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe 35 40
45 Thr Asp Tyr Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
50 55 60 Glu Trp Met Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn
Tyr Asn 65 70 75 80 Gln Lys Phe Lys Gly Arg Val Thr Met Thr Arg Asp
Thr Ser Thr Ser 85 90 95 Thr Val Tyr Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Gly Phe Tyr
Asp Gly Tyr Ser Pro Met Asp Tyr 115 120 125 Trp Gly Gln Gly Thr Thr
Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140 Pro Ser Val Phe
Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser 145 150 155 160 Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170
175 Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
180 185 190 Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser
Val Val 195 200 205 Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr
Thr Cys Asn Val 210 215 220 Asp His Lys Pro Ser Asn Thr Lys Val Asp
Lys Thr Val Glu Arg Lys 225 230 235 240 Cys Cys Val Glu Cys Pro Pro
Cys Pro Ala Pro Pro Val Ala Gly Pro 245 250 255 Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 260 265 270 Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp 275 280 285 Pro
Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 290 295
300 Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val
305 310 315 320 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu 325 330 335 Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro
Ser Ser Ile Glu Lys 340 345 350 Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr 355 360 365 Leu Pro Pro Ser Gln Glu Glu
Met Thr Lys Asn Gln Val Ser Leu Thr 370 375 380 Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 385 390 395 400 Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 405 410 415
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys 420
425 430 Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His
Glu 435 440 445 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Leu Gly 450 455 460 Lys 465 49446PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
49Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp
Tyr 20 25 30 Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45 Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn
Tyr Asn Gln Lys Phe 50 55 60 Lys Gly Arg Val Thr Met Thr Arg Asp
Thr Ser Thr Ser
Thr Val Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Gly Phe Tyr Asp Gly Tyr Ser
Pro Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Val Thr Val Ser
Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125 Phe Pro Leu Ala Pro
Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala Ala 130 135 140 Leu Gly Cys
Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser 145 150 155 160
Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165
170 175 Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val
Pro 180 185 190 Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val
Asp His Lys 195 200 205 Pro Ser Asn Thr Lys Val Asp Lys Thr Val Glu
Arg Lys Cys Cys Val 210 215 220 Glu Cys Pro Pro Cys Pro Ala Pro Pro
Val Ala Gly Pro Ser Val Phe 225 230 235 240 Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro 245 250 255 Glu Val Thr Cys
Val Val Val Asp Val Ser Gln Glu Asp Pro Glu Val 260 265 270 Gln Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 275 280 285
Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val Val Ser Val 290
295 300 Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys 305 310 315 320 Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu
Lys Thr Ile Ser 325 330 335 Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro 340 345 350 Ser Gln Glu Glu Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val 355 360 365 Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly 370 375 380 Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp 385 390 395 400 Gly
Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg Trp 405 410
415 Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
420 425 430 Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys
435 440 445 508PRTArtificial SequenceDescription of Artificial
Sequence Synthetic Flag tag 50Asp Tyr Lys Asp Asp Asp Asp Lys 1 5
5173PRTMus sp. 51Leu Arg Gln Lys Ile Glu Glu Gln Ala Ala Lys Tyr
Lys His Ser Val 1 5 10 15 Pro Lys Lys Cys Cys Tyr Asp Gly Ala Arg
Val Asn Phe Tyr Glu Thr 20 25 30 Cys Glu Glu Arg Val Ala Arg Val
Thr Ile Gly Pro Leu Cys Ile Arg 35 40 45 Ala Phe Asn Glu Cys Cys
Thr Ile Ala Asn Lys Ile Arg Lys Glu Ser 50 55 60 Pro His Lys Pro
Val Gln Leu Gly Arg 65 70 5272PRTMus sp. 52Leu Arg Gln Lys Ile Glu
Glu Gln Ala Ala Lys Tyr Lys His Ser Val 1 5 10 15 Pro Lys Lys Cys
Cys Tyr Asp Gly Ala Arg Val Asn Phe Tyr Glu Thr 20 25 30 Cys Glu
Glu Arg Val Ala Arg Val Thr Ile Gly Pro Leu Cys Ile Arg 35 40 45
Ala Phe Asn Glu Cys Cys Thr Ile Ala Asn Lys Ile Arg Lys Glu Ser 50
55 60 Pro His Lys Pro Val Gln Leu Gly 65 70 53107PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
53Glu Ile Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Leu Gly 1
5 10 15 Glu Lys Val Thr Met Ser Cys Arg Ala Ser Ser Ser Val Asn Tyr
Ile 20 25 30 Tyr Trp Tyr Gln Gln Lys Ser Asp Ala Ser Pro Lys Leu
Trp Ile Tyr 35 40 45 Tyr Thr Ser Asn Leu Ala Pro Gly Val Pro Ala
Arg Phe Ser Gly Ser 50 55 60 Gly Ser Gly Asn Ser Tyr Ser Leu Thr
Ile Ser Ser Met Glu Gly Glu 65 70 75 80 Asp Ala Ala Thr Tyr Tyr Cys
Gln Gln Phe Thr Ser Ser Pro Leu Thr 85 90 95 Phe Gly Val Gly Thr
Lys Leu Glu Leu Lys Arg 100 105 5410PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 54Arg
Ala Ser Ser Ser Val Asn Tyr Ile Tyr 1 5 10 557PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 55Tyr
Thr Ser Asn Leu Ala Pro 1 5 569PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 56Gln Gln Phe Thr Ser Ser Pro
Leu Thr 1 5 57106PRTMus sp. 57Ala Asp Ala Ala Pro Thr Val Ser Ile
Phe Pro Pro Ser Ser Glu Gln 1 5 10 15 Leu Thr Ser Gly Gly Ala Ser
Val Val Cys Phe Leu Asn Asn Phe Tyr 20 25 30 Pro Lys Asp Ile Asn
Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln 35 40 45 Asn Gly Val
Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr 50 55 60 Tyr
Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg 65 70
75 80 His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser
Pro 85 90 95 Ile Val Lys Ser Phe Asn Arg Asn Glu Cys 100 105
5819PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 58Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala
Thr Ala Thr Gly 1 5 10 15 Val His Ser 59214PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
59Arg Glu Ile Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Leu 1
5 10 15 Gly Glu Lys Val Thr Met Ser Cys Arg Ala Ser Ser Ser Val Asn
Tyr 20 25 30 Ile Tyr Trp Tyr Gln Gln Lys Ser Asp Ala Ser Pro Lys
Leu Trp Ile 35 40 45 Tyr Tyr Thr Ser Asn Leu Ala Pro Gly Val Pro
Ala Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Asn Ser Tyr Ser Leu
Thr Ile Ser Ser Met Glu Gly 65 70 75 80 Glu Asp Ala Ala Thr Tyr Tyr
Cys Gln Gln Phe Thr Ser Ser Pro Leu 85 90 95 Thr Phe Gly Val Gly
Thr Lys Leu Glu Leu Lys Arg Ala Asp Ala Ala 100 105 110 Pro Thr Val
Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly 115 120 125 Gly
Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile 130 135
140 Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu
145 150 155 160 Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr
Ser Met Ser 165 170 175 Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu
Arg His Asn Ser Tyr 180 185 190 Thr Cys Glu Ala Thr His Lys Thr Ser
Thr Ser Pro Ile Val Lys Ser 195 200 205 Phe Asn Arg Asn Glu Cys 210
60233PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 60Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val
Ala Thr Ala Thr Gly 1 5 10 15 Val His Ser Arg Glu Ile Val Leu Thr
Gln Ser Pro Ala Ile Met Ser 20 25 30 Ala Ser Leu Gly Glu Lys Val
Thr Met Ser Cys Arg Ala Ser Ser Ser 35 40 45 Val Asn Tyr Ile Tyr
Trp Tyr Gln Gln Lys Ser Asp Ala Ser Pro Lys 50 55 60 Leu Trp Ile
Tyr Tyr Thr Ser Asn Leu Ala Pro Gly Val Pro Ala Arg 65 70 75 80 Phe
Ser Gly Ser Gly Ser Gly Asn Ser Tyr Ser Leu Thr Ile Ser Ser 85 90
95 Met Glu Gly Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Phe Thr Ser
100 105 110 Ser Pro Leu Thr Phe Gly Val Gly Thr Lys Leu Glu Leu Lys
Arg Ala 115 120 125 Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser
Ser Glu Gln Leu 130 135 140 Thr Ser Gly Gly Ala Ser Val Val Cys Phe
Leu Asn Asn Phe Tyr Pro 145 150 155 160 Lys Asp Ile Asn Val Lys Trp
Lys Ile Asp Gly Ser Glu Arg Gln Asn 165 170 175 Gly Val Leu Asn Ser
Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr 180 185 190 Ser Met Ser
Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His 195 200 205 Asn
Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile 210 215
220 Val Lys Ser Phe Asn Arg Asn Glu Cys 225 230 61121PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
61Leu Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly 1
5 10 15 Ala Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr
Asp 20 25 30 Tyr Tyr Tyr Ile Asn Trp Val Lys Gln Ser His Gly Lys
Ser Leu Glu 35 40 45 Trp Ile Gly Tyr Ile Tyr Pro Asn Asp Gly Asp
Thr Asn Tyr Asn Gln 50 55 60 Lys Phe Lys Gly Lys Ala Thr Leu Thr
Val Asp Lys Ser Ser Ser Thr 65 70 75 80 Ala Tyr Met Glu Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Pro
Tyr Tyr Ser Asp Tyr Gly Met Asp Tyr Trp Gly 100 105 110 Gln Gly Thr
Ser Val Thr Val Ser Ser 115 120 626PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 62Asp
Tyr Tyr Tyr Ile Asn 1 5 6317PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 63Tyr Ile Tyr Pro Asn Asp Gly
Asp Thr Asn Tyr Asn Gln Lys Phe Lys 1 5 10 15 Gly 6410PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 64Pro
Tyr Tyr Ser Asp Tyr Gly Met Asp Tyr 1 5 10 6519PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 65Met
Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly 1 5 10
15 Val His Ser 66121PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 66Leu Glu Val Gln Leu Gln Gln Ser
Gly Pro Glu Leu Val Lys Pro Gly 1 5 10 15 Ala Ser Val Lys Ile Ser
Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp 20 25 30 Tyr Tyr Tyr Ile
Asn Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu 35 40 45 Trp Ile
Gly Tyr Ile Tyr Pro Asn Asp Gly Asp Thr Asn Tyr Asn Gln 50 55 60
Lys Phe Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr 65
70 75 80 Ala Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala
Val Tyr 85 90 95 Tyr Cys Ala Arg Pro Tyr Tyr Ser Asp Tyr Gly Met
Asp Tyr Trp Gly 100 105 110 Gln Gly Thr Ser Val Thr Val Ser Ser 115
120 6717PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 67Ala Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr Ser
Gln Lys Phe Lys 1 5 10 15 Asp 6830PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 68Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr 20 25 30
6930PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 69Gln Val Gln Leu Val Gln Ser Gly Ser Glu Leu
Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr 20 25 30 7014PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 70Trp Val Arg Gln Ala Pro
Gly Gln Gly Leu Glu Trp Met Gly 1 5 10 7114PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 71Trp
Val Arg Gln Ala Ser Gly Lys Gly Leu Glu Trp Val Gly 1 5 10
7232PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 72Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser
Thr Ala Tyr Met Glu 1 5 10 15 Leu Ser Ser Leu Arg Ser Glu Asp Thr
Ala Val Tyr Tyr Cys Ala Arg 20 25 30 7332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
73Arg Val Thr Ile Thr Ala Asp Glu Ser Thr Ser Thr Ala Tyr Met Glu 1
5 10 15 Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala
Arg 20 25 30 7432PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 74Arg Val Thr Ile Thr Arg Asp Arg
Ser Met Ser Thr Ala Tyr Met Glu 1 5 10 15 Leu Ser Ser Leu Arg Ser
Glu Asp Thr Ala Met Tyr Tyr Cys Ala Arg 20 25 30 7511PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 75Trp
Gly Gln Gly Thr Thr Val Thr Val Ser Ser 1 5 10 76120PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
76Gln Val Gln Leu Val Gln Ser Gly Ser Glu Leu Lys Lys Pro Gly Ala 1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp
Tyr 20 25 30 Ser Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45 Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn
Tyr Asn Gln Lys Phe 50 55 60 Lys Gly Arg Val Thr Ile Thr Ala Asp
Glu Ser Thr Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Gly Phe Tyr
Asp Gly Tyr Ser Pro Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr
Val Thr Val Ser Ser 115 120 77120PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 77Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser
Met Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Val 35 40
45 Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn Tyr Asn Gln Lys Phe
50 55 60 Lys Gly Arg Val Thr Ile Thr Ala Asp Glu Ser Thr Ser Thr
Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Ala Arg Gly Phe Tyr Asp Gly Tyr Ser Pro
Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Val Thr Val Ser Ser
115 120 78120PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 78Gln Val Gln Leu Val Gln Ser Gly
Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15
Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20
25 30 Ser Met Asp Trp Val Arg Gln Ala Ser Gly Lys Gly Leu Glu Trp
Met 35 40 45 Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn Tyr Asn
Gln Lys Phe 50 55 60 Lys Gly Arg Val Thr Ile Thr Ala Asp Glu Ser
Thr Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Gly Phe Tyr Asp Gly
Tyr Ser Pro Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Val Thr
Val Ser Ser 115 120 79120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 79Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser Met
Asp Trp Val Arg Gln Ala Ser Gly Lys Gly Leu Glu Trp Met 35 40 45
Gly Ala Ile His Leu Asn Thr Gly Tyr Thr Asn Tyr Asn Gln Lys Phe 50
55 60 Lys Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val
Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Gly Phe Tyr Asp Gly Tyr Ser Pro Met
Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Val Thr Val Ser Ser 115
120 80121PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 80Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser Met Asp Trp Val Arg Gln
Ala Pro Gly Gln Gly Leu Glu Trp Val 35 40 45 Gly Ala Ile Asn Pro
Asn Ser Gly Gly Thr Asn Tyr Ser Gln Lys Phe 50 55 60 Lys Asp Arg
Val Thr Ile Thr Ala Asp Glu Ser Thr Ser Thr Ala Tyr 65 70 75 80 Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Arg Ser Gly Ser Tyr Asp Gly Tyr Tyr Ala Met Asp Tyr Trp Gly
100 105 110 Gln Gly Thr Thr Val Thr Val Ser Ser 115 120
816PRTArtificial SequenceDescription of Artificial Sequence
Synthetic 6xHis tag 81His His His His His His 1 5 829PRTArtificial
SequenceDescription of Artificial Sequence Synthetic HA tag 82Tyr
Pro Tyr Asp Val Pro Asp Tyr Ala 1 5 83108PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
83Asp Ile Val Met Thr Gln Ser Gln Lys Phe Met Ser Thr Ser Val Gly 1
5 10 15 Asp Arg Val Ser Val Thr Cys Lys Ala Ser Gln Asn Val Gly Thr
Asn 20 25 30 Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys
Ala Leu Ile 35 40 45 Tyr Ser Ala Ser Tyr Arg Tyr Ser Gly Val Pro
Asp Arg Phe Thr Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu
Thr Ile Ser Asn Val Gln Ser 65 70 75 80 Glu Asp Leu Ala Glu Tyr Phe
Cys Gln Gln Tyr Asn Ser Tyr Pro Phe 85 90 95 Thr Phe Gly Ser Gly
Thr Lys Leu Glu Ile Lys Arg 100 105 8411PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 84Lys
Ala Ser Gln Asn Val Gly Thr Asn Val Ala 1 5 10 857PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 85Ser
Ala Ser Tyr Arg Tyr Ser 1 5 869PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 86Gln Gln Tyr Asn Ser Tyr Pro
Phe Thr 1 5 87107PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 87Glu Ile Val Leu Thr Gln Ser Pro
Ala Ile Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr
Cys Ser Ala Ser Ser Ser Val Ser Tyr Met 20 25 30 His Trp Tyr Gln
Gln Lys Ser Gly Thr Ser Pro Lys Arg Trp Ile Tyr 35 40 45 Asp Thr
Ser Lys Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser 50 55 60
Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu Ala Glu 65
70 75 80 Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Ser Asn Pro
Leu Thr 85 90 95 Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg 100
105 8810PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 88Ser Ala Ser Ser Ser Val Ser Tyr Met His 1 5 10
897PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 89Asp Thr Ser Lys Leu Ala Ser 1 5
909PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 90Gln Gln Trp Ser Ser Asn Pro Leu Thr 1 5
91107PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 91Gln Ile Val Leu Thr Gln Ser Pro Ala Ile Met
Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr Cys Ser Ala
Ser Ser Ser Ile Ser Tyr Met 20 25 30 His Trp Tyr Gln Gln Lys Pro
Gly Thr Ser Pro Lys Arg Trp Ile Tyr 35 40 45 Asp Thr Ser Lys Leu
Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser 50 55 60 Gly Ser Gly
Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu Ala Glu 65 70 75 80 Asp
Ala Ala Thr Tyr Tyr Cys His Gln Arg Ser Ser Tyr Pro Trp Thr 85 90
95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105
9210PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 92Ser Ala Ser Ser Ser Ile Ser Tyr Met His 1 5 10
939PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 93His Gln Arg Ser Ser Tyr Pro Trp Thr 1 5
94109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 94Gln Ile Val Leu Thr Gln Ser Pro Ala Ile Met
Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Leu Thr Cys Ser Ala
Ser Ser Ser Val Ser Ser Ser 20 25 30 Tyr Leu Tyr Trp Tyr Gln Gln
Lys Pro Gly Ser Ser Pro Lys Leu Trp 35 40 45 Ile Tyr Ser Thr Ser
Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser 50 55 60 Gly Ser Gly
Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Thr Val Glu 65 70 75 80 Ala
Glu Asp Ala Ala Ser Tyr Phe Cys His Gln Trp Ser Ser Tyr Pro 85 90
95 Pro Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105
9512PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 95Ser Ala Ser Ser Ser Val Ser Ser Ser Tyr Leu Tyr
1 5 10 967PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 96Ser Thr Ser Asn Leu Ala Ser 1 5
979PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 97His Gln Trp Ser Ser Tyr Pro Pro Thr 1 5
98108PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 98Asp Ile Gln Met Thr Gln Ser Pro Ala Pro Met
Leu Val Ser Val Gly 1 5 10 15 Glu Thr Val Thr Ile Thr Cys Arg Gly
Ser Glu Asn Ile Tyr Ser Asn 20 25 30 Leu Ala Trp Tyr Gln Gln Lys
Gln Gly Lys Ser Pro Gln Leu Leu Val 35 40 45 Tyr Ala Ala Thr Asn
Leu Ala Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser
Gly Thr Gln Tyr Ser Leu Lys Ile Asn Ser Leu Gln Ser 65 70 75 80 Glu
Asp Phe Gly Ser Tyr Tyr Cys Gln His Phe Trp Gly Thr Pro Arg 85 90
95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105
9911PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 99Arg Gly Ser Glu Asn Ile Tyr Ser Asn Leu Ala 1 5
10 1007PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 100Ala Ala Thr Asn Leu Ala Asp 1 5
1019PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 101Gln His Phe Trp Gly Thr Pro Arg Thr 1 5
102108PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 102Asp Ile Val Met Thr Gln Ser Gln Lys Phe
Met Ser Thr Ser Val Gly 1 5 10 15 Asp Arg Val Ser Val Thr Cys Lys
Ala Ser Gln Asn Val Gly Thr Asn 20 25 30 Val Ala Trp Tyr Gln Gln
Lys Pro Gly Gln Ser Pro Lys Ala Leu Ile 35 40 45 Tyr Ser Ala Ser
Tyr Arg Tyr Ser Gly Val Pro Asp Arg Phe Thr Gly 50 55 60 Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Val Gln Ser 65 70 75 80
Glu Asp Leu Ala Glu Tyr Phe Cys Gln Gln Tyr Asn Ser Tyr Pro Trp 85
90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105
1039PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 103Gln Gln Tyr Asn Ser Tyr Pro Trp Thr 1 5
104107PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 104Gln Ile Val Leu Thr Gln Ser Pro Val Ile
Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr Cys Ser
Ala Ser Ser Ser Val Ser Tyr Met 20 25 30 Tyr Trp Tyr Gln Gln Lys
Pro Gly Ser Ser Pro Arg Leu Leu Ile Tyr 35 40 45 Asp Thr Ser Asn
Leu Ala Ser Gly Val Pro Val Arg Phe Ser Gly Ser 50 55 60 Gly Ser
Gly Thr Ser Tyr Ser Leu Thr Ile Ser Arg Met Glu Ala Glu 65 70 75 80
Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Ser Tyr Pro Pro Thr 85
90 95 Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg 100 105
10510PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 105Ser Ala Ser Ser Ser Val Ser Tyr Met Tyr 1 5 10
1067PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 106Asp Thr Ser Asn Leu Ala Ser 1 5
1079PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 107Gln Gln Trp Ser Ser Tyr Pro Pro Thr 1 5
1089PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 108His Gln Arg Arg Ser Tyr Pro Trp Thr 1 5
109112PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 109Asp Ile Val Leu Thr Gln Ser Pro Ala Ser
Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg
Ala Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn Ser Phe Met His
Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile
Tyr Leu Ala Ser Asn Leu Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe
Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr Leu Thr Ile Asp 65 70 75 80
Pro Val Glu Ala Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Asn Asn 85
90 95 Glu Asp Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
Arg 100 105 110 1107PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 110Leu Ala Ser Asn Leu Glu Ser 1 5
1119PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 111Gln Gln Asn Asn Glu Asp Pro Leu Thr 1 5
112112PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 112Asp Ile Val Leu Thr Gln Ser Pro Ala Ser
Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg
Ala Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn Ser Phe Met His
Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile
Tyr Arg Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala 50 55 60 Arg Phe
Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr Leu Thr Ile Asn 65 70 75 80
Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys Gln Gln Ser Asn 85
90 95 Glu Asp Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
Arg 100 105 110 1139PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 113Gln Gln Ser Asn Glu Asp Pro Leu Thr 1
5 114115PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 114Glu Val Gln Leu Gln Gln Ser Gly Pro Glu
Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Ile Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Ser Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val
Lys Lys Ser His Gly Lys Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile
Phe Pro Lys Thr Gly Gly Thr Asn Tyr Ser Gln Arg 50 55 60 Phe Lys
Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80
Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85
90 95 Cys Ala Ser Gly Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val
Thr 100 105 110 Val Ser Ala 115 1156PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 115Asp
Tyr Tyr Tyr Met Asn 1 5 11617PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 116Tyr Ile Phe Pro Lys Thr
Gly Gly Thr Asn Tyr Ser Gln Arg Phe Lys 1 5 10 15 Gly
1175PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 117Gly Pro Phe Ala Tyr 1 5 118118PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
118Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly
1 5 10 15 Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser
Ser Tyr 20 25 30 Tyr Met Ala Trp Val Arg Gln Thr Pro Asp Lys Arg
Leu Glu Trp Val 35 40 45 Ala Thr Ile Ser Ser Gly Gly Ser Tyr Thr
Tyr Tyr Pro Asp Asn Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Ser Ser Leu
Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95 Thr Arg Tyr Tyr
Glu Asp Asp Ala Met Asp Tyr Trp Gly Gln Gly Thr 100 105 110 Ser Val
Thr Val Ser Ser 115 1195PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 119Ser Tyr Tyr Met Ala 1 5
12017PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 120Thr Ile Ser Ser Gly Gly Ser Tyr Thr Tyr Tyr
Pro Asp Asn Val Lys 1
5 10 15 Gly 1219PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 121Tyr Tyr Glu Asp Asp Ala Met Asp Tyr 1
5 122115PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 122Glu Val Gln Leu Gln Gln Ser Gly Pro Glu
Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Ile Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Ser Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val
Lys Lys Ser His Gly Lys Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile
Phe Pro Lys Thr Gly Gly Thr Asn Tyr Asn Gln Arg 50 55 60 Phe Lys
Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80
Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85
90 95 Cys Ala Ser Gly Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val
Thr 100 105 110 Val Ser Ala 115 12317PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 123Tyr
Ile Phe Pro Lys Thr Gly Gly Thr Asn Tyr Asn Gln Arg Phe Lys 1 5 10
15 Gly 12417PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 124Tyr Ile Phe Pro Asn Thr Gly Gly Thr
Thr Tyr Asn Gln Arg Phe Lys 1 5 10 15 Gly 125118PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
125Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly
1 5 10 15 Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Ser
Ser Tyr 20 25 30 Tyr Met Ala Trp Val Arg Gln Thr Pro Asp Lys Arg
Leu Glu Trp Val 35 40 45 Ala Thr Ile Ser Ser Gly Gly Ser Tyr Thr
Tyr Tyr Arg Asp Asn Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Ser Ser Leu
Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95 Thr Arg Tyr Phe
Glu Asp Tyr Pro Met Asp Tyr Trp Gly Gln Gly Thr 100 105 110 Ser Val
Thr Val Ser Ser 115 12617PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 126Thr Ile Ser Ser Gly Gly
Ser Tyr Thr Tyr Tyr Arg Asp Asn Val Lys 1 5 10 15 Gly
1279PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 127Tyr Phe Glu Asp Tyr Pro Met Asp Tyr 1 5
128115PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 128Glu Val Gln Leu Gln Gln Ser Gly Pro Glu
Leu Gly Lys Pro Gly Ala 1 5 10 15 Ser Gly Lys Ile Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val
Lys Gln Ser His Gly Lys Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile
Phe Pro Asn Thr Gly Gly Thr Ser Tyr Asn Gln Arg 50 55 60 Phe Lys
Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80
Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85
90 95 Cys Ala Ser Gly Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val
Thr 100 105 110 Val Ser Ala 115 12917PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 129Tyr
Ile Phe Pro Asn Thr Gly Gly Thr Ser Tyr Asn Gln Arg Phe Lys 1 5 10
15 Asp 130119PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 130Glu Val Gln Leu Gln Gln Pro Gly
Ser Val Leu Val Arg Pro Gly Ala 1 5 10 15 Thr Val Lys Leu Ser Cys
Lys Ala Ser Gly Phe Thr Phe Thr Ser Ser 20 25 30 Trp Met His Trp
Ala Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Glu
Ile His Thr Ser Gly His Thr Asn Tyr Asn Glu Lys Phe Lys 50 55 60
Gly Lys Ala Thr Leu Thr Leu Asp Thr Ser Ser Ser Thr Ala Tyr Val 65
70 75 80 Asp Ile Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr
Cys Ala 85 90 95 Arg Gly Gly Leu Arg Arg Gly Tyr Ala Met Asp Tyr
Trp Gly Gln Gly 100 105 110 Thr Ser Val Thr Val Ser Ser 115
1315PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 131Ser Ser Trp Met His 1 5 13216PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 132Glu
Ile His Thr Ser Gly His Thr Asn Tyr Asn Glu Lys Phe Lys Gly 1 5 10
15 13311PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 133Gly Gly Leu Arg Arg Gly Tyr Ala Met Asp Tyr 1
5 10 134120PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 134Glu Val Gln Pro Gln Gln Ser Gly Pro Glu
Leu Val Lys Pro Gly Ser 1 5 10 15 Ser Val Lys Ile Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser Met Asp Trp Val Lys
Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45 Gly Ala Ile His
Leu Asn Thr Gly Tyr Thr Asn Tyr Asn Gln Lys Phe 50 55 60 Lys Gly
Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80
Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95 Ala Arg Gly Phe Tyr Asp Gly Tyr Ser Pro Met Asp Tyr Trp Gly
Gln 100 105 110 Gly Thr Ser Val Thr Val Ser Ser 115 120
135120PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 135Glu Val Gln Leu Gln Gln Ser Gly Ala Glu
Leu Val Lys Pro Gly Thr 1 5 10 15 Ser Val Lys Leu Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Trp Met His Trp Val Lys
Gln Arg Pro Gly Gln Gly Leu Glu Tyr Ile 35 40 45 Gly Glu Ile His
Pro Ser Ser Gly His Thr Asn Tyr His Glu Lys Phe 50 55 60 Lys Ser
Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80
Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95 Ala Arg Ala Ser Leu Leu Arg Ala Tyr Ala Met Asp Tyr Trp Gly
Gln 100 105 110 Gly Thr Ser Val Thr Val Ser Ser 115 120
1365PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 136Ser Tyr Trp Met His 1 5 13717PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 137Glu
Ile His Pro Ser Ser Gly His Thr Asn Tyr His Glu Lys Phe Lys 1 5 10
15 Ser 13811PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 138Ala Ser Leu Leu Arg Ala Tyr Ala Met
Asp Tyr 1 5 10 139109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 139Glu Ile Val Leu Thr
Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val
Thr Met Thr Cys Arg Ala Ser Ser Ser Val Ser Ser Ser 20 25 30 Tyr
Leu His Trp Tyr Gln Gln Lys Ser Gly Ala Ser Pro Lys Leu Trp 35 40
45 Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser
50 55 60 Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser
Val Glu 65 70 75 80 Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Tyr
Ser Gly Tyr Pro 85 90 95 Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu
Leu Lys Arg 100 105 14012PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 140Arg Ala Ser Ser Ser Val
Ser Ser Ser Tyr Leu His 1 5 10 141107PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
141Gln Ile Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly
1 5 10 15 Glu Lys Val Thr Met Thr Cys Ser Ala Ser Ser Ser Ile Ser
Tyr Met 20 25 30 His Trp Tyr Gln Gln Lys Pro Gly Thr Ser Pro Lys
Arg Trp Ile Tyr 35 40 45 Asp Thr Ser Lys Leu Ala Ser Gly Val Pro
Ala Arg Phe Ser Gly Ser 50 55 60 Gly Ser Gly Thr Ser Tyr Ser Leu
Thr Ile Ser Ser Met Glu Ala Glu 65 70 75 80 Asp Ala Ala Thr Tyr Tyr
Cys His Gln Arg Arg Ser Tyr Pro Trp Thr 85 90 95 Phe Gly Gly Gly
Thr Lys Leu Glu Ile Lys Arg 100 105 1429PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 142Gln
Gln Tyr Ser Gly Tyr Pro Leu Thr 1 5 143115PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
143Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala
1 5 10 15 Ser Val Arg Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser
Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val Lys Lys Ser His Gly Lys
Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile Phe Pro Lys Thr Gly Gly
Thr His Tyr Asn Gln Arg 50 55 60 Phe Lys Gly Lys Ala Thr Leu Thr
Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80 Tyr Met Glu Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85 90 95 Cys Ala Ser Gly
Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val Thr 100 105 110 Val Ser
Ala 115 14417PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 144Tyr Ile Phe Pro Lys Thr Gly Gly Thr
His Tyr Asn Gln Arg Phe Lys 1 5 10 15 Gly 145115PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
145Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala
1 5 10 15 Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr
Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val Lys Gln Ser His Gly Lys
Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile Phe Pro Asn Thr Gly Gly
Thr Thr Tyr Asn Gln Arg 50 55 60 Phe Lys Gly Lys Ala Thr Leu Thr
Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80 Tyr Met Glu Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85 90 95 Cys Ala Ser Gly
Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val Thr 100 105 110 Val Ser
Ala 115 146107PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 146Glu Ile Val Leu Thr Gln Ser Pro
Ala Ile Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr
Cys Ser Ala Ser Ser Ser Val Ser Tyr Met 20 25 30 Tyr Trp Tyr Gln
Gln Lys Pro Gly Ser Ser Pro Arg Leu Leu Ile Tyr 35 40 45 Asp Thr
Ser Asn Leu Ala Ser Gly Val Pro Val Arg Phe Ser Gly Ser 50 55 60
Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Arg Met Glu Ala Glu 65
70 75 80 Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Ser Tyr Pro
Pro Thr 85 90 95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100
105 147115PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 147Glu Val Gln Leu Gln Gln Ser Gly Pro Glu
Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Arg Ile Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Asn Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val
Lys Gln Ser His Gly Lys Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile
Phe Pro Lys Thr Gly Gly Thr His Tyr Asn Gln Arg 50 55 60 Phe Lys
Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80
Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85
90 95 Cys Ala Ser Gly Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val
Thr 100 105 110 Val Ser Ala 115 148107PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
148Glu Ile Val Leu Thr Gln Ser Pro Val Ile Met Ser Ala Ser Pro Gly
1 5 10 15 Glu Lys Val Thr Met Ile Cys Ser Ala Ser Ser Ser Ile Ser
Tyr Met 20 25 30 His Trp Tyr Gln Gln Lys Pro Gly Thr Ser Pro Lys
Arg Trp Ile Tyr 35 40 45 Asp Thr Ser Lys Leu Ala Ser Gly Val Pro
Ala Arg Phe Ser Gly Ser 50 55 60 Gly Ser Gly Thr Ser Tyr Ser Leu
Thr Ile Ser Ile Met Glu Ala Glu 65 70 75 80 Asp Ala Ala Thr Tyr Tyr
Cys His Gln Arg Ser Ser Tyr Pro Trp Thr 85 90 95 Phe Gly Gly Gly
Thr Lys Leu Glu Ile Lys Arg 100 105 149115PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
149Glu Val Gln Met Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala
1 5 10 15 Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser
Asp Tyr 20 25 30 Tyr Tyr Met Asn Trp Val Lys Lys Ser His Gly Lys
Ser Leu Glu Trp 35 40 45 Ile Gly Tyr Ile Phe Pro Lys Thr Gly Gly
Thr Asn Tyr Asn Gln Arg 50 55 60 Phe Lys Gly Lys Ala Thr Leu Thr
Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80 Tyr Met Glu Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85 90 95 Cys Ala Ser Gly
Pro Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val Thr 100 105 110 Val Ser
Ala 115 150109PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 150Glu Ile Val Leu Thr Gln Ser Pro
Ala Ile Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Leu Thr
Cys Ser Ala Ser Ser Ser Val Ser Ser Ser 20 25 30 Tyr Leu Tyr Trp
Tyr Gln Gln Lys Pro Gly Ser Ser Pro Lys Leu Trp 35 40 45 Ile Tyr
Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser 50 55 60
Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu 65
70 75 80 Ala Glu Asp Ala Ala Ser Tyr Phe Cys His Gln Trp Ser Ser
Tyr Pro 85 90 95 Pro Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
Arg 100 105 151109PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 151Glu Ile Val Leu Thr Gln Ser Pro
Ala Ile Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr
Cys Arg Ala Ser Ser Ser Val Ser Ser Ser 20 25 30
Tyr Leu His Trp Tyr Gln Gln Lys Ser Gly Ala Ser Pro Lys Leu Trp 35
40 45 Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe
Ser 50 55 60 Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser
Ser Val Glu 65 70 75 80 Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln
Tyr Ser Gly Tyr Pro 85 90 95 Leu Thr Phe Gly Gly Gly Thr Lys Leu
Glu Ile Lys Arg 100 105 152115PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 152Glu Val Arg Leu Gln
Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Arg
Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Asn Asp Tyr 20 25 30 Tyr
Tyr Met Asn Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp 35 40
45 Ile Gly Tyr Ile Phe Pro Lys Thr Gly Gly Thr His Tyr Asn Gln Arg
50 55 60 Phe Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser
Thr Ala 65 70 75 80 Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser
Ala Val Tyr Tyr 85 90 95 Cys Ala Ser Gly Pro Phe Ala Tyr Trp Gly
Gln Gly Thr Leu Val Thr 100 105 110 Val Ser Ala 115
153112PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 153Asp Ile Val Met Thr Gln Ser Pro Ala Ser
Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg
Ala Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn Ser Phe Met His
Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile
Tyr Arg Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala 50 55 60 Arg Phe
Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr Leu Thr Ile Asn 65 70 75 80
Pro Val Glu Ala Asp Asp Val Ala Thr Tyr Tyr Cys Gln Gln Ser Asn 85
90 95 Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
Arg 100 105 110 154121PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 154Glu Val Gln Leu Gln
Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ser 1 5 10 15 Ser Val Lys
Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Ser
Met Asp Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40
45 Gly Ala Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr Ser Gln Lys Phe
50 55 60 Lys Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr
Ala Tyr 65 70 75 80 Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala
Val Tyr Tyr Cys 85 90 95 Ala Ser Ser Gly Ser Tyr Asp Gly Tyr Tyr
Ala Met Asp Tyr Trp Gly 100 105 110 Gln Gly Thr Ser Val Thr Val Ser
Ser 115 120 155108PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 155Asp Ile Gln Met Thr Gln Ser Pro
Ala Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Glu Thr Val Thr Ile Thr
Cys Arg Ala Ser Glu Asn Ile Tyr Ser Tyr 20 25 30 Leu Ala Trp Tyr
Gln Gln Lys Gln Gly Lys Ser Pro Gln Leu Leu Val 35 40 45 Tyr Asn
Ala Lys Thr Leu Ala Glu Gly Val Pro Ser Arg Phe Ser Gly 50 55 60
Ser Gly Ser Gly Thr Gln Phe Ser Leu Lys Ile Asn Ser Leu Gln Pro 65
70 75 80 Glu Asp Phe Gly Ser Tyr Tyr Cys Gln His His Tyr Gly Thr
Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg
100 105 15611PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 156Arg Ala Ser Glu Asn Ile Tyr Ser Tyr
Leu Ala 1 5 10 1577PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 157Asn Ala Lys Thr Leu Ala Glu 1 5
1589PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 158Gln His His Tyr Gly Thr Pro Tyr Thr 1 5
159122PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 159Glu Val Gln Leu Gln Gln Pro Gly Ala Glu
Ile Val Arg Pro Gly Ala 1 5 10 15 Ser Val Lys Leu Ser Cys Arg Ala
Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Trp Met Asn Trp Val Lys
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Thr Ile Asp
Pro Ser Asp Ser Tyr Thr Ile Tyr Asn Gln Lys Phe 50 55 60 Lys Gly
Lys Ala Thr Leu Thr Val Asp Thr Ser Ser Thr Thr Ala Tyr 65 70 75 80
Ile Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys 85
90 95 Ala Arg Gly Glu Asp Tyr Asp Val Ser Ser Tyr Thr Met Asp Tyr
Trp 100 105 110 Gly Gln Gly Thr Ser Val Thr Val Ser Ser 115 120
1605PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 160Asp Tyr Trp Met Asn 1 5 16117PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 161Thr
Ile Asp Pro Ser Asp Ser Tyr Thr Ile Tyr Asn Gln Lys Phe Lys 1 5 10
15 Gly 16213PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 162Gly Glu Asp Tyr Asp Val Ser Ser Tyr
Thr Met Asp Tyr 1 5 10 163112PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 163Glu Ile Val Leu Thr
Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala
Thr Ile Ser Cys Ser Ala Ser Glu Ser Val Glu Tyr Phe 20 25 30 Gly
Thr Ser Leu Met Gln Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40
45 Lys Leu Leu Ile Tyr Ala Ala Ser Asn Val Glu Ser Gly Val Pro Ala
50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Ser Leu Asn
Ile His 65 70 75 80 Pro Val Glu Glu Asp Asp Ile Ala Met Tyr Phe Cys
Gln Gln Ser Arg 85 90 95 Lys Val Pro Trp Thr Phe Gly Gly Gly Thr
Lys Leu Glu Ile Lys Arg 100 105 110 16415PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 164Ser
Ala Ser Glu Ser Val Glu Tyr Phe Gly Thr Ser Leu Met Gln 1 5 10 15
1657PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 165Ala Ala Ser Asn Val Glu Ser 1 5
1669PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 166Gln Gln Ser Arg Lys Val Pro Trp Thr 1 5
167119PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 167Glu Val Lys Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Arg Lys Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Asp Tyr 20 25 30 Gly Met Val Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Phe Ile Ser
Ser Gly Ser Ser Asn Ile Tyr Tyr Ala Asp Thr Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Pro Lys Asn Thr Leu Phe 65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ser Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95 Gly Arg Ala Phe Ser Phe Tyr Tyr Gly Tyr Asp Tyr Trp Gly Gln
Gly 100 105 110 Thr Thr Leu Thr Val Ser Ser 115 1685PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 168Asp
Tyr Gly Met Val 1 5 16917PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 169Phe Ile Ser Ser Gly Ser
Ser Asn Ile Tyr Tyr Ala Asp Thr Val Lys 1 5 10 15 Gly
17010PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 170Ala Phe Ser Phe Tyr Tyr Gly Tyr Asp Tyr 1 5 10
171113PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 171Asp Val Val Met Thr Gln Thr Pro Leu Ser
Leu Pro Val Ser Leu Gly 1 5 10 15 Asp Gln Ala Ser Ile Ser Cys Arg
Ser Ser Gln Ser Leu Val His Ser 20 25 30 Asn Gly Asn Thr Tyr Leu
His Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45 Pro Lys Leu Leu
Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60 Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gln Ser 85
90 95 Thr His Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu
Lys 100 105 110 Arg 17216PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 172Arg Ser Ser Gln Ser Leu
Val His Ser Asn Gly Asn Thr Tyr Leu His 1 5 10 15 1737PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 173Lys
Val Ser Asn Arg Phe Ser 1 5 1749PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 174Ser Gln Ser Thr His Val
Pro Leu Thr 1 5 175126PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 175Glu Val Gln Leu Gln
Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Arg
Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Leu
Ile His Trp Val Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45 Gly Tyr Ile Tyr Pro Phe Asn Asp Gly Thr Lys Asn Asn Glu Asn Phe
50 55 60 Lys Gly Lys Ala Thr Leu Thr Ser Asp Lys Ser Ser Ser Thr
Val Tyr 65 70 75 80 Met Glu Val Ser Ser Leu Thr Ser Glu Asp Ser Ala
Val Tyr Tyr Cys 85 90 95 Ala Arg Ser His Gly Pro His Tyr Tyr Gly
Gly Ser Tyr Gly Tyr His 100 105 110 Phe Asp Tyr Trp Gly Gln Gly Thr
Thr Leu Thr Val Ser Ser 115 120 125 1765PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 176Ser
Tyr Leu Ile His 1 5 17717PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 177Tyr Ile Tyr Pro Phe Asn
Asp Gly Thr Lys Asn Asn Glu Asn Phe Lys 1 5 10 15 Gly
17817PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 178Ser His Gly Pro His Tyr Tyr Gly Gly Ser Tyr
Gly Tyr His Phe Asp 1 5 10 15 Tyr 17974PRTMacaca sp. 179Met Leu Gln
Glu Lys Ile Glu Glu Ile Ala Ala Lys Tyr Lys His Leu 1 5 10 15 Val
Val Lys Lys Cys Cys Tyr Asp Gly Val Arg Ile Asn His Asp Glu 20 25
30 Thr Cys Glu Gln Arg Ala Ala Arg Ile Ser Val Gly Pro Arg Cys Val
35 40 45 Lys Ala Phe Thr Glu Cys Cys Val Val Ala Ser Gln Leu Arg
Ala Asn 50 55 60 Asn Ser His Lys Asp Leu Gln Leu Gly Arg 65 70
18073PRTMacaca sp. 180Met Leu Gln Glu Lys Ile Glu Glu Ile Ala Ala
Lys Tyr Lys His Leu 1 5 10 15 Val Val Lys Lys Cys Cys Tyr Asp Gly
Val Arg Ile Asn His Asp Glu 20 25 30 Thr Cys Glu Gln Arg Ala Ala
Arg Ile Ser Val Gly Pro Arg Cys Val 35 40 45 Lys Ala Phe Thr Glu
Cys Cys Val Val Ala Ser Gln Leu Arg Ala Asn 50 55 60 Asn Ser His
Lys Asp Leu Gln Leu Gly 65 70 181140PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
181Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly
1 5 10 15 Val His Ser Leu Glu Val Gln Leu Gln Gln Ser Gly Pro Glu
Leu Val 20 25 30 Lys Pro Gly Ala Ser Val Lys Ile Ser Cys Lys Ala
Ser Gly Tyr Thr 35 40 45 Phe Thr Asp Tyr Tyr Tyr Ile Asn Trp Val
Lys Gln Ser His Gly Lys 50 55 60 Ser Leu Glu Trp Ile Gly Tyr Ile
Tyr Pro Asn Asp Gly Asp Thr Asn 65 70 75 80 Tyr Asn Gln Lys Phe Lys
Gly Lys Ala Thr Leu Thr Val Asp Lys Ser 85 90 95 Ser Ser Thr Ala
Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser 100 105 110 Ala Val
Tyr Tyr Cys Ala Arg Pro Tyr Tyr Ser Asp Tyr Gly Met Asp 115 120 125
Tyr Trp Gly Gln Gly Thr Ser Val Thr Val Ser Ser 130 135 140
* * * * *