U.S. patent application number 14/997991 was filed with the patent office on 2016-07-21 for antibodies and chimeric antigen receptors specific for ror1.
This patent application is currently assigned to Juno Therapeutics, Inc.. The applicant listed for this patent is Juno Therapeutics, Inc.. Invention is credited to Yan Chen, Jul Dutta-Simmons, Csaba Pazmany, Steve Shamah.
Application Number | 20160208018 14/997991 |
Document ID | / |
Family ID | 55272713 |
Filed Date | 2016-07-21 |
United States Patent
Application |
20160208018 |
Kind Code |
A1 |
Chen; Yan ; et al. |
July 21, 2016 |
ANTIBODIES AND CHIMERIC ANTIGEN RECEPTORS SPECIFIC FOR ROR1
Abstract
Provided are ROR1 binding molecules, including anti-ROR1
antibodies, including antibody fragments such as variable heavy
chain (VH) regions, single-chain fragments, and chimeric receptors
including the antibodies, such as chimeric antigen receptors
(CARs). In some embodiments, the antibodies specifically bind to
ROR1. Among the antibodies are human antibodies, including those
that compete for binding to ROR1 with reference antibodies, such as
a non-human reference antibody. Also provided are genetically
engineered cells expressing the chimeric receptors, and uses of the
binding molecules and cells adoptive cell therapy.
Inventors: |
Chen; Yan; (Lexington,
MA) ; Shamah; Steve; (Acton, MA) ; Pazmany;
Csaba; (Belmont, MA) ; Dutta-Simmons; Jul;
(Framingham, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Juno Therapeutics, Inc. |
Seattle |
WA |
US |
|
|
Assignee: |
Juno Therapeutics, Inc.
Seattle
WA
|
Family ID: |
55272713 |
Appl. No.: |
14/997991 |
Filed: |
January 18, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62104664 |
Jan 16, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/21 20130101;
A61P 35/00 20180101; C07K 2317/92 20130101; C07K 16/40 20130101;
C07K 2319/30 20130101; C07K 14/71 20130101; C07K 14/70596 20130101;
A61P 35/02 20180101; A61P 43/00 20180101; C07K 16/2803 20130101;
A61K 39/395 20130101 |
International
Class: |
C07K 16/40 20060101
C07K016/40; C07K 14/71 20060101 C07K014/71; C07K 14/705 20060101
C07K014/705 |
Claims
1. An antibody or antigen-binding fragment thereof, said antibody
or antigen-binding fragment comprising a heavy chain variable
(V.sub.H) region comprising: a heavy chain complementarity
determining region 3 (CDR-H3) comprising the amino acid sequence
set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174;
or a CDR-H3 contained within the heavy chain variable (V.sub.H)
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189,
190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202,
203, 204, 205, 206, 207, 208 or 209.
2. An antibody or antigen-binding fragment thereof, said antibody
or antigen-binding fragment comprising a heavy chain variable
(V.sub.H) region comprising at least 90% sequence identity to the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 8, 10,
13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184,
185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197,
198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or 209.
3. The antibody or antigen-binding fragment thereof of claim 2,
said antibody or antigen-binding fragment comprising a heavy chain
variable (V.sub.H) region comprising at least 90% sequence identity
to the V.sub.H region amino acid sequence set forth in SEQ ID NO:
8, 10, 13, 15, 17, or 19.
4. The antibody or fragment of claim 2 or claim 3, wherein the
V.sub.H region comprises a heavy chain complementarity determining
region 3 (CDR-H3) comprising the amino acid sequence set forth in
SEQ ID NO: 92, 93, 94, 109 or 110.
5. The antibody or fragment of any of claims 2-4, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 3 (CDR-H3) comprising the amino acid sequence set forth in
SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59,
60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174; or a CDR-H3
contained within the V.sub.H sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209.
6. The antibody or fragment of any of claims 2-5, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 3 (CDR-H3) comprising the amino acid sequence set forth in
SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59,
60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70 or 71; or a CDR-H3
contained within the V.sub.H sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, or 19.
7. The antibody or fragment of any of claims 2-6, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 3 (CDR-H3) comprising the amino acid sequence set forth in
SEQ ID NO: 22, 29, 35 or 52; or a CDR-H3 contained within the
V.sub.H sequence set forth in SEQ ID NO: 10, 13, 15 or 19.
8. The antibody or fragment of claim 2 or claim 3, wherein the
V.sub.H region comprises a CDR-H3 comprising the amino acid
sequence set forth in SEQ ID NO: 72 or a CDR-H3 contained within
the V.sub.H sequence set forth in SEQ ID NO: 85.
9. The antibody or fragment of any of claims 1-8, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 1 (CDR-H1) comprising the amino acid sequence set forth in
SEQ ID NO:95 or 97; and/or a heavy chain complementarity
determining region 2 (CDR-H2) comprising the amino acid sequence
set forth in SEQ ID NO: 96 or 98.
10. The antibody or fragment of any of claims 1-9, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 1 (CDR-H1) comprising the amino acid sequence set forth in
SEQ ID NO: 20, 27, 33, 155, 156, 157, 158, 159, 160, 161, 162 or
163 and/or comprising the amino acid sequence set forth in SEQ ID
NO: 269, 270, 271, 272, 273, 274, 275, 276, 278 or 279 and/or
comprising the amino acid sequence set forth in SEQ ID NO: 75, 77,
79, 280, 281, 282, 283, 284, 285, 286, 287, 288 or 289 and/or a
CDR-H1 contained within the V.sub.H sequence set forth in SEQ ID
NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182,
183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195,
196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209; and/or a heavy chain complementarity determining region 2
(CDR-H2) comprising the amino acid sequence set forth in SEQ ID NO:
21, 26, 28, 34, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173 or
318, and/or comprising the amino acid sequence set forth in SEQ ID
NO: 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302 or
303 and/or comprising the amino acid sequence set forth in SEQ ID
NO: 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316
or 317 and/or a CDR-H2 contained within the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205,
206, 207, 208 or 209.
11. The antibody or fragment of any of claims 1-10, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 1 (CDR-H1) comprising the amino acid sequence set forth in
SEQ ID NO: 20, 27, or 33 and/or a CDR-H1 contained within the
V.sub.H sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19;
and/or a heavy chain complementarity determining region 2 (CDR-H2)
comprising the amino acid sequence set forth in SEQ ID NO: 21, 26,
28, or 34 and/or a CDR-H2 contained within the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
12. The antibody or fragment of any of claims 1-11, wherein the
V.sub.H region comprises: a heavy chain complementarity determining
region 1 (CDR-H1) comprising the amino acid sequence set forth in
SEQ ID NO: 20, 27, or 33 and/or a CDR-H1 contained within the
V.sub.H sequence set forth in SEQ ID NO: 10, 13, 15 or 19; and/or a
heavy chain complementarity determining region 2 (CDR-H2)
comprising the amino acid sequence set forth in SEQ ID NO: 26, 28,
or 34 and/or a CDR-H2 contained within the V.sub.H sequence set
forth in SEQ ID NO: 10, 13, 15 or 19.
13. An antibody or antigen-binding fragment thereof, comprising a
heavy chain variable (V.sub.H) region comprising a heavy chain
complementarity determining region 1 (CDR-H1), CDR-H2, and CDR-H3,
wherein: the CDR-H1 comprises the amino acid sequence set forth in
SEQ ID NO: 20, 27, 33, 75, 77, 79, 155, 156, 157, 158, 159, 160,
161, 162, 163, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278 or
279; the CDR-H2 comprises the amino acid sequence set forth in SEQ
ID NO: 21, 26. 28. 34, 80, 81, 82, 83, 164, 165, 166, 167, 168,
169, 170, 171, 172, 173, 291, 292, 293, 294, 295, 296, 297, 298,
299, 300, 301, 302, 303 or 318; and/or the CDR-H3 comprises the
amino acid sequence set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51,
52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68,
69, 70, 71 or 174.
14. The antibody or antigen-binding fragment of claim 11, wherein:
the CDR-H1 comprises the amino acid sequence set forth in SEQ ID
NO: 20, 27, or 33; the CDR-H2 comprises the amino acid sequence set
forth in SEQ ID NO: 21, 26, 28, or 34; and/or the CDR-H3 comprises
the amino acid sequence set forth in SEQ ID NO: 22, 29, 35, 45, 50,
51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67,
68, 69, 70 or 71.
15. The antibody or fragment of any of claims 1, 4-7 and 9-14,
wherein the CDR-H3 comprises the amino acid sequence VSNYEYYFDY
(SEQ ID NO: 29), DFGRWGYYFDY (SEQ ID NO: 52), DFGRWSYYFDY (SEQ ID
NO:35) or DSSYDAFDI (SEQ ID NO:22).
16. The antibody or fragment of any of claims 1-7 and 9-15,
comprising a heavy chain variable (V.sub.H) region comprising a
heavy chain complementarity determining region 1 (CDR-H1), CDR-H2,
and CDR-H3, wherein: the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 20, 21, and 22, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 20, 26,
and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 27, 28, and 29, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 33, 34,
and 35, respectively; or the CDR-H1, CDR-H2, and CDR-H3 comprise
the sequences of SEQ ID NOs: 33, 34, and 52, respectively; the
CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs:
27, 164 and 45, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 27, 164 and 68, respectively;
the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID
NOs: 27, 164 and 64, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 27, 164 and 66, respectively;
the CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs:
33, 318, and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 33, 34 and 70, respectively;
the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID
NOs: 33, 34 and 55, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 33, 34 and 53, respectively;
the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID
NOs: 33, 34 and 56, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 33, 34 and 61, respectively;
the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID
NOs: 33, 34 and 59, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 33, 171 and 60, respectively;
the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID
NOs: 155, 34 and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 156, 34 and 35, respectively;
the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ ID
NOs: 162, 170 and 50, respectively; the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 162, 170 and 51,
respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences
of SEQ ID NOs: 161, 169 and 54, respectively; the CDR-H1, CDR-H2,
and CDR-H3 comprise the sequences of SEQ ID NOs:159, 167 and 57,
respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences
of SEQ ID NOs: 160, 168 and 58, respectively; the CDR-H1, CDR-H2,
and CDR-H3 comprise the sequences of SEQ ID NOs: 158, 166 and 62,
respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences
of SEQ ID NOs: 158, 166 and 63, respectively; the CDR-H1, CDR-H2,
and CDR-H3 comprise the sequences of SEQ ID NOs: 158, 166 and 65,
respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences
of SEQ ID NOs: 157, 165 and 67, respectively; the CDR-H1, CDR-H2,
and CDR-H3 comprise the sequences of SEQ ID NOs: 163, 173 and 69,
respectively; or the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 160, 172, 71, respectively; or the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 160, 172,
174, respectively.
17. The antibody or fragment of any of claims 1-7 and 9-16,
comprising a heavy chain variable (V.sub.H) region comprising a
heavy chain complementarity determining region 1 (CDR-H1), CDR-H2,
and CDR-H3, wherein: the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 20, 21, and 22, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 20, 26,
and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 27, 28, and 29, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 33, 34,
and 35, respectively; or the CDR-H1, CDR-H2, and CDR-H3 comprise
the sequences of SEQ ID NOs: 33, 34, and 52, respectively.
18. An antibody or antigen-binding fragment thereof, comprising a
heavy chain variable (VH) region comprising a heavy chain
complementarity determining region 1 (CDR-H1), a CDR-H2, and a
CDR-H3, respectively, comprising the amino acid sequences of a
CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region
amino acid sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19,
175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187,
188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200,
201, 202, 203, 204, 205, 206, 207, 208 or 209.
19. The antibody or antigen-binding fragment of claim 18, wherein
the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the amino
acid sequences of a CDR-H1, a CDR-H2, and a CDR-H3 contained within
the V.sub.H region amino acid sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, or 19.
20. The antibody or fragment of any of claims 1-19, wherein the
V.sub.H region comprises a framework region 1 (FR1), a FR2, a FR3,
and/or a FR4 comprising at least 90% sequence identity,
respectively, to a FR1, FR2, FR3, and/or FR4 of the amino acid
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189,
190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202,
203, 204, 205, 206, 207, 208 or 209.
21. The antibody or fragment of any of claims 1-20, wherein the
V.sub.H region comprises a framework region 1 (FR1), a FR2, a FR3,
and/or a FR4 comprising at least 90% sequence identity,
respectively, to a FR1, FR2, FR3, and/or FR4 of the amino acid
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17 or 19.
22. The antibody or fragment of any of claims 1-7 and 9-21, wherein
the V.sub.H region comprises the sequence of amino acids set forth
in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180,
181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193,
194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,
207, 208 or 209.
23. The antibody or fragment of any of claims 1-7 and 9-22, wherein
the V.sub.H region comprises the sequence of amino acids set forth
in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
24. The antibody or fragment of claim 23, wherein the V.sub.H
region comprises the sequence of amino acids set forth in SEQ ID
NO: 8 or 10.
25. The antibody or fragment of any of claims 1-7 and 9-24, wherein
the V.sub.H region comprises the CDR-H1, CDR-H2, and CDR-H3 set
forth in SEQ ID NOS: 20, 26, and 22, respectively, or set forth in
SEQ ID NOS: 269, 294 or 22, respectively, and/or the V.sub.H region
comprises the sequence of amino acids set forth in SEQ ID NO:
19.
26. The antibody or fragment of any of claims 1-7 and 9-24, wherein
the V.sub.H region comprises the CDR-H1, CDR-H2, and CDR-H3 set
forth in SEQ ID NOS: 33, 34, and 52, respectively, or set forth in
SEQ ID NOS: 271, 291 and 52, respectively, and/or the V.sub.H
region comprises the sequence of amino acids set forth in SEQ ID
NO: 10.
27. The antibody or fragment of any of claims 1-7 and 9-24, wherein
the V.sub.H region comprises the CDR-H1, CDR-H2, and CDR-H3 set
forth in SEQ ID NOS: 33, 34, and 35, respectively, or set forth in
SEQ ID NOS: 271, 291 and 35, respectively, and/or the V.sub.H
region comprises the sequence of amino acids set forth in SEQ ID
NO: 13.
28. The antibody or fragment of any of claims 1-7 and 9-24, wherein
the V.sub.H region comprises the CDR-H1, CDR-H2, and CDR-H3 set
forth in SEQ ID NOS: 27, 28, and 29, respectively, or set forth in
SEQ ID NOS: 279, 292 and 29, respectively, and/or the V.sub.H
region comprises the sequence of amino acids set forth in SEQ ID
NO: 15.
29. The antibody or fragment of any of claims 1-28, wherein the
antibody or fragment does not comprise a light chain variable (VL)
region, does not comprise a CDR-L1, CDR-L2, and/or CDR-L3, and/or
is a single-domain antibody (sdAb) comprising only the V.sub.H
region.
30. The antibody or fragment of any of claims 1-29 that is a sdAb
comprising only the V.sub.H region.
31. The antibody or fragment of any of claims 1-28, wherein the
antibody or fragment further comprises a light chain variable (VL)
region.
32. The antibody or fragment of claim 31, wherein the V.sub.L
region comprises at least 90% sequence identity to the V.sub.L
region amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234,
235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or
248.
33. The antibody or fragment of claim 31 or claim 32, wherein the
V.sub.L region comprises at least 90% sequence identity to the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18.
34. The antibody of fragment of any of claims 31-33, wherein the
V.sub.L region comprises a light chain complementarity determining
region 3 (CDR-L3) comprising the amino acid sequence set forth in
SEQ ID NO: 99 or 100.
35. The antibody or fragment of any of claims 31-34, wherein the
V.sub.L region comprises a light chain complementarity determining
region 3 (CDR-L3) comprising the amino acid sequence set forth in
SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49, 232
or 233.
36. The antibody or fragment of any of claims 31-35, wherein the
V.sub.L region comprises a light chain complementarity determining
region 3 (CDR-L3) comprising the amino acid sequence set forth in
SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47, 48 or
49.
37. The antibody or fragment of any of claims 31-36, wherein the
V.sub.L region comprises a light chain complementarity determining
region 1 (CDR-L1) comprising the amino acid sequence set forth in
SEQ ID NO: 101 and/or a light chain complementarity determining
region 2 (CDR-L2) comprising the amino acid sequence set forth in
SEQ ID NO: 102.
38. The antibody or fragment of any of claims 31-38, wherein the
V.sub.L region comprises: a light chain complementarity determining
region 1 (CDR-L1) comprising the amino acid sequence set forth in
SEQ ID NO: 23, 30, 36, 210, 211, 212, 213, 214, 215, 217, 216, 218,
219 or 220 and/or a CDR-L1 contained within the V.sub.L sequence
set forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239,
240, 241, 242, 243, 244, 245, 246, 247 or 248; and/or a light chain
complementarity determining region 2 (CDR-L2) comprising the amino
acid sequence set forth in SEQ ID NO: 24, 31, 37, 221, 222, 223,
224, 225, 226, 227, 228, 229, 230 or 231 and/or a CDR-L2 contained
within the V.sub.L sequence set forth in SEQ ID NO: 14, 16, 18,
234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246,
247 or 248.
39. The antibody or fragment of any of claims 31-38, wherein the
V.sub.L region comprises: a light chain complementarity determining
region 1 (CDR-L1) comprising the amino acid sequence set forth in
SEQ ID NO: 23, 30, or 36 and/or a CDR-L1 contained within the
V.sub.L sequence set forth in SEQ ID NO: 14, 16, or 18; and/or a
light chain complementarity determining region 2 (CDR-L2)
comprising the amino acid sequence set forth in SEQ ID NO: 24, 31,
or 37 and/or a CDR-L2 contained within the V.sub.L sequence set
forth in SEQ ID NO: 14, 16, or 18.
40. The antibody or fragment of any of claims 31-39, wherein the
V.sub.L region comprises: a light chain complementarity determining
region 1 (CDR-L1) comprising the amino acid sequence set forth in
SEQ ID NO: 23, 30, 36, 210, 211, 212, 213, 214, 215, 217, 216, 218,
219 or 220; a light chain complementarity determining region 2
(CDR-L2), comprising the amino acid sequence set forth in SEQ ID
NO: 24, 31, 37, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230 or
231; and a light chain complementarity determining region 3
(CDR-L3) comprising the amino acid sequence set forth in SEQ ID NO:
25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49, 232 or 233.
41. The antibody or fragment of any of claims 31-40, wherein the
V.sub.L region comprises: a light chain complementarity determining
region 1 (CDR-L1) comprising the amino acid sequence set forth in
SEQ ID NO: 23, 30, or 36; a light chain complementarity determining
region 2 (CDR-L2), comprising the amino acid sequence set forth in
SEQ ID NO: 24, 31, or 37; and a light chain complementarity
determining region 3 (CDR-L3) comprising the amino acid sequence
set forth in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47,
48, or 49.
42. The antibody or fragment of any of claims 36-41, wherein the
CDR-L3 comprises the amino acid sequence set forth in SEQ ID NO:
25, 32 or 38.
43. The antibody or fragment of any of claims 31-42, wherein the
V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 selected
from: the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 23, 24, and 25, respectively; the CDR-L1, CDR-L2, and
CDR-L3 comprising the sequences of SEQ ID NOs: 30, 31, and 32,
respectively; the CDR-L1, CDR-L2, and CDR-L3 comprising the
sequences of SEQ ID NOs: 36, 37, and 38, respectively; the CDR-L1,
CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs: 216, 227,
and 40, respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 218, 229, and 39, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
219, 230, and 43, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 220, 231, and 46,
respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 210, 221, and 49, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
210, 221, and 233, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 211, 222, and 48,
respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 212, 223, and 42, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
214, 225, and 232, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 215, 226, and 44,
respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 217, 228, and 41, respectively; or the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
213, 224, and 47, respectively.
44. The antibody or fragment of any of claims 31-43, wherein the
V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 selected
from: the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 23, 24, and 25, respectively; the CDR-L1, CDR-L2, and
CDR-L3 comprising the sequences of SEQ ID NOs: 30, 31, and 32,
respectively; or the CDR-L1, CDR-L2, and CDR-L3 comprising the
sequences of SEQ ID NOs: 36, 37, and 38, respectively.
45. The antibody or fragment of any of claims 31-44, wherein the
V.sub.L region comprises light chain complementarity determining
region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively, contained
within the V.sub.L region amino acid sequence set forth in SEQ ID
NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243,
244, 245, 246, 247 or 248.
46. The antibody or fragment of any of claims 31-45, wherein the
V.sub.L region comprises light chain complementarity determining
region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively, contained
within the V.sub.L region amino acid sequence set forth in SEQ ID
NO: 14, 16, or 18.
47. The antibody or fragment of any of claims 31-46, wherein the
V.sub.L region comprises a framework region 1 (FR1), a FR2, a FR3,
and/or a FR4 comprising at least 90% sequence identity,
respectively, to the FR1, FR2, FR3, and/or FR4 of the amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18.
48. The antibody or fragment of any of claims 31-47, wherein the
V.sub.L region comprises the amino acid sequence set forth in SEQ
ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242,
243, 244, 245, 246, 247 or 248.
49. The antibody or fragment of any of claims 31-48, wherein the
V.sub.L region comprises the amino acid sequence set forth in SEQ
ID NO: 14, 16, or 18.
50. An antibody or antigen-binding fragment thereof, comprising: a
heavy chain complementarity determining regions 1, 2, and 3
(CDR-H1, CDR-H2, and CDR-H3), respectively comprising the amino
acid sequences of CDR-H1, CDR-H2, and CDR-H3 sequences contained
within the V.sub.H region amino acid sequence set forth in SEQ ID
NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182,
183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195,
196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209; and/or a light chain complementarity determining regions 1, 2,
and 3 (CDR-L1, CDR-L2, and CDR-L3), respectively comprising the
amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 sequences
contained within the light chain variable (VL) region amino acid
sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237,
238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or 248.
51. The antibody or antigen-binding fragment of claim 50, wherein:
the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the amino
acid sequences of CDR-H1, CDR-H2, and CDR-H3 sequences contained
within the V.sub.H region amino acid sequence set forth in SEQ ID
NO: 8, 10, 13, 15, 17, or 19; and/or the CDR-L1, CDR-L2, and
CDR-L3, respectively, comprise the amino acid sequences of CDR-L1,
CDR-L2, and CDR-L3 sequences contained within the light chain
variable (VL) region amino acid sequence set forth in SEQ ID NO:
14, 16, or 18.
52. An antibody or antigen-binding fragment thereof, comprising: a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 19 and 18, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 17 and 18, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 15 and 16, respectively; or a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 13 and 14, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 182 and 242 respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 182 and 246, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 182 and 247, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 185 and 248, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 186 and 248, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 175 and 234, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 175 and 235, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 176 and 236, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 176 and 237, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 177 and 238, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 179 and 240 respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 180 and 241, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 181 and 241, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 183 and 243 respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 183 and 244 respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 184 and 243, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 184 and 244 respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 183 and 245, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90% identity to SEQ ID NOs: 184 and 245, respectively; or
a V.sub.H and V.sub.L regions comprising amino acid sequences
having at least 90% identity to SEQ ID NOs: 178 and 239,
respectively.
53. The antibody or antigen-binding fragment of claim 52,
comprising: a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 19 and 18,
respectively; a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 17 and 18,
respectively; a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 15 and 16,
respectively; or a V.sub.H and V.sub.L regions comprising amino
acid sequences having at least 90% identity to SEQ ID NOs: 13 and
14, respectively.
54. The antibody or fragment of claim 52 or claim 53, wherein: the
V.sub.H and V.sub.L regions comprise the amino acid sequences of
SEQ ID NOs: 19 and 18, respectively; the V.sub.H and V.sub.L
regions comprise the amino acid sequences of SEQ ID NOs: 17 and 18,
respectively; the V.sub.H and V.sub.L regions comprise the amino
acid sequences of SEQ ID NOs: 15 and 16 respectively; or the
V.sub.H and V.sub.L regions comprise the amino acid sequences of
SEQ ID NOs: 13 and 14 respectively.
55. The antibody or fragment of any of claims 1-54, wherein said
antibody or fragment specifically binds to a ROR1 protein.
56. The antibody or fragment of claim 55, wherein the ROR1 protein
is a human ROR1 protein.
57. The antibody or fragment of claim 55, wherein the ROR1 protein
is a mouse ROR1 protein.
58. The antibody or fragment of any of claims 1-57, wherein: said
antibody or fragment has a binding affinity for a ROR1 protein with
an EC50 that is from or from about 0.1 nM to 100 nM, 0.5 nM to 50
nM or 1 nM to 10 nM; or said antibody or fragment has a binding
affinity for a ROR1 protein with an EC50 that is less than or less
than about 100 nM, less than or less than about 50 nM, less than or
less than about 10 nM or less than or less than about 1 nM.
59. The antibody or fragment of any of claims 1-58, wherein said
antibody or fragment has a binding affinity for a human ROR1
protein that is at least as high or substantially as high as the
binding affinity for the ROR1 protein of the corresponding form of
the anti-ROR1 antibody R12 or antigen-binding fragment thereof,
which is optionally an scFv fragment of R12.
60. The antibody or fragment of any of claims 1-59, wherein said
antibody or fragment specifically binds to the same or an
overlapping epitope of a human ROR1 protein as the epitope
specifically bound by the anti-ROR1 antibody R12 or an
antigen-binding fragment thereof, which is optionally an scFv
fragment of R12.
61. The antibody or fragment of any of claims 1-60, wherein said
antibody or fragment competes for binding to a human ROR1 protein
with anti-ROR1 antibody R12 or an antigen-binding fragment thereof,
which is optionally an scFv fragment of R12.
62. The antibody or fragment of any of claims 1-61, wherein said
antibody or fragment inhibits the binding of the anti-ROR1 antibody
R12 or an antigen-binding fragment thereof, which is optionally an
scFv fragment of R12, to a human ROR1 protein by greater than or
greater than about 80% or greater than or greater than about
90%.
63. The antibody or fragment of any of claims 1-62, wherein the
antibody or fragment binds to an overlapping epitope of a human
ROR1 protein as the epitope specifically bound by the anti-ROR1
antibody R12 or an antigen-binding fragment thereof, which is
optionally an scFv fragment of R12 and the antibody or fragment
binds to mouse ROR1.
64. The antibody or antigen-binding fragment of any of claims 55,
56 and 58-63, wherein said human ROR1 protein comprises an amino
acid sequence set forth in SEQ ID NO: 103.
65. The antibody or antigen-binding fragment of any of claims 55,
56 and 58-64, which binds an epitope within an extracellular
portion of the ROR1 protein; and/or binds to an epitope of said
ROR1 protein comprising residues within the fz domain or the Ig
domain of the ROR1 protein.
66. The antibody or antigen-binding fragment of claim 65, wherein
the epitope comprises a residue within the fz domain of the ROR1
protein and a residue within the Ig domain of the ROR1 protein.
67. The antibody or antigen-binding fragment thereof of claim 65 or
claim 66, wherein said Ig domain comprises residues 13-118 of the
amino acid sequence set forth in SEQ ID NO: 103; and/or said fz
domain comprises residues 136-270 of the amino acid sequence set
forth in SEQ ID NO:103.
68. The antibody or antigen binding fragment of claim 65, wherein
the extracellular portion comprises amino acids 1-377 of SEQ ID
NO:103.
69. The antibody or fragment thereof of any of claims 1-56, 58-62
and 64-68, wherein the antibody does not specifically bind to a
mouse ROR1 protein or does not specifically bind to a protein
having the amino acid sequence set forth in SEQ ID NO: 106.
70. The antibody or fragment of any of claims 1-7 and 9-69, which
does not comprise the CDR-H1, CDR-H2, CDR-H3 and/or CDR-L1, CDR-L2,
CDR-L3 sequences of the anti-ROR1 antibody, R12, and/or of the
anti-ROR1 antibody 2A2.
71. The antibody or fragment of any of claims 1-7 and 9-70, which
does not comprise CDR-H1, CDR-H2, CDR-H3 and/or CDR-L1, CDR-L2,
CDR-L3 sequences having at least 90% identity to the CDR-H1,
CDR-H2, CDR-H3 and/or CDR-L1, CDR-L2, CDR-L3 sequences of the
anti-ROR1 antibody, R12, and/or of the anti-ROR1 antibody 2A2.
72. The antibody or fragment of any of claims 1-71, wherein the
antibody or fragment is human.
73. A human antibody or antigen-binding fragment thereof that
specifically binds to the same or an overlapping epitope of a ROR1
protein as the epitope specifically bound by a reference antibody,
wherein the reference antibody is the antibody or fragment thereof
of any of claims 1-72 or is the anti-ROR1 antibody, R12, or antigen
binding fragment thereof, said human antibody or fragment
comprising heavy and light chain CDRs that are distinct from the
CDRs present in R12 and/or 2A2.
74. A human antibody or antigen-binding fragment thereof that
specifically binds to ROR1 and competes for binding to ROR1 with a
reference antibody, wherein the reference antibody is the antibody
or fragment of any of claims 1-72 or is the anti-ROR1 antibody R12
or an antigen binding fragment thereof, said human antibody or
fragment comprising heavy and light chain CDRs that are distinct
from the CDRs present in R12 and/or 2A2.
75. The human antibody or fragment of any of claims 72-74, wherein:
the antibody comprises a heavy chain variable (V.sub.H) region,
said V.sub.H region comprises a portion having at least 95%, 96%,
97%, 98%, 99%, or 100% sequence identity to an amino acid sequence
encoded by a germline nucleotide human heavy chain V segment, a
portion with at least 95%, 96%, 97%, 98%, 99%, or 100% sequence
identity to an amino acid sequence encoded by a germline nucleotide
human heavy chain D segment, and/or a portion having at least 95%,
96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid
sequence encoded by a germline nucleotide human heavy chain J
segment; and/or the antibody comprises a light chain variable
(V.sub.L) region, said V.sub.L region comprises a portion with at
least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an
amino acid sequence encoded by a germline nucleotide human kappa or
lambda chain V segment, and/or a portion with at least 95%, 96%,
97%, 98%, 99%, or 100% sequence identity to an amino acid sequence
encoded by a germline nucleotide human kappa or lambda chain J
segment.
76. The human antibody or fragment of any of claims 72-75, wherein:
the CDR-H1 and/or CDR-H2 comprises a sequence 100% identical or
with no more than one amino acid difference as compared to an amino
acid sequence of a CDR-H1 and/or CDR-H2, respectively, within a
sequence encoded by a germline nucleotide human heavy chain V
segment; and/or the CDR-L1 and/or CDR-L2 comprises a sequence 100%
identical or with no more than one amino acid difference as
compared to an amino acid sequence of a CDR-L1 and/or CDR-L2,
respectively, within a sequence encoded by a germline nucleotide
human kappa or lambda v segment.
77. The antibody or fragment of any of claims 1-76, wherein the
antibody or fragment is recombinant.
78. The antibody or fragment of any of claims 1-77, which is
monoclonal.
79. The antibody or fragment of any of claims 1-78 that is an
antigen-binding fragment.
80. The antibody or fragment of any of any of claims 1-79, which is
a single chain fragment.
81. The antibody or fragment of any of claims 31-80, which is a
fragment comprising antibody V.sub.H and V.sub.L regions joined by
a flexible linker.
82. The antibody or fragment of claim 80 or claim 81, wherein the
fragment comprises an scFv.
83. The antibody or fragment of claim 82, wherein the scFv
comprises a linker comprising the sequence set forth SEQ ID NO:
91.
84. The antibody or fragment of claim 82 or claim 83, wherein the
scFv comprises the amino acid sequence set forth in SEQ ID NO: 2,
4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259,
260, 261, 262, 263, 264, 265, 266, 267 or 268, or a sequence of
amino acids that exhibits at least 90% sequence identity to the
amino acid sequence set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250,
251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263,
264, 265, 266, 267 or 268.
85. The antibody or fragment of any of claims 82-84, wherein the
scFv comprises the amino acid sequence set forth in SEQ ID NO: 2,
4, 6, or 12, or a sequence of amino acids that exhibits at least
90% sequence identity to the amino acid sequence set forth in SEQ
ID NO: 2, 4, 6, or 12.
86. The antibody or fragment of any of claims 82-85, wherein the
scFv comprises the amino acid sequence set forth in SEQ ID NO: 2,
4, 6, or 12.
87. The antibody or fragment of any of claims 31-86, wherein the
antibody or fragment comprises the V.sub.H region set forth in SEQ
ID NO: 19 and the V.sub.L region set forth in SEQ ID NO: 18, and/or
the antibody or fragment comprises the sequence of amino acids set
forth in SEQ ID NO: 12.
88. The antibody or fragment of any of claims 31-86, wherein the
antibody or fragment comprises the V.sub.H region set forth in SEQ
ID NO: 13 and the V.sub.L region set forth in SEQ ID NO: 14, and/or
the antibody or fragment comprises the sequence of amino acids set
forth in SEQ ID NO: 6.
89. The antibody or fragment of any of claims 31-86, wherein the
antibody or fragment comprises the V.sub.H region set forth in SEQ
ID NO: 15 and the V.sub.L region set forth in SEQ ID NO: 16, and/or
the antibody or fragment comprises the sequence of amino acids set
forth in SEQ ID NO: 4.
90. The antibody or fragment of any of claims 31-86, wherein the
antibody or fragment comprises the V.sub.H region set forth in SEQ
ID NO: 17 and the V.sub.L region set forth in SEQ ID NO: 18, and/or
the antibody or fragment comprises the sequence of amino acids set
forth in SEQ ID NO: 2.
91. A single chain cell-surface protein, comprising the antibody or
fragment of any of claims 1-90.
92. A single chain cell surface protein comprising the scFv
sequence of SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254,
255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or
268 or comprising the V.sub.H sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209.
93. The single chain cell surface protein of claim 92, comprising
the scFv sequence of SEQ ID NO: 2, 4, 6 or 12 or comprising the
V.sub.H sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, or
19.
94. The antibody or fragment of any of claims 1-90, which further
comprises at least a portion of an immunoglobulin constant
region.
95. The antibody or fragment of claim 94, further comprising a
spacer set forth in SEQ ID NO:108.
96. The antibody or fragment of claim 94, wherein the at least a
portion of an immunoglobulin constant region comprises an Fc
region.
97. The antibody or fragment of claim 96, wherein the Fc region is
an Fc region of a human IgG.
98. A conjugate, comprising the antibody or fragment of any of
claims 1-97 and a heterologous molecule or moiety.
99. A chimeric antigen receptor (CAR) comprising an extracellular
portion comprising the antibody or fragment of any of claims 1-97
and an intracellular signaling domain.
100. The chimeric antigen receptor of claim 99, wherein the
antibody or fragment comprises a VH sdAb, an scFv and the
intracellular signaling domain comprises an ITAM.
101. The chimeric antigen receptor of claim 99 or 100, wherein the
intracellular signaling domain comprises a signaling domain of a
zeta chain of a CD3-zeta (CD3) chain.
102. The chimeric antigen receptor of any of claims 99-101, further
comprising a transmembrane domain linking the extracellular domain
and the intracellular signaling domain.
103. The chimeric antigen receptor of claim 102, wherein the
transmembrane domain comprises a transmembrane portion of CD28.
104. The chimeric antigen receptor of any of claims 99-103, further
comprising an intracellular signaling domain of a T cell
costimulatory molecule.
105. The chimeric antigen receptor of claim 104, wherein the T cell
costimulatory molecule is selected from the group consisting of
CD28 and 41BB.
106. A nucleic acid encoding the antibody or fragment thereof of
any of claims 1-97, conjugate of claim 98 or the chimeric antigen
receptor of any of claims 99-105.
107. An engineered cell expressing a receptor comprising the
antibody or fragment of any of claims 1-97, conjugate of claim 98
or the chimeric antigen receptor of any of claims 99-105.
108. The engineered cell of claim 107, which is a T cell.
109. A composition comprising the antibody or fragment thereof of
any of claims 1-97, conjugate of claim 98, the CAR of any of claims
99-105, or the cell of claim 107 or 108.
110. The composition of claim 109, further comprising a
pharmaceutically acceptable excipient.
111. A method of treatment, comprising administering the
composition of claim 109 or claim 110 to a subject having a disease
or disorder associated with ROR1.
112. A method of treatment, comprising administering an antibody or
fragment of any of claims 1-97, conjugate of claim 98, a CAR of any
of claims 99-103 or the cell of claim 107 or 108 to a subject
having a disease or disorder associated with ROR1.
113. A method of treatment, comprising administering the cell of
claim 107 or claim 108 to a subject having a disease or disorder
associated with ROR1.
114. The method of any of claims 112-113, wherein the disease or
disorder is a ROR1-expressing cancer.
115. The method of claim any of claims 112-114, wherein the
ROR1-expressing cancer is selected from the group consisting of B
cell leukemia, lymphoma, B cell chronic lymphocytic leukemia (CLL),
AML, acute myeloid leukemia (AML), acute lymphocytic leukemia
(ALL), Burkett's Lymphoma, mantle cell lymphoma (MCL), non-small
cell lung cancer (NSCLC), neuroblastoma, renal cell carcinoma,
colon cancer, colorectal cancer, breast cancer, epithelial squamous
cell cancer, melanoma, myeloma, stomach cancer, brain cancer, lung
cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver
cancer, bladder cancer, prostate cancer, testicular cancer, thyroid
cancer, uterine cancer, adrenal cancer and head and neck
cancer.
116. A composition of claim 109 or claim 110 for use in treating a
disease or disorder associated with ROR1.
117. Use of a composition of claim 109 or claim 110 for the
manufacture of a medicament for treating a disease or disorder
associated with ROR1.
118. The composition for use of claim 116 or the use of claim 117,
wherein the disease or disorder is a ROR1-expressing cancer.
119. The composition for use or use of claim 118, wherein the
ROR1-expressing cancer is selected from the group consisting of B
cell leukemia, lymphoma, B cell chronic lymphocytic leukemia (CLL),
AML, acute myeloid leukemia (AML), acute lymphocytic leukemia
(ALL), Burkett's Lymphoma, mantle cell lymphoma (MCL), non-small
cell lung cancer (NSCLC), neuroblastoma, renal cell carcinoma,
colon cancer, colorectal cancer, breast cancer, epithelial squamous
cell cancer, melanoma, myeloma, stomach cancer, brain cancer, lung
cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver
cancer, bladder cancer, prostate cancer, testicular cancer, thyroid
cancer, uterine cancer, adrenal cancer and head and neck cancer.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority from U.S. provisional
application No. 62/104,664 filed Jan. 16, 2015, entitled
"Antibodies and Chimeric Antigen Receptors Specific for ROR1," the
contents of which are incorporated by reference in their
entirety.
INCORPORATION BY REFERENCE OF SEQUENCE LISTING
[0002] The present application is being filed with a Sequence
Listing in electronic format. The Sequence Listing is provided as a
file entitled 735042001700seqlist.txt, created Jan. 18, 2016, which
is 215,631 kilobytes in size. The information in electronic format
of the Sequence Listing is incorporated by reference in its
entirety.
FIELD
[0003] The present disclosure relates in some aspects to ROR1
binding molecules, in particular, to anti-ROR1 antibodies,
including antibody fragments. The present disclosure further
relates to recombinant receptors containing such antibodies,
including chimeric antigen receptors (CARs), which contain such
antibodies. The disclosure further relates to genetically
engineered cells expressing such receptors and antibodies, and use
thereof in adoptive cell therapy.
BACKGROUND
[0004] Receptor tyrosine kinase-like orphan receptor 1 (ROR1) is a
transmembrane receptor that is expressed during embryogenesis, but
generally is not expressed on normal adult cells. ROR1, however, is
expressed in the context of a variety of different cancers, where
it is involved in cell signaling to promote tumor cell survival.
Because ROR1 is generally not expressed on normal cells, ROR1 is a
tumor-specific and/or tumor-associated target for therapy. Various
ROR1-binding molecules, including anti-ROR1 antibodies are
available. Chimeric antigen receptors containing anti-ROR1 antibody
portions, and cells expressing such chimeric receptors, also are
available. Improved ROR1-binding molecules and engineered
ROR1-targeting cells are needed. For example, there is a need for
molecules and cells with reduced immunogenicity and fully human
antibodies, including antibody fragments, that specifically bind to
ROR1, and chimeric receptors expressing such human antibodies for
use in adoptive cell therapy. Provided are embodiments that meet
such needs.
SUMMARY
[0005] Provided are ROR1-binding molecules, including polypeptides,
such as anti-ROR1 antibodies, including antigen-binding antibody
fragments such as single domain antibodies (e.g. V.sub.H alone),
single-chain fragments including scFv fragments, and polypeptides
containing such antibodies, including fusion proteins, receptors,
e.g., recombinant receptors, including chimeric receptors such as
chimeric antigen receptors (CARs) containing the antibody as an
antigen-recognition component. In particular embodiments, the
antibodies are human antibodies, such as human single-chain
fragments including scFvs.
[0006] Provided are antibodies or antigen-binding fragments
thereof, including those that specifically bind to ROR1, such as
specifically bind to human ROR1. In some embodiments, the
antibodies contain particular complementarity determining regions
(CDRs), including heavy chain CDRs (CDR-Hs) and light chain CDRs
(CDR-Ls), such as any described. In some embodiments, the antibody
or antigen-binding fragment thereof includes a heavy chain variable
(V.sub.H) region. In some embodiments, the antibody or
antigen-binding fragment thereof includes a V.sub.H region and a
light chain variable (V.sub.L) region.
[0007] In some embodiments, provided are antibodies or
antigen-binding fragments thereof that include a heavy chain
variable (VH) region containing a heavy chain complementarity
determining region 3 (CDR-H3) having the the amino acid sequence
set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174
and/or a CDR-H3 contained within the heavy chain variable (V.sub.H)
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189,
190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202,
203, 204, 205, 206, 207, 208 or 209.
[0008] Provided are antibody or antigen-binding fragments thereof
that include a heavy chain variable (V.sub.H) region comprising at
least 90% sequence identity to the V.sub.H region amino acid
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189,
190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202,
203, 204, 205, 206, 207, 208 or 209. In some embodiments, provided
are antibodies or antigen-binding fragments thereof that include a
heavy chain variable (V.sub.H) region having at least 90% sequence
identity to the V.sub.H region amino acid sequence set forth in SEQ
ID NO: 8, 10, 13, 15, 17, or 19, such as at least 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
[0009] In some of any such embodiments, the V.sub.H region
comprises a heavy chain complementarity determining region 3
(CDR-H3) comprising the amino acid sequence set forth in SEQ ID NO:
22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62,
63, 64, 65, 66, 67, 68, 69, 70, 71 or 174; or a CDR-H3 contained
within the VH sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17,
19, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186,
187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 202, 203, 204, 205, 206, 207, 208 or 209. In some of any
such embodiments, the V.sub.H region includes a heavy chain
complementarity determining region 3 (CDR-H3) having the amino acid
sequence set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71 or 174 and/or a CDR-H3 contained within the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19. In some embodiments,
the V.sub.H region includes a heavy chain complementarity
determining region 3 (CDR-H3) having the amino acid sequence set
forth in SEQ ID NO: 72 and/or a CDR-H3 contained within the V.sub.H
sequence set forth in SEQ ID NO: 85.
[0010] In some of any such embodiments, the V.sub.H region includes
a heavy chain complementarity determining region 1 (CDR-H1)
comprising the amino acid sequence set forth in SEQ ID NO: 20, 27,
33, 155, 156, 157, 158, 159, 160, 161, 162 or 163, and/or
comprising the amino acid sequence set forth in SEQ ID NO: 269,
270, 271, 272, 273, 274, 275, 276, 278 or 279 and/or comprising the
amino acid sequence set forth in SEQ ID NO: 75, 77, 79, 280, 281,
282, 283, 284, 285, 286, 287, 288 or 289 and/or a CDR-H1 contained
within the V.sub.H sequence set forth in SEQ ID NO: 8, 10, 13, 15,
17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186,
187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 202, 203, 204, 205, 206, 207, 208 or 209; and/or a heavy
chain complementarity determining region 2 (CDR-H2) comprising the
amino acid sequence set forth in SEQ ID NO: 21, 26, 28, 34, 164,
165, 166, 167, 168, 169, 170, 171, 172, 173 or 318 and/or
comprising the amino acid sequence set forth in SEQ ID NO: 291,
292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302 or 303 and/or
comprising the amino acid sequence set forth in SEQ ID NO: 304,
305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316 or 317
and/or a CDR-H2 contained within the V.sub.H sequence set forth in
SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180,
181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193,
194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,
207, 208 or 209. In some of any such embodiments, the V.sub.H
region includes a heavy chain complementarity determining region 1
(CDR-H1) having the amino acid sequence set forth in SEQ ID NO: 20,
27, or 33 and/or a CDR-H1 contained within the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19; and/or a heavy chain
complementarity determining region 2 (CDR-H2) having the amino acid
sequence set forth in SEQ ID NO: 21, 26, 28, or 34 and/or a CDR-H2
contained within the V.sub.H sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, or 19.
[0011] Provided are antibodies or antigen-binding fragments thereof
that include a heavy chain variable (VH) region comprising a heavy
chain complementarity determining region 1 (CDR-H1), CDR-H2, and
CDR-H3, wherein the CDR-H1 comprises the amino acid sequence set
forth in SEQ ID NO: 20, 27, 33, 74, 75, 76, 77, 78, 79, 155, 156,
157, 158, 159, 160, 161, 162 or 163; the CDR-H2 comprises the amino
acid sequence set forth in SEQ ID NO: 21, 26, 28, 34, 80, 81, 82,
83, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, or 318;
and/or the CDR-H3 comprises the amino acid sequence set forth in
SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59,
60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174. In some
embodiments, provided are antibodies or antigen-binding fragments
thereof that include a CDR-H1 having the amino acid sequence set
forth in SEQ ID NO: 20, 27, or 33; a CDR-H2 having the amino acid
sequence set forth in SEQ ID NO: 21, 26, 28, or 34; and a CDR-H3
having the amino acid sequence set forth in SEQ ID NO: 22, 29, 35,
45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65,
66, 67, 68, 69, 70, 71 or 174.
[0012] In some of any of such embodiments, the antibody includes a
CDR-H3 that has the amino acid sequence VSNYEYYFDY (SEQ ID NO: 29),
DFGRWGYYFDY (SEQ ID NO: 52), DFGRWSYYFDY (SEQ ID NO: 35) or
DSSYDAFDI (SEQ ID NO: 22).
[0013] In some of any of such embodiments, the antibody includes a
V.sub.H region that includes the CDR-H1, CDR-H2, and CDR-H3 having
the sequences of SEQ ID NOs: 20, 21, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 20,
26, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 having the
sequences of SEQ ID NOs: 27, 28, and 29, respectively; the CDR-H1,
CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 33, 34, and
35, respectively; the CDR-H1, CDR-H2, and CDR-H3 having the
sequences of SEQ ID NOs: 33, 34, and 52, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 27, 164
and 45, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 27, 164 and 68, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 27, 164
and 64, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 27, 164 and 66, respectively; the CDR-H1,
CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 33, 318, and
35, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 33, 34 and 70, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 33, 34 and
55, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 33, 34 and 53, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 33, 34 and
56, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 33, 34 and 61, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 33, 34 and
59, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 33, 171 and 60, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 155, 34
and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 156, 34 and 35, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 162, 170
and 50, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 162, 170 and 51, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 161, 169
and 54, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs:159, 167 and 57, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 160, 168
and 58, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 158, 166 and 62, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 158, 166
and 63, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 158, 166 and 65, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 157, 165
and 67, respectively; the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 163, 173 and 69, respectively; the CDR-H1,
CDR-H2, and CDR-H3 comprise the sequences of SEQ ID NOs: 160, 172,
71, respectively; or the CDR-H1, CDR-H2, and CDR-H3 comprise the
sequences of SEQ ID NOs: 160, 172, 174, respectively. In some
embodiments, any of the above provided antibodies or fragments can
contain the corresponding CDR (e.g. CDR-H1 or CDR-H2) in accord
with an alternative numbering scheme as is described and known to a
skilled artisan.
[0014] In some of any of such embodiments, the antibody includes a
V.sub.H region that includes the CDR-H1, CDR-H2, and CDR-H3 having
the sequences of SEQ ID NOs: 20, 21, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 20,
26, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 having the
sequences of SEQ ID NOs: 27, 28, and 29, respectively; the CDR-H1,
CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 33, 34, and
35, respectively; or the CDR-H1, CDR-H2, and CDR-H3 having the
sequences of SEQ ID NOs: 33, 34, and 52, respectively. In some
embodiments, the antibody includes a V.sub.H region that includes
the CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs:
27, 28, and 29, respectively; or the CDR-H1, CDR-H2, and CDR-H3
comprise the sequences of SEQ ID NOs: 33, 34, and 52, respectively.
In some embodiments, the antibody includes a V.sub.H region that
includes the CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ
ID NOs: 20, 21, and 22, respectively; the CDR-H1, CDR-H2, and
CDR-H3 having the sequences of SEQ ID NOs: 20, 26, and 22,
respectively; the CDR-H1, CDR-H2, and CDR-H3 having the sequences
of SEQ ID NOs: 27, 28, and 29, respectively; the CDR-H1, CDR-H2,
and CDR-H3 having the sequences of SEQ ID NOs: 33, 34, and 35,
respectively.
[0015] Provided are antibodies or antigen-binding fragments thereof
that includes a heavy chain complementarity determining region 1
(CDR-H1), a CDR-H2, and a CDR-H3, respectively, comprising the
amino acid sequences of a CDR-H1, a CDR-H2, and a CDR-H3 contained
within the V.sub.H region amino acid sequence set forth in SEQ ID
NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182,
183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195,
196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209. In some embodiments, provided are antibodies or
antigen-binding fragments thereof includes a V.sub.H region that
includes a heavy chain CDR-H1, a CDR-H2, and a CDR-H3, respectively
having the amino acid sequences of a CDR-H1, a CDR-H2, and a CDR-H3
contained within the V.sub.H region amino acid sequence set forth
in SEQ ID NO: 8, 10, 13, 15, 17, or 19. In some embodiments, the
antibody includes a V.sub.H region that includes a heavy chain
CDR-H1, a CDR-H2, and a CDR-H3, respectively having the amino acid
sequences of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 8 or 10.
In some embodiments, the antibody includes a V.sub.H region that
includes a heavy chain CDR-H1, a CDR-H2, and a CDR-H3, respectively
having the amino acid sequences of a CDR-H1, a CDR-H2, and a CDR-H3
contained within the V.sub.H region amino acid sequence set forth
in SEQ ID NO: 13, 15, 17, or 19.
[0016] In some of any such embodiments, the V.sub.H region contains
a framework region 1 (FR1), a FR2, a FR3, and/or a FR4 comprising
at least 90% sequence identity, respectively, to a FR1, FR2, FR3,
and/or FR4 of the amino acid sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or 209.
In some of any such embodiments, the V.sub.H region contains a
framework region 1 (FR1), a FR2, a FR3, and/or a FR4 sequence
having at least 90% sequence identity, respectively, to a FR1, FR2,
FR3, and/or FR4 of the amino acid sequence set forth in SEQ ID NO:
8, 10, 13, 15, 17 or 19. In some embodiments, the V.sub.H region
contains a framework region 1 (FR1), a FR2, a FR3, and/or a FR4
sequence having at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
98%, 99% sequence identity, respectively, to a FR1, FR2, FR3,
and/or FR4 of the amino acid sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17 or 19. In some embodiments, the V.sub.H region
contains a framework region 1 (FR1), a FR2, a FR3, and a FR4
sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 98%, 99% sequence identity, respectively, to a FR1, FR2, FR3,
and FR4 of the amino acid sequence set forth in SEQ ID NO: 8, 10,
13, 15, 17 or 19.
[0017] In some of any of such embodiments, the V.sub.H region has
the sequence of amino acids set forth in SEQ ID NO: 8, 10, 13, 15,
17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186,
187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 202, 203, 204, 205, 206, 207, 208 or 209. In some of any
such embodiments, the V.sub.H region has the sequence of amino
acids set forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19. In some
embodiments, the V.sub.H region has the sequence of amino acids set
forth in SEQ ID NO: 8 or 10. In some embodiments, the V.sub.H
region has the sequence of amino acids set forth in SEQ ID NO: 13,
15, 17, or 19.
[0018] In some of any of such embodiments, the V.sub.H region
comprises the CDR-H1, CDR-H2, and CDR-H3 set forth in SEQ ID NOS:
20, 26, and 22, respectively, and/or the V.sub.H region comprises
the sequence of amino acids set forth in SEQ ID NO: 19. In some of
any of such embodiments, the V.sub.H region comprises the CDR-H1,
CDR-H2, and CDR-H3 set forth in SEQ ID NOS: 33, 34, and 52,
respectively, and/or the V.sub.H region comprises the sequence of
amino acids set forth in SEQ ID NO: 10. In some of any of such
embodiments, the V.sub.H region comprises the CDR-H1, CDR-H2, and
CDR-H3 set forth in SEQ ID NOS: 33, 34, and 35, respectively,
and/or the V.sub.H region comprises the sequence of amino acids set
forth in SEQ ID NO: 13. In some of any of such embodiments, the
V.sub.H region comprises the CDR-H1, CDR-H2, and CDR-H3 set forth
in SEQ ID NOS: 27, 28, and 29, respectively, and/or the V.sub.H
region comprises the sequence of amino acids set forth in SEQ ID
NO: 15.
[0019] In any of such provided embodiments, the antibody or
antigen-binding fragment is a heavy chain only, a VH-only, and/or
does not include a VL or antigen-binding portion thereof and/or the
antigen-binding site of the antibody or fragment includes residues
from the heavy chain only and/or does not include residues from a
light chain.
[0020] In some of any such embodiments, the antibody or fragment
does not contain a light chain variable (V.sub.L) region, does not
contain a CDR-L1, CDR-L2, and/or CDR-L3, and/or is a single-domain
antibody (sdAb) containing only the V.sub.H region. In some
embodiments, the antibody or fragment is a sdAb that only contains
a VH region from any as described.
[0021] In some embodiments of any of the antibodies or fragments
containing any of the above VH region sequences, the antibody or
fragment further contains a light chain variable (V.sub.L) region.
In some such embodiments, the V.sub.L region has at least 90%
sequence identity to the V.sub.L region amino acid sequence set
forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240,
241, 242, 243, 244, 245, 246, 247 or 248, such as at least 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245,
246, 247 or 248. In some such embodiments, the V.sub.L region has
at least 90% sequence identity to the V.sub.L region amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18, such as at least
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to
the V.sub.L region amino acid sequence set forth in SEQ ID NO: 14,
16, or 18.
[0022] In some of any such embodiments, he V.sub.L region comprises
a light chain complementarity determining region 3 (CDR-L3)
comprising the amino acid sequence set forth in SEQ ID NO: 25, 32,
38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49, 232 or 233. In some of
any such embodiments, the V.sub.L region contains a light chain
complementarity determining region 3 (CDR-L3) having the amino acid
sequence set forth in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43,
44, 46, 47, 48 or 49.
[0023] In some of any such embodiments, he V.sub.L region contains
a light chain complementarity determining region 1 (CDR-L1)
comprising the amino acid sequence set forth in SEQ ID NO: 23, 30,
36, 210, 211, 212, 213, 214, 215, 217, 216, 218, 219 or 220 and/or
a CDR-L1 contained within the V.sub.L sequence set forth in SEQ ID
NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243,
244, 245, 246, 247 or 248; and/or a light chain complementarity
determining region 2 (CDR-L2) comprising the amino acid sequence
set forth in SEQ ID NO: 24, 31, 37, 221, 222, 223, 224, 225, 226,
227, 228, 229, 230 or 231 and/or a CDR-L2 contained within the
V.sub.L sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235, 236,
237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or 248. In
some of any such embodiments, the V.sub.L region contains a light
chain complementarity determining region 1 (CDR-L1) having the
amino acid sequence set forth in SEQ ID NO: 23, 30, or 36 and/or a
CDR-L1 contained within the V.sub.L sequence set forth in SEQ ID
NO: 14, 16, or 18; and/or a light chain complementarity determining
region 2 (CDR-L2) having the amino acid sequence set forth in SEQ
ID NO: 24, 31, or 37 and/or a CDR-L2 contained within the V.sub.L
sequence set forth in SEQ ID NO: 14, 16, or 18.
[0024] In some of any such embodiments, the V.sub.L region contains
a CDR-L1 containing the amino acid sequence set forth in SEQ ID NO:
23, 30, 36, 210, 211, 212, 213, 214, 215, 217, 216, 218, 219 or
220; a CDR-L2 containing the amino acid sequence set forth in SEQ
ID NO: 24, 31, 37, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230
or 231; and a CDR-L3 containing the amino acid sequence set forth
in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49,
232 or 233. In some of any such embodiments, the V.sub.L region
contains a CDR-L1 having the amino acid sequence set forth in SEQ
ID NO: 23, 30, or 36; a CDR-L2 having the amino acid sequence set
forth in SEQ ID NO: 24, 31, or 37; and a CDR-L3 having the amino
acid sequence set forth in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42,
43, 44, 46, 47, 48, or 49.
[0025] In some of any such embodiments, the CDR-L3 has the amino
acid sequence set forth in SEQ ID NO: 25, 32 or 38.
[0026] In some of any such embodiments, the antibody includes a
V.sub.L region that includes the CDR-L1, CDR-L2, and CDR-L3
comprising the sequences of SEQ ID NOs: 23, 24, and 25,
respectively; the CDR-L1, CDR-L2, and CDR-L3 comprising the
sequences of SEQ ID NOs: 30, 31, and 32, respectively; the CDR-L1,
CDR-L2, and CDR-L3 comprising the sequences of SEQ ID NOs: 36, 37,
and 38, respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 216, 227, and 40, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
218, 229, and 39, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 219, 230, and 43,
respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 220, 231, and 46, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
210, 221, and 49, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 210, 221, and 233,
respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 211, 222, and 48, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
212, 223, and 42, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 214, 225, and 232,
respectively; the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 215, 226, and 44, respectively; the
CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of SEQ ID NOs:
217, 228, and 41, respectively; the CDR-L1, CDR-L2 and CDR-L3
comprising the sequences of SEQ ID NOs: 36, 37, and 38,
respectively; or the CDR-L1, CDR-L2 and CDR-L3 comprising the
sequences of SEQ ID NOs: 213, 224, and 47, respectively. In some of
any such embodiments, the antibody or fragment includes a V.sub.L
region that includes the CDR-L1, CDR-L2, and CDR-L3 comprising the
sequences of SEQ ID NOs: 23, 24, and 25, respectively; the CDR-L1,
CDR-L2, and CDR-L3 comprising the sequences of SEQ ID NOs: 30, 31,
and 32, respectively; or the CDR-L1, CDR-L2, and CDR-L3 comprising
the sequences of SEQ ID NOs: 36, 37, and 38, respectively.
[0027] In some of any such embodiments, the V.sub.L region contains
the CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245,
246, 247 or 248. In some of any such embodiments, the V.sub.L
region contains the CDR-L1, CDR-L2, and CDR-L3, respectively,
contained within the V.sub.L region amino acid sequence set forth
in SEQ ID NO: 14, 16, or 18.
[0028] In some of any such embodiments, the V.sub.L region contains
a framework region 1 (FR1), a FR2, a FR3, and/or a FR4 having at
least 90% sequence identity, respectively, to the FR1, FR2, FR3,
and/or FR4 of the amino acid sequence set forth in SEQ ID NO: 14,
16, or 18. In some embodiments, the V.sub.L region contains a
framework region 1 (FR1), a FR2, a FR3, and/or a FR4 sequence
having at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98%, 99%
sequence identity, respectively, to a FR1, FR2, FR3, and/or FR4 of
the amino acid sequence set forth in SEQ ID NO: 14, 16, or 18. In
some embodiments, the V.sub.L region contains a framework region 1
(FR1), a FR2, a FR3, and a FR4 sequence having at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 98%, 99% sequence identity,
respectively, to a FR1, FR2, FR3, and FR4 of the amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18.
[0029] In some of any such embodiments, the V.sub.L region has the
amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235,
236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or 248.
In some of any such embodiments, the V.sub.L region has the amino
acid sequence set forth in SEQ ID NO: 14, 16, or 18.
[0030] Provided are antibodies or antigen-binding fragments thereof
that contain the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3
sequences contained within the V.sub.H region amino acid sequence
set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178,
179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191,
192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204,
205, 206, 207, 208 or 209; and/or contain the amino acid sequences
of CDR-L1, CDR-L2, and CDR-L3 sequences contained within the light
chain variable (VL) region amino acid sequence set forth in SEQ ID
NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243,
244, 245, 246, 247 or 248. In some embodiments, provided are
antibodies or antigen-binding fragments thereof that contain the
amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 sequences
contained within the V.sub.H region amino acid sequence set forth
in SEQ ID NO: 8, 10, 13, 15, 17, or 19; and/or contain the amino
acid sequences of CDR-L1, CDR-L2, and CDR-L3 sequences contained
within the light chain variable (VL) region amino acid sequence set
forth in SEQ ID NO: 14, 16, or 18.
[0031] Provided are antibodies or antigen-binding fragments thereof
that include the V.sub.H and V.sub.L regions having amino acid
sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99% identity to SEQ ID NOs: 19 and 18, respectively; V.sub.H
and V.sub.L regions having amino acid sequences having at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ
ID NOs: 17 and 18, respectively; V.sub.H and V.sub.L regions having
amino acid sequences having at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98% or 99% identity to SEQ ID NOs: 15 and 16,
respectively; V.sub.H and V.sub.L regions having amino acid
sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99% identity to SEQ ID NOs: 13 and 14, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
identity to SEQ ID NOs: 182 and 242 respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences having at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ
ID NOs: 182 and 246, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences having at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 182 and 247,
respectively; a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99% identity to SEQ ID NOs: 185 and 248, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
identity to SEQ ID NOs: 186 and 248, respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences having at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ
ID NOs: 175 and 234, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences having at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 175 and 235,
respectively; a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99% identity to SEQ ID NOs: 176 and 236, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
identity to SEQ ID NOs: 176 and 237, respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences having at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ
ID NOs: 177 and 238, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences having at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 179 and 240
respectively; a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99% identity to SEQ ID NOs: 180 and 241, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
identity to SEQ ID NOs: 181 and 241, respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences having at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ
ID NOs: 183 and 243 respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences having at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 183 and 244
respectively; a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99% identity to SEQ ID NOs: 184 and 243, respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences having
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
identity to SEQ ID NOs: 184 and 244 respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences having at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ
ID NOs: 183 and 245, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences having at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 184 and 245,
respectively; or a V.sub.H and V.sub.L regions comprising amino
acid sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98% or 99% identity to SEQ ID NOs: 178 and 239,
respectively.
[0032] In some embodiments, provided are antibodies or
antigen-binding fragments thereof that include the V.sub.H and
V.sub.L regions having amino acid sequences set forth in SEQ ID
NOs: 19 and 18, respectively; V.sub.H and V.sub.L regions having
amino acid sequences set forth in SEQ ID NOs: 17 and 18,
respectively; V.sub.H and V.sub.L regions having amino acid
sequences set forth in SEQ ID NOs: 15 and 16, respectively; V.sub.H
and V.sub.L regions having amino acid sequences set forth in SEQ ID
NOs: 13 and 14, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences set forth in SEQ ID NOs: 182 and
242 respectively; a V.sub.H and V.sub.L regions comprising amino
acid sequences set forth in SEQ ID NOs: 182 and 246, respectively;
a V.sub.H and V.sub.L regions comprising amino acid sequences set
forth in SEQ ID NOs: 182 and 247, respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences set forth in SEQ ID
NOs: 185 and 248, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences set forth in SEQ ID NOs: 186 and
248, respectively; a V.sub.H and V.sub.L regions comprising amino
acid sequences set forth in SEQ ID NOs: 175 and 234, respectively;
a V.sub.H and V.sub.L regions comprising amino acid sequences set
forth in SEQ ID NOs: 175 and 235, respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences set forth in SEQ ID
NOs: 176 and 236, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences set forth in SEQ ID NOs: 176 and
237, respectively; a V.sub.H and V.sub.L regions comprising amino
acid sequences set forth in SEQ ID NOs: 177 and 238, respectively;
a V.sub.H and V.sub.L regions comprising amino acid sequences set
forth in SEQ ID NOs: 179 and 240 respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences set forth in SEQ ID
NOs: 180 and 241, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences set forth in SEQ ID NOs: 181 and
241, respectively; a V.sub.H and V.sub.L regions comprising amino
acid sequences set forth in SEQ ID NOs: 183 and 243 respectively; a
V.sub.H and V.sub.L regions comprising amino acid sequences set
forth in SEQ ID NOs: 183 and 244 respectively; a V.sub.H and
V.sub.L regions comprising amino acid sequences set forth in SEQ ID
NOs: 184 and 243, respectively; a V.sub.H and V.sub.L regions
comprising amino acid sequences set forth in SEQ ID NOs: 184 and
244 respectively; a V.sub.H and V.sub.L regions comprising amino
acid sequences set forth in SEQ ID NOs: 183 and 245, respectively;
a V.sub.H and V.sub.L regions comprising amino acid sequences set
forth in SEQ ID NOs: 184 and 245, respectively; or a V.sub.H and
V.sub.L regions comprising amino acid sequences set forth in SEQ ID
NOs: 178 and 239, respectively.
[0033] In some of any such embodiments, the V.sub.H and V.sub.L
regions include the amino acid sequences of SEQ ID NOs: 19 and 18,
respectively; the V.sub.H and V.sub.L regions include the amino
acid sequences of SEQ ID NOs: 17 and 18, respectively; the V.sub.H
and V.sub.L regions include the amino acid sequences of SEQ ID NOs:
15 and 16 respectively; or the V.sub.H and V.sub.L regions include
the amino acid sequences of SEQ ID NOs: 13 and 14 respectively.
[0034] In some of any such embodiments, the antibody or fragment
specifically binds to a ROR1 protein. In some embodiments, the
antibody or fragment has a binding affinity for a ROR1 protein with
an EC50 that is from or from about 0.1 nM to 100 nM, 0.5 nM to 50
nM or 1 nM to 10 nM. In some embodiments, the antibody or fragment
has a binding affinity for a ROR1 protein with an EC50 that is less
than or less than about 100 nM, less than or less than about 50 nM,
less than or less than about 10 nM or less than or less than about
1 nM.
[0035] In some of any such embodiments, the antibody or fragment
has a binding affinity for a ROR1 protein, such as a human ROR1
protein, that is at least as high or substantially as high as the
binding affinity for the same ROR1 protein of the corresponding
form of the anti-ROR1 antibody R12 or antigen-binding fragment
thereof, which is optionally an scFv fragment of R12.
[0036] In some of any such embodiments, the antibody or fragment
specifically binds to the same or an overlapping epitope of a ROR1
protein, such as a human ROR1 protein, as the epitope specifically
bound by the anti-ROR1 antibody R12 or an antigen-binding fragment
thereof, which is optionally an scFv fragment of R12. In some
embodiments, the antibody or fragment inhibits the binding of the
anti-ROR1 antibody R12 or an antigen-binding fragment thereof,
which is optionally an scFv fragment of R12, to a ROR1 protein,
such as a human ROR1 protein, by greater than or greater than about
80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, or 99%, such as greater than or
greater than about 80% or greater than or greater than about
90%.
[0037] In some of any such embodiments, the ROR1 protein is a human
ROR1 protein and the antibody or fragment binds to a human ROR1
protein. In some embodiments, the human ROR1 protein has the amino
acid sequence set forth in SEQ ID NO: 103. In some embodiments,
provided are anti-human ROR1 antibodies.
[0038] In some of any such embodiments, the antibody or fragment
binds an epitope within an extracellular portion of the ROR1
protein, such as a human ROR1 protein. In some embodiments, the
extracellular portion of ROR1 contains the amino acids 1-377 of SEQ
ID NO: 103. In some of any such embodiments, the antibody or
fragment binds to an epitope of a ROR1 protein, such as a human
ROR1 protein, containing residues within the fz domain or the Ig
domain of the ROR1 protein. In some embodiments, the epitope
contains a residue within the fz domain of the ROR1 protein and a
residue within the Ig domain of the ROR1 protein. In some
embodiments, the Ig domain is one that contains residues 13-118 of
the amino acid sequence set forth in SEQ ID NO: 103; and/or the fz
domain contains residues 136-270 of the amino acid sequence set
forth in SEQ ID NO:103.
[0039] In some embodiments, the ROR1 protein is a mouse ROR1
protein and the antibody or fragment binds to a mouse ROR1 protein.
In some embodiments, the mouse ROR1 protein has the amino acid
sequence set forth in SEQ ID NO:106. In some embodiments, the
antibody or fragment binds to an overlapping epitope of a human
ROR1 protein as the epitope specifically bound by the anti-ROR1
antibody R12 or an antigen-binding fragment thereof, which is
optionally an scFv fragment of R12 and the antibody or fragment
also binds to mouse ROR1.
[0040] In some of any such embodiments, the antibody or fragment
does not specifically bind to a mouse ROR1 protein or does not
specifically bind to a protein having the amino acid sequence set
forth in SEQ ID NO: 106.
[0041] In some of any such embodiments, the antibody or fragment
does not contain the CDR-H1, CDR-H2, CDR-H3 and/or CDR-L1, CDR-L2,
CDR-L3 sequences of the anti-ROR1 antibody, R12, and/or of the
anti-ROR1 antibody 2A2. In some embodiments, the antibody or
fragment does not contain a CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2
and/or CDR-L3 sequences having at least 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98% or 99% identity to the CDR-H1, CDR-H2, CDR-H3
and/or CDR-L1, CDR-L2, CDR-L3 sequences of the anti-ROR1 antibody,
R12, and/or of the anti-ROR1 antibody 2A2.
[0042] In some of any such embodiments, the antibody or fragment is
human.
[0043] Provided are human antibodies or antigen-binding fragments
thereof that specifically bind to the same or an overlapping
epitope of a ROR1 protein, such as a human ROR1 protein, as the
epitope specifically bound by any of the above provided antibodies
or antigen-binding fragments thereof or by the anti-ROR1 antibody
designated R12 or an antigen-binding fragment thereof. Also
provided are human antibodies or antigen-binding fragments thereof
that specifically bind to ROR1 and competes for binding to ROR1,
such as a human ROR1 protein, with any of the above provided
antibodies or antigen-binding fragments thereof or by the anti-ROR1
antibody designated R12 or antigen-binding fragment thereof. In
some such embodiments, the human antibody or fragment contains a
CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and/or CDR-L3 that is
distinct from a corresponding CDR-H1, CDR-H2, CDR-H3, CDR-L1,
CDR-L2 and/or CDR-L3 present in an antibody designated R12 and/or
2A2.
[0044] In some of any such embodiments, the human antibody or
fragment contains a V.sub.H region with a portion having at least
95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid
sequence encoded by a germline nucleotide human heavy chain V
segment, a portion with at least 95%, 96%, 97%, 98%, 99%, or 100%
sequence identity to an amino acid sequence encoded by a germline
nucleotide human heavy chain D segment, and/or a portion having at
least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an
amino acid sequence encoded by a germline nucleotide human heavy
chain J segment. In some of any such embodiments, the human
antibody or fragment contains va.sub.le region with a portion with
at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an
amino acid sequence encoded by a germline nucleotide human kappa or
lambda chain V segment, and/or a portion with at least 95%, 96%,
97%, 98%, 99%, or 100% sequence identity to an amino acid sequence
encoded by a germline nucleotide human kappa or lambda chain J
segment.
[0045] In some of any such embodiments, the human antibody or
fragment contains a CDR-H1 and/or CDR-H2 that has a sequence 100%
identical or with no more than one amino acid difference as
compared to an amino acid sequence of a CDR-H1 and/or CDR-H2,
respectively, within a sequence encoded by a germline nucleotide
human heavy chain V segment; and/or contains a CDR-L1 and/or CDR-L2
that has a sequence 100% identical or with no more than one amino
acid difference as compared to an amino acid sequence of a CDR-L1
and/or CDR-L2, respectively, within a sequence encoded by a
germline nucleotide human kappa or lambda v segment.
[0046] In some of any such embodiments, the antibody or fragment is
recombinant. In some of any such embodiments, the antibody or
fragment is monoclonal.
[0047] In some of any such embodiments, the antibody or fragment is
an antigen-binding fragment. In some embodiments, the antibody is a
single chain fragment. In some embodiments, the antibody is a
single domain antibody, such as a single domain antibody containing
only a V.sub.H region. In some embodiments, the antibody contains
both a V.sub.H region and a V.sub.L region and is a fragment in
which the antibody variable regions are joined by a flexible
linker.
[0048] In some of any such embodiments, the fragment is an scFv. In
some embodiments, the scFv contains a linker having the sequence
set forth SEQ ID NO: 91. In some embodiments, the scFv contains the
amino acid sequence set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250,
251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263,
264, 265, 266, 267 or 268, or a sequence of amino acids that
exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or
99% sequence identity to the amino acid sequence set forth in SEQ
ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256, 257,
258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or 268. In some
embodiments, the scFv contains the amino acid sequence set forth in
SEQ ID NO: 2, 4, 6, or 12, or a sequence of amino acids that
exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or
99% sequence identity to the amino acid sequence set forth in SEQ
ID NO: 2, 4, 6, or 12. In some embodiments, the scFv contains the
amino acid sequence set forth in SEQ ID NO: 2, 4, 6, or 12.
[0049] In some aspects, the scFv contains the VH, linker and VL as
set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254,
255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or
268, or a sequence at least at or about 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, or 99% identical to such a sequence, but in
which the VH and VL are configured in the opposite orientation,
i.e. VL-VH, as compared to such sequence.
[0050] In some embodiments, the antibody or fragment comprises the
V.sub.H region set forth in SEQ ID NO: 19 and the V.sub.L region
set forth in SEQ ID NO: 18, and/or the antibody or fragment
comprises the sequence of amino acids set forth in SEQ ID NO: 12.
In some embodiments, the antibody or fragment comprises the V.sub.H
region set forth in SEQ ID NO: 13 and the V.sub.L region set forth
in SEQ ID NO: 14, and/or the antibody or fragment comprises the
sequence of amino acids set forth in SEQ ID NO: 6. In some
embodiments, the antibody or fragment comprises the V.sub.H region
set forth in SEQ ID NO: 15 and the V.sub.L region set forth in SEQ
ID NO: 16, and/or the antibody or fragment comprises the sequence
of amino acids set forth in SEQ ID NO: 4. In some embodiments, the
antibody or fragment comprises the V.sub.H region set forth in SEQ
ID NO: 17 and the V.sub.L region set forth in SEQ ID NO: 18, and/or
the antibody or fragment comprises the sequence of amino acids set
forth in SEQ ID NO: 2.
[0051] Provided is a single chain cell-surface protein containing
any of the provided single chain antibody fragment. In some
embodiments, the single chain cell surface protein contains any of
the provided single domain antibodies. In some embodiments, the
single chain cell surface protein contains the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205,
206, 207, 208 or 209. In some embodiment, the single chain cell
surface protein contains the V.sub.H region sequence having the
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19. In some
embodiments, the single chain cell surface protein contains any of
the provided scFv antibody fragments. In some embodiments, the
single chain cell surface protein contains the scFv sequence of SEQ
ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256, 257,
258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or 268. In some
embodiment, the single chain cell surface protein contains the scFv
sequence of SEQ ID NO: 2, 4, 6 or 12. In some embodiments, the
single chain cell surface protein contains the scFv sequence of SEQ
ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256, 257,
258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or 268, but in
which the VH and VL are configured in the opposite orientation,
i.e. VL-VH, as compared to such sequence.
[0052] In some of any such embodiments, the antibody or fragment
further contains at least a portion of an immunoglobulin constant
region. In some embodiments, the antibody or fragment further
contains a spacer. In some embodiments, the antibody or fragment
contains a spacer set forth in SEQ ID NO: 108. In some embodiments,
the antibody or fragment contains a spacer set forth in SEQ ID NO:
142. In some embodiments, the antibody or fragment contains a
spacer set forth in SEQ ID NO: 143. In some embodiments, the
antibody or fragment contains an immunoglobulin constant region
containing an Fc region. In some embodiments, the Fc region is an
Fc region of a human IgG.
[0053] Also provided is a conjugate containing any of the provided
antibodies or fragments. Also provided is a conjugate containing
any of the provided single chain cell-surface proteins. In some
embodiments, the conjugate contains a heterologous moiety that is
linked directly or indirectly to the antibody or antigen-binding
fragment. In some embodiments, the conjugate can be a fusion
protein or chimeric molecule. In some embodiments, the heterologous
moiety is an effect domain.
[0054] In some embodiments, provided is a conjugate, fusion protein
or chimeric molecule containing a) any of the provided antibodies
or antigen-binding fragments and b) an effector domain. In some
embodiments, the effector domain is not naturally associated in a
single polypeptide chain with the antibody or antigen-binding
fragment thereof. In some embodiments, the effector domain is a
chemotherapeutic agent or toxin. In some embodiments, the effector
domain contains a signaling domain that is capable of delivering a
signal to a cell, such as an immune cell, such as a lymphocyte, for
example, an activating signal, a costimulatory signal, a
suppressive signal and/or an inhibitory signal.
[0055] Also provided is a chimeric antigen receptor (CAR) including
an extracellular portion containing any of the provided antibodies
or antigen-binding fragments and an intracellular signaling domain.
In some embodiments, the antibody or fragment is an scFv and the
intracellular signaling domain contains an ITAM. In some
embodiments, the intracellular signaling domain contains a
signaling domain of a zeta chain of a CD3-zeta (CD3.zeta.)
chain.
[0056] In some of any such embodiments, the CAR also contains a
transmembrane domain linking the extracellular domain and the
intracellular signaling domain. In some embodiments, the
transmembrane domain contains a transmembrane portion of a
costimulatory molecule, such as a T cell costimulatory molecule,
e.g., CD28 and/or 41BB. In some embodiments, the T cell
costimulatory molecule is CD28 or 41BB. In some embodiments, the
intracellular signaling domain also includes an intracellular
domain of a T cell costimulatory molecule. In some aspects, the T
cell costimulatory molecule is CD28 or 41BB.
[0057] In some embodiments of any of the provided CARs, the CAR
contains an antibody or antigen-binding fragment as provided
herein, a transmembrane domain that is a portion of CD28 or variant
thereof, and an intracellular signaling domain containing a
signaling portion of CD28 or functional variant thereof and a
signaling portion of CD3 zeta or functional variant thereof. In
some such embodiments, the receptor further includes a spacer
containing an Ig hinge, e.g., an IgG4 hinge, such as a hinge-only
spacer, between the antibody or antigen-binding fragment and the
transmembrane domain.
[0058] In some embodiments of any of the provided CARs, the CAR
contains an antibody or antigen-binding fragment as provided
herein, a transmembrane domain that is a portion of CD28 or variant
thereof, and an intracellular signaling domain containing a
signaling portion of a 4-1BB or functional variant thereof and a
signaling portion of CD3 zeta or functional variant thereof. In
some such embodiments, the receptor further includes a spacer
containing an Ig hinge, e.g., an IgG4 hinge, such as a hinge-only
spacer, between the antibody or antigen-binding fragment and the
transmembrane domain.
[0059] Provided are nucleic acids encoding any of the provided
antibodies or fragments thereof, any of the provided single chain
cell-surface proteins, any of the provided conjugates, or any of
the provided CARs. In some embodiments, the nucleic acid molecule
encoding an antibody or antigen-binding fragment comprises the
sequence of nucleotides set forth in SEQ ID NO:7 or 9 or a sequence
of nucleotides that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99% or more sequence identity to the sequence set
forth in SEQ ID NO:7 or 9. In some embodiments, the nucleic acid
molecule encoding an antibody or antigen-binding fragment comprises
the sequence of nucleotides set forth in SEQ ID NO: 1, 3, 5 or 11
or a sequence of nucleotides that exhibits at least 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the
sequence set forth in SEQ ID NO: 1, 3, 5 or 11.
[0060] Also provided are cells that contain any of the provided
antibodies or fragments, any of the provided single chain
cell-surface proteins, any of the provided conjugates, or any of
the provided CARs. In some embodiments, the cell is an engineered
cell expressing a receptor and contains any of the provided
antibodies or fragments, any of the single chain cell-surface
proteins, any of the provided conjugates, or any of the provided
CARs. In some embodiments, the cell or engineered cell is a T
cell.
[0061] Provided are compositions or pharmaceutical compositions
containing any of the provided antibodies or fragments, any of the
provided single chain cell-surface proteins, any of the provided
conjugates, any of the provided CARs or any of the provided cells.
In some embodiments, the composition or pharmaceutical composition
contains a pharmaceutically acceptable excipient.
[0062] Provided are methods of treatments that include
administering any of the provided compositions or pharmaceutical
compositions to a subject having a disease or disorder associated
with ROR1. Provided are methods of treatment that include
administering any of the provided antibodies or fragments, any of
the provided single chain cell-surface proteins, any of the
provided conjugates, any of the provided CARs or any of the
provided cell to a subject having a disease or disorder associated
with ROR1.
[0063] Provided are any of the provided compositions or
pharmaceutical compositions for use in treating a disease or
disorder associated with ROR1. Provided is use of any of the
provided compositions or pharmaceutical compositions for the
manufacture of a medicament for treating a disease or disorder
associated with ROR1.
[0064] In some of any such embodiments, the disease or disorder is
a ROR-1-expressing cancer. In some embodiments, the
ROR-1-expressing cancer is a B cell leukemia, lymphoma, B cell
chronic lymphocytic leukemia (CLL), AML, acute myeloid leukemia
(AML), acute lymphocytic leukemia (ALL), Burkett's Lymphoma, mantle
cell lymphoma (MCL), non-small cell lung cancer (NSCLC),
neuroblastoma, renal cell carcinoma, colon cancer, colorectal
cancer, breast cancer, epithelial squamous cell cancer, melanoma,
myeloma, stomach cancer, brain cancer, lung cancer, pancreatic
cancer, cervical cancer, ovarian cancer, liver cancer, bladder
cancer, prostate cancer, testicular cancer, thyroid cancer, uterine
cancer, adrenal cancer or head and neck cancer.
[0065] In some embodiments, administration of the antibody or
receptor, or conjugate or cell containing the same, is associated
with a lower degree of immunogenicity as compared to administration
of a reference antibody (or receptor containing the reference
antibody) that competes for binding with the antibody or binds to
an overlapping epitope. In some aspects, the reference antibody is
a humanized, chimeric, or non-human antibody.
BRIEF DESCRIPTION OF THE DRAWINGS
[0066] FIG. 1A shows cytolytic activity of primary human CD8+ T
cells expressing various anti-ROR1 specific CARs against
ROR1-expressing cells. tEGFR alone is a negative control; R12 is
R12 scFv CAR. FIG. 1B shows cytokine secretion of primary human
CD8+ T cells expressing various anti-ROR1 specific CARs after
co-culture with ROR1-expressing cells. tEGFR alone is a negative
control; R12 is R12 scFv CAR.
[0067] FIG. 2 shows cytokine secretion of primary human CD8+ T
cells expressing various anti-ROR1 specific CARs after co-culture
with human ROR1-expressing cells (hROR1) or mouse ROR1-expressing
cells (mROR1). tEGFR alone is a negative control; R12 is R12 scFv
CAR.
DETAILED DESCRIPTION
[0068] Provided are ROR1-binding molecules, including antibodies
(including antigen-binding antibody fragments, such as heavy chain
variable (VH) regions and single chain fragments, including scFvs)
and recombinant receptors, including chimeric receptors containing
such antibodies and fragments, nucleic acids encoding such
antibodies and fragments, and cells, such as recombinant cells,
expressing and for production of these antibodies and fragments.
The invention also provides methods of making and using the
antibodies and fragments as well as cells expressing or containing
the antibodies and fragments.
I. ROR1 BINDING MOLECULES
[0069] Provided in some aspects are ROR1 binding molecules, such as
ROR1-binding polypeptides. Such binding molecules include
antibodies (including antigen-binding fragments) that specifically
bind to ROR1 proteins, such as human ROR1 protein. Also among the
binding molecules are polypeptides containing such antibodies,
including single chain cell surface proteins, e.g., recombinant
receptors such as chimeric antigen receptors, containing such
antibodies.
[0070] A. ROR1 Antibodies
[0071] Provided are anti-ROR1 antibodies, including functional
antibody fragments. In some embodiments, the antibodies include
those that are single domain antibodies, containing a variable
heavy chain that without pairing with a light chain antigen-binding
site and/or without any additional antibody domain or binding site
are capable of specifically binding to ROR1. Also among the
antibodies are multi-domain antibodies, such as those containing
V.sub.H and V.sub.L domains, comprised of the V.sub.H domain or
antigen-binding site thereof of the single-domain antibody. In some
embodiments, the antibodies include a variable heavy chain and a
variable light chain, such as scFvs. The antibodies include
antibodies that specifically bind to ROR1, e.g., human ROR1. Among
the provided anti-ROR1 antibodies are human antibodies. The
antibodies include isolated antibodies. The molecules include
isolated molecules. Also provided are molecules containing such
antibodies, e.g., single-chain proteins, fusion proteins, and/or
recombinant receptors such as chimeric receptors, including antigen
receptors.
[0072] The term "antibody" herein is used in the broadest sense and
includes polyclonal and monoclonal antibodies, including intact
antibodies and functional (antigen-binding) antibody fragments,
including fragment antigen binding (Fab) fragments, F(ab').sub.2
fragments, Fab' fragments, Fv fragments, recombinant IgG (rIgG)
fragments, variable heavy chain (V.sub.H) regions capable of
specifically binding the antigen, single chain antibody fragments,
including single chain variable fragments (scFv), and single domain
antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term
encompasses genetically engineered and/or otherwise modified forms
of immunoglobulins, such as intrabodies, peptibodies, chimeric
antibodies, fully human antibodies, humanized antibodies, and
heteroconjugate antibodies, multispecific, e.g., bispecific,
antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv,
tandem tri-scFv. Unless otherwise stated, the term "antibody"
should be understood to encompass functional antibody fragments
thereof. The term also encompasses intact or full-length
antibodies, including antibodies of any class or sub-class,
including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.
[0073] The terms "complementarity determining region," and "CDR,"
synonymous with "hypervariable region" or "HVR," are known in the
art to refer to non-contiguous sequences of amino acids within
antibody variable regions, which confer antigen specificity and/or
binding affinity. In general, there are three CDRs in each heavy
chain variable region (CDR-H1, CDR-H2, CDR-H3) and three CDRs in
each light chain variable region (CDR-L1, CDR-L2, CDR-L3).
"Framework regions" and "FR" are known in the art to refer to the
non-CDR portions of the variable regions of the heavy and light
chains. In general, there are four FRs in each full-length heavy
chain variable region (FR-H1, FR-H2, FR-H3, and FR-H4), and four
FRs in each full-length light chain variable region (FR-L1, FR-L2,
FR-L3, and FR-L4).
[0074] The precise amino acid sequence boundaries of a given CDR or
FR can be readily determined using any of a number of well-known
schemes, including those described by Kabat et al. (1991),
"Sequences of Proteins of Immunological Interest," 5th Ed. Public
Health Service, National Institutes of Health, Bethesda, Md.
("Kabat" numbering scheme), Al-Lazikani et al., (1997) JMB 273,
927-948 ("Chothia" numbering scheme), MacCallum et al., J. Mol.
Biol. 262:732-745 (1996), "Antibody-antigen interactions: Contact
analysis and binding site topography," J. Mol. Biol. 262, 732-745,"
("Contact" numbering scheme), Martin et al., Proc. Natl. Acad.
Sci., 86:9268-9272 (1989) ("AbM" numbering scheme), Lefranc M P et
al., "IMGT unique numbering for immunoglobulin and T cell receptor
variable domains and Ig superfamily V-like domains," Dev Comp
Immunol, 2003 January; 27(1):55-77 ("IMGT" numbering scheme), and
Honegger A and Pluckthun A, "Yet another numbering scheme for
immunoglobulin variable domains: an automatic modeling and analysis
tool," J Mol Biol, 2001 Jun. 8; 309(3):657-70, ("Aho" numbering
scheme).
[0075] The boundaries of a given CDR or FR may vary depending on
the scheme used for identification. For example, the Kabat scheme
is based structural alignments, while the Chothia scheme is based
on structural information. Numbering for both the Kabat and Chothia
schemes is based upon the most common antibody region sequence
lengths, with insertions accommodated by insertion letters, for
example, "30a," and deletions appearing in some antibodies. The two
schemes place certain insertions and deletions ("indels") at
different positions, resulting in differential numbering. The
Contact scheme is based on analysis of complex crystal structures
and is similar in many respects to the Chothia numbering
scheme.
[0076] Table 1, below, lists exemplary position boundaries of
CDR-L1, CDR-L2, CDR-L3 and CDR-H1, CDR-H2, CDR-H3 as identified by
Kabat, Chothia, and Contact schemes, respectively. For CDR-H1,
residue numbering is listed using both the Kabat and Chothia
numbering schemes. FRs are located between CDRs, for example, with
FR-L1 located between CDR-L1 and CDR-L2, and so forth. It is noted
that because the shown Kabat numbering scheme places insertions at
H35A and H35B, the end of the Chothia CDR-H1 loop when numbered
using the shown Kabat numbering convention varies between H32 and
H34, depending on the length of the loop.
TABLE-US-00001 TABLE 1 CDR Kabat Chothia AbM Contact CDR-L1
L24--L34 L24--L34 L24--L34 L30--L36 CDR-L2 L50--L56 L50--L56
L50--L56 L46--L55 CDR-L3 L89--L97 L89--L97 L89--L97 L89--L96 CDR-H1
H31--H35B H26--H32 . . . 34 H26--H35B H30--H35B (Kabat Num-
bering.sup.1) CDR-H1 H31--H35 H26--H32 H26--H35 H30--H35 (Chothia
Num- bering.sup.2) CDR-H2 H50--H65 H52--H56 H50--H58 H47--H58
CDR-H3 H95--H102 H95--H102 H95--H102 H93--H101 .sup.1Kabat et al.
(1991), "Sequences of Proteins of Immunological Interest," 5th Ed.
Public Health Service, National Institutes of Health, Bethesda, MD
.sup.2Al-Lazikani et al., (1997) JMB 273, 927-948
[0077] Thus, unless otherwise specified, a "CDR" or "complementary
determining region," or individual specified CDRs (e.g., "CDR-H1,
CDR-H2), of a given antibody or region thereof, such as a variable
region thereof, should be understood to encompass a (or the
specific) complementary determining region as defined by any of the
aforementioned schemes. For example, where it is stated that a
particular CDR (e.g., a CDR-H3) contains the amino acid sequence of
a corresponding CDR in a given V.sub.H or V.sub.L amino acid
sequence, it is understood that such a CDR has a sequence of the
corresponding CDR (e.g., CDR-H3) within the variable region, as
defined by any of the aforementioned schemes. In some embodiments,
specific CDR sequences are specified.
[0078] Likewise, unless otherwise specified, a FR or individual
specified FR(s) (e.g., FR-H1, FR-H2), of a given antibody or region
thereof, such as a variable region thereof, should be understood to
encompass a (or the specific) framework region as defined by any of
the known schemes. In some instances, the scheme for identification
of a particular CDR, FR, or FRs or CDRs is specified, such as the
CDR as defined by the Kabat, Chothia, or Contact method. In other
cases, the particular amino acid sequence of a CDR or FR is
given.
[0079] The term "variable region" or "variable domain" refers to
the domain of an antibody heavy or light chain that is involved in
binding the antibody to antigen. The variable domains of the heavy
chain and light chain (V.sub.H and V.sub.L, respectively) of a
native antibody generally have similar structures, with each domain
comprising four conserved framework regions (FRs) and three CDRs.
(See, e.g., Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman and
Co., page 91 (2007). A single V.sub.H or V.sub.L domain may be
sufficient to confer antigen-binding specificity. Furthermore,
antibodies that bind a particular antigen may be isolated using a
V.sub.H or V.sub.L domain from an antibody that binds the antigen
to screen a library of complementary V.sub.L or V.sub.H domains,
respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887
(1993); Clarkson et al., Nature 352:624-628 (1991).
[0080] Among the provided antibodies are antibody fragments. An
"antibody fragment" refers to a molecule other than an intact
antibody that comprises a portion of an intact antibody that binds
the antigen to which the intact antibody binds. Examples of
antibody fragments include but are not limited to Fv, Fab, Fab',
Fab'-SH, F(ab').sub.2; diabodies; linear antibodies; variable heavy
chain (V.sub.H) regions, single-chain antibody molecules such as
scFvs and single-domain V.sub.H single antibodies; and
multispecific antibodies formed from antibody fragments. In
particular embodiments, the antibodies are single-chain antibody
fragments comprising a variable heavy chain region and/or a
variable light chain region, such as scFvs.
[0081] Single-domain antibodies are antibody fragments comprising
all or a portion of the heavy chain variable domain or all or a
portion of the light chain variable domain of an antibody. In
certain embodiments, a single-domain antibody is a human
single-domain antibody.
[0082] Antibody fragments can be made by various techniques,
including but not limited to proteolytic digestion of an intact
antibody as well as production by recombinant host cells. In some
embodiments, the antibodies are recombinantly-produced fragments,
such as fragments comprising arrangements that do not occur
naturally, such as those with two or more antibody regions or
chains joined by synthetic linkers, e.g., peptide linkers, and/or
that are may not be produced by enzyme digestion of a
naturally-occurring intact antibody. In some aspects, the antibody
fragments are scFvs.
[0083] A "humanized" antibody is an antibody in which all or
substantially all CDR amino acid residues are derived from
non-human CDRs and all or substantially all FR amino acid residues
are derived from human FRs. A humanized antibody optionally may
include at least a portion of an antibody constant region derived
from a human antibody. A "humanized form" of a non-human antibody,
refers to a variant of the non-human antibody that has undergone
humanization, typically to reduce immunogenicity to humans, while
retaining the specificity and affinity of the parental non-human
antibody. In some embodiments, some FR residues in a humanized
antibody are substituted with corresponding residues from a
non-human antibody (e.g., the antibody from which the CDR residues
are derived), e.g., to restore or improve antibody specificity or
affinity.
[0084] Among the provided anti-ROR1 antibodies are human
antibodies. A "human antibody" is an antibody with an amino acid
sequence corresponding to that of an antibody produced by a human
or a human cell, or non-human source that utilizes human antibody
repertoires or other human antibody-encoding sequences, including
human antibody libraries. The term excludes humanized forms of
non-human antibodies comprising non-human antigen-binding regions,
such as those in which all or substantially all CDRs are non-human.
The term includes antigen-binding fragments of human
antibodies.
[0085] Human antibodies may be prepared by administering an
immunogen to a transgenic animal that has been modified to produce
intact human antibodies or intact antibodies with human variable
regions in response to antigenic challenge. Such animals typically
contain all or a portion of the human immunoglobulin loci, which
replace the endogenous immunoglobulin loci, or which are present
extrachromosomally or integrated randomly into the animal's
chromosomes. In such transgenic animals, the endogenous
immunoglobulin loci have generally been inactivated. Human
antibodies also may be derived from human antibody libraries,
including phage display and cell-free libraries, containing
antibody-encoding sequences derived from a human repertoire.
[0086] Among the provided antibodies are monoclonal antibodies,
including monoclonal antibody fragments. The term "monoclonal
antibody" as used herein refers to an antibody obtained from or
within a population of substantially homogeneous antibodies, i.e.,
the individual antibodies comprising the population are identical,
except for possible variants containing naturally occurring
mutations or arising during production of a monoclonal antibody
preparation, such variants generally being present in minor
amounts. In contrast to polyclonal antibody preparations, which
typically include different antibodies directed against different
epitopes, each monoclonal antibody of a monoclonal antibody
preparation is directed against a single epitope on an antigen. The
term is not to be construed as requiring production of the antibody
by any particular method. A monoclonal antibody may be made by a
variety of techniques, including but not limited to generation from
a hybridoma, recombinant DNA methods, phage-display and other
antibody display methods.
[0087] The terms "polypeptide" and "protein" are used
interchangeably to refer to a polymer of amino acid residues, and
are not limited to a minimum length. Polypeptides, including the
provided antibodies and antibody chains and other peptides, e.g.,
linkers and ROR1-binding peptides, may include amino acid residues
including natural and/or non-natural amino acid residues. The terms
also include post-expression modifications of the polypeptide, for
example, glycosylation, sialylation, acetylation, phosphorylation,
and the like. In some aspects, the polypeptides may contain
modifications with respect to a native or natural sequence, as long
as the protein maintains the desired activity. These modifications
may be deliberate, as through site-directed mutagenesis, or may be
accidental, such as through mutations of hosts which produce the
proteins or errors due to PCR amplification.
[0088] Exemplary Antibodies
[0089] In some embodiments, the antibody, e.g., the anti-ROR1
antibody, e.g., antigen-binding antibody fragment, contains a heavy
and/or light chain variable (V.sub.H or V.sub.L) region sequence as
described, or a sufficient antigen-binding portion thereof. In some
embodiments, the anti-ROR1 antibody, e.g., antigen-binding antibody
fragment, contains a V.sub.H region sequence or sufficient
antigen-binding portion thereof that contains a CDR-H1, CDR-H2
and/or CDR-H3 as described. In some embodiments, the anti-ROR1
antibody, e.g., antigen-binding antibody fragment, contains a
V.sub.L region sequence or sufficient antigen-binding portion that
contains a CDR-L1, CDR-L2 and/or CDR-L2 as described. In some
embodiments, the anti-ROR1 antibody, e.g., antigen-binding antibody
fragment, contains a V.sub.H region sequence that contains a
CDR-H1, CDR-H2 and/or CDR-H3 as described and contains a V.sub.L
region sequence that contains a CDR-L1, CDR-L2 and/or CDR-L2 as
described. Also among the provided antibodies are those having
sequences at least at or about 90, 91, 92, 93, 94, 95, 96, 97, 98,
or 99% identical to such a sequence.
[0090] In some embodiments, the antibody, e.g., antigen-binding
fragment thereof, has a heavy chain variable (VH) region having the
amino acid sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17 or
19, or an amino acid sequence that has at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the V.sub.H
region amino acid sequence set forth in SEQ ID NO: 8, 10, 13, 15,
17, or 19, or contains a CDR-H1, CDR-H2, and/or CDR-H3 present in
such a V.sub.H sequence.
[0091] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a heavy chain complementarity
determining region 3 (CDR-H3) that contains the amino acid
sequence:
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.-
sub.11X.sub.12X.sub.13X.sub.14X.sub.15X.sub.16 (SEQ ID NO: 92),
wherein X.sub.1 is D, V, Q, I, T, G, A, or E; X.sub.2 is S, F, N,
R, G, T, Y, D, Q, M, K, I, L, or P; X.sub.3 is S, N, G, E, D, P, I,
V, R, F, N, or L; X.sub.4 is Y, R, V, G, S, P, E, A, or L; X.sub.5
is D, E, W, R, S, L, A, V, G, or P; X.sub.6 is A, W, S, E, G, Y, R,
F, H, V, D, S, or Q; X.sub.7 is F, Y, A, W, L, G, D, V, N, S, K, or
R; X.sub.8 is F, Y, H, E, L, W, V, N, I, D, or null; X.sub.9 is F,
L, V, S, E, W, G, P, Y, or null; X.sub.10 is S, E, L, Y, W, F, N,
G, P, or null; X.sub.11 is Y, V, L, F, I, W, N, or null; X.sub.12
is F, Y, W, or null; X.sub.13 is Y, F, T, or null; X.sub.14 is F or
null; X.sub.15 is D or Q; and X.sub.16 is I, Y, or P. In some such
embodiments, in said CDR-H3, X.sub.1 is D or V; X.sub.2 is S or F;
X.sub.3 is S, N, G, or E; X.sub.4 is Y, R, or V; X.sub.5 is D, E,
W, or R; X.sub.6 is A, Y, S, or E; X.sub.7 is F, Y, or A; X.sub.8
is F, Y, H, or null; X.sub.9 is F, L, or null; X.sub.10 is S or
null; X.sub.11 is Y or null; X.sub.12 is F or null; X.sub.13 is
null; X.sub.14 is null; X.sub.15 is D; and X.sub.16 is I or Y. In
some such embodiments, in said CDR-H3, X.sub.1 is V or D; X.sub.2
is S or F; X.sub.3 is N or G; X.sub.4 is Y or R; X.sub.5 is E or W;
X.sub.6 is Y or G; X.sub.7 is Y; X.sub.8 is F or Y; X.sub.9 is F or
null; X.sub.10 is null; X.sub.11 is null; X.sub.12 is null;
X.sub.13 is null; X.sub.14 is null; X.sub.15 is D; and X.sub.16 is
Y.
[0092] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a CDR-H3 that contains the amino acid
sequence:
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.-
sub.11X.sub.12DX.sub.14 (SEQ ID NO: 93), wherein X.sub.1 is D or V;
X.sub.2 is S or F; X.sub.3 is S, N, G, or E; X.sub.4 is Y, R, or V;
X.sub.5 is D, E, W, or R; X.sub.6 is A, Y, S, or E; X.sub.7 is F,
Y, or A; X.sub.8 is F, Y, H, or null; X.sub.9 is F, L, or null;
X.sub.10 is S or null; X.sub.11 is Y or null; X.sub.12 is F or
null; and X.sub.14 is I or Y.
[0093] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a CDR-H3 that contains the amino acid
sequence:
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6YX.sub.8X.sub.9DY (SEQ ID
NO: 94), wherein X.sub.1 is V or D; X.sub.2 is S or F; X.sub.3 is N
or G; X.sub.4 is Y or R; X.sub.5 is E or W; X.sub.6 is Y or G;
X.sub.8 is F or Y; and X.sub.9 is F or null.
[0094] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a CDR-H3 that contains the amino acid
sequence: X.sub.1SX.sub.3YX.sub.5X.sub.6X.sub.7X.sub.8DX.sub.10
(SEQ ID NO: 109), wherein X.sub.1 is V or D; X.sub.3 is S or N;
X.sub.5 is D or E; X.sub.6 is Y or A; X.sub.7 is F or Y; X.sub.8 is
F or null; and X.sub.10 is I or Y.
[0095] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a CDR-H3 that contains the amino acid
sequence: VX.sub.2X.sub.3X.sub.4EYYFDY (SEQ ID NO: 110), wherein
X.sub.2 is S or N or R; X.sub.3 is N or G; X.sub.4 is Y or G or
S.
[0096] In some embodiments, the provided antibody contains a CDR-H3
having the amino acid sequence set forth in SEQ ID NO: 22, 29, 35,
45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65,
66, 67, 68, 69, 70, 71 or 174. In any of such examples, the
provided antibody can contain a V.sub.H region sequence set forth
in any of SEQ ID NOs: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178,
179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191,
192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204,
205, 206, 207, 208 or 209 in which the corresponding CDR-H3
sequence contained therein (e.g. corresponding to amino acid
residues H95-H102 by Kabat numbering) is replaced by the CDR-H3
sequence set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71 or 174.
[0097] In some embodiments, the provided antibody contains a CDR-H3
having the amino acid sequence set forth in SEQ ID NO: 22, 29, 35,
45, or 52. In some embodiments, the provided antibody contains a
CDR-H3 set forth in SEQ ID NO: 22, 29 or 35. In some embodiments,
the provided antibody contains a CDR-H3 set forth in SEQ ID NO: 29
or 35. In some embodiments, the provided antibody contains a CDR-H3
having the amino acid sequence set forth in SEQ ID NO: 29 or 52. In
some embodiments, the provided antibody contains a CDR-H3 contained
within the CDR-H3 of the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205,
206, 207, 208 or 209. In some embodiments, the provided antibody
contains a CDR-H3 contained within the CDR-H3 of the V.sub.H region
amino acid sequence set forth in SEQ ID NO: 8 or 10. In some
embodiments, the provided antibody contains a CDR-H3 contained
within the CDR-H3 of the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 10, 13, 15, 17 or 19. In some embodiments, the
provided antibody contains a CDR-H3 contained within the CDR-H3 of
the V.sub.H region amino acid sequence set forth in SEQ ID NO: 13,
15 or 19. In some embodiments, the provided antibody contains a
CDR-H3 contained within the CDR-H3 of the V.sub.H region amino acid
sequence set forth in SEQ ID NO: 13 or 15.
[0098] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a heavy chain complementarity
determining region 1 (CDR-H1) that contains the amino acid
sequence: X.sub.1X.sub.2X.sub.3MX.sub.5 (SEQ ID NO: 95), wherein
X.sub.1 is S, D, or N; X.sub.2 is Y or A; X.sub.3 is Y, A, or W;
and X.sub.5 is H or S. In some embodiments, in said CDR-H1, X.sub.1
is D or N; X.sub.2 is Y or A; X.sub.3 is A or W; and X.sub.5 is
S.
[0099] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a CDR-H1 that contains the amino acid
sequence: X.sub.1X.sub.2X.sub.3MS (SEQ ID NO: 97), wherein X.sub.1
is D or N; X.sub.2 is Y or A; and X.sub.3 is A or W.
[0100] In some embodiments, the provided antibody contains a CDR-H1
having the amino acid sequence set forth in SEQ ID NO: 20, 27, 33,
155, 156, 157, 158, 159, 160, 161, 162 or 163. In some embodiments,
the provided antibody contains a CDR-H1 having the amino acid
sequence set forth in SEQ ID NO: 269, 270, 271, 272, 273, 274, 275,
276, 277, 278 or 279. In some embodiments, the provided antibody
contains a CDR-H1 having the amino acid sequence set forth in SEQ
ID NO: 75, 77, 79, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289
or 290. In some embodiments, the provided antibody contains a
CDR-H1 having the amino acid sequence set forth in SEQ ID NO: 20,
27, 33, 75, 77, 79, 269, 270 or 271. In some embodiments, the
provided antibody contains a CDR-H1 having the amino acid sequence
set forth in SEQ ID NO: 27, 33, 77, 79, 270 or 271. In some
embodiments, the provided antibody contains a CDR-H1 having the
amino acid sequence set forth in SEQ ID NO: 74, 76 or 78. In some
embodiments, the provided antibody contains a CDR-H1 contained
within the CDR-H1 of the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205,
206, 207, 208 or 209. In some embodiments, the provided antibody
contains a CDR-H1 contained within the CDR-H1 of the V.sub.H region
amino acid sequence set forth in SEQ ID NO: 8 or 10. In some
embodiments, the provided antibody contains a CDR-H1 contained
within the CDR-H1 of the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 10, 13, 15, 17 or 19. In some embodiments, the
provided antibody contains a CDR-H1 contained within the CDR-H1 of
the V.sub.H region amino acid sequence set forth in SEQ ID NO: 13,
15 or 19. In some embodiments, the provided antibody contains a
CDR-H1 contained within the CDR-H1 of the V.sub.H region amino acid
sequence set forth in SEQ ID NO: 13 or 15.
[0101] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a heavy chain complementarity
determining region 2 (CDR-H2) that contains the amino acid
sequence:
X.sub.1IX.sub.3X.sub.4X.sub.5X.sub.6X.sub.7GX.sub.9X.sub.10TX.sub.12X.sub-
.13AX.sub.15X.sub.16X.sub.17X.sub.18G (SEQ ID NO: 96), wherein
X.sub.1 is I, S, or R; X.sub.3 is N, S, or K; X.sub.4 is P, G, or
S; X.sub.5 is K or null; X.sub.6 is T or null; X.sub.7 is 5, D, or
N; X.sub.9 is G or R; X.sub.10 is S or T; X.sub.12 is S or D;
X.sub.13 is Y or H; X.sub.15 is Q, D, or A; X.sub.16 is K, Y, or P;
X.sub.17 is F or V; and X.sub.18 is Q or K. In some embodiments in
said CDR-H2, X.sub.1 is S or R; X.sub.3 is S or K; X.sub.4 is G or
S; X.sub.5 is K or null; X.sub.6 is T or null; X.sub.7 is S or D;
X.sub.9 is G or R; X.sub.10 is S or T; X.sub.12 is D; X.sub.13 is Y
or H; X.sub.15 is D or A; X.sub.16 is Y or P; X.sub.17 is F; and
X.sub.18 is K
[0102] In some embodiments, the V.sub.H region of the anti-ROR1
antibody is one that includes a CDR-H2 that contains the amino acid
sequence:
X.sub.1IX.sub.3X.sub.4X.sub.5X.sub.6X.sub.7GX.sub.9X.sub.10TX.sub.12X.sub-
.13AX.sub.15X.sub.16X.sub.17X.sub.18G (SEQ ID NO: 98), wherein
X.sub.1 is I, S, or R; X.sub.3 is N, S, or K; X.sub.4 is P, G, or
S; X.sub.5 is K or null; X.sub.6 is T or null; X.sub.7 is S, D, or
N; X.sub.9 is G or R; X.sub.10 is S or T; X.sub.12 is S or D;
X.sub.13 is Y or H; X.sub.15 is Q, D, or A; X.sub.16 is K, Y, or P;
X.sub.17 is F or V; and X.sub.18 is Q or K.
[0103] In some embodiments, the provided antibody contains a CDR-H2
having the amino acid sequence set forth in SEQ ID NO: 21, 26, 28,
34, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173 or 318. In
some embodiments, the provided antibody contains a CDR-H2 having
the amino acid sequence set forth in SEQ ID NO: 291, 292, 293, 294,
295, 296, 297, 298, 299, 300, 301, 302 or 303. In some embodiments,
the provided antibody contains a CDR-H2 having the amino acid
sequence set forth in SEQ ID NO: 304, 305, 306, 307, 308, 309, 310,
311, 312, 313, 314, 315, 316 or 317. In some embodiments, the
provided antibody contains a CDR-H2 having the amino acid sequence
set forth in SEQ ID NO: 21, 26, 28, 34, 291, 292, 293, 294, 304,
305, 306, 307. In some embodiments, the provided antibody contains
a CDR-H2 having the amino acid sequence set forth in SEQ ID NO: 26,
28, 34, 291, 292, 294, 304, 305 or 307. In some embodiments, the
provided antibody contains a CDR-H2 having the amino acid sequence
set forth in SEQ ID NO: 28, 34, 291, 292, 304 or 305. In some
embodiments, the provided antibody contains a CDR-H2 having the
amino acid sequence set forth in SEQ ID NO: 80, 81, 82 or 83. In
some embodiments, the provided antibody contains a CDR-H2 contained
within the CDR-H2 of the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205,
206, 207, 208 or 209. In some embodiments, the provided antibody
contains a CDR-H2 contained within the CDR-H2 of the V.sub.H region
amino acid sequence set forth in SEQ ID NO:8 or 10. In some
embodiments, the provided antibody contains a CDR-H2 contained
within the CDR-H2 of the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 10, 13, 15, 17 or 19. In some embodiments, the
provided antibody contains a CDR-H2 contained within the CDR-H2 of
the V.sub.H region amino acid sequence set forth in SEQ ID NO: 13,
15 or 19. In some embodiments, the provided antibody contains a
CDR-H2 contained within the CDR-H2 of the V.sub.H region amino acid
sequence set forth in SEQ ID NO: 13 or 15.
[0104] In some embodiments, the provided antibody contains a CDR-H1
having the amino acid sequence set forth in SEQ ID NO: 20, 27, 33,
155, 156, 157, 158, 159, 160, 161, 162 or 163; a CDR-H2 having the
amino acid sequence set forth in SEQ ID NO: 21, 26, 28, 34, 164,
165, 166, 167, 168, 169, 170, 171, 172, 173 or 318; and a CDR-H3
having the amino acid sequence set forth in SEQ ID NO: 22, 29, 35,
45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65,
66, 67, 68, 69, 70, 71 or 174. In some embodiments, the provided
antibody contains a CDR-H1 having the amino acid sequence set forth
in SEQ ID NO: 269, 270, 271, 272, 273, 274, 275, 276, 277, 278 or
279; a CDR-H2 having the amino acid sequence set forth in SEQ ID
NO: 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302 or
303; and a CDR-H3 having the amino acid sequence set forth in SEQ
ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60,
61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174. In some
embodiments, the provided antibody contains a CDR-H1 having the
amino acid sequence set forth in SEQ ID NO: 75, 77, 79, 280, 281,
282, 283, 284, 285, 286, 287, 288 or 289; a CDR-H2 having the amino
acid sequence set forth in SEQ ID NO: 304, 305, 306, 307, 308, 309,
310, 311, 312, 313, 314, 315, 316 or 317; and a CDR-H3 having the
amino acid sequence set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51,
52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68,
69, 70, 71 or 174.
[0105] In some embodiments, the provided antibody contains a CDR-H1
having the amino acid sequence set forth in SEQ ID NO: 20, 27, 33,
75, 77, 79, 269, 270, or 271, a CDR-H2 having the amino acid
sequence set forth in SEQ ID NO: 21, 26, 28, 34, 291, 292, 293,
294, 304, 305 306 or 307; and a CDR-H3 having the amino acid
sequence set forth in SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71 or 174. In some embodiments, the provided antibody contains a
CDR-H1 having the amino acid sequence set forth in SEQ ID NO: 20,
27, 33, 75, 77, 79, 269, 270, or 271; a CDR-H2 having the amino
acid sequence set forth in SEQ ID NO: 21, 26, 28, 34, 291, 292,
293, 294, 304, 305 306 or 307; and a CDR-H3 having the amino acid
sequence set forth in SEQ ID NO: 22, 29, 35 or 52. In some
embodiments, the provided antibody contains a CDR-H1 having the
amino acid sequence set forth in SEQ ID NO: 27, 33, 77, 79, 269,
271; a CDR-H2 having the amino acid sequence set forth in SEQ ID
NO: 28, 34, 291, 292, 304 or 305; and a CDR-H3 having the amino
acid sequence set forth in SEQ ID NO: 29 or 352.
[0106] In some embodiments, the CDR-H1, CDR-H2 and CDR-H3 contain
the sequences of SEQ ID NOS: 20, 21, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 20,
26, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 27, 28, and 29, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 33,
34, and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 33, 34, and 52, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 27,
164 and 45, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 27, 164 and 68, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 27,
164 and 64, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 27, 164 and 66, respectively; the
CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 33,
318, and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 33, 34 and 70, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 33,
34 and 55, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 33, 34 and 53, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 33, 34 and
56, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 33, 34 and 61, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 33, 34 and
59, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 33, 171 and 60, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 155, 34 and
35, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 156, 34 and 35, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 162, 170
and 50, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 162, 170 and 51, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 161, 169
and 54, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs:159, 167 and 57, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 160, 168
and 58, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 158, 166 and 62, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 158, 166
and 63, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 158, 166 and 65, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 157, 165
and 67, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 163, 173 and 69, respectively; the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 160, 172,
71, respectively; or the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 160, 172, 174, respectively.
[0107] In some embodiments, the CDR-H1, CDR-H2 and CDR-H3 contain
the sequences of SEQ ID NOS: 269, 293, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs:
269, 294, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3
contain the sequences of SEQ ID NOs: 270, 292, and 29,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291, and 35, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291, and 35,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291, and 52, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291, and 52,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 270, 296 and 45, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 270, 296 and 68,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 270, 296 and 64, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 270, 296 and 66,
respectively; the CDR-H1, CDR-H2, and CDR-H3 having the sequences
of SEQ ID NOs: 271, 295, and 35, respectively; the CDR-H1, CDR-H2,
and CDR-H3 having the sequences of SEQ ID NOs: 276, 295, and 35,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 70, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 70,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 55, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 55,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 53, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 53,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 56, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 56,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 61, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 61,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 59, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 59,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291 and 60, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 276, 291 and 60,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 274, 291 and 35, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 275, 291 and 35,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 273, 302 and 50, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 273, 302 and 51,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 279, 301 and 54, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs:277, 299 and 57,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 278, 300 and 58, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 273, 298 and 62,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 273, 298 and 63, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 273, 298 and 65,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 272, 297 and 67, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 273, 303 and 69,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 278, 300, 71, respectively; or the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 278, 300, 174,
respectively.
[0108] In some embodiments, the CDR-H1, CDR-H2 and CDR-H3 contain
the sequences of SEQ ID NOS: 75, 306, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 75,
307, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 77, 305, and 29, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 79,
304, and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 79, 304, and 52, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 77,
309 and 45, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 77, 309 and 68, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 77,
309 and 64, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 77, 309 and 66, respectively; the
CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ ID NOs: 79,
308, and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 79, 304 and 70, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 79,
304 and 55, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 284, 304 and 55, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 79,
304 and 53, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 79, 304 and 56, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 79,
304 and 61, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 79, 304 and 59, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 79,
304 and 60, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 280, 304 and 35, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs:
283, 304 and 35, respectively; the CDR-H1, CDR-H2, and CDR-H3
contain the sequences of SEQ ID NOs: 288, 315 and 50, respectively;
the CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs:
288, 315 and 51, respectively; the CDR-H1, CDR-H2, and CDR-H3
contain the sequences of SEQ ID NOs: 287, 314 and 54, respectively;
the CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID
NOs:285, 312 and 57, respectively; the CDR-H1, CDR-H2, and CDR-H3
contain the sequences of SEQ ID NOs: 286 or 289, 313 and 58,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 282, 311 and 62, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 282, 311 and 63,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 282, 311 and 65, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 281, 310 and 67,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 290, 317 and 69, respectively; the CDR-H1, CDR-H2,
and CDR-H3 contain the sequences of SEQ ID NOs: 286 or 289, 316,
71, respectively; or the CDR-H1, CDR-H2, and CDR-H3 contain the
sequences of SEQ ID NOs: 286 or 289, 316, 174, respectively.
[0109] In some embodiments, the CDR-H1, CDR-H2 and CDR-H3 contain
the sequences of SEQ ID NOS: 20, 80, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 20,
83, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 27, 81, and 29, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 33,
82, and 35, respectively; or the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 33, 82, and 52, respectively.
[0110] In some embodiments, the CDR-H1, CDR-H2 and CDR-H3 contain
the sequences of SEQ ID NOS: 269, 293, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs:
269, 294, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3
contain the sequences of SEQ ID NOs: 270, 292, and 29,
respectively; the CDR-H1, CDR-H2, and CDR-H3 contain the sequences
of SEQ ID NOs: 271, 291, and 35, respectively; or the CDR-H1,
CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 271, 291,
and 52, respectively.
[0111] In some embodiments, the CDR-H1, CDR-H2 and CDR-H3 contain
the sequences of SEQ ID NOS: 75, 306, and 22, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 75,
307, and 22, respectively; the CDR-H1, CDR-H2, and CDR-H3 contain
the sequences of SEQ ID NOs: 77, 305, and 29, respectively; the
CDR-H1, CDR-H2, and CDR-H3 contain the sequences of SEQ ID NOs: 79,
304, and 35, respectively; or the CDR-H1, CDR-H2, and CDR-H3
contain the sequences of SEQ ID NOs: 79, 304, and 52,
respectively.
[0112] In some embodiments, the provided antibody contains a
CDR-H1, CDR-H2 and CDR-H3, respectively, contained within the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 8, 10,
13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184,
185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197,
198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or 209. In
some embodiments, the provided antibody contains a CDR-H1, CDR-H2
and CDR-H3, respectively, contained within the V.sub.H region amino
acid sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19. In
some embodiments, the provided antibody contains a CDR-H1, CDR-H2
and CDR-H3, respectively, contained within the V.sub.H region amino
acid sequence set forth in SEQ ID NO: 8 or 10. In some embodiments,
the provided antibody contains a CDR-H1, CDR-H2 and CDR-H3,
respectively, contained within the V.sub.H region amino acid
sequence set forth in SEQ ID NO: 10, 13, 15, 17 or 19. In some
embodiments, the provided antibody contains a CDR-H1, CDR-H2 and
CDR-H3, respectively, contained within the V.sub.H region amino
acid sequence set forth in SEQ ID NO: 13, 15 or 19. In some
embodiments, the provided antibody contains a CDR-H1, CDR-H2 and
CDR-H3, respectively, contained within the V.sub.H region amino
acid sequence set forth in SEQ ID NO: 13 or 15.
[0113] In some embodiments, the V.sub.H region contains any of the
CDR-H1, CDR-H2 and CDR-H3 as described and contains a framework
region that contains at least 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99% sequence identity to the framework region set forth
in the V.sub.H region amino acid sequence set forth in SEQ ID NO:
8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or 209.
In some embodiments, the anti-ROR1 antibody can contain a CDR-H1,
CDR-H2 and CDR-H3, respectively, contained within the V.sub.H
region amino acid sequence set forth in SEQ ID NO: 8, 10, 13, 15,
17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186,
187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 202, 203, 204, 205, 206, 207, 208 or 209, and a frame
work region that contains at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99% sequence identity to the framework region of the
amino acid sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19,
175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187,
188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200,
201, 202, 203, 204, 205, 206, 207, 208 or 209.
[0114] In some embodiments, the V.sub.H region contains any of the
CDR-H1, CDR-H2 and CDR-H3 as described and contains a framework
region that contains at least 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99% sequence identity to the framework region set forth
in the V.sub.H region amino acid sequence set forth in SEQ ID NO:
8, 10, 13, 15, 17, or 19. For example, the anti-ROR1 antibody can
contain a CDR-H1, CDR-H2 and CDR-H3, respectively, contained within
the V.sub.H region amino acid sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, or 19, and a frame work region that contains at
least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence
identity to the framework region of the amino acid sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
[0115] In some embodiments, the provided antibody contains a
V.sub.H region that has the sequence of amino acids set forth in
SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180,
181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193,
194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,
207, 208 or 209. In some embodiments, the provided antibody
contains a V.sub.H region that has the sequence of amino acids set
forth in SEQ ID NO: 8, 10, 13, 15, 17 or 19. In some embodiments,
the provided antibody contains a V.sub.H region that has the
sequence of amino acids set forth in SEQ ID NO: 10, 13, 15 or 19.
In some embodiments, the provided antibody contains a V.sub.H
region that has the sequence of amino acids set forth in SEQ ID NO:
13, 15 or 19. In some embodiments, the provided antibody contains a
V.sub.H region that has the sequence of amino acids set forth in
SEQ ID NO: 13 or 15.
[0116] Also provided are antibodies having sequences at least at or
about at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identical to such sequences.
[0117] In some embodiments, the antibody is a single domain
antibody (sdAb) containing only the V.sub.H region sequence, such
as any of the above described V.sub.H region sequences, or a
sufficient antigen-binding portion thereof.
[0118] In some embodiments, the anti-ROR1 antibody containing a
V.sub.H region further contains a light chain or a sufficient
antigen binding portion thereof. For example, in some embodiments,
the antibody contains a V.sub.H region and a V.sub.L region, or a
sufficient antigen-binding portion of a V.sub.H and V.sub.L region.
In such embodiments, a V.sub.H region sequence can be any of the
above described V.sub.H sequence. In some such embodiments, the
antibody is an antigen-binding fragment, such as a Fab or a scFv.
In some such embodiments, the antibody is a full-length or intact
antibody that also contains a constant region.
[0119] In some embodiments, the antibody, e.g., antigen-binding
fragment thereof, has a light chain variable (VL) region having the
amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235,
236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or 248,
or an amino acid sequence that has at least 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the V.sub.H
region amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234,
235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or
248. In some embodiments, the antibody, e.g., antigen-binding
fragment thereof, has a light chain variable (VL) region having the
amino acid sequence set forth in SEQ ID NO: 14, 16, or 18, or an
amino acid sequence that has at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, or 99% sequence identity to the V.sub.H region amino
acid sequence set forth in SEQ ID NO: 14, 16, or 18.
[0120] In some embodiments, the V.sub.L region of the anti-ROR1
antibody is one that includes a light chain complementarity
determining region 3 (CDR-L3) that contains the amino acid
sequence:
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.-
sub.11X.sub.12X.sub.13X.sub.14 (SEQ ID NO: 99), wherein X.sub.1 is
Q, A, or K; X.sub.2 is Q, V, A, or S; X.sub.3 is Y, W, or L;
X.sub.4 is E, D, K, or N; X.sub.5 is S, D, N, or G; X.sub.6 is L,
T, S, D, R, or Y; X.sub.7 is P, G, L, S, N, or T; X.sub.8 is D, S,
N, or null; X.sub.9 is H, G, L, or null; X.sub.10 is Y, P, V, R, H,
or L; and X.sub.11 is T, V, S, or M. In some embodiments, in said
CDR-L3, X.sub.1 is Q or A; X.sub.2 is Q, V, or A; X.sub.3 is Y or
W; X.sub.4 is E or D; X.sub.5 is S or D; X.sub.6 is L, T, or S;
X.sub.7 is P, G, or L; X.sub.8 is D, S, or null; X.sub.9 is H, G,
or null; X.sub.10 is Y, P, or V; and X.sub.11 is T or V.
[0121] In some embodiments, the V.sub.L region of the anti-ROR1
antibody is one that includes a light chain complementarity
determining region 3 (CDR-L3) that contains the amino acid
sequence:
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.-
sub.11X.sub.12X.sub.13X.sub.14 (SEQ ID NO: 100), wherein X.sub.1 is
Q or A; X.sub.2 is Q, V, or A; X.sub.3 is Y or W; X.sub.4 is E or
D; X.sub.5 is S or D; X.sub.6 is L, T, or S; X.sub.7 is P, G, or L;
X.sub.8 is D, S, or null; X.sub.9 is H, G, or null; X.sub.10 is Y,
P, or V; and X.sub.11 is T or V.
[0122] In some embodiments, the provided antibody contains a CDR-L3
having the amino acid sequence set forth in SEQ ID NO: 25, 32, 38,
39, 40, 41, 42, 43, 44, 46, 47, 48, 49, 232 or 233. In some
embodiments, the provided antibody can contain a V.sub.L region
sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237,
238, 239, 240, 241, 242, 243, 244, 245, 246, 247 or 248 in which
the corresponding CDR-L3 sequence contained therein (e.g.
corresponding to amino acid residues L89 to L97 by Kabat numbering)
is replaced by the CDR-L3 sequence set forth in SEQ ID NO: 25, 32,
38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49, 232 or 233. In some
embodiments, the provided antibody can contain a V.sub.L region
sequence set forth in SEQ ID NO: 14, 16, or 18 in which the
corresponding CDR-L3 sequence contained therein (e.g. corresponding
to amino acid residues L89 to L97 by Kabat numbering) is replaced
by the CDR-L3 sequence set forth in SEQ ID NO: 25, 32, 38, 39, 40,
41, 42, 43, 44, 46, 47, 48, and 49.
[0123] In some embodiments, the provided antibody contains a CDR-L3
having the amino acid sequence set forth in SEQ ID NO: 25, 32, or
38. In some embodiments, the provided antibody contains a CDR-L3
contained within the CDR-L3 of the V.sub.L region amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18. In some
embodiments, the provided antibody contains a CDR-L3 having the
amino acid sequence set forth in SEQ ID NO: 32, or 38. In some
embodiments, the provided antibody contains a CDR-L3 contained
within the CDR-L3 of the V.sub.L region amino acid sequence set
forth in SEQ ID NO: 14 or 16.
[0124] In some embodiments, the V.sub.L region of the anti-ROR1
antibody is one that includes a light chain complementarity
determining region 1 (CDR-L1) that contains the amino acid
sequence:
X.sub.1X.sub.2SX.sub.4X.sub.5X.sub.6X.sub.7X.sub.8SX.sub.10X.sub.11X.sub.-
12X.sub.13 (SEQ ID NO: 101), wherein X.sub.1 is Q, G, or S; X.sub.2
is A or G; X.sub.4 is Q, N, or S; X.sub.5 is S or null; X.sub.6 is
N or null; X.sub.7 is D or I; X.sub.8 is I or G; X.sub.10 is N or
E; X.sub.11 is Y or S; X.sub.12 is L or V; and X.sub.13 is N or
Y.
[0125] In some embodiments, the provided antibody contains a CDR-L1
having the amino acid sequence set forth in SEQ ID NO: 23, 30, 36,
210, 211, 212, 213, 214, 215, 217, 216, 218, 219 or 220. In some
embodiments, the provided antibody contains a CDR-L1 contained
within the CDR-L1 of the V.sub.L region amino acid sequence set
forth in SEQ ID NO: 234, 235, 236, 237, 238, 239, 240, 241, 242,
243, 244, 245, 246, 247 or 248. In some embodiments, the provided
antibody contains a CDR-L1 having the amino acid sequence set forth
in SEQ ID NO: 23, 30, or 36. In some embodiments, the provided
antibody contains a CDR-L1 contained within the CDR-L1 of the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18.
[0126] In some embodiments, the V.sub.L region of the anti-ROR1
antibody is one that includes a light chain complementarity
determining region 2 (CDR-L2) that contains the amino acid sequence
of X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7 (SEQ ID NO:
102), wherein X.sub.1 is D or R; X.sub.2 is A, T, or N; X.sub.3 is
S, T, or N; X.sub.4 is Y, D, or Q; X.sub.5 is L or R; X.sub.6 is E
or P; and X.sub.7 is T or S.
[0127] In some embodiments, the provided antibody contains a CDR-L2
having the amino acid sequence set forth in SEQ ID NO: 24, 31, 37,
221, 222, 223, 224, 225, 226, 227, 228, 229, 230 or 231. In some
embodiments, the provided antibody contains a CDR-L2 contained
within the CDR-L2 of the V.sub.L region amino acid sequence set
forth in SEQ ID NO: 234, 235, 236, 237, 238, 239, 240, 241, 242,
243, 244, 245, 246, 247 or 248. In some embodiments, the provided
antibody contains a CDR-L2 having the amino acid sequence set forth
in SEQ ID NO: 24, 31, or 37. In some embodiments, the provided
antibody contains a CDR-L2 contained within the CDR-L2 of the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18.
[0128] In some embodiments, the provided antibody contains a CDR-L1
having the amino acid sequence set forth in SEQ ID NO: 23, 30, 36,
210, 211, 212, 213, 214, 215, 216, 217, 218, 219 or 220; a CDR-L2
having the amino acid sequence set forth in SEQ ID NO: 24, 31, 37,
221, 222, 223, 224, 225, 226, 227, 228, 229, 230 or 231; and a
CDR-L3 having the amino acid sequence set forth in SEQ ID NO: 25,
32, 38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49 or 233. In some
embodiments, the provided antibody contains a CDR-L1 having the
amino acid sequence set forth in SEQ ID NO: 23, 30, or 36; a CDR-L2
having the amino acid sequence set forth in SEQ ID NO: 24, 31, or
37; and a CDR-L3 having the amino acid sequence set forth in SEQ ID
NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47, 48 49 or 233. In
some embodiments, the provided antibody contains a CDR-L1 having
the amino acid sequence set forth in SEQ ID NO: 23, 30, or 36; a
CDR-L2 having the amino acid sequence set forth in SEQ ID NO: 24,
31, or 37; and a CDR-L3 having the amino acid sequence set forth in
SEQ ID NO: 25, 32 or 38.
[0129] In some embodiments, the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 23, 24, and 25, respectively; the
CDR-L1, CDR-L2, and CDR-L3 contain the sequences of SEQ ID NOs: 30,
31, and 22, respectively; the CDR-L1, CDR-L2, and CDR-L3 comprising
the sequences of SEQ ID NOs: 36, 37, and 38, respectively; the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 216,
227, and 40, respectively; the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 218, 229, and 39, respectively; the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 219,
230, and 43, respectively; the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 220, 231, and 46, respectively; the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 210,
221, and 49, respectively; the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 210, 221, and 233, respectively; the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 211,
222, and 48, respectively; the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 212, 223, and 42, respectively; the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 214,
225, and 232, respectively; the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 215, 226, and 44, respectively; the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 217,
228, and 41, respectively; the CDR-L1, CDR-L2 and CDR-L3 contain
the sequences of SEQ ID NOs: 36, 37, and 38, respectively; or the
CDR-L1, CDR-L2 and CDR-L3 contain the sequences of SEQ ID NOs: 213,
224, and 47, respectively.
[0130] In some embodiments, the provided antibody contains a
CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245 246,
247 or 248. In some embodiments, the provided antibody contains a
CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18. In some embodiments, the provided antibody contains a
CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14 or
16.
[0131] In some embodiments, the V.sub.L region contains any of the
CDR-L1, CDR-L2 and CDR-L3 as described and contains a framework
region that contains at least 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99% sequence identity to the framework region of the
amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235,
236, 237, 238, 239, 240, 241, 242, 243, 244, 245 246, 247 or 248.
For example, the anti-ROR1 antibody can contain a CDR-L1, CDR-L2
and CDR-L3, respectively, contained within the V.sub.L region amino
acid sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235, 236,
237, 238, 239, 240, 241, 242, 243, 244, 245 246, 247 or 248, and a
frame work region that contains at least 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99% sequence identity to the framework region
of the amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234,
235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245 246, 247 or
248.
[0132] In some embodiments, the V.sub.L region contains any of the
CDR-L1, CDR-L2 and CDR-L3 as described and contains a framework
region that contains at least 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99% sequence identity to the framework region of the
amino acid sequence set forth in SEQ ID NO: 14, 16, or 18. For
example, the anti-ROR1 antibody can contain a CDR-L1, CDR-L2 and
CDR-L3, respectively, contained within the V.sub.L region amino
acid sequence set forth in SEQ ID NO: 14, 16, or 18, and a frame
work region that contains at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99% sequence identity to the framework region of the
amino acid sequence set forth in SEQ ID NO: 14, 16, or 18.
[0133] In some embodiments, the provided antibody contains a
V.sub.L region that has the sequence of amino acids set forth in
SEQ ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242,
243, 244, 245 246, 247 or 248. In some embodiments, the provided
antibody contains a V.sub.L region that has the sequence of amino
acids set forth in SEQ ID NO: 14, 16, or 18. In some embodiments,
the provided antibody contains a V.sub.L region that has the
sequence of amino acids set forth in SEQ ID NO: 14 or 16.
[0134] Also provided are antibodies having sequences at least at or
about at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identical to such sequences.
[0135] In some embodiments, the V.sub.H region of the antibody or
fragment comprises the amino acid sequence set forth in SEQ ID NO:
8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or 209
and the V.sub.L region of the antibody or fragment comprises the
amino acid sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235,
236, 237, 238, 239, 240, 241, 242, 243, 244, 245 246, 247 or 248.
In some embodiments, the V.sub.H region of the antibody or fragment
comprises the amino acid sequence set forth in SEQ ID NO: 8, 10,
13, 15, 17 or 19 and the V.sub.L region of the antibody or fragment
comprises the amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18. In some embodiments, the V.sub.H region of the antibody or
fragment comprises the amino acid sequence set forth in SEQ ID NO:
10, 13, 15 or 19 and the V.sub.L region of the antibody or fragment
comprises the amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18. In some embodiments, the V.sub.H region of the antibody or
fragment comprises the amino acid sequence set forth in SEQ ID NO:
13, 15 or 19 and the V.sub.L region of the antibody or fragment
comprises the amino acid sequence set forth in SEQ ID NO: 14, 16,
or 18. In some embodiments, the V.sub.H region of the antibody or
fragment comprises the amino acid sequence set forth in SEQ ID NO:
13 or 15 and the V.sub.L region of the antibody or fragment
comprises the amino acid sequence set forth in SEQ ID NO: 14 or
16.
[0136] Also provided are antibodies having sequences at least at or
about at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identical to such sequences.
[0137] In some embodiments, the V.sub.H region of the antibody
contains the CDR-H1, CDR-H2, and CDR-H3, respectively contained
within the V.sub.H region amino acid sequence set forth in SEQ ID
NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182,
183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195,
196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209; and contains the CDR-L1, CDR-L2, and CDR-L3 sequences
contained within the light chain variable (VL) region amino acid
sequence set forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237,
238, 239, 240, 241, 242, 243, 244, 245 246, 247 or 248. In some
embodiments, the V.sub.H region of the antibody contains the
CDR-H1, CDR-H2, and CDR-H3, respectively contained within the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 8, 10,
13, 15, 17, or 19; and contains the CDR-L1, CDR-L2, and CDR-L3
sequences contained within the light chain variable (VL) region
amino acid sequence set forth in SEQ ID NO: 14, 16, or 18. In some
embodiments, the V.sub.H region of the antibody contains the
CDR-H1, CDR-H2, and CDR-H3, respectively contained within the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 10, 13,
15, 17, or 19; and contains the CDR-L1, CDR-L2, and CDR-L3
sequences contained within the light chain variable (VL) region
amino acid sequence set forth in SEQ ID NO: 14, 16, or 18. In some
embodiments, the V.sub.H region of the antibody contains the
CDR-H1, CDR-H2, and CDR-H3, respectively contained within the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 13, 15
or 19; and contains the CDR-L1, CDR-L2, and CDR-L3 sequences
contained within the light chain variable (VL) region amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18. In some
embodiments, the V.sub.H region of the antibody contains the
CDR-H1, CDR-H2, and CDR-H3, respectively contained within the
V.sub.H region amino acid sequence set forth in SEQ ID NO: 13 or
15; and contains the CDR-L1, CDR-L2, and CDR-L3 sequences contained
within the light chain variable (VL) region amino acid sequence set
forth in SEQ ID NO: 14 or 16.
[0138] In some embodiments, the V.sub.H and V.sub.L regions of the
antibody or fragment comprise the amino acid sequences of SEQ ID
NOs: 19 and 18, respectively; the V.sub.H and V.sub.L regions of
the antibody or fragment comprise the amino acid sequences of SEQ
ID NOs: 17 and 18, respectively; the V.sub.H and V.sub.L regions of
the antibody or fragment comprise the amino acid sequences of SEQ
ID NOs: 15 and 16 respectively; the V.sub.H and V.sub.L regions of
the antibody or fragment comprise the amino acid sequences of SEQ
ID NOs: 13 and 14, respectively; the V.sub.H and V.sub.L regions of
the antibody or fragment comprise the amino acid sequences of SEQ
ID NOs: 182 and 242 respectively; the V.sub.H and V.sub.L regions
of the antibody or fragment comprise the amino acid sequences of
SEQ ID NOs: 182 and 246, respectively; the V.sub.H and V.sub.L
regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 182 and 247, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 185 and 248, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 186 and 248, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 175 and 234, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 175 and 235, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 176 and 236, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 176 and 237, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 177 and 238, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 179 and 240 respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 180 and 241, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 181 and 241, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 183 and 243 respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 183 and 244 respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 184 and 243, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 184 and 244 respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 183 and 245, respectively; the V.sub.H and
V.sub.L regions of the antibody or fragment comprise the amino acid
sequences of SEQ ID NOs: 184 and 245, respectively; or the V.sub.H
and V.sub.L regions of the antibody or fragment comprise the amino
acid sequences of SEQ ID NOs: 178 and 239, respectively.
[0139] Also provided are antibodies having sequences at least at or
about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical
to such sequences.
[0140] In some embodiments, the antibody is a single-chain antibody
fragment, such as an scFv or diabody or a VH-only single domain
antibody. In some embodiments, the single-chain antibody includes
one or more linkers joining two antibody domains or regions, such
as a variable heavy chain (VH) region and a variable light chain
(V.sub.L). The linker typically is a peptide linker, e.g., a
flexible and/or soluble peptide linker. Among the linkers are those
rich in glycine and serine and/or in some cases threonine. In some
embodiments, the linkers further include charged residues such as
lysine and/or glutamate, which can improve solubility. In some
embodiments, the linkers further include one or more proline.
[0141] Accordingly, the provided anti-ROR1 antibodies include
single-chain antibody fragments, such as scFvs and diabodies,
particularly human single-chain fragments, typically comprising
linker(s) joining two antibody domains or regions, such V.sub.H and
V.sub.L domains. The linker typically is a peptide linker, e.g., a
flexible and/or soluble peptide linker, such as one rich in glycine
and serine.
[0142] In some aspects, the linkers rich in glycine and serine
(and/or threonine) include at least 80%, 85%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% such amino acid(s). In some
embodiments, they include at least at or about 50%, 55%, 60%, 70%,
or 75%, glycine, serine, and/or threonine. In some embodiments, the
linker is comprised substantially entirely of glycine, serine,
and/or threonine. The linkers generally are between about 5 and
about 50 amino acids in length, typically between at or about 10
and at or about 30, e.g., 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30, and in some examples
between 10 and 25 amino acids in length. Exemplary linkers include
linkers having various numbers of repeats of the sequence GGGGS
(4GS; SEQ ID NO:111) or GGGS (3GS; SEQ ID NO:112), such as between
2, 3, 4, and 5 repeats of such a sequence. Exemplary linkers
include those having or consisting of a sequence set forth in SEQ
ID NO: 91 (GGGGSGGGGSGGGGS). Exemplary linkers further include
those having or consisting of the sequence set forth in SEQ ID NO:
113 (GSTSGSGKPGSGEGSTKG).
[0143] Accordingly, in some embodiments, the provided embodiments
include single-chain fragments, e.g., scFvs, comprising one or more
of the aforementioned linkers, such as glycine/serine rich linkers,
including linkers having repeats of GGGS or GGGGS, such as the
linker set forth as SEQ ID NO: 91.
[0144] In some embodiments, the linker has an amino acid sequence
containing the sequence set forth SEQ ID NO: 91. The fragment,
e.g., scFv, may include a V.sub.H region or portion thereof,
followed by the linker, followed by a V.sub.L or portions thereof.
The fragment, e.g., the scFv, may include the V.sub.L, followed by
the linker, followed by the VH.
[0145] In some embodiments, the scFv has the amino acid sequence
set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254,
255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or
268, or has a sequence at least at or about 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid
sequence set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252,
253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265,
266, 267 or 268. In some aspects, the scFv has the amino acid
sequence set forth in SEQ ID NO: 2, 4, 6, or 12, or has a sequence
at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
or 99% identical to the amino acid sequence set forth in SEQ ID NO:
2, 4, 6, or 12. In some aspects, the scFv has the amino acid
sequence set forth in SEQ ID NO: 4 or 6, or has a sequence at least
at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identical to the amino acid sequence set forth in SEQ ID NO: 4 or
6.
[0146] In some aspects, the scFv contains the VH, linker and VL as
set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254,
255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or
268, or a sequence at least at or about 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, or 99% identical to such a sequence, but in
which the VH and VL are configured in the opposite orientation,
i.e. VL-VH, as compared to such sequence. In some aspects, the scFv
has the amino acid sequence set forth in SEQ ID NO: 2, 4, 6 or 12,
or has a sequence at least at or about 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set
forth in SEQ ID NO: 2, 4, 6 or 12, but in which the VH and VL are
configured in the opposite orientation, i.e. VL-VH, as compared to
such sequence. In some embodiments, the scFv has the amino acid
sequence set forth in SEQ ID NO:12, but in which the VH and VL are
configured in the opposite orientation, i.e. VL-VH, as compared to
such sequence. In some embodiments, the scFv has the amino acid
sequence set forth in SEQ ID NO:6, but in which the VH and VL are
configured in the opposite orientation, i.e. VL-VH, as compared to
such sequence.
[0147] Also provided are human anti-ROR1 antibodies, e.g.,
antigen-binding antibody fragments that specifically bind to the
same or an overlapping epitope of a ROR1 protein, such as a human
ROR1 protein, as the epitope specifically bound by a reference
antibody. Such antibody may be any of the above described
antibodies or the anti-ROR1 antibody designated R12 or an
antigen-binding fragment thereof.
[0148] Also provided are human anti-ROR1 antibodies, e.g.,
antigen-binding antibody fragments, that specifically bind to a
ROR1 protein, such as a human ROR1 protein, and compete for binding
to the ROR1 protein with a reference antibody that is any of the
above described antibodies or is the anti-ROR1 antibody designated
R12 or an antigen-binding fragment thereof.
[0149] In some such embodiments, the reference antibody can be an
scFv that comprises the amino acid sequence set forth in SEQ ID NO:
2, 4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259,
260, 261, 262, 263, 264, 265, 266, 267 or 268, or that has a
sequence at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identical to the amino acid sequence set forth in
SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256,
257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or 268. In
some such embodiments, the reference antibody can be an scFv that
comprises the amino acid sequence set forth in SEQ ID NO: 2, 4, 6,
or 12, or that has a sequence at least at or about 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid
sequence set forth in SEQ ID NO: 2, 4, 6, or 12. In some
embodiments, the reference antibody can be an antibody that
contains the V.sub.H and V.sub.L of an scFv that comprises the
amino acid sequence set forth in SEQ ID NO: 2, 4, 6, 12, 249, 250,
251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263,
264, 265, 266, 267 or 268, such as set forth in SEQ ID NO: 2, 4, 6,
or 12.
[0150] In some embodiments of a provided human anti-ROR1 antibody,
the human antibody contains a V.sub.H region that contains a
portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence
identity to an amino acid sequence encoded by a germline nucleotide
human heavy chain V segment, a portion with at least 95%, 96%, 97%,
98%, 99%, or 100% identity to an amino acid sequence encoded by a
germline nucleotide human heavy chain D segment, and/or a portion
having at least 95%, 96%, 97%, 98%, 99%, or 100% identity to an
amino acid sequence encoded by a germline nucleotide human heavy
chain J segment; and/or contains a V.sub.L region that contains a
portion with at least 95%, 96%, 97%, 98%, 99%, or 100% identity to
an amino acid sequence encoded by a germline nucleotide human kappa
or lambda chain V segment, and/or a portion with at least 95%, 96%,
97%, 98%, 99%, or 100% identity to an amino acid sequence encoded
by a germline nucleotide human kappa or lambda chain J segment. In
some embodiments, the portion of the V.sub.H region corresponds to
the CDR-H1, CDR-H2 and/or CDR-H3. In some embodiments, the portion
of the V.sub.H region corresponds to the framework region 1 (FR1),
FR2, FR2 and/or FR4. In some embodiments, the portion of the
V.sub.L region corresponds to the CDR-L1, CDR-L2 and/or CDR-L3. In
some embodiments, the portion of the V.sub.L region corresponds to
the FR1, FR2, FR2 and/or FR4.
[0151] In some embodiments, the human antibody contains a CDR-H1
having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to an amino acid sequence of the corresponding CDR-H1 region within
a sequence encoded by a germline nucleotide human heavy chain V
segment. For example, the human antibody in some embodiments
contains a CDR-H1 having a sequence that is 100% identical or with
no more than one, two or three amino acid differences as compared
to the corresponding CDR-H1 region within a sequence encoded by a
germline nucleotide human heavy chain V segment.
[0152] In some embodiments, the human antibody contains a CDR-H2
having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to an amino acid sequence of the corresponding CDR-H2 region within
a sequence encoded by a germline nucleotide human heavy chain V
segment. For example, the human antibody in some embodiments
contains a CDR-H2 having a sequence that is 100% identical or with
no more than one, two or three amino acid difference as compared to
the corresponding CDR-H2 region within a sequence encoded by a
germline nucleotide human heavy chain V segment.
[0153] In some embodiments, the human antibody contains a CDR-H3
having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to an amino acid sequence of the corresponding CDR-H3 region within
a sequence encoded by a germline nucleotide human heavy chain V
segment, D segment and J segment. For example, the human antibody
in some embodiments contains a CDR-H3 having a sequence that is
100% identical or with no more than one, two or three amino acid
differences as compared to the corresponding CDR-H3 region within a
sequence encoded by a germline nucleotide human heavy chain V
segment, D segment and J segment.
[0154] In some embodiments, the human antibody contains a CDR-L1
having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to an amino acid sequence of the corresponding CDR-L1 region within
a sequence encoded by a germline nucleotide human light chain V
segment. For example, the human antibody in some embodiments
contains a CDR-L1 having a sequence that is 100% identical or with
no more than one, two or three amino acid differences as compared
to the corresponding CDR-L1 region within a sequence encoded by a
germline nucleotide human light chain V segment.
[0155] In some embodiments, the human antibody contains a CDR-L2
having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to an amino acid sequence of the corresponding CDR-L2 region within
a sequence encoded by a germline nucleotide human light chain V
segment. For example, the human antibody in some embodiments
contains a CDR-L2 having a sequence that is 100% identical or with
no more than one, two or three amino acid difference as compared to
the corresponding CDR-L2 region within a sequence encoded by a
germline nucleotide human light chain V segment.
[0156] In some embodiments, the human antibody contains a CDR-L3
having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to an amino acid sequence of the corresponding CDR-L3 region within
a sequence encoded by a germline nucleotide human light chain V
segment and J segment. For example, the human antibody in some
embodiments contains a CDR-L3 having a sequence that is 100%
identical or with no more than one, two or three amino acid
differences as compared to the corresponding CDR-L3 region within a
sequence encoded by a germline nucleotide human light chain V
segment and J segment.
[0157] In some embodiments, the human antibody contains a framework
region that contains human germline gene segment sequences. For
example, in some embodiments, the human antibody contains a V.sub.H
region in which the framework region, e.g. FR1, FR2, FR3 and FR4,
has at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to
a framework region encoded by a human germline antibody segment,
such as a V and/or J segment. In some embodiments, the human
antibody contains a V.sub.L region in which the framework region
e.g. FR1, FR2, FR3 and FR4, has at least 95%, 96%, 97%, 98%, 99%,
or 100% sequence identity to a framework region encoded by a human
germline antibody segment, such as a V and/or segment. For example,
in some such embodiments, the framework sequence of the V.sub.H
and/or V.sub.L sequence differs by no more than 10 amino acids,
such as no more than 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid,
compared to the framework region encoded by a human germline
antibody segment.
[0158] The antibody, e.g., antibody fragment, may contain at least
a portion of an immunoglobulin constant region, such as one or more
constant region domain. In some embodiments, the constant regions
include a light chain constant region and/or a heavy chain constant
region 1 (CH1). In some embodiments, the antibody includes a CH2
and/or CH3 domain, such as an Fc region. In some embodiments, the
Fc region is an Fc region of a human IgG, such as an IgG1 or
IgG4.
[0159] Also provided are nucleic acids encoding the antibodies
and/or portions, e.g., chains, thereof. Among the provided nucleic
acids are those encoding the anti-ROR antibodies described herein.
The nucleic acids may include those encompassing natural and/or
non-naturally occurring nucleotides and bases, e.g., including
those with backbone modifications. The terms "nucleic acid
molecule", "nucleic acid" and "polynucleotide" may be used
interchangeably, and refer to a polymer of nucleotides. Such
polymers of nucleotides may contain natural and/or non-natural
nucleotides, and include, but are not limited to, DNA, RNA, and
PNA. "Nucleic acid sequence" refers to the linear sequence of
nucleotides that comprise the nucleic acid molecule or
polynucleotide.
[0160] Also provided are vectors containing the nucleic acids, host
cells containing the vectors, e.g., for producing the antibodies.
Also provided are methods for producing the antibodies. The nucleic
acid may encode an amino acid sequence comprising the V.sub.L
and/or an amino acid sequence comprising the V.sub.H of the
antibody (e.g., the light and/or heavy chains of the antibody). In
a further embodiment, one or more vectors (e.g., expression
vectors) comprising such nucleic acid are provided. In a further
embodiment, a host cell comprising such nucleic acid is provided.
In one such embodiment, a host cell comprises (e.g., has been
transformed with): a vector comprising a nucleic acid that encodes
an amino acid sequence comprising the V.sub.H of the antibody. In
another such embodiment, a host cell comprises (e.g., has been
transformed with): (1) a vector comprising a nucleic acid that
encodes an amino acid sequence comprising the V.sub.L of the
antibody and an amino acid sequence comprising the V.sub.H of the
antibody, or (2) a first vector comprising a nucleic acid that
encodes an amino acid sequence comprising the V.sub.L of the
antibody and a second vector comprising a nucleic acid that encodes
an amino acid sequence comprising the V.sub.H of the antibody.
[0161] Also provided are methods of making the anti-ROR1 antibodies
(including antigen-binding fragments). For recombinant production
of the anti-ROR1 antibody, nucleic acid encoding an antibody, e.g.,
as described above, may be isolated and inserted into one or more
vectors for further cloning and/or expression in a host cell. Such
nucleic acid may be readily isolated and sequenced using
conventional procedures (e.g., by using oligonucleotide probes that
are capable of binding specifically to genes encoding the heavy and
light chains of the antibody). In some embodiments, a method of
making the anti-ROR1 antibody is provided, wherein the method
comprises culturing a host cell comprising a nucleic acid encoding
the antibody, as provided above, under conditions suitable for
expression of the antibody, and optionally recovering the antibody
from the host cell (or host cell culture medium).
[0162] In addition to prokaryotes, eukaryotic microbes such as
filamentous fungi or yeast are suitable cloning or expression hosts
for antibody-encoding vectors, including fungi and yeast strains
whose glycosylation pathways have been modified to mimic or
approximate those in human cells, resulting in the production of an
antibody with a partially or fully human glycosylation pattern. See
Gerngross, Nat. Biotech. 22:1409-1414 (2004), and Li et al., Nat.
Biotech. 24:210-215 (2006).
[0163] Exemplary eukaryotic cells that may be used to express
polypeptides include, but are not limited to, COS cells, including
COS 7 cells; 293 cells, including 293-6E cells; CHO cells,
including CHO-S, DG44. Lec13 CHO cells, and FUT8 CHO cells;
PER.C6.RTM. cells; and NSO cells. In some embodiments, the antibody
heavy chains and/or light chains may be expressed in yeast. See,
e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments,
a particular eukaryotic host cell is selected based on its ability
to make desired post-translational modifications to the heavy
chains and/or light chains. For example, in some embodiments, CHO
cells produce polypeptides that have a higher level of sialylation
than the same polypeptide produced in 293 cells.
[0164] In some embodiments, the antibody is produced in a cell-free
system. Exemplary cell-free systems are described, e.g., in
Sitaraman et al., Methods Mol. Biol. 498: 229-44 (2009); Spirin,
Trends Biotechnol. 22: 538-45 (2004); Endo et al., Biotechnol. Adv.
21: 695-713 (2003).
[0165] The provided embodiments further include vectors and host
cells and other expression systems for expressing and producing the
antibodies and other binding proteins, including eukaryotic and
prokaryotic host cells, including bacteria, filamentous fungi, and
yeast, as well as mammalian cells such as human cells, as well as
cell-free expression systems.
[0166] Exemplary Features
[0167] In some aspects, the provided antibodies have one or more
specified functional features, such as binding properties,
including binding to particular epitopes, such as epitopes that are
similar to or overlap with those specifically bound by other
antibodies such as reference antibodies, the ability to compete for
binding with other antibodies such as reference antibodies, and/or
particular binding affinities.
[0168] In some embodiments, the antibodies specifically bind to
ROR1 protein. In some embodiments of any of the embodiments herein,
ROR1 refers to human ROR1. The observation that an antibody or
other binding molecule binds to ROR1 or specifically binds to ROR1
does not necessarily mean that it binds to ROR1 of every species.
For example, in some embodiments, features of binding to ROR1, such
as the ability to specifically bind thereto and/or to compete for
binding thereto with a reference antibody, and/or to bind with a
particular affinity or compete to a particular degree, in some
embodiments, refers to the ability with respect to a human ROR1
protein and the antibody may not have this feature with respect to
a ROR1 of another species such as mouse. In some embodiments, the
antibody binds to human ROR1 and binds to ROR1 of another species,
such as mouse.
[0169] In some embodiments, the antibodies specifically bind to
human ROR1, such as to an epitope or region of human ROR1, such as
the human ROR1 set forth in SEQ ID NO:103 (GenBank No. NP_005003.2,
such as encoded by nucleotides set forth in GenBank No.
NM_005012.3), or an allelic variant or splice variant thereof. In
one embodiment, human ROR1 is a transcript variant or isoform that
has the sequence of amino acids forth in SEQ ID NO:104 or SEQ ID
NO:105.
[0170] In some embodiments, the antibody binds to non-human ROR1,
such as monkey, rabbit, rat, mouse, or other species of ROR1. In
some embodiments, the antibody binds to mouse ROR1, such as to an
epitope or region of mouse ROR1, such as the mouse ROR1 set forth
in SEQ ID NO: 106 (GenBank No. NP_038873, such as encoded by
nucleotides set forth in GenBank No. NM_013845). In some
embodiments, the antibody binds to human ROR1 and binds to mouse
ROR1. In some embodiments, the extent of binding of an anti-ROR1
antibody to a non-human ROR1, such as mouse ROR1, is at least or
about at least 75%, 80%, 90%, 95%, 100%, 110%, 120%, 130%, 140%,
150% or more of the binding of the antibody to ROR1.
[0171] In some embodiments, the antibodies do not bind to mouse
ROR1, such as the mouse ROR1 set forth in SEQ ID NO:106 (GenBank
No. NP_038873, such as encoded by nucleotides set forth in GenBank
No. NM_013845).
[0172] In one embodiment, the extent of binding of an anti-ROR1
antibody to an unrelated, non-ROR1 protein or to anon-human ROR1 or
other non-ROR1 protein, is less than at or about 10% of the binding
of the antibody to human ROR1 as measured, e.g., by a
radioimmunoassay (RIA). In some embodiments, among provided
antibodies are antibodies in which binding to mouse ROR1 is less
than or at or about 10% of the binding of the antibody to human
ROR1. In some embodiments, among provided antibodies are antibodies
in which binding to a ROR2, such as a human ROR2, is less than or
at or about 10% of the binding of the antibody to human ROR1.
[0173] In some embodiments, the provided antibodies are capable of
binding ROR1, such as human ROR1 and/or mouse ROR1, with at least a
certain affinity, as measured by any of a number of known methods.
In some embodiments, the affinity is represented by a dissociation
constant (Kd). In some embodiments, the affinity is represented by
EC50.
[0174] In some embodiments, the binding affinity (EC50) and/or the
dissociation constant of the antibody to ROR1, such as human ROR1
or mouse ROR1, is from or from about 0.1 nM to 500 nM, 0.1 nM to
100 nM, 0.1 nM to 50 nM, 0.1 nM to 10 nM, 0.1 nM to 1 nM, 1 nM to
500 nM, 1 nM to 100 nM, 1 nM to 50 nM, 1 nM to 10 nM, 10 nM to 500
nM, 10 nM to 100 nM, 10 nM to 50 nM, 50 nM to 500 nM, 50 nM to 100
nM or 100 nM to 500 nM. In certain embodiments, the binding
affinity (EC50) and/or the dissociation constant of the antibody to
ROR1, such as human ROR1 or mouse ROR1, is at or about or less than
at or about 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19 nM, 18
nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8
nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM. In some
embodiments, the antibodies bind to ROR1, such as human ROR1 or
mouse ROR1, with a sub-nanomolar binding affinity, for example,
with a binding affinity less than 1 nM, such as less than 0.9 nM,
0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM or 0.1
nM.
[0175] In some embodiments, the antibodies, such as the human
antibodies, specifically bind to a particular epitope or region of
ROR1, such as generally an extracellular epitope or region. ROR1 is
a type I membrane protein that contains an extracellular region
containing an immunoglobulin (Ig) domain, a frizzled (Fz) domain
and a kringle (Kr) domain followed by a transmembrane domain. With
reference to human ROR1 set forth in SEQ ID NO:103, the
extracellular region corresponds to amino acids 1-377, whereby
amino acids 13-118 correspond to the Ig domain, amino acids 136-270
correspond to the Fz domain and amino acids 283-362 correspond to
the Kr domain. In some embodiments, the antibodies, such as human
antibodies, bind to an epitope comprising residues within the Ig
domain, the Fz domain and/or the Kr domain. In some embodiments,
the antibodies, such as human antibodies, bind to an epitope
comprising residues with the Ig domain and/or Fz domain. In some
embodiments, the antibodies, such as human antibodies, bind to an
epitope comprising residues within both the Ig and Fz domains.
[0176] In some embodiments, properties or features of the provided
antibodies are described in relation to properties observed for
another antibody, e.g., a reference antibody. In some embodiments,
the reference antibody is a non-human anti-ROR1 antibody, such as a
rabbit or chimeric or humanized anti-ROR1 antibody. In some
aspects, the reference antibody is the chimeric rabbit/human IgG1
antibody designated R12 (see, e.g., Yang et al. (2011) PloS ONE,
6:e21018; U.S. Patent Application No. US 2013/0251642), and/or a
fragment derived therefrom such as an scFv fragment thereof, and/or
an antibody containing the V.sub.H and V.sub.L sequences of such an
antibody and/or the heavy and light chain CDRs of such an antibody.
A chimeric antigen receptor (CAR) containing an antigen-binding
scFv fragment of R12 has been demonstrated to effectively promote
antitumor reactivity in a CAR therapy (Hudecek et al. (2013) Clin.
Cancer Res., 19:3153; International published PCT Appl. No.
WO2014031687).
[0177] For example, in some embodiments, the reference antibody has
a V.sub.H region containing the sequence set forth in SEQ ID NO:
85, or comprises CDR1, CDR2, and/or CDR3 within such a sequence,
and/or has a V.sub.L containing the sequence set forth in SEQ ID
NO: 86, or comprises CDR1, CDR2, and/or CDR3 within such a
sequence. For example, the reference antibody can be an antibody
that contains a CDR-H1 sequence of AYYMS (SEQ ID NO:87), a CDR-H2
sequence of TIYPSSGKTYYATWVNG (set forth in SEQ ID NO:88), a CDR-H3
sequence of DSYADDGALFN (SEQ ID NO:72), a CDR-L1 sequence of
TLSSAHKTDTID (SEQ ID NO:89), a CDR-L2 sequence of GSYTKRP (SEQ ID
NO:90) and/or a CDR-L3 sequence of GADYIGGYV (SEQ ID NO:73). In
some embodiments, the reference antibody is an scFv that comprises
the sequence of amino acids set forth in SEQ ID NO:84.
[0178] In some embodiments, the reference antibody is the mouse
anti-human ROR1 antibody designated 2A2, and/or a fragment derived
therefrom such as an scFv fragment thereof, and/or an antibody
containing the V.sub.H and V.sub.L sequences of such an antibody
and/or the heavy and light chain CDRs of such an antibody (see,
e.g., Baskar et al. (2012) I, 4:349-361; published U.S. Patent
Appl. No. US2012/20058051).
[0179] For example, in some embodiments, the reference antibody has
a V.sub.H region containing the sequence set forth in SEQ ID NO:
114, or comprises CDR1, CDR2, and/or CDR3 within such a sequence,
and/or has a V.sub.L containing the sequence set forth in SEQ ID
NO: 115, or comprises CDR1, CDR2, and/or CDR3 within such a
sequence. For example, the reference antibody can be an antibody
that contains a CDR-H1 sequence of DYEMH (SEQ ID NO:116), a CDR-H2
sequence of AIDPETGGTAYNQKFKG (set forth in SEQ ID NO:117), a
CDR-H3 sequence of YYDYDSFTY (SEQ ID NO:118), a CDR-L1 sequence of
KASQNVDAAVA (SEQ ID NO:119), a CDR-L2 sequence of SASNRYT (SEQ ID
NO:120) and/or a CDR-L3 sequence of QQYDIYPYT (SEQ ID NO:121). In
some embodiments, the reference antibody is an scFv form of
antibody 2A2.
[0180] In some embodiments, the reference antibody is a human or
humanized anti-ROR1 antibody. Exemplary humanized anti-ROR1
antibodies are described in International PCT Appl. No.
WO2014/031174. In some embodiments, the reference antibody is a
humanized variant of an antibody designated 99961. In some
embodiments, the reference antibody has a V.sub.H region containing
the sequence set forth in SEQ ID NO: 122, 123, 124 or 125, or
comprises CDR1, CDR2, and/or CDR3 within such a sequence, and/or
has a V.sub.L containing the sequence set forth in SEQ ID NO: 126,
127, 128 or 129, or comprises CDR1, CDR2, and/or CDR3 within such a
sequence. In some embodiments, the reference antibody can be an
antibody that contains a CDR-H1 sequence set forth in SEQ ID NO:130
or 133, a CDR-H2 sequence set forth in SEQ ID NO:131 or 134, a
CDR-H3 sequence set forth in SEQ ID NO:132 or 135, a CDR-L1
sequence set forth in SEQ ID NO:136 or 139, a CDR-L2 sequence set
forth in SEQ ID NO:137 or 140 and/or a CDR-L3 sequence set forth in
SEQ ID NO:138 or 141.
[0181] In some embodiments, the provided antibody contains heavy
and light chain CDRs that are distinct from the CDRs present in the
reference antibody or antibodies. In some embodiments, the provided
antibody contains heavy and light chain CDRs that are distinct from
the CDRs present in the antibody designated R12, such as present in
the V.sub.H region set forth in SEQ ID NO: 85 and/or the V.sub.L
region set forth in SEQ ID NO: 86. In some embodiments, the
provided antibody contains heavy and light chain CDRs that are
distinct from the CDRs present in the antibody designated 2A2, such
as present in the V.sub.H region set forth in SEQ ID NO: 104 and/or
the V.sub.L region set forth in SEQ ID NO: 105. In some
embodiments, the provided antibody contains heavy and light chain
CDRs that are distinct from the CDRs present in a humanized variant
of antibody designated 99961, such as present in the V.sub.H region
set forth in SEQ ID NO: 122, 123, 124 or 125 and/or the V.sub.L
region set forth in SEQ ID NO: 126, 127, 128 or 129.
[0182] Among the provided antibodies are those that compete for
binding with and/or bind to the same or overlapping epitopes of
ROR1 as those bound by a reference antibody or antibody, such as
R12, but nonetheless contain distinct CDRs, e.g., distinct heavy
and/or light chain CDR1, CDR2, and CDR3.
[0183] In some embodiments, the reference antibody has a sequence
present in an antibody or portion thereof as described herein, such
as any of the provided exemplary antibodies. For example, in some
embodiments, the reference antibody contains a CDR-H1 comprising
the amino acid sequence set forth in SEQ ID NO: 20, 27, or 33; a
CDR-H2 comprising the amino acid sequence set forth in SEQ ID NO:
21, 26, 28, or 34; a CDR-H3 comprising the amino acid sequence set
forth in SEQ ID NO: 22, 29, 35, 46, 50, 51, 52, 53, 54, 55, 56, 57,
58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174; a
CDR-L1 comprising the amino acid sequence set forth in SEQ ID NO:
23, 30, or 36; CDR-L2 comprising the amino acid sequence set forth
in SEQ ID NO: 24, 31, or 37; and/or a CDR-L3 comprising the amino
acid sequence set forth in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42,
43, 44, 45, 47, 48, and 49. For example, in some embodiments, the
reference antibody has a light chain variable (V.sub.L) region
amino acid sequence set forth in SEQ ID NO: 14, 16, or 18 and/or
has a heavy chain variable (VH) region set forth in SEQ ID NO: 8,
10, 13, 15, 17, or 19. In some such embodiments, the antibody has
heavy and/or light chain CDRs 1, 2, and/or 3 as present in such an
antibody.
[0184] In some embodiments, the antibody has an affinity, e.g.,
EC50 or Kd, about the same as or lower than that of the
corresponding form of the reference antibody, e.g., no more than
about 1.5-fold or no more than about 2-fold greater, no more than
3-fold greater, and/or no more than 10-fold greater, than the EC50
or Kd of the corresponding form of the reference antibody. In some
embodiments, the antibody has an affinity, e.g., EC50 or Kd, that
is greater than or greater than about 5-fold, 10-fold, 20-fold,
30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold,
100-fold, 150-fold, 200-fold, 250-fold or greater than the EC50 or
Kd of the corresponding form of the reference antibody.
[0185] In some embodiments, the antibodies display a binding
preference for ROR1-expressing cells as compared to ROR1-negative
cells, such as particular cells known and/or described herein to
express ROR1 and known not to express ROR1. In some embodiments,
the binding preference is observed where a significantly greater
degree of binding is measured to the ROR1-expressing, as compared
to the non-expressing, cells. In some embodiments, the fold change
in degree of binding detected, for example, as measured by mean
fluorescence intensity in a flow cytometry-based assay and/or
dissociation constant or EC50, to the ROR1-expressing cells as
compared to the non-ROR1-expressing cells, is at least at or about
1.5, 2, 3, 4, 5, 6, or more, and/or is about as great, about the
same, at least as great or at least about as great, or greater,
than the fold change observed for the corresponding form of the
reference antibody. In some cases, the total degree of observed
binding to ROR1 or to the ROR1-expressing cells is approximately
the same, at least as great, or greater than that observed for the
corresponding form of the reference antibody.
[0186] In some aspects, the affinity is at or about the same degree
or substantially the same degree of affinity compared to the
corresponding form of the reference antibody, such as rabbit ROR1
antibody. In some aspects, the affinity is at least 80, 85, 90, 95,
or 99% the same as that of the corresponding form of the reference
antibody.
[0187] In some embodiments, the antibody specifically binds to an
epitope that overlaps with the epitope of ROR1 bound by a reference
antibody. In some aspects, among such antibodies are antibodies
that bind to the same or a similar epitope as the reference
antibody. In some embodiments, two antibodies specifically bind to
the same epitope and/or an overlapping epitope if all or
essentially all amino acid mutations in the antigen that reduce or
eliminate binding of one antibody reduce or eliminate binding of
the other antibody.
[0188] In some embodiments, the antibodies bind to the same or a
similar epitope or an epitope within the same region or containing
residues within the same region of ROR1 as a reference antibody,
such as anti-ROR1 antibody R12 or scFv fragment thereof (set forth
in SEQ ID NO: 84; see e.g. Yang et al. (2011) PloS ONE, 6:e21018).
In some such embodiments, the antibodies bind to an epitope that
contains amino acids within the Ig domain and the Fz domain of a
ROR1, such as a human ROR1, such as an epitope comprising residues
from both such domains and/or at the conjunction of the Ig and Fz
domains. In some embodiments, the antibodies bind to an epitope of
the ROR1 that overlaps with the epitope specifically bound by R12
and/or an scFv fragment thereof and/or compete for binding with
such an antibody.
[0189] In some embodiments, the antibody inhibits binding to and/or
competes for binding to ROR1, such as human ROR1, with the
reference antibody. In some embodiments, the antibody inhibits
binding to and/or competes for binding to ROR1, such as human ROR1,
with R12 or an IgG or antigen-binding fragment thereof.
[0190] An antibody "competes for binding" to ROR1 with a reference
antibody if it competitively inhibits binding of the reference
antibody to ROR1, and/or if the reference antibody competitively
inhibits binding of the antibody to ROR1. An antibody competitively
inhibits binding of a reference antibody to an antigen if the
presence of the antibody in excess detectably inhibits (blocks)
binding of the other antibody to its antigen. A particular degree
of inhibition may be specified.
[0191] Competitive inhibition assays are known and include
ELISA-based, flow cytometry-based assays, and RIA-based assays. In
some aspects, competitive inhibition assays are carried out by
incorporating an excess of an unlabeled form of one of the
antibodies and assessing its ability to block binding of the other
antibody, which is labeled with a detectable marker, such that
degree of binding and reduction thereof can be assessed by
detection of the label or marker.
[0192] In some embodiments, addition of the provided antibody in
excess, e.g., 1-, 2-, 5-, 10-, 50- or 100-fold excess, as compared
to the amount or concentration of the reference antibody, inhibits
binding to the antigen by the reference antibody (or vice versa).
In some embodiments, the inhibition of binding is by at least 50%,
and in some embodiments by at least 75%, 90% or 99%. In some
aspects, the competitive inhibition is as measured in a competitive
binding assay (see, e.g., Junghans et al., Cancer Res.
1990:50:1495-1502).
[0193] In some embodiments, where the reference antibody is present
at a concentration of or of about 2 nM, the provided antibody
inhibits binding of the reference antibody with an IC50 of less
than at or about 200 nM, 150 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25
nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM,
11 nM, or 10 nM, or less than at or about 9 nM, 8 nM, 7 nM, 6 nM,
or 5 nM. In some embodiments, where the provided antibody is
present at a concentration of or about 2 nM, the reference antibody
inhibits binding of the provided antibody with an IC50 of less than
at or about 200 nM, 150 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20
nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM,
or 10 nM, or less than at or about 9 nM, 8 nM, 7 nM, 6 nM, or 5
nM.
[0194] In some embodiments, competitive inhibition of the reference
antibody's binding by the provided antibody (or vice versa) is at
or about or least at or about the same degree as the degree of
competitive inhibition of the reference antibody's binding by the
reference antibody itself, e.g., unlabeled reference antibody. In
some embodiments, the provided antibody inhibits binding of the
reference antibody, such as binding of R12 scFv, to human ROR1 by
at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99%.
[0195] Anti-ROR1 antibodies provided herein may be identified,
screened for, or characterized for their physical/chemical
properties and/or biological activities by various known assays. In
one aspect, the antibody is tested for its antigen binding
activity, e.g., by known methods such as ELISA, Western blotting,
and/or flow cytometric assays, including cell-based binding assays,
for example, assessing binding of the antibody (e.g., conjugated to
a fluorescent marker or tagged) to a cell expressing the target
antigen, e.g., ROR1, in some cases compared to results using cells
that do not express the target antigen, e.g., ROR1. Binding
affinity may be measured as Kd or EC50.
[0196] Competition assays may be used to identify an antibody that
competes with any of the antibodies described herein. Assays for
mapping epitopes bound by the antibodies and reference antibodies
also may be used and are known.
[0197] Immunoconjugates
[0198] In some embodiments, the antibody is or is part of an
immunoconjugate, in which the antibody is conjugated to one or more
heterologous molecule(s), such as, but not limited to, a cytotoxic
or an imaging agent. Cytotoxic agents include, but are not limited
to, radioactive isotopes (e.g., At211, I131, I125, Y90, Re186,
Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu);
chemotherapeutic agents (e.g., methotrexate, adriamicin, vinca
alkaloids (vincristine, vinblastine, etoposide), doxorubicin,
melphalan, mitomycin C, chlorambucil, daunorubicin or other
intercalating agents); growth inhibitory agents; enzymes and
fragments thereof such as nucleolytic enzymes; antibiotics; toxins
such as small molecule toxins or enzymatically active toxins. In
some embodiments, the antibody is conjugated to one or more
cytotoxic agents, such as chemotherapeutic agents or drugs, growth
inhibitory agents, toxins (e.g., protein toxins, enzymatically
active toxins of bacterial, fungal, plant, or animal origin, or
fragments thereof), or radioactive isotopes.
[0199] Among the immunoconjugates are antibody-drug conjugates
(ADCs), in which an antibody is conjugated to one or more drugs,
including but not limited to a maytansinoid (see U.S. Pat. Nos.
5,208,020, 5,416,064 and European Patent EP 0 425 235 B1); an
auristatin such as monomethylauristatin drug moieties DE and DF
(MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483 and 5,780,588, and
7,498,298); a dolastatin; a calicheamicin or derivative thereof
(see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285,
5,770,701, 5,770,710, 5,773,001, and 5,877,296; Hinman et al.,
Cancer Res. 53:3336-3342 (1993); and Lode et al., Cancer Res.
58:2925-2928 (1998)); an anthracycline such as daunomycin or
doxorubicin (see Kratz et al., Current Med. Chem. 13:477-523
(2006); Jeffrey et al., Bioorganic & Med. Chem. Letters
16:358-362 (2006); Torgov et al., Bioconj. Chem. 16:717-721 (2005);
Nagy et al., Proc. Natl. Acad. Sci. USA 97:829-834 (2000);
Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532
(2002); King et al., J. Med. Chem. 45:4336-4343 (2002); and U.S.
Pat. No. 6,630,579); methotrexate; vindesine; a taxane such as
docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel; a
trichothecene; and CC 1065.
[0200] Also among the immunoconjugates are those in which the
antibody is conjugated to an enzymatically active toxin or fragment
thereof, including but not limited to diphtheria A chain,
nonbinding active fragments of diphtheria toxin, exotoxin A chain
(from Pseudomonas aeruginosa), ricin A chain, abrin A chain,
modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin
proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S),
momordica charantia inhibitor, curcin, crotin, sapaonaria
officinalis inhibitor, gelonin, mitogellin, restrictocin,
phenomycin, enomycin, and the tricothecenes.
[0201] Also among the immunoconjugates are those in which the
antibody is conjugated to a radioactive atom to form a
radioconjugate. Exemplary radioactive isotopes include At.sup.211,
I.sup.131, I.sup.125, Y.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153,
Bi.sup.212, P.sup.32, Pb.sup.212 and radioactive isotopes of
Lu.
[0202] Conjugates of an antibody and cytotoxic agent may be made
using any of a number of known protein coupling agents, e.g.,
linkers, (see Vitetta et al., Science 238:1098 (1987)), WO94/11026.
The linker may be a "cleavable linker" facilitating release of a
cytotoxic drug in the cell, such as acid-labile linkers,
peptidase-sensitive linkers, photolabile linkers, dimethyl linkers,
and disulfide-containing linkers (Chari et al., Cancer Res.
52:127-131 (1992); U.S. Pat. No. 5,208,020).
[0203] Multispecific Antibodies
[0204] In certain embodiments, the ROR1-binding molecules, e.g.,
antibodies or polypeptides such as chimeric receptors containing
the same, are multispecific. Among the multispecific binding
molecules are multispecific antibodies, including, e.g. bispecific.
Multispecific binding partners, e.g., antibodies, have binding
specificities for at least two different sites, which may be in the
same or different antigens. In certain embodiments, one of the
binding specificities is for ROR1 and the other is for another
antigen. In certain embodiments, bispecific antibodies may bind to
two different epitopes of ROR1. Bispecific antibodies may also be
used to localize cytotoxic agents to cells which express ROR1.
Bispecific antibodies can be prepared as full length antibodies or
antibody fragments. Among the multispecific antibodies are
multispecific single-chain antibodies, e.g., diabodies, triabodies,
and tetrabodies, tandem di-scFvs, and tandem tri-scFvs. Also
provided are multispecific chimeric receptors, such as
multispecific CARs, containing the antibodies. Also provided are
multispecific cells containing the antibodies or polypeptides
including the same, such as cells containing a cell surface protein
including the anti-ROR1 antibody and an additional cell surface
protein, such as an additional chimeric receptor, which binds to a
different antigen or a different epitope on ROR1.
[0205] Exemplary additional antigens include B cell specific
antigens, other tumor-specific antigens, such as antigens expressed
specifically on or associated with B cell leukemia, lymphoma, B
cell chronic lymphocytic leukemia (CLL), AML, acute myeloid
leukemia (AML), acute lymphocytic leukemia (ALL), Burkett's
Lymphoma, mantle cell lymphoma (MCL), non-small cell lung cancer
(NSCLC), neuroblastoma, renal cell carcinoma, colon cancer,
colorectal cancer, breast cancer, epithelial squamous cell cancer,
melanoma, myeloma, stomach cancer, brain cancer, lung cancer,
pancreatic cancer, cervical cancer, ovarian cancer, liver cancer,
bladder cancer, prostate cancer, testicular cancer, thyroid cancer,
uterine cancer, adrenal cancer and/or head and neck cancer, and
antigens expressed on T cells. Exemplary antigens include CD4, CD5,
CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37,
CD38, CD40, CD40L, CD46, CD52, CD54, CD74, CD80, CD126, CD138, B7,
MUC-1, Ia, HM1.24, HLA-DR, tenascin, an angiogenesis factor, VEGF,
PIGF, ED-B fibronectin, an oncogene, an oncogene product, CD66a-d,
necrosis antigens, Ii, IL-2, T101, TAC, IL-6, TRAIL-R1 (DR4) and
TRAIL-R2 (DR5).
[0206] Variants
[0207] In certain embodiments, the antibodies include one or more
amino acid variations, e.g., substitutions, deletions, insertions,
and/or mutations, compared to the sequence of an antibody described
herein. Exemplary variants include those designed to improve the
binding affinity and/or other biological properties of the
antibody. Amino acid sequence variants of an antibody may be
prepared by introducing appropriate modifications into the
nucleotide sequence encoding the antibody, or by peptide synthesis.
Such modifications include, for example, deletions from, and/or
insertions into and/or substitutions of residues within the amino
acid sequences of the antibody. Any combination of deletion,
insertion, and substitution can be made to arrive at the final
construct, provided that the final construct possesses the desired
characteristics, e.g., antigen-binding.
[0208] In certain embodiments, the antibodies include one or more
amino acid substitutions, e.g., as compared to an antibody sequence
described herein and/or compared to a sequence of a natural
repertoire, e.g., human repertoire. Sites of interest for
substitutional mutagenesis include the CDRs and FRs. Amino acid
substitutions may be introduced into an antibody of interest and
the products screened for a desired activity, e.g.,
retained/improved antigen binding, decreased immunogenicity,
improved half-life, and/or improved effector function, such as the
ability to promote antibody-dependent cellular cytotoxicity (ADCC)
or complement-dependent cytotoxicity (CDC).
[0209] In some embodiments, one or more residues within a CDR of a
parent antibody (e.g. a humanized or human antibody) is/are
substituted. In some embodiments, the substitution is made to
revert a sequence or position in the sequence to a germline
sequence, such as an antibody sequence found in the germline (e.g.,
human germline), for example, to reduce the likelihood of
immunogenicity, e.g., upon administration to a human subject.
[0210] In some embodiments, alterations are made in CDR "hotspots,"
residues encoded by codons that undergo mutation at high frequency
during the somatic maturation process (see, e.g., Chowdhury,
Methods Mol. Biol. 207:179-196 (2008)), and/or residues that
contact antigen, with the resulting variant V.sub.H or V.sub.L
being tested for binding affinity. Affinity maturation by
constructing and reselecting from secondary libraries has been
described, e.g., in Hoogenboom et al. in Methods in Molecular
Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J.,
(2001)). In some embodiments of affinity maturation, diversity is
introduced into the variable genes chosen for maturation by any of
a variety of methods (e.g., error-prone PCR, chain shuffling, or
oligonucleotide-directed mutagenesis). A secondary library is then
created. The library is then screened to identify any antibody
variants with the desired affinity. Another method to introduce
diversity involves CDR-directed approaches, in which several CDR
residues (e.g., 4-6 residues at a time) are randomized. CDR
residues involved in antigen binding may be specifically
identified, e.g., using alanine scanning mutagenesis or modeling.
CDR-H3 and CDR-L3 in particular are often targeted.
[0211] In certain embodiments, substitutions, insertions, or
deletions may occur within one or more CDRs so long as such
alterations do not substantially reduce the ability of the antibody
to bind antigen. For example, conservative alterations (e.g.,
conservative substitutions as provided herein) that do not
substantially reduce binding affinity may be made in CDRs. Such
alterations may, for example, be outside of antigen contacting
residues in the CDRs. In certain embodiments of the variant V.sub.H
and V.sub.L sequences provided above, each CDR either is unaltered,
or contains no more than one, two or three amino acid
substitutions.
[0212] Amino acid sequence insertions include amino- and/or
carboxyl-terminal fusions ranging in length from one residue to
polypeptides containing a hundred or more residues, as well as
intrasequence insertions of single or multiple amino acid residues.
Examples of terminal insertions include an antibody with an
N-terminal methionyl residue. Other insertional variants of the
antibody molecule include the fusion to the N- or C-terminus of the
antibody to an enzyme or a polypeptide which increases the serum
half-life of the antibody.
[0213] Modifications
[0214] In certain embodiments, the antibody is altered to increase
or decrease the extent to which the antibody is glycosylated, for
example, by removing or inserting one or more glycosylation sites
by altering the amino acid sequence and/or by modifying the
oligosaccharide(s) attached to the glycosylation sites, e.g., using
certain cell lines.
[0215] In some embodiments, an N-linked glycosylation, which is a
glycosylation site that occurs at asparagines in the consensus
sequence -Asn-Xaa-Ser/Thr is removed or inserted. For example, an
exemplary N-linked consensus sequence corresponds to residues
N52/P52A/S53, by Kabat numbering, of the exemplary heavy chain set
forth in SEQ ID NO: 17. In some embodiments, one or more residues
corresponding to N52, P52A and/or S53 are replaced with another
amino acid to remove the glycosylation site. Exemplary of a
modification is S53N, such as is provided in the exemplary heavy
chain set forth in SEQ ID NO: 19.
[0216] Exemplary modifications, variants, and cell lines are
described, e.g., in Patent Publication Nos. US 2003/0157108, US
2004/0093621, US 2003/0157108; WO 2000/61739; WO 2001/29246; US
2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US
2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO
2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742;
WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004);
Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Ripka et al.
Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US
2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Yamane-Ohnuki et
al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol.
Bioeng., 94(4):680-688 (2006); and WO2003/085107); WO 2003/011878
(Jean-Mairet et al.); U.S. Pat. No. 6,602,684 (Umana et al.); and
US 2005/0123546 (Umana et al.); WO 1997/30087 (Patel et al.); WO
1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
[0217] Among the modified antibodies are those having one or more
amino acid modifications in the Fc region, such as those having a
human Fc region sequence or other portion of a constant region
(e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an
amino acid modification (e.g. a substitution) at one or more amino
acid positions.
[0218] Such modifications can be made, e.g., to improve half-life,
alter binding to one or more types of Fc receptors, and/or alter
effector functions.
[0219] Also among the variants are cysteine engineered antibodies
such as "thioMAbs" and other cysteine engineered variants, in which
one or more residues of an antibody are substituted with cysteine
residues, in order to generate reactive thiol groups at accessible
sites, e.g., for use in conjugation of agents and linker-agents, to
produce immunoconjugates. Cysteine engineered antibodies are
described, e.g., in U.S. Pat. Nos. 7,855,275 and 7,521,541.
[0220] In some embodiments, the antibodies are modified to contain
additional nonproteinaceous moieties, including water soluble
polymers. Exemplary polymers include, but are not limited to,
polyethylene glycol (PEG), copolymers of ethylene glycol/propylene
glycol, carboxymethylcellulose, dextran, polyvinyl alcohol,
polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane,
ethylene/maleic anhydride copolymer, polyaminoacids (either
homopolymers or random copolymers), and dextran or poly(n-vinyl
pyrrolidone)polyethylene glycol, propropylene glycol homopolymers,
prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated
polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
Polyethylene glycol propionaldehyde may have advantages in
manufacturing due to its stability in water. The polymer may be of
any molecular weight, and may be branched or unbranched. The number
of polymers attached to the antibody may vary, and if more than one
polymer is attached, they can be the same or different molecules.
In general, the number and/or type of polymers used for
derivatization can be determined based on considerations including,
but not limited to, the particular properties or functions of the
antibody to be improved, whether the antibody derivative will be
used in a therapy under defined conditions, etc.
[0221] B. Recombinant Receptors
[0222] Among the provided binding molecules, e.g., ROR1 binding
molecules, are recombinant receptors, such as those that include
one of the provided antibodies. The receptors include antigen
receptors and other chimeric receptors that specifically bind to
ROR1, such as receptors containing the provided anti-ROR1
antibodies, e.g., antibody fragments. Among the antigen receptors
are functional non-TCR antigen receptors, such as chimeric antigen
receptors (CARs). Also provided are cells expressing the
recombinant receptors and uses thereof in adoptive cell therapy,
such as treatment of diseases and disorders associated with ROR1
expression.
[0223] Exemplary antigen receptors, including CARs, and methods for
engineering and introducing such receptors into cells, include
those described, for example, in international patent application
publication numbers WO200014257, WO2013126726, WO2012/129514,
WO2014031687, WO2013/166321, WO2013/071154, WO2013/123061 U.S.
patent application publication numbers US2002131960, US2013287748,
US20130149337, U.S. Pat. Nos. 6,451,995, 7,446,190, 8,252,592,
8,339,645, 8,398,282, 7,446,179, 6,410,319, 7,070,995, 7,265,209,
7,354,762, 7,446,191, 8,324,353, and 8,479,118, and European patent
application number EP2537416, and/or those described by Sadelain et
al., Cancer Discov. 2013 April; 3(4): 388-398; Davila et al. (2013)
PLoS ONE 8(4): e61338; Turtle et al., Curr. Opin. Immunol., 2012
October; 24(5): 633-39; Wu et al., Cancer, 2012 Mar. 18(2): 160-75.
In some aspects, the antigen receptors include a CAR as described
in U.S. Pat. No. 7,446,190, and those described in International
Patent Application Publication No.: WO/2014055668 A1. Exemplary of
the CARs include CARs as disclosed in any of the aforementioned
publications, such as WO2014031687, U.S. Pat. No. 8,339,645, U.S.
Pat. No. 7,446,179, US 2013/0149337, U.S. Pat. No. 7,446,190, U.S.
Pat. No. 8,389,282, e.g., and in which the antigen-binding portion,
e.g., scFv, is replaced by an antibody, e.g., as provided
herein.
[0224] Among the chimeric receptors are chimeric antigen receptors
(CARs). The chimeric receptors, such as CARs, generally include an
extracellular antigen binding domain that includes, is, or is
comprised within, one of the provided anti-ROR1 antibodies. Thus,
the chimeric receptors, e.g., CARs, typically include in their
extracellular portions one or more ROR1-binding molecules, such as
one or more antigen-binding fragment, domain, or portion, or one or
more antibody variable domains, and/or antibody molecules, such as
those described herein. In some embodiments, the CAR includes a
ROR1-binding portion or portions of the antibody molecule, such as
a variable heavy (VH) chain region and/or variable light (V.sub.L)
chain region of the antibody, e.g., an scFv antibody fragment.
[0225] ROR1-targeting CARs are described, for example, by Hudecek
et al., Clin Cancer Res, 19(12), 3153-3164 (2013) and Baskar et al.
MAbs. 4(3): 349-361 (2012). See also WO2014031687.
[0226] In some embodiments, the recombinant receptor such as the
CAR, such as the antibody portion thereof, further includes a
spacer, which may be or include at least a portion of an
immunoglobulin constant region or variant or modified version
thereof, such as a hinge region, e.g., an IgG4 hinge region, and/or
a CH1/CL and/or Fc region. In some embodiments, the constant region
or portion is of a human IgG, such as IgG4 or IgG1. In some
aspects, the portion of the constant region serves as a spacer
region between the antigen-recognition component, e.g., scFv, and
transmembrane domain. The spacer can be of a length that provides
for increased responsiveness of the cell following antigen binding,
as compared to in the absence of the spacer. In some examples, the
spacer is at or about 12 amino acids in length or is no more than
12 amino acids in length. Exemplary spacers include those having at
least about 10 to 229 amino acids, about 10 to 200 amino acids,
about 10 to 175 amino acids, about 10 to 150 amino acids, about 10
to 125 amino acids, about 10 to 100 amino acids, about 10 to 75
amino acids, about 10 to 50 amino acids, about 10 to 40 amino
acids, about 10 to 30 amino acids, about 10 to 20 amino acids, or
about 10 to 15 amino acids, and including any integer between the
endpoints of any of the listed ranges. In some embodiments, a
spacer region has about 12 amino acids or less, about 119 amino
acids or less, or about 229 amino acids or less. Exemplary spacers
include IgG4 hinge alone, IgG4 hinge linked to CH2 and CH3 domains,
or IgG4 hinge linked to the CH3 domain. Exemplary spacers include,
but are not limited to, those described in Hudecek et al. (2013)
Clin. Cancer Res., 19:3153 or international patent application
publication number WO2014031687. In some embodiments, the spacer
has the sequence set forth in SEQ ID NO: 108, and is encoded by the
sequence set forth in SEQ ID NO: 107. In some embodiments, the
spacer has the sequence set forth in SEQ ID NO: 142. In some
embodiments, the spacer has the sequence set forth in SEQ ID NO:
143.
[0227] In some embodiments, the constant region or portion is of
IgD. In some embodiments, the spacer has the sequence set forth in
SEQ ID NO:144. In some embodiments, the spacer has a sequence of
amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence
identity to any of SEQ ID NOS: 108, 142, 143 or 144.
[0228] The antigen recognition domain generally is linked to one or
more intracellular signaling components, such as signaling
components that mimic activation through an antigen receptor
complex, such as a TCR complex, in the case of a CAR, and/or signal
via another cell surface receptor. Thus, in some embodiments, the
ROR1-specific binding component (e.g., antibody) is linked to one
or more transmembrane and intracellular signaling domains. In some
embodiments, the transmembrane domain is fused to the extracellular
domain. In one embodiment, a transmembrane domain that naturally is
associated with one of the domains in the receptor, e.g., CAR, is
used. In some instances, the transmembrane domain is selected or
modified by amino acid substitution to avoid binding of such
domains to the transmembrane domains of the same or different
surface membrane proteins to minimize interactions with other
members of the receptor complex.
[0229] The transmembrane domain in some embodiments is derived
either from a natural or from a synthetic source. Where the source
is natural, the domain in some aspects is derived from any
membrane-bound or transmembrane protein. Transmembrane regions
include those derived from (i.e. comprise at least the
transmembrane region(s) of) the alpha, beta or zeta chain of the
T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CDS, CD9, CD
16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154.
Alternatively the transmembrane domain in some embodiments is
synthetic. In some aspects, the synthetic transmembrane domain
comprises predominantly hydrophobic residues such as leucine and
valine. In some aspects, a triplet of phenylalanine, tryptophan and
valine will be found at each end of a synthetic transmembrane
domain. In some embodiments, the linkage is by linkers, spacers,
and/or transmembrane domain(s).
[0230] Among the intracellular signaling domains are those that
mimic or approximate a signal through a natural antigen receptor, a
signal through such a receptor in combination with a costimulatory
receptor, and/or a signal through a costimulatory receptor alone.
In some embodiments, a short oligo- or polypeptide linker, for
example, a linker of between 2 and 10 amino acids in length, such
as one containing glycines and serines, e.g., glycine-serine
doublet, is present and forms a linkage between the transmembrane
domain and the cytoplasmic signaling domain of the CAR.
[0231] The receptor, e.g., the CAR, generally includes at least one
intracellular signaling component or components. In some
embodiments, the receptor includes an intracellular component of a
TCR complex, such as a TCR CD3 chain that mediates T-cell
activation and cytotoxicity, e.g., CD3 zeta chain. Thus, in some
aspects, the ROR1-binding antibody is linked to one or more cell
signaling modules. In some embodiments, cell signaling modules
include CD3 transmembrane domain, CD3 intracellular signaling
domains, and/or other CD transmembrane domains. In some
embodiments, the receptor, e.g., CAR, further includes a portion of
one or more additional molecules such as Fc receptor .gamma., CD8,
CD4, CD25, or CD16. For example, in some aspects, the CAR includes
a chimeric molecule between CD3-zeta (CD3-.zeta.) or Fc receptor
.gamma. and CD8, CD4, CD25 or CD16.
[0232] In some embodiments, upon ligation of the CAR, the
cytoplasmic domain or intracellular signaling domain of the CAR
activates at least one of the normal effector functions or
responses of the immune cell, e.g., T cell engineered to express
the CAR. For example, in some contexts, the CAR induces a function
of a T cell such as cytolytic activity or T-helper activity, such
as secretion of cytokines or other factors. In some embodiments, a
truncated portion of an intracellular signaling domain of an
antigen receptor component or costimulatory molecule is used in
place of an intact immunostimulatory chain, for example, if it
transduces the effector function signal. In some embodiments, the
intracellular signaling domain or domains include the cytoplasmic
sequences of the T cell receptor (TCR), and in some aspects also
those of co-receptors that in the natural context act in concert
with such receptor to initiate signal transduction following
antigen receptor engagement, and/or any derivative or variant of
such molecules, and/or any synthetic sequence that has the same
functional capability.
[0233] In the context of a natural TCR, full activation generally
requires not only signaling through the TCR, but also a
costimulatory signal. Thus, in some embodiments, to promote full
activation, a component for generating secondary or co-stimulatory
signal is also included in the CAR. In other embodiments, the CAR
does not include a component for generating a costimulatory signal.
In some aspects, an additional CAR is expressed in the same cell
and provides the component for generating the secondary or
costimulatory signal.
[0234] T cell activation is in some aspects described as being
mediated by two classes of cytoplasmic signaling sequences: those
that initiate antigen-dependent primary activation through the TCR
(primary cytoplasmic signaling sequences), and those that act in an
antigen-independent manner to provide a secondary or co-stimulatory
signal (secondary cytoplasmic signaling sequences). In some
aspects, the CAR includes one or both of such signaling
components.
[0235] In some aspects, the CAR includes a primary cytoplasmic
signaling sequence that regulates primary activation of the TCR
complex. Primary cytoplasmic signaling sequences that act in a
stimulatory manner may contain signaling motifs which are known as
immunoreceptor tyrosine-based activation motifs or ITAMs. Examples
of ITAM containing primary cytoplasmic signaling sequences include
those derived from TCR or CD3 zeta, FcR gamma, FcR beta, CD3 gamma,
CD3 delta, CD3 epsilon, CDS, CD22, CD79a, CD79b, and CD66d. In some
embodiments, cytoplasmic signaling molecule(s) in the CAR
contain(s) a cytoplasmic signaling domain, portion thereof, or
sequence derived from CD3 zeta.
[0236] In some embodiments, the CAR includes a signaling domain
and/or transmembrane portion of a costimulatory receptor, such as
CD28, 4-1BB, OX40, DAP10, and ICOS. In some aspects, the same CAR
includes both the activating and costimulatory components.
[0237] In some embodiments, the activating domain is included
within one CAR, whereas the costimulatory component is provided by
another CAR recognizing another antigen. In some embodiments, the
CARs include activating or stimulatory CARs, and costimulatory
CARs, both expressed on the same cell (see WO2014/055668). In some
aspects, the ROR1-targeting CAR is the stimulatory or activating
CAR; in other aspects, it is the costimulatory CAR. In some
embodiments, the cells further include inhibitory CARs (iCARs, see
Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013),
such as a CAR recognizing an antigen other than ROR1, whereby an
activating signal delivered through the ROR1-targeting CAR is
diminished or inhibited by binding of the inhibitory CAR to its
ligand, e.g., to reduce off-target effects.
[0238] In certain embodiments, the intracellular signaling domain
comprises a CD28 transmembrane and signaling domain linked to a CD3
(e.g., CD3-zeta) intracellular domain. In some embodiments, the
intracellular signaling domain comprises a chimeric CD28 and CD137
(4-1BB, TNFRSF9) co-stimulatory domains, linked to a CD3 zeta
intracellular domain.
[0239] In some embodiments, the CAR encompasses one or more, e.g.,
two or more, costimulatory domains and an activation domain, e.g.,
primary activation domain, in the cytoplasmic portion. Exemplary
CARs include intracellular components of CD3-zeta, CD28, and
4-1BB.
[0240] In some embodiments, the CAR or other antigen receptor
further includes a marker, such as a cell surface marker, which may
be used to confirm transduction or engineering of the cell to
express the receptor, such as a truncated version of a cell surface
receptor, such as truncated EGFR (tEGFR). In some aspects, the
marker includes all or part (e.g., truncated form) of CD34, a NGFR,
or epidermal growth factor receptor (e.g., tEGFR). In some
embodiments, the nucleic acid encoding the marker is operably
linked to a polynucleotide encoding for a linker sequence, such as
a cleavable linker sequence, e.g., T2A. See WO2014031687. In some
embodiments, introduction of a construct encoding the CAR and EGFRt
separated by a T2A ribosome switch can express two proteins from
the same construct, such that the EGFRt can be used as a marker to
detect cells expressing such construct. In some embodiments, a
marker, and optionally a linker sequence, can be any as disclosed
in published patent application No. WO2014031687. For example, the
marker can be a truncated EGFR (tEGFR) that is, optionally, linked
to a linker sequence, such as a T2A cleavable linker sequence. An
exemplary polypeptide for a truncated EGFR (e.g. tEGFR) comprises
the sequence of amino acids set forth in SEQ ID NO: 154 or a
sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%,
89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more
sequence identity to SEQ ID NO: 154. An exemplary T2A linker
sequence comprises the sequence of amino acids set forth in SEQ ID
NO: 153 or a sequence of amino acids that exhibits at least 85%,
86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99% or more sequence identity to SEQ ID NO: 153.
[0241] In some embodiments, the marker is a molecule, e.g., cell
surface protein, not naturally found on T cells or not naturally
found on the surface of T cells, or a portion thereof.
[0242] In some embodiments, the molecule is a non-self molecule,
e.g., non-self protein, i.e., one that is not recognized as "self"
by the immune system of the host into which the cells will be
adoptively transferred.
[0243] In some embodiments, the marker serves no therapeutic
function and/or produces no effect other than to be used as a
marker for genetic engineering, e.g., for selecting cells
successfully engineered. In other embodiments, the marker may be a
therapeutic molecule or molecule otherwise exerting some desired
effect, such as a ligand for a cell to be encountered in vivo, such
as a costimulatory or immune checkpoint molecule to enhance and/or
dampen responses of the cells upon adoptive transfer and encounter
with ligand.
[0244] In some cases, CARs are referred to as first, second, and/or
third generation CARs. In some aspects, a first generation CAR is
one that solely provides a CD3-chain induced signal upon antigen
binding; in some aspects, a second-generation CARs is one that
provides such a signal and costimulatory signal, such as one
including an intracellular signaling domain from a costimulatory
receptor such as CD28 or CD137; in some aspects, a third generation
CAR in some aspects is one that includes multiple costimulatory
domains of different costimulatory receptors.
[0245] In some embodiments, the chimeric antigen receptor includes
an extracellular portion containing the antibody or fragment
described herein. In some aspects, the chimeric antigen receptor
includes an extracellular portion containing the antibody or
fragment described herein and an intracellular signaling domain. In
some embodiments, the antibody or fragment includes an scFv or a
single-domain V.sub.H antibody and the intracellular domain
contains an ITAM. In some aspects, the intracellular signaling
domain includes a signaling domain of a zeta chain of a CD3-zeta
(CD3) chain. In some embodiments, the chimeric antigen receptor
includes a transmembrane domain linking the extracellular domain
and the intracellular signaling domain.
[0246] In some aspects, the transmembrane domain contains a
transmembrane portion of CD28. The extracellular domain and
transmembrane can be linked directly or indirectly. In some
embodiments, the extracellular domain and transmembrane are linked
by a spacer, such as any described herein. In some embodiments, the
chimeric antigen receptor contains an intracellular domain of a T
cell costimulatory molecule, such as between the transmembrane
domain and intracellular signaling domain. In some aspects, the T
cell costimulatory molecule is CD28 or 41BB.
[0247] In some embodiments, the CAR contains an antibody, e.g., an
antibody fragment, a transmembrane domain that is or contains a
transmembrane portion of CD28 or a functional variant thereof, and
an intracellular signaling domain containing a signaling portion of
CD28 or functional variant thereof and a signaling portion of CD3
zeta or functional variant thereof. In some embodiments, the CAR
contains an antibody, e.g., antibody fragment, a transmembrane
domain that is or contains a transmembrane portion of CD28 or a
functional variant thereof, and an intracellular signaling domain
containing a signaling portion of a 4-1BB or functional variant
thereof and a signaling portion of CD3 zeta or functional variant
thereof. In some such embodiments, the receptor further includes a
spacer containing a portion of an Ig molecule, such as a human Ig
molecule, such as an Ig hinge, e.g. an IgG4 hinge, such as a
hinge-only spacer.
[0248] In some embodiments, the transmembrane domain of the
receptor, e.g., the CAR is a transmembrane domain of human CD28 or
variant thereof, e.g., a 27-amino acid transmembrane domain of a
human CD28 (Accession No.: P10747.1), or is a transmembrane domain
that comprises the sequence of amino acids set forth in SEQ ID NO:
145 or a sequence of amino acids that exhibits at least 85%, 86%,
87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or
more sequence identity to SEQ ID NO:145; in some embodiments, the
transmembrane-domain containing portion of the recombinant receptor
comprises the sequence of amino acids set forth in SEQ ID NO: 146
or a sequence of amino acids having at least at or about 85%, 86%,
87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or
more sequence identity thereto.
[0249] In some embodiments, the chimeric antigen receptor contains
an intracellular domain of a T cell costimulatory molecule. In some
aspects, the T cell costimulatory molecule is CD28 or 41BB.
[0250] In some embodiments, the intracellular signaling domain
comprises an intracellular costimulatory signaling domain of human
CD28 or functional variant or portion thereof, such as a 41 amino
acid domain thereof and/or such a domain with an LL to GG
substitution at positions 186-187 of a native CD28 protein. In some
embodiments, the intracellular signaling domain can comprise the
sequence of amino acids set forth in SEQ ID NO: 147 or 148 or a
sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%,
89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more
sequence identity to SEQ ID NO: 147 or 148. In some embodiments,
the intracellular domain comprises an intracellular costimulatory
signaling domain of 41BB or functional variant or portion thereof,
such as a 42-amino acid cytoplasmic domain of a human 4-1BB
(Accession No. Q07011.1) or functional variant or portion thereof,
such as the sequence of amino acids set forth in SEQ ID NO: 149 or
a sequence of amino acids that exhibits at least 85%, 86%, 87%,
88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more
sequence identity to SEQ ID NO: 149.
[0251] In some embodiments, the intracellular signaling domain
comprises a human CD3 zeta stimulatory signaling domain or
functional variant thereof, such as an 112 AA cytoplasmic domain of
isoform 3 of human CD3.zeta. (Accession No.: P20963.2) or a CD3
zeta signaling domain as described in U.S. Pat. No. 7,446,190 or
U.S. Pat. No. 8,911,993. In some embodiments, the intracellular
signaling domain comprises the sequence of amino acids set forth in
SEQ ID NO: 150, 151 or 152 or a sequence of amino acids that
exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:
150, 151 or 152
[0252] In some aspects, the spacer contains only a hinge region of
an IgG, such as only a hinge of IgG4 or IgG1, such as the hinge
only spacer set forth in SEQ ID NO:108. In other embodiments, the
spacer is an Ig hinge, e.g., and IgG4 hinge, linked to a CH2 and/or
CH3 domains. In some embodiments, the spacer is an Ig hinge, e.g.,
an IgG4 hinge, linked to CH2 and CH3 domains, such as set forth in
SEQ ID NO:143. In some embodiments, the spacer is an Ig hinge,
e.g., an IgG4 hinge, linked to a CH3 domain only, such as set forth
in SEQ ID NO:142. In some embodiments, the spacer is or comprises a
glycine-serine rich sequence or other flexible linker such as known
flexible linkers.
[0253] For example, in some embodiments, the CAR includes a ROR-1
antibody or fragment, such as any of the human ROR1 antibodies,
including sdAbs (e.g. containing only the V.sub.H region) and
scFvs, described herein, a spacer such as any of the Ig-hinge
containing spacers, a CD28 transmembrane domain, a CD28
intracellular signaling domain, and a CD3 zeta signaling domain. In
some embodiments, the CAR includes the ROR-1 antibody or fragment,
such as any of the human ROR1 antibodies, including sdAbs and scFvs
described herein, a spacer such as any of the Ig-hinge containing
spacers, a CD28 transmembrane domain, a CD28 intracellular
signaling domain, and a CD3 zeta signaling domain. In some
embodiments, such CAR constructs further includes a T2A ribosomal
skip element and/or a tEGFR sequence, e.g., downstream of the
CAR.
[0254] C. Engineered Cells
[0255] Also provided are cells such as cells that contain an
engineered antigen receptor, e.g., that contains an extracellular
domain including the anti-ROR1 antibody or fragment, described
herein. Also provided are populations of such cells, compositions
containing such cells and/or enriched for such cells, such as in
which cells expressing the ROR1 binding molecule make up at least
50, 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or more
percent of the total cells in the composition or cells of a certain
type such as T cells or CD8+ or CD4+ cells. Among the compositions
are pharmaceutical compositions and formulations for
administration, such as for adoptive cell therapy. Also provided
are therapeutic methods for administering the cells and
compositions to subjects, e.g., patients.
[0256] Thus also provided are genetically engineered cells
expressing the recombinant receptors containing the antibodies,
e.g., cells containing the CARs. The cells generally are eukaryotic
cells, such as mammalian cells, and typically are human cells. In
some embodiments, the cells are derived from the blood, bone
marrow, lymph, or lymphoid organs, are cells of the immune system,
such as cells of the innate or adaptive immunity, e.g., myeloid or
lymphoid cells, including lymphocytes, typically T cells and/or NK
cells. Other exemplary cells include stem cells, such as
multipotent and pluripotent stem cells, including induced
pluripotent stem cells (iPSCs). The cells typically are primary
cells, such as those isolated directly from a subject and/or
isolated from a subject and frozen. In some embodiments, the cells
include one or more subsets of T cells or other cell types, such as
whole T cell populations, CD4+ cells, CD8+ cells, and
subpopulations thereof, such as those defined by function,
activation state, maturity, potential for differentiation,
expansion, recirculation, localization, and/or persistence
capacities, antigen-specificity, type of antigen receptor, presence
in a particular organ or compartment, marker or cytokine secretion
profile, and/or degree of differentiation. With reference to the
subject to be treated, the cells may be allogeneic and/or
autologous. Among the methods include off-the-shelf methods. In
some aspects, such as for off-the-shelf technologies, the cells are
pluripotent and/or multipotent, such as stem cells, such as induced
pluripotent stem cells (iPSCs). In some embodiments, the methods
include isolating cells from the subject, preparing, processing,
culturing, and/or engineering them, as described herein, and
re-introducing them into the same patient, before or after
cryopreservation.
[0257] Among the sub-types and subpopulations of T cells and/or of
CD4+ and/or of CD8+ T cells are naive T (T.sub.N) cells, effector T
cells (T.sub.EFF), memory T cells and sub-types thereof, such as
stem cell memory T (T.sub.SCM), central memory T (T.sub.CM),
effector memory T (T.sub.EM), or terminally differentiated effector
memory T cells, tumor-infiltrating lymphocytes (TIL), immature T
cells, mature T cells, helper T cells, cytotoxic T cells,
mucosa-associated invariant T (MALT) cells, naturally occurring and
adaptive regulatory T (Treg) cells, helper T cells, such as TH1
cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells,
follicular helper T cells, alpha/beta T cells, and delta/gamma T
cells.
[0258] In some embodiments, the cells are natural killer (NK)
cells. In some embodiments, the cells are monocytes or
granulocytes, e.g., myeloid cells, macrophages, neutrophils,
dendritic cells, mast cells, eosinophils, and/or basophils.
[0259] In some embodiments, the cells include one or more nucleic
acids introduced via genetic engineering, and thereby express
recombinant or genetically engineered products of such nucleic
acids. In some embodiments, the nucleic acids are heterologous,
i.e., normally not present in a cell or sample obtained from the
cell, such as one obtained from another organism or cell, which for
example, is not ordinarily found in the cell being engineered
and/or an organism from which such cell is derived. In some
embodiments, the nucleic acids are not naturally occurring, such as
a nucleic acid not found in nature, including one comprising
chimeric combinations of nucleic acids encoding various domains
from multiple different cell types.
[0260] Vectors and Methods for Genetic Engineering
[0261] Also provided are methods, nucleic acids, compositions, and
kits, for expressing the binding molecules, including receptors
comprising the antibodies, and for producing the genetically
engineered cells expressing such binding molecules. The genetic
engineering generally involves introduction of a nucleic acid
encoding the recombinant or engineered component into the cell,
such as by retroviral transduction, transfection, or
transformation.
[0262] In some embodiments, gene transfer is accomplished by first
stimulating the cell, such as by combining it with a stimulus that
induces a response such as proliferation, survival, and/or
activation, e.g., as measured by expression of a cytokine or
activation marker, followed by transduction of the activated cells,
and expansion in culture to numbers sufficient for clinical
applications.
[0263] In some contexts, overexpression of a stimulatory factor
(for example, a lymphokine or a cytokine) may be toxic to a
subject. Thus, in some contexts, the engineered cells include gene
segments that cause the cells to be susceptible to negative
selection in vivo, such as upon administration in adoptive
immunotherapy. For example in some aspects, the cells are
engineered so that they can be eliminated as a result of a change
in the in vivo condition of the patient to which they are
administered. The negative selectable phenotype may result from the
insertion of a gene that confers sensitivity to an administered
agent, for example, a compound. Negative selectable genes include
the Herpes simplex virus type I thymidine kinase (HSV-I TK) gene
(Wigler et al., Cell II: 223, 1977) which confers ganciclovir
sensitivity; the cellular hypoxanthine phosphribosyltransferase
(HPRT) gene, the cellular adenine phosphoribosyltransferase (APRT)
gene, bacterial cytosine deaminase, (Mullen et al., Proc. Natl.
Acad. Sci. USA. 89:33 (1992)).
[0264] In some aspects, the cells further are engineered to promote
expression of cytokines or other factors. Various methods for the
introduction of genetically engineered components, e.g., antigen
receptors, e.g., CARs, are well known and may be used with the
provided methods and compositions. Exemplary methods include those
for transfer of nucleic acids encoding the receptors, including via
viral, e.g., retroviral or lentiviral, transduction, transposons,
and electroporation.
[0265] In some embodiments, recombinant nucleic acids are
transferred into cells using recombinant infectious virus
particles, such as, e.g., vectors derived from simian virus 40
(SV40), adenoviruses, adeno-associated virus (AAV). In some
embodiments, recombinant nucleic acids are transferred into T cells
using recombinant lentiviral vectors or retroviral vectors, such as
gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene
Therapy 2014 Apr. 3. doi: 10.1038/gt.2014.25; Carlens et al. (2000)
Exp Hematol 28(10): 1137-46; Alonso-Camino et al. (2013) Mol Ther
Nucl Acids 2, e93; Park et al., Trends Biotechnol. 2011 Nov.
29(11): 550-557.
[0266] In some embodiments, the retroviral vector has a long
terminal repeat sequence (LTR), e.g., a retroviral vector derived
from the Moloney murine leukemia virus (MoMLV), myeloproliferative
sarcoma virus (MPSV), murine embryonic stem cell virus (MESV),
murine stem cell virus (MSCV), spleen focus forming virus (SFFV),
or adeno-associated virus (AAV). Most retroviral vectors are
derived from murine retroviruses. In some embodiments, the
retroviruses include those derived from any avian or mammalian cell
source. The retroviruses typically are amphotropic, meaning that
they are capable of infecting host cells of several species,
including humans. In one embodiment, the gene to be expressed
replaces the retroviral gag, pol and/or env sequences. A number of
illustrative retroviral systems have been described (e.g., U.S.
Pat. Nos. 5,219,740; 6,207,453; 5,219,740; Miller and Rosman (1989)
BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy
1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al.
(1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie
and Temin (1993) Cur. Opin. Genet. Develop. 3:102-109.
[0267] Methods of lentiviral transduction are known. Exemplary
methods are described in, e.g., Wang et al. (2012) J. Immunother.
35(9): 689-701; Cooper et al. (2003) Blood. 101:1637-1644;
Verhoeyen et al. (2009) Methods Mol Biol. 506: 97-114; and
Cavalieri et al. (2003) Blood. 102(2): 497-505.
[0268] In some embodiments, recombinant nucleic acids are
transferred into T cells via electroporation (see, e.g., Chicaybam
et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000)
Gene Therapy 7(16): 1431-1437). In some embodiments, recombinant
nucleic acids are transferred into T cells via transposition (see,
e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et
al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009)
Methods Mol Biol 506: 115-126). Other methods of introducing and
expressing genetic material in immune cells include calcium
phosphate transfection (e.g., as described in Current Protocols in
Molecular Biology, John Wiley & Sons, New York. N.Y.),
protoplast fusion, cationic liposome-mediated transfection;
tungsten particle-facilitated microparticle bombardment (Johnston,
Nature, 346: 776-777 (1990)); and strontium phosphate DNA
co-precipitation (Brash et al., Mol. Cell Biol., 7: 2031-2034
(1987)).
[0269] Other approaches and vectors for transfer of the nucleic
acids encoding the recombinant products are those described, e.g.,
in international patent application, Publication No.: WO2014055668,
and U.S. Pat. No. 7,446,190.
[0270] Among additional nucleic acids, e.g., genes for introduction
are those to improve the efficacy of therapy, such as by promoting
viability and/or function of transferred cells; genes to provide a
genetic marker for selection and/or evaluation of the cells, such
as to assess in vivo survival or localization; genes to improve
safety, for example, by making the cell susceptible to negative
selection in vivo as described by Lupton S. D. et al., Mol. and
Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy
3:319-338 (1992); see also the publications of PCT/US91/08442 and
PCT/US94/05601 by Lupton et al. describing the use of bifunctional
selectable fusion genes derived from fusing a dominant positive
selectable marker with a negative selectable marker. See, e.g.,
Riddell et al., U.S. Pat. No. 6,040,177, at columns 14-17.
[0271] Preparation of Cells for Engineering
[0272] In some embodiments, preparation of the engineered cells
includes one or more culture and/or preparation steps. The cells
for introduction of the ROR1-binding molecule, e.g., CAR, may be
isolated from a sample, such as a biological sample, e.g., one
obtained from or derived from a subject. In some embodiments, the
subject from which the cell is isolated is one having the disease
or condition or in need of a cell therapy or to which cell therapy
will be administered. The subject in some embodiments is a human in
need of a particular therapeutic intervention, such as the adoptive
cell therapy for which cells are being isolated, processed, and/or
engineered.
[0273] Accordingly, the cells in some embodiments are primary
cells, e.g., primary human cells. The samples include tissue,
fluid, and other samples taken directly from the subject, as well
as samples resulting from one or more processing steps, such as
separation, centrifugation, genetic engineering (e.g. transduction
with viral vector), washing, and/or incubation. The biological
sample can be a sample obtained directly from a biological source
or a sample that is processed. Biological samples include, but are
not limited to, body fluids, such as blood, plasma, serum,
cerebrospinal fluid, synovial fluid, urine and sweat, tissue and
organ samples, including processed samples derived therefrom.
[0274] In some aspects, the sample from which the cells are derived
or isolated is blood or a blood-derived sample, or is or is derived
from an apheresis or leukapheresis product. Exemplary samples
include whole blood, peripheral blood mononuclear cells (PBMCs),
leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia,
lymphoma, lymph node, gut associated lymphoid tissue, mucosa
associated lymphoid tissue, spleen, other lymphoid tissues, liver,
lung, stomach, intestine, colon, kidney, pancreas, breast, bone,
prostate, cervix, testes, ovaries, tonsil, or other organ, and/or
cells derived therefrom. Samples include, in the context of cell
therapy, e.g., adoptive cell therapy, samples from autologous and
allogeneic sources.
[0275] In some embodiments, the cells are derived from cell lines,
e.g., T cell lines. The cells in some embodiments are obtained from
a xenogeneic source, for example, from mouse, rat, non-human
primate, or pig.
[0276] In some embodiments, isolation of the cells includes one or
more preparation and/or non-affinity based cell separation steps.
In some examples, cells are washed, centrifuged, and/or incubated
in the presence of one or more reagents, for example, to remove
unwanted components, enrich for desired components, lyse or remove
cells sensitive to particular reagents. In some examples, cells are
separated based on one or more property, such as density, adherent
properties, size, sensitivity and/or resistance to particular
components.
[0277] In some examples, cells from the circulating blood of a
subject are obtained, e.g., by apheresis or leukapheresis. The
samples, in some aspects, contain lymphocytes, including T cells,
monocytes, granulocytes, B cells, other nucleated white blood
cells, red blood cells, and/or platelets, and in some aspects
contains cells other than red blood cells and platelets.
[0278] In some embodiments, the blood cells collected from the
subject are washed, e.g., to remove the plasma fraction and to
place the cells in an appropriate buffer or media for subsequent
processing steps. In some embodiments, the cells are washed with
phosphate buffered saline (PBS). In some embodiments, the wash
solution lacks calcium and/or magnesium and/or many or all divalent
cations. In some aspects, a washing step is accomplished a
semi-automated "flow-through" centrifuge (for example, the Cobe
2991 cell processor, Baxter) according to the manufacturer's
instructions. In some aspects, a washing step is accomplished by
tangential flow filtration (TFF) according to the manufacturer's
instructions. In some embodiments, the cells are resuspended in a
variety of biocompatible buffers after washing, such as, for
example, Ca.sup.++/Mg.sup.++ free PBS. In certain embodiments,
components of a blood cell sample are removed and the cells
directly resuspended in culture media.
[0279] In some embodiments, the methods include density-based cell
separation methods, such as the preparation of white blood cells
from peripheral blood by lysing the red blood cells and
centrifugation through a Percoll or Ficoll gradient.
[0280] In some embodiments, the isolation methods include the
separation of different cell types based on the expression or
presence in the cell of one or more specific molecules, such as
surface markers, e.g., surface proteins, intracellular markers, or
nucleic acid. In some embodiments, any known method for separation
based on such markers may be used. In some embodiments, the
separation is affinity- or immunoaffinity-based separation. For
example, the isolation in some aspects includes separation of cells
and cell populations based on the cells' expression or expression
level of one or more markers, typically cell surface markers, for
example, by incubation with an antibody or binding partner that
specifically binds to such markers, followed generally by washing
steps and separation of cells having bound the antibody or binding
partner, from those cells having not bound to the antibody or
binding partner.
[0281] Such separation steps can be based on positive selection, in
which the cells having bound the reagents are retained for further
use, and/or negative selection, in which the cells having not bound
to the antibody or binding partner are retained. In some examples,
both fractions are retained for further use. In some aspects,
negative selection can be particularly useful where no antibody is
available that specifically identifies a cell type in a
heterogeneous population, such that separation is best carried out
based on markers expressed by cells other than the desired
population.
[0282] The separation need not result in 100% enrichment or removal
of a particular cell population or cells expressing a particular
marker. For example, positive selection of or enrichment for cells
of a particular type, such as those expressing a marker, refers to
increasing the number or percentage of such cells, but need not
result in a complete absence of cells not expressing the marker.
Likewise, negative selection, removal, or depletion of cells of a
particular type, such as those expressing a marker, refers to
decreasing the number or percentage of such cells, but need not
result in a complete removal of all such cells.
[0283] In some examples, multiple rounds of separation steps are
carried out, where the positively or negatively selected fraction
from one step is subjected to another separation step, such as a
subsequent positive or negative selection. In some examples, a
single separation step can deplete cells expressing multiple
markers simultaneously, such as by incubating cells with a
plurality of antibodies or binding partners, each specific for a
marker targeted for negative selection. Likewise, multiple cell
types can simultaneously be positively selected by incubating cells
with a plurality of antibodies or binding partners expressed on the
various cell types.
[0284] For example, in some aspects, specific subpopulations of T
cells, such as cells positive or expressing high levels of one or
more surface markers, e.g., CD28.sup.+, CD62L.sup.+, CCR7.sup.+,
CD27.sup.+, CD127.sup.+, CD4.sup.+, CD8.sup.+, CD45RA.sup.+, and/or
CD45RO.sup.+ T cells, are isolated by positive or negative
selection techniques.
[0285] For example, CD3.sup.+, CD28.sup.+ T cells can be positively
selected using CD3/CD28 conjugated magnetic beads (e.g.,
DYNABEADS.RTM. M-450 CD3/CD28 T Cell Expander).
[0286] In some embodiments, isolation is carried out by enrichment
for a particular cell population by positive selection, or
depletion of a particular cell population, by negative selection.
In some embodiments, positive or negative selection is accomplished
by incubating cells with one or more antibodies or other binding
agent that specifically bind to one or more surface markers
expressed or expressed (marker.sup.+) at a relatively higher level
(marker.sup.high) on the positively or negatively selected cells,
respectively.
[0287] In some embodiments, T cells are separated from a PBMC
sample by negative selection of markers expressed on non-T cells,
such as B cells, monocytes, or other white blood cells, such as
CD14. In some aspects, a CD4.sup.+ or CD8.sup.+ selection step is
used to separate CD4.sup.+ helper and CD8.sup.+ cytotoxic T cells.
Such CD4.sup.+ and CD8.sup.+ populations can be further sorted into
sub-populations by positive or negative selection for markers
expressed or expressed to a relatively higher degree on one or more
naive, memory, and/or effector T cell subpopulations.
[0288] In some embodiments, CD8.sup.+ cells are further enriched
for or depleted of naive, central memory, effector memory, and/or
central memory stem cells, such as by positive or negative
selection based on surface antigens associated with the respective
subpopulation. In some embodiments, enrichment for central memory T
(T.sub.CM) cells is carried out to increase efficacy, such as to
improve long-term survival, expansion, and/or engraftment following
administration, which in some aspects is particularly robust in
such sub-populations. See Terakura et al. (2012) Blood. 1:72-82;
Wang et al. (2012) J Immunother. 35(9):689-701. In some
embodiments, combining T.sub.CM-enriched CD8.sup.+ T cells and
CD4.sup.+ T cells further enhances efficacy.
[0289] In embodiments, memory T cells are present in both
CD62L.sup.+ and CD62L.sup.- subsets of CD8.sup.+ peripheral blood
lymphocytes. PBMC can be enriched for or depleted of
CD62L.sup.-CD8.sup.+ and/or CD62L.sup.+CD8.sup.+ fractions, such as
using anti-CD8 and anti-CD62L antibodies.
[0290] In some embodiments, the enrichment for central memory T
(T.sub.CM) cells is based on positive or high surface expression of
CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it
is based on negative selection for cells expressing or highly
expressing CD45RA and/or granzyme B. In some aspects, isolation of
a CD8.sup.+ population enriched for T.sub.CM cells is carried out
by depletion of cells expressing CD4, CD14, CD45RA, and positive
selection or enrichment for cells expressing CD62L. In one aspect,
enrichment for central memory T (T.sub.CM) cells is carried out
starting with a negative fraction of cells selected based on CD4
expression, which is subjected to a negative selection based on
expression of CD14 and CD45RA, and a positive selection based on
CD62L. Such selections in some aspects are carried out
simultaneously and in other aspects are carried out sequentially,
in either order. In some aspects, the same CD4 expression-based
selection step used in preparing the CD8.sup.+ cell population or
subpopulation, also is used to generate the CD4.sup.+ cell
population or sub-population, such that both the positive and
negative fractions from the CD4-based separation are retained and
used in subsequent steps of the methods, optionally following one
or more further positive or negative selection steps.
[0291] In a particular example, a sample of PBMCs or other white
blood cell sample is subjected to selection of CD4.sup.+ cells,
where both the negative and positive fractions are retained. The
negative fraction then is subjected to negative selection based on
expression of CD14 and CD45RA or ROR1, and positive selection based
on a marker characteristic of central memory T cells, such as CD62L
or CCR7, where the positive and negative selections are carried out
in either order.
[0292] CD4.sup.+ T helper cells are sorted into naive, central
memory, and effector cells by identifying cell populations that
have cell surface antigens. CD4.sup.+ lymphocytes can be obtained
by standard methods. In some embodiments, naive CD4.sup.+ T
lymphocytes are CD45RO.sup.-, CD45RA.sup.+, CD62L.sup.+, CD4.sup.+
T cells. In some embodiments, central memory CD4.sup.+ cells are
CD62L.sup.+ and CD45RO.sup.+. In some embodiments, effector
CD4.sup.+ cells are CD62L.sup.- and CD45RO.sup.-.
[0293] In one example, to enrich for CD4.sup.+ cells by negative
selection, a monoclonal antibody cocktail typically includes
antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8. In some
embodiments, the antibody or binding partner is bound to a solid
support or matrix, such as a magnetic bead or paramagnetic bead, to
allow for separation of cells for positive and/or negative
selection. For example, in some embodiments, the cells and cell
populations are separated or isolated using immunomagnetic (or
affinitymagnetic) separation techniques (reviewed in Methods in
Molecular Medicine, vol. 58: Metastasis Research Protocols, Vol. 2:
Cell Behavior In Vitro and In Vivo, p 17-25 Edited by: S. A. Brooks
and U. Schumacher .COPYRGT. Humana Press Inc., Totowa, N.J.).
[0294] In some aspects, the sample or composition of cells to be
separated is incubated with small, magnetizable or magnetically
responsive material, such as magnetically responsive particles or
microparticles, such as paramagnetic beads (e.g., such as
Dynalbeads or MACS beads). The magnetically responsive material,
e.g., particle, generally is directly or indirectly attached to a
binding partner, e.g., an antibody, that specifically binds to a
molecule, e.g., surface marker, present on the cell, cells, or
population of cells that it is desired to separate, e.g., that it
is desired to negatively or positively select.
[0295] In some embodiments, the magnetic particle or bead comprises
a magnetically responsive material bound to a specific binding
member, such as an antibody or other binding partner. There are
many well-known magnetically responsive materials used in magnetic
separation methods. Suitable magnetic particles include those
described in Molday, U.S. Pat. No. 4,452,773, and in European
Patent Specification EP 452342 B, which are hereby incorporated by
reference. Colloidal sized particles, such as those described in
Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No.
5,200,084 are other examples.
[0296] The incubation generally is carried out under conditions
whereby the antibodies or binding partners, or molecules, such as
secondary antibodies or other reagents, which specifically bind to
such antibodies or binding partners, which are attached to the
magnetic particle or bead, specifically bind to cell surface
molecules if present on cells within the sample.
[0297] In some aspects, the sample is placed in a magnetic field,
and those cells having magnetically responsive or magnetizable
particles attached thereto will be attracted to the magnet and
separated from the unlabeled cells. For positive selection, cells
that are attracted to the magnet are retained; for negative
selection, cells that are not attracted (unlabeled cells) are
retained. In some aspects, a combination of positive and negative
selection is performed during the same selection step, where the
positive and negative fractions are retained and further processed
or subject to further separation steps.
[0298] In certain embodiments, the magnetically responsive
particles are coated in primary antibodies or other binding
partners, secondary antibodies, lectins, enzymes, or streptavidin.
In certain embodiments, the magnetic particles are attached to
cells via a coating of primary antibodies specific for one or more
markers. In certain embodiments, the cells, rather than the beads,
are labeled with a primary antibody or binding partner, and then
cell-type specific secondary antibody- or other binding partner
(e.g., streptavidin)-coated magnetic particles, are added. In
certain embodiments, streptavidin-coated magnetic particles are
used in conjunction with biotinylated primary or secondary
antibodies.
[0299] In some embodiments, the magnetically responsive particles
are left attached to the cells that are to be subsequently
incubated, cultured and/or engineered; in some aspects, the
particles are left attached to the cells for administration to a
patient. In some embodiments, the magnetizable or magnetically
responsive particles are removed from the cells. Methods for
removing magnetizable particles from cells are known and include,
e.g., the use of competing non-labeled antibodies, magnetizable
particles or antibodies conjugated to cleavable linkers, etc. In
some embodiments, the magnetizable particles are biodegradable.
[0300] In some embodiments, the affinity-based selection is via
magnetic-activated cell sorting (MACS) (Miltenyi Biotech, Auburn,
Calif.). Magnetic Activated Cell Sorting (MACS) systems are capable
of high-purity selection of cells having magnetized particles
attached thereto. In certain embodiments, MACS operates in a mode
wherein the non-target and target species are sequentially eluted
after the application of the external magnetic field. That is, the
cells attached to magnetized particles are held in place while the
unattached species are eluted. Then, after this first elution step
is completed, the species that were trapped in the magnetic field
and were prevented from being eluted are freed in some manner such
that they can be eluted and recovered. In certain embodiments, the
non-target cells are labelled and depleted from the heterogeneous
population of cells.
[0301] In certain embodiments, the isolation or separation is
carried out using a system, device, or apparatus that carries out
one or more of the isolation, cell preparation, separation,
processing, incubation, culture, and/or formulation steps of the
methods. In some aspects, the system is used to carry out each of
these steps in a closed or sterile environment, for example, to
minimize error, user handling and/or contamination. In one example,
the system is a system as described in International Patent
Application, Publication Number WO2009/072003, or US 20110003380
A1.
[0302] In some embodiments, the system or apparatus carries out one
or more, e.g., all, of the isolation, processing, engineering, and
formulation steps in an integrated or self-contained system, and/or
in an automated or programmable fashion. In some aspects, the
system or apparatus includes a computer and/or computer program in
communication with the system or apparatus, which allows a user to
program, control, assess the outcome of, and/or adjust various
aspects of the processing, isolation, engineering, and formulation
steps.
[0303] In some aspects, the separation and/or other steps is
carried out using CliniMACS system (Miltenyi Biotic), for example,
for automated separation of cells on a clinical-scale level in a
closed and sterile system. Components can include an integrated
microcomputer, magnetic separation unit, peristaltic pump, and
various pinch valves. The integrated computer in some aspects
controls all components of the instrument and directs the system to
perform repeated procedures in a standardized sequence. The
magnetic separation unit in some aspects includes a movable
permanent magnet and a holder for the selection column. The
peristaltic pump controls the flow rate throughout the tubing set
and, together with the pinch valves, ensures the controlled flow of
buffer through the system and continual suspension of cells.
[0304] The CliniMACS system in some aspects uses antibody-coupled
magnetizable particles that are supplied in a sterile,
non-pyrogenic solution. In some embodiments, after labelling of
cells with magnetic particles the cells are washed to remove excess
particles. A cell preparation bag is then connected to the tubing
set, which in turn is connected to a bag containing buffer and a
cell collection bag. The tubing set consists of pre-assembled
sterile tubing, including a pre-column and a separation column, and
are for single use only. After initiation of the separation
program, the system automatically applies the cell sample onto the
separation column. Labelled cells are retained within the column,
while unlabeled cells are removed by a series of washing steps. In
some embodiments, the cell populations for use with the methods
described herein are unlabeled and are not retained in the column.
In some embodiments, the cell populations for use with the methods
described herein are labeled and are retained in the column. In
some embodiments, the cell populations for use with the methods
described herein are eluted from the column after removal of the
magnetic field, and are collected within the cell collection
bag.
[0305] In certain embodiments, separation and/or other steps are
carried out using the CliniMACS Prodigy system (Miltenyi Biotec).
The CliniMACS Prodigy system in some aspects is equipped with a
cell processing unity that permits automated washing and
fractionation of cells by centrifugation. The CliniMACS Prodigy
system can also include an onboard camera and image recognition
software that determines the optimal cell fractionation endpoint by
discerning the macroscopic layers of the source cell product. For
example, peripheral blood may be automatically separated into
erythrocytes, white blood cells and plasma layers. The CliniMACS
Prodigy system can also include an integrated cell cultivation
chamber which accomplishes cell culture protocols such as, e.g.,
cell differentiation and expansion, antigen loading, and long-term
cell culture. Input ports can allow for the sterile removal and
replenishment of media and cells can be monitored using an
integrated microscope. See, e.g., Klebanoff et al. (2012) J
Immunother. 35(9): 651-660, Terakura et al. (2012) Blood. 1:72-82,
and Wang et al. (2012) J Immunother. 35(9):689-701.
[0306] In some embodiments, a cell population described herein is
collected and enriched (or depleted) via flow cytometry, in which
cells stained for multiple cell surface markers are carried in a
fluidic stream. In some embodiments, a cell population described
herein is collected and enriched (or depleted) via preparative
scale (FACS)-sorting. In certain embodiments, a cell population
described herein is collected and enriched (or depleted) by use of
microelectromechanical systems (MEMS) chips in combination with a
FACS-based detection system (see, e.g., WO 2010/033140, Cho et al.
(2010) Lab Chip 10, 1567-1573; and Godin et al. (2008) J Biophoton.
1(5):355-376. In both cases, cells can be labeled with multiple
markers, allowing for the isolation of well-defined T cell subsets
at high purity.
[0307] In some embodiments, the antibodies or binding partners are
labeled with one or more detectable marker, to facilitate
separation for positive and/or negative selection. For example,
separation may be based on binding to fluorescently labeled
antibodies. In some examples, separation of cells based on binding
of antibodies or other binding partners specific for one or more
cell surface markers are carried in a fluidic stream, such as by
fluorescence-activated cell sorting (FACS), including preparative
scale (FACS) and/or microelectromechanical systems (MEMS) chips,
e.g., in combination with a flow-cytometric detection system. Such
methods allow for positive and negative selection based on multiple
markers simultaneously.
[0308] In some embodiments, the preparation methods include steps
for freezing, e.g., cryopreserving, the cells, either before or
after isolation, incubation, and/or engineering. In some
embodiments, the freeze and subsequent thaw step removes
granulocytes and, to some extent, monocytes in the cell population.
In some embodiments, the cells are suspended in a freezing
solution, e.g., following a washing step to remove plasma and
platelets. Any of a variety of known freezing solutions and
parameters in some aspects may be used. One example involves using
PBS containing 20% DMSO and 8% human serum albumin (HSA), or other
suitable cell freezing media. This is then diluted 1:1 with media
so that the final concentration of DMSO and HSA are 10% and 4%,
respectively. The cells are then frozen to -80.degree. C. at a rate
of 1.degree. per minute and stored in the vapor phase of a liquid
nitrogen storage tank.
[0309] In some embodiments, the provided methods include
cultivation, incubation, culture, and/or genetic engineering steps.
For example, in some embodiments, provided are methods for
incubating and/or engineering the depleted cell populations and
culture-initiating compositions.
[0310] Thus, in some embodiments, the cell populations are
incubated in a culture-initiating composition. The incubation
and/or engineering may be carried out in a culture vessel, such as
a unit, chamber, well, column, tube, tubing set, valve, vial,
culture dish, bag, or other container for culture or cultivating
cells.
[0311] In some embodiments, the cells are incubated and/or cultured
prior to or in connection with genetic engineering. The incubation
steps can include culture, cultivation, stimulation, activation,
and/or propagation. In some embodiments, the compositions or cells
are incubated in the presence of stimulating conditions or a
stimulatory agent. Such conditions include those designed to induce
proliferation, expansion, activation, and/or survival of cells in
the population, to mimic antigen exposure, and/or to prime the
cells for genetic engineering, such as for the introduction of a
recombinant antigen receptor.
[0312] The conditions can include one or more of particular media,
temperature, oxygen content, carbon dioxide content, time, agents,
e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory
factors, such as cytokines, chemokines, antigens, binding partners,
fusion proteins, recombinant soluble receptors, and any other
agents designed to activate the cells.
[0313] In some embodiments, the stimulating conditions or agents
include one or more agent, e.g., ligand, which is capable of
activating an intracellular signaling domain of a TCR complex. In
some aspects, the agent turns on or initiates TCR/CD3 intracellular
signaling cascade in a T cell. Such agents can include antibodies,
such as those specific for a TCR component and/or costimulatory
receptor, e.g., anti-CD3, anti-CD28, for example, bound to solid
support such as a bead, and/or one or more cytokines. Optionally,
the expansion method may further comprise the step of adding
anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at
a concentration of at least about 0.5 ng/ml). In some embodiments,
the stimulating agents include IL-2 and/or IL-15, for example, an
IL-2 concentration of at least about 10 units/mL.
[0314] In some aspects, incubation is carried out in accordance
with techniques such as those described in U.S. Pat. No. 6,040,177
to Riddell et al., Klebanoff et al. (2012) J Immunother. 35(9):
651-660, Terakura et al. (2012) Blood. 1:72-82, and/or Wang et al.
(2012) J Immunother. 35(9):689-701.
[0315] In some embodiments, the T cells are expanded by adding to
the culture-initiating composition feeder cells, such as
non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such
that the resulting population of cells contains at least about 5,
10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in
the initial population to be expanded); and incubating the culture
(e.g. for a time sufficient to expand the numbers of T cells). In
some aspects, the non-dividing feeder cells can comprise
gamma-irradiated PBMC feeder cells. In some embodiments, the PBMC
are irradiated with gamma rays in the range of about 3000 to 3600
rads to prevent cell division. In some aspects, the feeder cells
are added to culture medium prior to the addition of the
populations of T cells.
[0316] In some embodiments, the stimulating conditions include
temperature suitable for the growth of human T lymphocytes, for
example, at least about 25 degrees Celsius, generally at least
about 30 degrees, and generally at or about 37 degrees Celsius.
Optionally, the incubation may further comprise adding non-dividing
EBV-transformed lymphoblastoid cells (LCL) as feeder cells. LCL can
be irradiated with gamma rays in the range of about 6000 to 10,000
rads. The LCL feeder cells in some aspects is provided in any
suitable amount, such as a ratio of LCL feeder cells to initial T
lymphocytes of at least about 10:1.
[0317] In embodiments, antigen-specific T cells, such as
antigen-specific CD4+ and/or CD8+ T cells, are obtained by
stimulating naive or antigen specific T lymphocytes with antigen.
For example, antigen-specific T cell lines or clones can be
generated to cytomegalovirus antigens by isolating T cells from
infected subjects and stimulating the cells in vitro with the same
antigen.
II. COMPOSITIONS, METHODS AND USES
[0318] Also provided are compositions including the ROR1 binding
molecules and engineered cells, including pharmaceutical
compositions and formulations, and methods of using and uses of the
molecules and compositions, such as in the treatment of diseases,
conditions, and disorders in which ROR1 is expressed, and/or
detection, diagnostic, and prognostic methods.
[0319] A. Pharmaceutical Compositions and Formulations
[0320] Provided are pharmaceutical formulations including the
ROR1-binding molecule, e.g., antibody or chimeric receptor, and/or
the engineered cells expressing the molecules. The pharmaceutical
compositions and formulations generally include one or more
optional pharmaceutically acceptable carrier or excipient. In some
embodiments, the composition includes at least one additional
therapeutic agent.
[0321] The term "pharmaceutical formulation" refers to a
preparation which is in such form as to permit the biological
activity of an active ingredient contained therein to be effective,
and which contains no additional components which are unacceptably
toxic to a subject to which the formulation would be
administered.
[0322] A "pharmaceutically acceptable carrier" refers to an
ingredient in a pharmaceutical formulation, other than an active
ingredient, which is nontoxic to a subject. A pharmaceutically
acceptable carrier includes, but is not limited to, a buffer,
excipient, stabilizer, or preservative.
[0323] In some aspects, the choice of carrier is determined in part
by the particular cell, binding molecule, and/or antibody, and/or
by the method of administration. Accordingly, there are a variety
of suitable formulations. For example, the pharmaceutical
composition can contain preservatives. Suitable preservatives may
include, for example, methylparaben, propylparaben, sodium
benzoate, and benzalkonium chloride. In some aspects, a mixture of
two or more preservatives is used. The preservative or mixtures
thereof are typically present in an amount of about 0.0001% to
about 2% by weight of the total composition. Carriers are
described, e.g., by Remington's Pharmaceutical Sciences 16th
edition, Osol, A. Ed. (1980). Pharmaceutically acceptable carriers
are generally nontoxic to recipients at the dosages and
concentrations employed, and include, but are not limited to:
buffers such as phosphate, citrate, and other organic acids;
antioxidants including ascorbic acid and methionine; preservatives
(such as octadecyldimethylbenzyl ammonium chloride; hexamethonium
chloride; benzalkonium chloride; benzethonium chloride; phenol,
butyl or benzyl alcohol; alkyl parabens such as methyl or propyl
paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and
m-cresol); low molecular weight (less than about 10 residues)
polypeptides; proteins, such as serum albumin, gelatin, or
immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone;
amino acids such as glycine, glutamine, asparagine, histidine,
arginine, or lysine; monosaccharides, disaccharides, and other
carbohydrates including glucose, mannose, or dextrins; chelating
agents such as EDTA; sugars such as sucrose, mannitol, trehalose or
sorbitol; salt-forming counter-ions such as sodium; metal complexes
(e.g. Zn-protein complexes); and/or non-ionic surfactants such as
polyethylene glycol (PEG).
[0324] Buffering agents in some aspects are included in the
compositions. Suitable buffering agents include, for example,
citric acid, sodium citrate, phosphoric acid, potassium phosphate,
and various other acids and salts. In some aspects, a mixture of
two or more buffering agents is used. The buffering agent or
mixtures thereof are typically present in an amount of about 0.001%
to about 4% by weight of the total composition. Methods for
preparing administrable pharmaceutical compositions are known.
Exemplary methods are described in more detail in, for example,
Remington: The Science and Practice of Pharmacy, Lippincott
Williams & Wilkins; 21st ed. (May 1, 2005).
[0325] Formulations of the antibodies can include lyophilized
formulations and aqueous solutions.
[0326] The formulation or composition may also contain more than
one active ingredient useful for the particular indication,
disease, or condition being treated with the binding molecules or
cells, preferably those with activities complementary to the
binding molecule or cell, where the respective activities do not
adversely affect one another. Such active ingredients are suitably
present in combination in amounts that are effective for the
purpose intended. Thus, in some embodiments, the pharmaceutical
composition further includes other pharmaceutically active agents
or drugs, such as chemotherapeutic agents, e.g., asparaginase,
busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin,
fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel,
rituximab, vinblastine, vincristine, etc. In some embodiments, the
cells or antibodies are administered in the form of a salt, e.g., a
pharmaceutically acceptable salt. Suitable pharmaceutically
acceptable acid addition salts include those derived from mineral
acids, such as hydrochloric, hydrobromic, phosphoric,
metaphosphoric, nitric, and sulphuric acids, and organic acids,
such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic,
glycolic, gluconic, succinic, and arylsulphonic acids, for example,
p-toluenesulphonic acid.
[0327] Active ingredients may be entrapped in microcapsules, in
colloidal drug delivery systems (for example, liposomes, albumin
microspheres, microemulsions, nano-particles and nanocapsules) or
in macroemulsions. In certain embodiments, the pharmaceutical
composition is formulated as an inclusion complex, such as
cyclodextrin inclusion complex, or as a liposome. Liposomes can
serve to target the host cells (e.g., T-cells or NK cells) to a
particular tissue. Many methods are available for preparing
liposomes, such as those described in, for example, Szoka et al.,
Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S. Pat. Nos.
4,235,871, 4,501,728, 4,837,028, and 5,019,369.
[0328] The pharmaceutical composition in some aspects can employ
time-released, delayed release, and sustained release delivery
systems such that the delivery of the composition occurs prior to,
and with sufficient time to cause, sensitization of the site to be
treated. Many types of release delivery systems are available and
known. Such systems can avoid repeated administrations of the
composition, thereby increasing convenience to the subject and the
physician.
[0329] The pharmaceutical composition in some embodiments contains
the binding molecules and/or cells in amounts effective to treat or
prevent the disease or condition, such as a therapeutically
effective or prophylactically effective amount. Therapeutic or
prophylactic efficacy in some embodiments is monitored by periodic
assessment of treated subjects. For repeated administrations over
several days or longer, depending on the condition, the treatment
is repeated until a desired suppression of disease symptoms occurs.
However, other dosage regimens may be useful and can be determined.
The desired dosage can be delivered by a single bolus
administration of the composition, by multiple bolus
administrations of the composition, or by continuous infusion
administration of the composition.
[0330] In certain embodiments, in the context of genetically
engineered cells containing the binding molecules, a subject is
administered the range of about one million to about 100 billion
cells, such as, e.g., 1 million to about 50 billion cells (e.g.,
about 5 million cells, about 25 million cells, about 500 million
cells, about 1 billion cells, about 5 billion cells, about 20
billion cells, about 30 billion cells, about 40 billion cells, or a
range defined by any two of the foregoing values), such as about 10
million to about 100 billion cells (e.g., about 20 million cells,
about 30 million cells, about 40 million cells, about 60 million
cells, about 70 million cells, about 80 million cells, about 90
million cells, about 10 billion cells, about 25 billion cells,
about 50 billion cells, about 75 billion cells, about 90 billion
cells, or a range defined by any two of the foregoing values), and
in some cases about 100 million cells to about 50 billion cells
(e.g., about 120 million cells, about 250 million cells, about 350
million cells, about 450 million cells, about 650 million cells,
about 800 million cells, about 900 million cells, about 3 billion
cells, about 30 billion cells, about 45 billion cells) or any value
in between these ranges, and/or such a number of cells per kilogram
of body weight of the subject.
[0331] The may be administered using standard administration
techniques, formulations, and/or devices. Provided are formulations
and devices, such as syringes and vials, for storage and
administration of the compositions. Administration of the cells can
be autologous or heterologous. For example, immunoresponsive cells
or progenitors can be obtained from one subject, and administered
to the same subject or a different, compatible subject. Peripheral
blood derived immunoresponsive cells or their progeny (e.g., in
vivo, ex vivo or in vitro derived) can be administered via
localized injection, including catheter administration, systemic
injection, localized injection, intravenous injection, or
parenteral administration. When administering a therapeutic
composition (e.g., a pharmaceutical composition containing a
genetically modified immunoresponsive cell), it will generally be
formulated in a unit dosage injectable form (solution, suspension,
emulsion).
[0332] Formulations include those for oral, intravenous,
intraperitoneal, subcutaneous, pulmonary, transdermal,
intramuscular, intranasal, buccal, sublingual, or suppository
administration. In some embodiments, the cell populations are
administered parenterally. The term "parenteral," as used herein,
includes intravenous, intramuscular, subcutaneous, rectal, vaginal,
intracranial, intrathoracic, and intraperitoneal administration. In
some embodiments, the cell populations are administered to a
subject using peripheral systemic delivery by intravenous,
intraperitoneal, or subcutaneous injection.
[0333] Compositions in some embodiments are provided as sterile
liquid preparations, e.g., isotonic aqueous solutions, suspensions,
emulsions, dispersions, or viscous compositions, which may in some
aspects be buffered to a selected pH. Liquid preparations are
normally easier to prepare than gels, other viscous compositions,
and solid compositions. Additionally, liquid compositions are
somewhat more convenient to administer, especially by injection.
Viscous compositions, on the other hand, can be formulated within
the appropriate viscosity range to provide longer contact periods
with specific tissues. Liquid or viscous compositions can comprise
carriers, which can be a solvent or dispersing medium containing,
for example, water, saline, phosphate buffered saline, polyoi (for
example, glycerol, propylene glycol, liquid polyethylene glycol)
and suitable mixtures thereof.
[0334] Sterile injectable solutions can be prepared by
incorporating the binding molecule in a solvent, such as in
admixture with a suitable carrier, diluent, or excipient such as
sterile water, physiological saline, glucose, dextrose, or the
like. The compositions can also be lyophilized. The compositions
can contain auxiliary substances such as wetting, dispersing, or
emulsifying agents (e.g., methylcellulose), pH buffering agents,
gelling or viscosity enhancing additives, preservatives, flavoring
agents, colors, and the like, depending upon the route of
administration and the preparation desired. Standard texts may in
some aspects be consulted to prepare suitable preparations.
[0335] Various additives which enhance the stability and sterility
of the compositions, including antimicrobial preservatives,
antioxidants, chelating agents, and buffers, can be added.
Prevention of the action of microorganisms can be ensured by
various antibacterial and antifungal agents, for example, parabens,
chlorobutanol, phenol, sorbic acid, and the like. Prolonged
absorption of the injectable pharmaceutical form can be brought
about by the use of agents delaying absorption, for example,
aluminum monostearate and gelatin.
[0336] Sustained-release preparations may be prepared. Suitable
examples of sustained-release preparations include semipermeable
matrices of solid hydrophobic polymers containing the antibody,
which matrices are in the form of shaped articles, e.g. films, or
microcapsules.
[0337] The formulations to be used for in vivo administration are
generally sterile. Sterility may be readily accomplished, e.g., by
filtration through sterile filtration membranes.
[0338] B. Therapeutic and Prophylactic Methods and Uses
[0339] Also provided are methods of administering and uses, such as
therapeutic and prophylactic uses, of the ROR1 binding molecules,
including the anti-ROR1 antibodies, e.g., antibody fragments and
proteins containing the same such as the chimeric receptors, and/or
engineered cells expressing the recombinant receptors. Such methods
and uses include therapeutic methods and uses, for example,
involving administration of the molecules, cells, or compositions
containing the same, to a subject having a disease, condition, or
disorder expressing or associated with ROR1 expression, and/or in
which cells or tissues express, e.g., specifically express, ROR1.
In some embodiments, the molecule, cell, and/or composition is
administered in an effective amount to effect treatment of the
disease or disorder. Uses include uses of the binding molecules,
CARs, antibodies, and cells in such methods and treatments, and in
the preparation of a medicament in order to carry out such
therapeutic methods. In some embodiments, the methods are carried
out by administering the antibodies or cells, or compositions
comprising the same, to the subject having, having hand, or
suspected of having the disease or condition. In some embodiments,
the methods thereby treat the disease or condition or disorder in
the subject.
[0340] As used herein, "treatment" (and grammatical variations
thereof such as "treat" or "treating") refers to complete or
partial amelioration or reduction of a disease or condition or
disorder, or a symptom, adverse effect or outcome, or phenotype
associated therewith. Desirable effects of treatment include, but
are not limited to, preventing occurrence or recurrence of disease,
alleviation of symptoms, diminishment of any direct or indirect
pathological consequences of the disease, preventing metastasis,
decreasing the rate of disease progression, amelioration or
palliation of the disease state, and remission or improved
prognosis. The terms do not imply complete curing of a disease or
complete elimination of any symptom or effect(s) on all symptoms or
outcomes.
[0341] As used herein, "delaying development of a disease" means to
defer, hinder, slow, retard, stabilize, suppress and/or postpone
development of the disease (such as cancer). This delay can be of
varying lengths of time, depending on the history of the disease
and/or individual being treated. As is evident to one skilled in
the art, a sufficient or significant delay can, in effect,
encompass prevention, in that the individual does not develop the
disease. For example, a late stage cancer, such as development of
metastasis, may be delayed.
[0342] "Preventing," as used herein, includes providing prophylaxis
with respect to the occurrence or recurrence of a disease in a
subject that may be predisposed to the disease but has not yet been
diagnosed with the disease. In some embodiments, the provided
molecules and compositions are used to delay development of a
disease or to slow the progression of a disease.
[0343] As used herein, to "suppress" a function or activity is to
reduce the function or activity when compared to otherwise same
conditions except for a condition or parameter of interest, or
alternatively, as compared to another condition. For example, an
antibody or composition or cell which suppresses tumor growth
reduces the rate of growth of the tumor compared to the rate of
growth of the tumor in the absence of the antibody or composition
or cell.
[0344] An "effective amount" of an agent, e.g., a pharmaceutical
formulation, binding molecule, antibody, or cells, or composition,
in the context of administration, refers to an amount effective, at
dosages/amounts and for periods of time necessary, to achieve a
desired result, such as a therapeutic or prophylactic result.
[0345] A "therapeutically effective amount" of an agent, e.g., a
pharmaceutical formulation, antibody, or cells, refers to an amount
effective, at dosages and for periods of time necessary, to achieve
a desired therapeutic result, such as for treatment of a disease,
condition, or disorder, and/or pharmacokinetic or pharmacodynamic
effect of the treatment. The therapeutically effective amount may
vary according to factors such as the disease state, age, sex, and
weight of the subject, and the populations of cells administered.
In some embodiments, the provided methods involve administering the
molecules, cells, and/or compositions at effective amounts, e.g.,
therapeutically effective amounts.
[0346] A "prophylactically effective amount" refers to an amount
effective, at dosages and for periods of time necessary, to achieve
the desired prophylactic result. Typically but not necessarily,
since a prophylactic dose is used in subjects prior to or at an
earlier stage of disease, the prophylactically effective amount
will be less than the therapeutically effective amount.
[0347] As used herein, a "subject" is a mammal, such as a human or
other animal, and typically is human.
[0348] Among the diseases to be treated are any ROR1-associated
disease or condition or disease or condition in which ROR1 is
specifically expressed. In certain diseases and conditions, ROR1 is
expressed on malignant cells and cancers. In some embodiments, the
disease or condition is a ROR1-expressing cancer. Among the
ROR1-associated diseases or conditions that can be treated include,
but are not limited to, B cell leukemia, lymphoma, B cell chronic
lymphocytic leukemia (CLL), AML, acute myeloid leukemia (AML),
acute lymphocytic leukemia (ALL), Burkett's Lymphoma, mantle cell
lymphoma (MCL), non-small cell lung cancer (NSCLC), neuroblastoma,
renal cell carcinoma, colon cancer, colorectal cancer, breast
cancer, epithelial squamous cell cancer, melanoma, myeloma, stomach
cancer, brain cancer, lung cancer, pancreatic cancer, cervical
cancer, ovarian cancer, liver cancer, bladder cancer, prostate
cancer, testicular cancer, thyroid cancer, uterine cancer, adrenal
cancer and head and neck cancer.
[0349] In some embodiments, the methods may identify a subject who
has, is suspected to have, or is at risk for developing a
ROR1-associated disease or disorder. Hence, provided are methods
for identifying subjects with diseases or disorders associated with
elevated ROR1 expression and selecting them for treatment with a
provided ROR1 binding molecule, including any of the anti-ROR1
antibodies, e.g., antibody fragments and proteins containing the
same such as the chimeric receptors, and/or engineered cells
expressing the recombinant receptors.
[0350] For example, a subject may be screened for the presence of a
disease or disorder associated with elevated ROR1 expression, such
as a ROR1-expressing cancer. In some embodiments, the methods
include screening for or detecting the presence of a
ROR1-associated disease, e.g. a tumor. Thus, in some aspects, a
sample may be obtained from a patient suspected of having a disease
or disorder associated with elevated ROR1 expression and assayed
for the expression level of ROR1. In some aspects, a subject who
tests positive for a ROR1-associated disease or disorder may be
selected for treatment by the present methods, and may be
administered a therapeutically effective amount of a ROR1 antibody,
CAR expressing ROR1, cells containing a CAR or a pharmaceutical
composition thereof as described herein. In some embodiments, the
methods can be used to monitor the size or density of a
ROR1-expressing tissue, e.g. tumor, over time, e.g., before,
during, or after treatment by the methods.
[0351] In some embodiments, the subject has persistent or relapsed
disease, e.g., following treatment with another ROR1-specific
antibody and/or cells expressing a ROR1-targeting chimeric receptor
and/or other therapy, including chemotherapy, radiation, and/or
hematopoietic stem cell transplantation (HSCT), e.g., allogenic
HSCT. In some embodiments, the administration effectively treats
the subject despite the subject having become resistant to another
ROR1-targeted therapy. In some embodiments, the subject has not
relapsed but is determined to be at risk for relapse, such as at a
high risk of relapse, and thus the compound or composition is
administered prophylactically, e.g., to reduce the likelihood of or
prevent relapse.
[0352] In some embodiments, the treatment does not induce an immune
response by the subject to the therapy, and/or does not induce such
a response to a degree that prevents effective treatment of the
disease or condition. In some aspects, the degree of immunogenicity
and/or graft versus host response is less than that observed with a
different but comparable treatment. For example, in the case of
adoptive cell therapy using cells expressing CARs including the
provided anti-ROR1 antibodies, the degree of immunogenicity in some
embodiments is reduced compared to CARs including a different
antibody that binds to a similar, e.g., overlapping epitope and/or
that competes for binding to ROR1 with the provided antibody, such
as a mouse or rabbit or humanized antibody.
[0353] In some embodiments, the methods include adoptive cell
therapy, whereby genetically engineered cells expressing the
provided anti-ROR1-containing receptors (e.g., ROR1-targeted CARs)
are administered to subjects. Such administration can promote
activation of the cells (e.g., T cell activation) in a
ROR1-targeted manner, such that the cells of the disease or
disorder are targeted for destruction.
[0354] Thus, the provided methods and uses include methods and uses
for adoptive cell therapy. In some embodiments, the methods include
administration of the cells or a composition containing the cells
to a subject, tissue, or cell, such as one having, at risk for, or
suspected of having the disease, condition or disorder. In some
embodiments, the cells, populations, and compositions are
administered to a subject having the particular disease or
condition to be treated, e.g., via adoptive cell therapy, such as
adoptive T cell therapy. In some embodiments, the cells or
compositions are administered to the subject, such as a subject
having or at risk for the disease or condition. In some aspects,
the methods thereby treat, e.g., ameliorate one or more symptom of
the disease or condition, such as by lessening tumor burden in a
ROR1-expressing cancer.
[0355] Methods for administration of cells for adoptive cell
therapy are known and may be used in connection with the provided
methods and compositions. For example, adoptive T cell therapy
methods are described, e.g., in US Patent Application Publication
No. 2003/0170238 to Gruenberg et al; U.S. Pat. No. 4,690,915 to
Rosenberg; Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85). See,
e.g., Themeli et al. (2013) Nat Biotechnol. 31(10): 928-933;
Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1): 84-9;
Davila et al. (2013) PLoS ONE 8(4): e61338.
[0356] In some embodiments, the cell therapy, e.g., adoptive cell
therapy, e.g., adoptive T cell therapy, is carried out by
autologous transfer, in which the cells are isolated and/or
otherwise prepared from the subject who is to receive the cell
therapy, or from a sample derived from such a subject. Thus, in
some aspects, the cells are derived from a subject, e.g., patient,
in need of a treatment and the cells, following isolation and
processing are administered to the same subject.
[0357] In some embodiments, the cell therapy, e.g., adoptive cell
therapy, e.g., adoptive T cell therapy, is carried out by
allogeneic transfer, in which the cells are isolated and/or
otherwise prepared from a subject other than a subject who is to
receive or who ultimately receives the cell therapy, e.g., a first
subject. In such embodiments, the cells then are administered to a
different subject, e.g., a second subject, of the same species. In
some embodiments, the first and second subjects are genetically
identical. In some embodiments, the first and second subjects are
genetically similar. In some embodiments, the second subject
expresses the same HLA class or supertype as the first subject.
[0358] In some embodiments, the subject, to whom the cells, cell
populations, or compositions are administered is a primate, such as
a human. In some embodiments, the primate is a monkey or an ape.
The subject can be male or female and can be any suitable age,
including infant, juvenile, adolescent, adult, and geriatric
subjects. In some embodiments, the subject is a non-primate mammal,
such as a rodent. In some examples, the patient or subject is a
validated animal model for disease, adoptive cell therapy, and/or
for assessing toxic outcomes such as cytokine release syndrome
(CRS).
[0359] The ROR1-binding molecules, such as antibodies and chimeric
receptors containing the antibodies and cells expressing the same,
can be administered by any suitable means, for example, by
injection, e.g., intravenous or subcutaneous injections,
intraocular injection, periocular injection, subretinal injection,
intravitreal injection, trans-septal injection, subscleral
injection, intrachoroidal injection, intracameral injection,
subconjectval injection, subconjuntival injection, sub-Tenon's
injection, retrobulbar injection, peribulbar injection, or
posterior juxtascleral delivery. In some embodiments, they are
administered by parenteral, intrapulmonary, and intranasal, and, if
desired for local treatment, intralesional administration.
Parenteral infusions include intramuscular, intravenous,
intraarterial, intraperitoneal, intracranial, intrathoracic, or
subcutaneous administration. Dosing and administration may depend
in part on whether the administration is brief or chronic. Various
dosing schedules include but are not limited to single or multiple
administrations over various time-points, bolus administration, and
pulse infusion.
[0360] For the prevention or treatment of disease, the appropriate
dosage of the binding molecule or cell may depend on the type of
disease to be treated, the type of binding molecule, the severity
and course of the disease, whether the binding molecule is
administered for preventive or therapeutic purposes, previous
therapy, the patient's clinical history and response to the binding
molecule, and the discretion of the attending physician. The
compositions and molecules and cells are in some embodiments
suitably administered to the patient at one time or over a series
of treatments.
[0361] Depending on the type and severity of the disease, dosages
of antibodies may include about 1 .mu.g/kg to 15 mg/kg (e.g. 0.1
mg/kg-10 mg/kg), about 1 .mu.g/kg to 100 mg/kg or more, about 0.05
mg/kg to about 10 mg/kg, 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10
mg/kg. Multiple doses may be administered intermittently, e.g.
every week or every three weeks. An initial higher loading dose,
followed by one or more lower doses may be administered.
[0362] In certain embodiments, in the context of genetically
engineered cells containing the binding molecules, a subject is
administered the range of about one million to about 100 billion
cells and/or that amount of cells per kilogram of body weight, such
as, e.g., 1 million to about 50 billion cells (e.g., about 5
million cells, about 25 million cells, about 500 million cells,
about 1 billion cells, about 5 billion cells, about 20 billion
cells, about 30 billion cells, about 40 billion cells, or a range
defined by any two of the foregoing values), such as about 10
million to about 100 billion cells (e.g., about 20 million cells,
about 30 million cells, about 40 million cells, about 60 million
cells, about 70 million cells, about 80 million cells, about 90
million cells, about 10 billion cells, about 25 billion cells,
about 50 billion cells, about 75 billion cells, about 90 billion
cells, or a range defined by any two of the foregoing values), and
in some cases about 100 million cells to about 50 billion cells
(e.g., about 120 million cells, about 250 million cells, about 350
million cells, about 450 million cells, about 650 million cells,
about 800 million cells, about 900 million cells, about 3 billion
cells, about 30 billion cells, about 45 billion cells) or any value
in between these ranges and/or per kilogram of body weight. Again,
dosages may vary depending on attributes particular to the disease
or disorder and/or patient and/or other treatments.
[0363] In some embodiments, the cells or antibodies are
administered as part of a combination treatment, such as
simultaneously with or sequentially with, in any order, another
therapeutic intervention, such as another antibody or engineered
cell or receptor or agent, such as a cytotoxic or therapeutic
agent.
[0364] The cells or antibodies in some embodiments are
co-administered with one or more additional therapeutic agents or
in connection with another therapeutic intervention, either
simultaneously or sequentially in any order. In some contexts, the
cells are co-administered with another therapy sufficiently close
in time such that the cell populations enhance the effect of one or
more additional therapeutic agents, or vice versa. In some
embodiments, the cells or antibodies are administered prior to the
one or more additional therapeutic agents. In some embodiments, the
cells or antibodies are administered after to the one or more
additional therapeutic agents.
[0365] Once the cells are administered to a mammal (e.g., a human),
the biological activity of the engineered cell populations and/or
antibodies in some aspects is measured by any of a number of known
methods. Parameters to assess include specific binding of an
engineered or natural T cell or other immune cell to antigen, in
vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow
cytometry. In certain embodiments, the ability of the engineered
cells to destroy target cells can be measured using any suitable
method known in the art, such as cytotoxicity assays described in,
for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702
(2009), and Herman et al. J. Immunological Methods, 285(1): 25-40
(2004). In certain embodiments, the biological activity of the
cells also can be measured by assaying expression and/or secretion
of certain cytokines, such as CD 107a, IFN.gamma., IL-2, and TNF.
In some aspects the biological activity is measured by assessing
clinical outcome, such as reduction in tumor burden or load.
[0366] In certain embodiments, engineered cells are modified in any
number of ways, such that their therapeutic or prophylactic
efficacy is increased. For example, the engineered CAR or TCR
expressed by the population in some embodiments are conjugated
either directly or indirectly through a linker to a targeting
moiety. The practice of conjugating compounds, e.g., the CAR or
TCR, to targeting moieties is known in the art. See, for instance,
Wadwa et al., J. Drug Targeting 3: 111 (1995), and U.S. Pat. No.
5,087,616.
[0367] C. Diagnostic and Detection Methods
[0368] Also provided are methods involving use of the provided
binding molecules, e.g., antibodies, in detection of ROR1, for
example, in diagnostic and/or prognostic methods in association
with a ROR1-expressing disease or condition. The methods in some
embodiments include incubating a biological sample with the
antibody and/or administering the antibody to a subject. In certain
embodiments, a biological sample includes a cell or tissue, such as
tumor or cancer tissue. In certain embodiments, the contacting is
under conditions permissive for binding of the anti-ROR1 antibody
to ROR1, and detecting whether a complex is formed between the
anti-ROR1 antibody and ROR1. Such a method may be an in vitro or in
vivo method. In one embodiment, an anti-ROR1 antibody is used to
select subjects eligible for therapy with an anti-ROR1 antibody or
engineered antigen receptor, e.g. where ROR1 is a biomarker for
selection of patients.
[0369] In some embodiments, a sample, such as a cell, tissue
sample, lysate, composition, or other sample derived therefrom is
contacted with the anti-ROR1 antibody and binding or formation of a
complex between the antibody and the sample (e.g., ROR1 in the
sample) is determined or detected. When binding in the test sample
is demonstrated or detected as compared to a reference cell of the
same tissue type, it may indicate the presence of an associated
disease or condition. In some embodiments, the sample is from human
tissues.
[0370] Various methods known in the art for detecting specific
antibody-antigen binding can be used. Exemplary immunoassays
include fluorescence polarization immunoassay (FPIA), fluorescence
immunoassay (FIA), enzyme immunoassay (EIA), nephelometric
inhibition immunoassay (NIA), enzyme linked immunosorbent assay
(ELISA), and radioimmunoassay (RIA). An indicator moiety, or label
group, can be attached to the subject antibodies and is selected so
as to meet the needs of various uses of the method which are often
dictated by the availability of assay equipment and compatible
immunoassay procedures. Exemplary labels include radionuclides
(e.g. .sup.125I, .sup.131I, .sup.35S, .sup.3H, or .sup.32P),
enzymes (e.g., alkaline phosphatase, horseradish peroxidase,
luciferase, or .beta.-galactosidase), fluorescent moieties or
proteins (e.g., fluorescein, rhodamine, phycoerythrin, GFP, or
BFP), or luminescent moieties (e.g., Qdot.TM. nanoparticles
supplied by the Quantum Dot Corporation, Palo Alto, Calif.).
General techniques to be used in performing the various
immunoassays noted above are known to those of ordinary skill in
the art.
[0371] For purposes of diagnosis, the antibodies can be labeled
with a detectable moiety including but not limited to
radioisotopes, fluorescent labels, and various enzyme-substrate
labels know in the art. Methods of conjugating labels to an
antibody are known in the art.
[0372] In some embodiments, antibodies need not be labeled, and the
presence thereof can be detected using a labeled antibody which
binds to the antibodies.
[0373] The provided antibodies in some embodiments can be employed
in any known assay method, such as competitive binding assays,
direct and indirect sandwich assays, and immunoprecipitation
assays. Zola, Monoclonal Antibodies: A Manual of Techniques, pp.
147-158 (CRC Press, Inc. 1987).
[0374] The antibodies and polypeptides can also be used for in vivo
diagnostic assays, such as in vivo imaging. Generally, the antibody
is labeled with a radionuclide (such as .sup.111In, .sup.99Tc,
.sup.14C, .sup.131I, .sup.125I, or .sup.3H) so that the cells or
tissue of interest can be localized in vivo following
administration to a subject.
[0375] The antibody may also be used as staining reagent in
pathology, e.g., using known techniques.
III. ARTICLES OF MANUFACTURE
[0376] Also provided are articles of manufacture containing the
provided binding molecules, e.g., antibodies and CARs and/or
genetically engineered cells, and/or compositions. The articles of
manufacture may include a container and a label or package insert
on or associated with the container. Suitable containers include,
for example, bottles, vials, syringes, IV solution bags, etc. The
containers may be formed from a variety of materials such as glass
or plastic. The container in some embodiments holds a composition
which is by itself or combined with another composition effective
for treating, preventing and/or diagnosing the condition. In some
embodiments, the container has a sterile access port. Exemplary
containers include an intravenous solution bags, vials, including
those with stoppers pierceable by a needle for injection. The label
or package insert may indicate that the composition is used for
treating the ROR1-expressing or -associated disease or condition.
The article of manufacture may include (a) a first container with a
composition contained therein, wherein the composition includes the
antibody or engineered antigen receptor; and (b) a second container
with a composition contained therein, wherein the composition
includes a further agent, such as a cytotoxic or otherwise
therapeutic agent. The article of manufacture may further include a
package insert indicating that the compositions can be used to
treat a particular condition. Alternatively, or additionally, the
article of manufacture may further include another or the same
container comprising a pharmaceutically-acceptable buffer. It may
further include other materials such as other buffers, diluents,
filters, needles, and/or syringes.
[0377] As used herein, reference to a "corresponding form" of an
antibody means that when comparing a property or activity of two
antibodies, the property is compared using the same form of the
antibody. For example, if it is stated that an antibody has greater
activity compared to the activity of the corresponding form of a
first antibody, that means that a particular form, such as a scFv
of that antibody, has greater activity compared to the scFv form of
the first antibody.
[0378] "Effector functions" refer to those biological activities
attributable to the Fc region of an antibody, which vary with the
antibody isotype. Examples of antibody effector functions include:
C1q binding and complement dependent cytotoxicity (CDC); Fc
receptor binding; antibody-dependent cell-mediated cytotoxicity
(ADCC); phagocytosis; down regulation of cell surface receptors
(e.g. B cell receptor); and B cell activation.
[0379] The term "Fc region" herein is used to define a C-terminal
region of an immunoglobulin heavy chain that contains at least a
portion of the constant region. The term includes native sequence
Fc regions and variant Fc regions. In one embodiment, a human IgG
heavy chain Fc region extends from Cys226, or from Pro230, to the
carboxyl-terminus of the heavy chain. However, the C-terminal
lysine (Lys447) of the Fc region may or may not be present. Unless
otherwise specified herein, numbering of amino acid residues in the
Fc region or constant region is according to the EU numbering
system, also called the EU index, as described in Kabat et al.,
Sequences of Proteins of Immunological Interest, 5th Ed. Public
Health Service, National Institutes of Health, Bethesda, Md.,
1991.
[0380] The terms "full length antibody," "intact antibody," and
"whole antibody" are used herein interchangeably to refer to an
antibody having a structure substantially similar to a native
antibody structure or having heavy chains that contain an Fc region
as defined herein.
[0381] An "isolated" antibody is one which has been separated from
a component of its natural environment. In some embodiments, an
antibody is purified to greater than 95% or 99% purity as
determined by, for example, electrophoretic (e.g., SDS-PAGE,
isoelectric focusing (IEF), capillary electrophoresis) or
chromatographic (e.g., ion exchange or reverse phase HPLC). For
review of methods for assessment of antibody purity, see, e.g.,
Flatman et al., J. Chromatogr. B 848:79-87 (2007).
[0382] An "isolated" nucleic acid refers to a nucleic acid molecule
that has been separated from a component of its natural
environment. An isolated nucleic acid includes a nucleic acid
molecule contained in cells that ordinarily contain the nucleic
acid molecule, but the nucleic acid molecule is present
extrachromosomally or at a chromosomal location that is different
from its natural chromosomal location.
[0383] "Isolated nucleic acid encoding an anti-ROR1 antibody"
refers to one or more nucleic acid molecules encoding antibody
heavy and light chains (or fragments thereof), including such
nucleic acid molecule(s) in a single vector or separate vectors,
and such nucleic acid molecule(s) present at one or more locations
in a host cell.
[0384] The terms "host cell," "host cell line," and "host cell
culture" are used interchangeably and refer to cells into which
exogenous nucleic acid has been introduced, including the progeny
of such cells. Host cells include "transformants" and "transformed
cells," which include the primary transformed cell and progeny
derived therefrom without regard to the number of passages. Progeny
may not be completely identical in nucleic acid content to a parent
cell, but may contain mutations. Mutant progeny that have the same
function or biological activity as screened or selected for in the
originally transformed cell are included herein.
[0385] As used herein, "percent (%) amino acid sequence identity"
and "percent identity" when used with respect to an amino acid
sequence (reference polypeptide sequence) is defined as the
percentage of amino acid residues in a candidate sequence (e.g.,
the subject antibody or fragment) that are identical with the amino
acid residues in the reference polypeptide sequence, after aligning
the sequences and introducing gaps, if necessary, to achieve the
maximum percent sequence identity, and not considering any
conservative substitutions as part of the sequence identity.
Alignment for purposes of determining percent amino acid sequence
identity can be achieved in various ways that are within the skill
in the art, for instance, using publicly available computer
software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR)
software. Those skilled in the art can determine appropriate
parameters for aligning sequences, including any algorithms needed
to achieve maximal alignment over the full length of the sequences
being compared.
[0386] An amino acid substitution may include replacement of one
amino acid in a polypeptide with another amino acid. Exemplary
substitutions are shown in Table 1. Amino acid substitutions may be
introduced into a binding molecule, e.g., antibody, of interest and
the products screened for a desired activity, e.g.,
retained/improved antigen binding, decreased immunogenicity, or
improved ADCC or CDC.
[0387] Amino acids generally can be grouped according to the
following common side-chain properties: [0388] (1) hydrophobic:
Norleucine, Met, Ala, Val, Leu, Ile; [0389] (2) neutral
hydrophilic: Cys, Ser, Thr, Asn, Gln; [0390] (3) acidic: Asp, Glu;
[0391] (4) basic: His, Lys, Arg; [0392] (5) residues that influence
chain orientation: Gly, Pro; [0393] (6) aromatic: Trp, Tyr,
Phe.
[0394] Non-conservative amino acid substitutions will involve
exchanging a member of one of these classes for another class.
[0395] The term "vector," as used herein, refers to a nucleic acid
molecule capable of propagating another nucleic acid to which it is
linked. The term includes the vector as a self-replicating nucleic
acid structure as well as the vector incorporated into the genome
of a host cell into which it has been introduced. Certain vectors
are capable of directing the expression of nucleic acids to which
they are operatively linked. Such vectors are referred to herein as
"expression vectors."
[0396] The term "package insert" is used to refer to instructions
customarily included in commercial packages of therapeutic
products, that contain information about the indications, usage,
dosage, administration, combination therapy, contraindications
and/or warnings concerning the use of such therapeutic
products.
[0397] Unless defined otherwise, all terms of art, notations and
other technical and scientific terms or terminology used herein are
intended to have the same meaning as is commonly understood by one
of ordinary skill in the art to which the claimed subject matter
pertains. In some cases, terms with commonly understood meanings
are defined herein for clarity and/or for ready reference, and the
inclusion of such definitions herein should not necessarily be
construed to represent a substantial difference over what is
generally understood in the art.
[0398] As used herein, the singular forms "a," "an," and "the"
include plural referents unless the context clearly dictates
otherwise. For example, "a" or "an" means "at least one" or "one or
more." It is understood that aspects and variations described
herein include "consisting" and/or "consisting essentially of"
aspects and variations.
[0399] Throughout this disclosure, various aspects of the claimed
subject matter are presented in a range format. It should be
understood that the description in range format is merely for
convenience and brevity and should not be construed as an
inflexible limitation on the scope of the claimed subject matter.
Accordingly, the description of a range should be considered to
have specifically disclosed all the possible sub-ranges as well as
individual numerical values within that range. For example, where a
range of values is provided, it is understood that each intervening
value, between the upper and lower limit of that range and any
other stated or intervening value in that stated range is
encompassed within the claimed subject matter. The upper and lower
limits of these smaller ranges may independently be included in the
smaller ranges, and are also encompassed within the claimed subject
matter, subject to any specifically excluded limit in the stated
range. Where the stated range includes one or both of the limits,
ranges excluding either or both of those included limits are also
included in the claimed subject matter. This applies regardless of
the breadth of the range.
[0400] The term "about" as used herein refers to the usual error
range for the respective value readily known to the skilled person
in this technical field. Reference to "about" a value or parameter
herein includes (and describes) embodiments that are directed to
that value or parameter per se. For example, description referring
to "about X" includes description of "X".
[0401] As used herein, a composition refers to any mixture of two
or more products, substances, or compounds, including cells. It may
be a solution, a suspension, liquid, powder, a paste, aqueous,
non-aqueous or any combination thereof.
[0402] As used herein, a statement that a cell or population of
cells is "positive" for a particular marker refers to the
detectable presence on or in the cell of a particular marker,
typically a surface marker. When referring to a surface marker, the
term refers to the presence of surface expression as detected by
flow cytometry, for example, by staining with an antibody that
specifically binds to the marker and detecting said antibody,
wherein the staining is detectable by flow cytometry at a level
substantially above the staining detected carrying out the same
procedure with an isotype-matched control under otherwise identical
conditions and/or at a level substantially similar to that for cell
known to be positive for the marker, and/or at a level
substantially higher than that for a cell known to be negative for
the marker.
[0403] As used herein, a statement that a cell or population of
cells is "negative" for a particular marker refers to the absence
of substantial detectable presence on or in the cell of a
particular marker, typically a surface marker. When referring to a
surface marker, the term refers to the absence of surface
expression as detected by flow cytometry, for example, by staining
with an antibody that specifically binds to the marker and
detecting said antibody, wherein the staining is not detected by
flow cytometry at a level substantially above the staining detected
carrying out the same procedure with an isotype-matched control
under otherwise identical conditions, and/or at a level
substantially lower than that for cell known to be positive for the
marker, and/or at a level substantially similar as compared to that
for a cell known to be negative for the marker.
[0404] All publications, including patent documents, scientific
articles and databases, referred to in this application are
incorporated by reference in their entirety for all purposes to the
same extent as if each individual publication were individually
incorporated by reference. If a definition set forth herein is
contrary to or otherwise inconsistent with a definition set forth
in the patents, applications, published applications and other
publications that are herein incorporated by reference, the
definition set forth herein prevails over the definition that is
incorporated herein by reference.
[0405] The section headings used herein are for organizational
purposes only and are not to be construed as limiting the subject
matter described.
IV. EXEMPLARY EMBODIMENTS
[0406] Among the embodiments provided herein are:
[0407] 1. An antibody or antigen-binding fragment thereof, said
antibody or antigen-binding fragment comprising a heavy chain
variable (V.sub.H) region comprising:
[0408] a heavy chain complementarity determining region 3 (CDR-H3)
comprising the amino acid sequence set forth in SEQ ID NO: 22, 29,
35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64,
65, 66, 67, 68, 69, 70, 71 or 174; or
[0409] a CDR-H3 contained within the heavy chain variable (V.sub.H)
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189,
190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202,
203, 204, 205, 206, 207, 208 or 209.
[0410] 2. An antibody or antigen-binding fragment thereof, said
antibody or antigen-binding fragment comprising a heavy chain
variable (V.sub.H) region comprising at least 90% sequence identity
to the V.sub.H region amino acid sequence set forth in SEQ ID NO:
8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209.
[0411] 3. The antibody or antigen-binding fragment thereof of
embodiment 2, said antibody or antigen-binding fragment comprising
a heavy chain variable (V.sub.H) region comprising at least 90%
sequence identity to the V.sub.H region amino acid sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
[0412] 4. The antibody or fragment of embodiment 2 or embodiment 3,
wherein the V.sub.H region comprises a heavy chain complementarity
determining region 3 (CDR-H3) comprising the amino acid sequence
set forth in SEQ ID NO: 92, 93, 94, 109 or 110.
[0413] 5. The antibody or fragment of any of embodiments 2-4,
wherein the V.sub.H region comprises:
[0414] a heavy chain complementarity determining region 3 (CDR-H3)
comprising the amino acid sequence set forth in SEQ ID NO: 22, 29,
35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64,
65, 66, 67, 68, 69, 70, 71 or 174; or
[0415] a CDR-H3 contained within the V.sub.H sequence set forth in
SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180,
181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193,
194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,
207, 208 or 209.
[0416] 6. The antibody or fragment of any of embodiments 2-5,
wherein the V.sub.H region comprises:
[0417] a heavy chain complementarity determining region 3 (CDR-H3)
comprising the amino acid sequence set forth in SEQ ID NO: 22, 29,
35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64,
65, 66, 67, 68, 69, 70, 71 or 174; or
[0418] a CDR-H3 contained within the V.sub.H sequence set forth in
SEQ ID NO: 8, 10, 13, 15, 17, or 19.
[0419] 7. The antibody or fragment of any of embodiments 2-6,
wherein the V.sub.H region comprises:
[0420] a heavy chain complementarity determining region 3 (CDR-H3)
comprising the amino acid sequence set forth in SEQ ID NO: 22, 29,
35 or 52; or
[0421] a CDR-H3 contained within the V.sub.H sequence set forth in
SEQ ID NO: 10, 13, 15 or 19.
[0422] 8. The antibody or fragment of embodiment 2 or embodiment 3,
wherein the V.sub.H region comprises a CDR-H3 comprising the amino
acid sequence set forth in SEQ ID NO: 72 or a CDR-H3 contained
within the V.sub.H sequence set forth in SEQ ID NO: 85.
[0423] 9. The antibody or fragment of any of embodiments 1-8,
wherein the V.sub.H region comprises:
[0424] a heavy chain complementarity determining region 1 (CDR-H1)
comprising the amino acid sequence set forth in SEQ ID NO:95 or 97;
and/or
[0425] a heavy chain complementarity determining region 2 (CDR-H2)
comprising the amino acid sequence set forth in SEQ ID NO: 96 or
98.
[0426] 10. The antibody or fragment of any of embodiments 1-9,
wherein the V.sub.H region comprises:
[0427] a heavy chain complementarity determining region 1 (CDR-H1)
comprising the amino acid sequence set forth in SEQ ID NO: 20, 27,
33, 155, 156, 157, 158, 159, 160, 161, 162 or 163 and/or comprising
the amino acid sequence set forth in SEQ ID NO: 269, 270, 271, 272,
273, 274, 275, 276, 278 or 279 and/or comprising the amino acid
sequence set forth in SEQ ID NO: 75, 77, 79, 280, 281, 282, 283,
284, 285, 286, 287, 288 or 289 and/or a CDR-H1 contained within the
V.sub.H sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19,
175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187,
188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200,
201, 202, 203, 204, 205, 206, 207, 208 or 209; and/or
[0428] a heavy chain complementarity determining region 2 (CDR-H2)
comprising the amino acid sequence set forth in SEQ ID NO: 21, 26,
28, 34, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, or 318
and/or comprising the amino acid sequence set forth in SEQ ID NO:
291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302 or 303
and/or comprising the amino acid sequence set forth in SEQ ID NO:
304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316 or
317 and/or a CDR-H2 contained within the V.sub.H sequence set forth
in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180,
181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193,
194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,
207, 208 or 209.
[0429] 11. The antibody or fragment of any of embodiments 1-10,
wherein the V.sub.H region comprises:
[0430] a heavy chain complementarity determining region 1 (CDR-H1)
comprising the amino acid sequence set forth in SEQ ID NO: 20, 27,
or 33 and/or a CDR-H1 contained within the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19; and/or
[0431] a heavy chain complementarity determining region 2 (CDR-H2)
comprising the amino acid sequence set forth in SEQ ID NO: 21, 26,
28, or 34 and/or a CDR-H2 contained within the V.sub.H sequence set
forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
[0432] 12. The antibody or fragment of any of embodiments 1-11,
wherein the V.sub.H region comprises:
[0433] a heavy chain complementarity determining region 1 (CDR-H1)
comprising the amino acid sequence set forth in SEQ ID NO: 20, 27,
or 33 and/or a CDR-H1 contained within the V.sub.H sequence set
forth in SEQ ID NO: 10, 13, 15 or 19; and/or
[0434] a heavy chain complementarity determining region 2 (CDR-H2)
comprising the amino acid sequence set forth in SEQ ID NO: 26, 28,
or 34 and/or a CDR-H2 contained within the V.sub.H sequence set
forth in SEQ ID NO: 10, 13, 15 or 19.
[0435] 13. An antibody or antigen-binding fragment thereof,
comprising a heavy chain variable (V.sub.H) region comprising a
heavy chain complementarity determining region 1 (CDR-H1), CDR-H2,
and CDR-H3, wherein:
[0436] the CDR-H1 comprises the amino acid sequence set forth in
SEQ ID NO: 20, 27, 33, 75, 77, 79, 155, 156, 157, 158, 159, 160,
161, 162, 163, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278 or
279;
[0437] the CDR-H2 comprises the amino acid sequence set forth in
SEQ ID NO: 21, 26. 28. 34, 80, 81, 82, 83, 164, 165, 166, 167, 168,
169, 170, 171, 172, 173, 291, 292, 293, 294, 295, 296, 297, 298,
299, 300, 301, 302, 303 or 318; and/or
[0438] the CDR-H3 comprises the amino acid sequence set forth in
SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59,
60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 or 174.
[0439] 14. The antibody or antigen-binding fragment of embodiment
11, wherein:
[0440] the CDR-H1 comprises the amino acid sequence set forth in
SEQ ID NO: 20, 27, or 33;
[0441] the CDR-H2 comprises the amino acid sequence set forth in
SEQ ID NO: 21, 26, 28, or 34; and/or
[0442] the CDR-H3 comprises the amino acid sequence set forth in
SEQ ID NO: 22, 29, 35, 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59,
60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70 or 71.
[0443] 15. The antibody or fragment of any of embodiments 1, 4-7
and 9-14, wherein the CDR-H3 comprises the amino acid sequence
VSNYEYYFDY (SEQ ID NO: 29), DFGRWGYYFDY (SEQ ID NO: 52),
DFGRWSYYFDY (SEQ ID NO:35) or DSSYDAFDI (SEQ ID NO:22).
[0444] 16. The antibody or fragment of any of embodiments 1-7 and
9-15, comprising a heavy chain variable (V.sub.H) region comprising
a heavy chain complementarity determining region 1 (CDR-H1),
CDR-H2, and CDR-H3, wherein:
[0445] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 20, 21, and 22, respectively;
[0446] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 20, 26, and 22, respectively;
[0447] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 27, 28, and 29, respectively;
[0448] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34, and 35, respectively; or
[0449] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34, and 52, respectively;
[0450] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 27, 164 and 45, respectively;
[0451] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 27, 164 and 68, respectively;
[0452] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 27, 164 and 64, respectively;
[0453] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 27, 164 and 66, respectively;
[0454] the CDR-H1, CDR-H2, and CDR-H3 having the sequences of SEQ
ID NOs: 33, 318, and 35, respectively;
[0455] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34 and 70, respectively;
[0456] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34 and 55, respectively;
[0457] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34 and 53, respectively;
[0458] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34 and 56, respectively;
[0459] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34 and 61, respectively;
[0460] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34 and 59, respectively;
[0461] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 171 and 60, respectively;
[0462] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 155, 34 and 35, respectively;
[0463] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 156, 34 and 35, respectively;
[0464] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 162, 170 and 50, respectively;
[0465] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 162, 170 and 51, respectively;
[0466] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 161, 169 and 54, respectively;
[0467] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs:159, 167 and 57, respectively;
[0468] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 160, 168 and 58, respectively;
[0469] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 158, 166 and 62, respectively;
[0470] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 158, 166 and 63, respectively;
[0471] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 158, 166 and 65, respectively;
[0472] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 157, 165 and 67, respectively;
[0473] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 163, 173 and 69, respectively; or
[0474] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 160, 172, 71, respectively; or
[0475] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 160, 172, 174, respectively.
[0476] 17. The antibody or fragment of any of embodiments 1-7 and
9-16, comprising a heavy chain variable (V.sub.H) region comprising
a heavy chain complementarity determining region 1 (CDR-H1),
CDR-H2, and CDR-H3, wherein:
[0477] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 20, 21, and 22, respectively;
[0478] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 20, 26, and 22, respectively;
[0479] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 27, 28, and 29, respectively;
[0480] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34, and 35, respectively; or
[0481] the CDR-H1, CDR-H2, and CDR-H3 comprise the sequences of SEQ
ID NOs: 33, 34, and 52, respectively.
[0482] 18. An antibody or antigen-binding fragment thereof,
comprising a heavy chain variable (VH) region comprising a heavy
chain complementarity determining region 1 (CDR-H1), a CDR-H2, and
a CDR-H3, respectively, comprising the amino acid sequences of a
CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region
amino acid sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19,
175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187,
188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200,
201, 202, 203, 204, 205, 206, 207, 208 or 209.
[0483] 19. The antibody or antigen-binding fragment of embodiment
18, wherein the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise
the amino acid sequences of a CDR-H1, a CDR-H2, and a CDR-H3
contained within the V.sub.H region amino acid sequence set forth
in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
[0484] 20. The antibody or fragment of any of embodiments 1-19,
wherein the V.sub.H region comprises a framework region 1 (FR1), a
FR2, a FR3, and/or a FR4 comprising at least 90% sequence identity,
respectively, to a FR1, FR2, FR3, and/or FR4 of the amino acid
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189,
190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202,
203, 204, 205, 206, 207, 208 or 209.
[0485] 21. The antibody or fragment of any of embodiments 1-20,
wherein the V.sub.H region comprises a framework region 1 (FR1), a
FR2, a FR3, and/or a FR4 comprising at least 90% sequence identity,
respectively, to a FR1, FR2, FR3, and/or FR4 of the amino acid
sequence set forth in SEQ ID NO: 8, 10, 13, 15, 17 or 19.
[0486] 22. The antibody or fragment of any of embodiments 1-7 and
9-21, wherein the V.sub.H region comprises the sequence of amino
acids set forth in SEQ ID NO: 8, 10, 13, 15, 17, 19, 175, 176, 177,
178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190,
191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203,
204, 205, 206, 207, 208 or 209.
[0487] 23. The antibody or fragment of any of embodiments 1-7 and
9-22, wherein the V.sub.H region comprises the sequence of amino
acids set forth in SEQ ID NO: 8, 10, 13, 15, 17, or 19.
[0488] 24. The antibody or fragment of embodiment 23, wherein the
V.sub.H region comprises the sequence of amino acids set forth in
SEQ ID NO: 8 or 10.
[0489] 25. The antibody or fragment of any of embodiments 1-7 and
9-24, wherein the V.sub.H region comprises the CDR-H1, CDR-H2, and
CDR-H3 set forth in SEQ ID NOS: 20, 26, and 22, respectively,
and/or the V.sub.H region comprises the sequence of amino acids set
forth in SEQ ID NO: 19.
[0490] 26. The antibody or fragment of any of embodiments 1-7 and
9-24, wherein the V.sub.H region comprises the CDR-H1, CDR-H2, and
CDR-H3 set forth in SEQ ID NOS: 33, 34, and 52, respectively,
and/or the V.sub.H region comprises the sequence of amino acids set
forth in SEQ ID NO: 10.
[0491] 27. The antibody or fragment of any of embodiments 1-7 and
9-24, wherein the V.sub.H region comprises the CDR-H1, CDR-H2, and
CDR-H3 set forth in SEQ ID NOS: 33, 34, and 35, respectively,
and/or the V.sub.H region comprises the sequence of amino acids set
forth in SEQ ID NO: 13.
[0492] 28. The antibody or fragment of any of embodiments 1-7 and
9-24, wherein the V.sub.H region comprises the CDR-H1, CDR-H2, and
CDR-H3 set forth in SEQ ID NOS: 27, 28, and 29, respectively,
and/or the V.sub.H region comprises the sequence of amino acids set
forth in SEQ ID NO: 15.
[0493] 29. The antibody or fragment of any of embodiments 1-28,
wherein the antibody or fragment does not comprise a light chain
variable (VL) region, does not comprise a CDR-L1, CDR-L2, and/or
CDR-L3, and/or is a single-domain antibody (sdAb) comprising only
the V.sub.H region.
[0494] 30. The antibody or fragment of any of embodiments 1-29 that
is a sdAb comprising only the V.sub.H region.
[0495] 31. The antibody or fragment of any of embodiments 1-28,
wherein the antibody or fragment further comprises a light chain
variable (VL) region.
[0496] 32. The antibody or fragment of embodiment 31, wherein the
V.sub.L region comprises at least 90% sequence identity to the
V.sub.L region amino acid sequence set forth in SEQ ID NO: 14, 16,
18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245,
246, 247 or 248.
[0497] 33. The antibody or fragment of embodiment 31 or embodiment
32, wherein the V.sub.L region comprises at least 90% sequence
identity to the V.sub.L region amino acid sequence set forth in SEQ
ID NO: 14, 16, or 18.
[0498] 34. The antibody of fragment of any of embodiments 31-33,
wherein the V.sub.L region comprises a light chain complementarity
determining region 3 (CDR-L3) comprising the amino acid sequence
set forth in SEQ ID NO: 99 or 100.
[0499] 35. The antibody or fragment of any of embodiments 31-34,
wherein the V.sub.L region comprises a light chain complementarity
determining region 3 (CDR-L3) comprising the amino acid sequence
set forth in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47,
48, 49, 232 or 233.
[0500] 36. The antibody or fragment of any of embodiments 31-35,
wherein the V.sub.L region comprises a light chain complementarity
determining region 3 (CDR-L3) comprising the amino acid sequence
set forth in SEQ ID NO: 25, 32, 38, 39, 40, 41, 42, 43, 44, 46, 47,
48 or 49.
[0501] 37. The antibody or fragment of any of embodiments 31-36,
wherein the V.sub.L region comprises a light chain complementarity
determining region 1 (CDR-L1) comprising the amino acid sequence
set forth in SEQ ID NO: 101 and/or a light chain complementarity
determining region 2 (CDR-L2) comprising the amino acid sequence
set forth in SEQ ID NO: 102.
[0502] 38. The antibody or fragment of any of embodiments 31-38,
wherein the V.sub.L region comprises:
[0503] a light chain complementarity determining region 1 (CDR-L1)
comprising the amino acid sequence set forth in SEQ ID NO: 23, 30,
36, 210, 211, 212, 213, 214, 215, 217, 216, 218, 219 or 220 and/or
a CDR-L1 contained within the V.sub.L sequence set forth in SEQ ID
NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243,
244, 245, 246, 247 or 248; and/or
[0504] a light chain complementarity determining region 2 (CDR-L2)
comprising the amino acid sequence set forth in SEQ ID NO: 24, 31,
37, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230 or 231 and/or
a CDR-L2 contained within the V.sub.L sequence set forth in SEQ ID
NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243,
244, 245, 246, 247 or 248.
[0505] 39. The antibody or fragment of any of embodiments 31-38,
wherein the V.sub.L region comprises:
[0506] a light chain complementarity determining region 1 (CDR-L1)
comprising the amino acid sequence set forth in SEQ ID NO: 23, 30,
or 36 and/or a CDR-L1 contained within the V.sub.L sequence set
forth in SEQ ID NO: 14, 16, or 18; and/or
[0507] a light chain complementarity determining region 2 (CDR-L2)
comprising the amino acid sequence set forth in SEQ ID NO: 24, 31,
or 37 and/or a CDR-L2 contained within the V.sub.L sequence set
forth in SEQ ID NO: 14, 16, or 18.
[0508] 40. The antibody or fragment of any of embodiments 31-39,
wherein the V.sub.L region comprises:
[0509] a light chain complementarity determining region 1 (CDR-L1)
comprising the amino acid sequence set forth in SEQ ID NO: 23, 30,
36, 210, 211, 212, 213, 214, 215, 217, 216, 218, 219 or 220;
[0510] a light chain complementarity determining region 2 (CDR-L2),
comprising the amino acid sequence set forth in SEQ ID NO: 24, 31,
37, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230 or 231;
and
[0511] a light chain complementarity determining region 3 (CDR-L3)
comprising the amino acid sequence set forth in SEQ ID NO: 25, 32,
38, 39, 40, 41, 42, 43, 44, 46, 47, 48, 49, 232 or 233.
[0512] 41. The antibody or fragment of any of embodiments 31-40,
wherein the V.sub.L region comprises:
[0513] a light chain complementarity determining region 1 (CDR-L1)
comprising the amino acid sequence set forth in SEQ ID NO: 23, 30,
or 36;
[0514] a light chain complementarity determining region 2 (CDR-L2),
comprising the amino acid sequence set forth in SEQ ID NO: 24, 31,
or 37; and
[0515] a light chain complementarity determining region 3 (CDR-L3)
comprising the amino acid sequence set forth in SEQ ID NO: 25, 32,
38, 39, 40, 41, 42, 43, 44, 46, 47, 48, or 49.
[0516] 42. The antibody or fragment of any of embodiments 36-41,
wherein the CDR-L3 comprises the amino acid sequence set forth in
SEQ ID NO: 25, 32 or 38.
[0517] 43. The antibody or fragment of any of embodiments 31-42,
wherein the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3
selected from:
[0518] the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 23, 24, and 25, respectively;
[0519] the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 30, 31, and 32, respectively;
[0520] the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 36, 37, and 38, respectively;
[0521] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 216, 227, and 40, respectively;
[0522] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 218, 229, and 39, respectively;
[0523] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 219, 230, and 43, respectively;
[0524] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 220, 231, and 46, respectively;
[0525] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 210, 221, and 49, respectively;
[0526] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 210, 221, and 233, respectively;
[0527] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 211, 222, and 48, respectively;
[0528] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 212, 223, and 42, respectively;
[0529] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 214, 225, and 232, respectively;
[0530] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 215, 226, and 44, respectively;
[0531] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 217, 228, and 41, respectively; or
[0532] the CDR-L1, CDR-L2 and CDR-L3 comprising the sequences of
SEQ ID NOs: 213, 224, and 47, respectively.
[0533] 44. The antibody or fragment of any of embodiments 31-43,
wherein the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3
selected from:
[0534] the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 23, 24, and 25, respectively;
[0535] the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 30, 31, and 32, respectively; or
[0536] the CDR-L1, CDR-L2, and CDR-L3 comprising the sequences of
SEQ ID NOs: 36, 37, and 38, respectively.
[0537] 45. The antibody or fragment of any of embodiments 31-44,
wherein the V.sub.L region comprises light chain complementarity
determining region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively,
contained within the V.sub.L region amino acid sequence set forth
in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240, 241,
242, 243, 244, 245, 246, 247 or 248.
[0538] 46. The antibody or fragment of any of embodiments 31-45,
wherein the V.sub.L region comprises light chain complementarity
determining region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively,
contained within the V.sub.L region amino acid sequence set forth
in SEQ ID NO: 14, 16, or 18.
[0539] 47. The antibody or fragment of any of embodiments 31-46,
wherein the V.sub.L region comprises a framework region 1 (FR1), a
FR2, a FR3, and/or a FR4 comprising at least 90% sequence identity,
respectively, to the FR1, FR2, FR3, and/or FR4 of the amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18.
[0540] 48. The antibody or fragment of any of embodiments 31-47,
wherein the V.sub.L region comprises the amino acid sequence set
forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240,
241, 242, 243, 244, 245, 246, 247 or 248.
[0541] 49. The antibody or fragment of any of embodiments 31-48,
wherein the V.sub.L region comprises the amino acid sequence set
forth in SEQ ID NO: 14, 16, or 18.
[0542] 50. An antibody or antigen-binding fragment thereof,
comprising:
[0543] a heavy chain complementarity determining regions 1, 2, and
3 (CDR-H1, CDR-H2, and CDR-H3), respectively comprising the amino
acid sequences of CDR-H1, CDR-H2, and CDR-H3 sequences contained
within the V.sub.H region amino acid sequence set forth in SEQ ID
NO: 8, 10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182,
183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195,
196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209; and/or
[0544] a light chain complementarity determining regions 1, 2, and
3 (CDR-L1, CDR-L2, and CDR-L3), respectively comprising the amino
acid sequences of CDR-L1, CDR-L2, and CDR-L3 sequences contained
within the light chain variable (VL) region amino acid sequence set
forth in SEQ ID NO: 14, 16, 18, 234, 235, 236, 237, 238, 239, 240,
241, 242, 243, 244, 245, 246, 247 or 248.
[0545] 51. The antibody or antigen-binding fragment of embodiment
50, wherein:
[0546] the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the
amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 sequences
contained within the V.sub.H region amino acid sequence set forth
in SEQ ID NO: 8, 10, 13, 15, 17, or 19; and/or
[0547] the CDR-L1, CDR-L2, and CDR-L3, respectively, comprise the
amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 sequences
contained within the light chain variable (VL) region amino acid
sequence set forth in SEQ ID NO: 14, 16, or 18.
[0548] 52. An antibody or antigen-binding fragment thereof,
comprising:
[0549] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 19 and 18,
respectively;
[0550] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 17 and 18,
respectively;
[0551] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 15 and 16,
respectively; or
[0552] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 13 and 14,
respectively;
[0553] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 182 and 242
respectively;
[0554] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 182 and 246,
respectively;
[0555] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 182 and 247,
respectively;
[0556] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 185 and 248,
respectively;
[0557] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 186 and 248,
respectively;
[0558] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 175 and 234,
respectively;
[0559] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 175 and 235,
respectively;
[0560] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 176 and 236,
respectively;
[0561] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 176 and 237,
respectively;
[0562] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 177 and 238,
respectively;
[0563] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 179 and 240
respectively;
[0564] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 180 and 241,
respectively;
[0565] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 181 and 241,
respectively;
[0566] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 183 and 243
respectively;
[0567] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 183 and 244
respectively;
[0568] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 184 and 243,
respectively;
[0569] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 184 and 244
respectively;
[0570] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 183 and 245,
respectively;
[0571] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 184 and 245,
respectively; or
[0572] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 178 and 239,
respectively.
[0573] 53. The antibody or antigen-binding fragment of embodiment
52, comprising:
[0574] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 19 and 18,
respectively;
[0575] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 17 and 18,
respectively;
[0576] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 15 and 16,
respectively; or
[0577] a V.sub.H and V.sub.L regions comprising amino acid
sequences having at least 90% identity to SEQ ID NOs: 13 and 14,
respectively.
[0578] 54. The antibody or fragment of embodiment 52 or embodiment
53, wherein:
[0579] the V.sub.H and V.sub.L regions comprise the amino acid
sequences of SEQ ID NOs: 19 and 18, respectively;
[0580] the V.sub.H and V.sub.L regions comprise the amino acid
sequences of SEQ ID NOs: 17 and 18, respectively;
[0581] the V.sub.H and V.sub.L regions comprise the amino acid
sequences of SEQ ID NOs: 15 and 16 respectively; or
[0582] the V.sub.H and V.sub.L regions comprise the amino acid
sequences of SEQ ID NOs: 13 and 14 respectively.
[0583] 55. The antibody or fragment of any of embodiments 1-54,
wherein said antibody or fragment specifically binds to a ROR1
protein.
[0584] 56. The antibody or fragment of embodiment 55, wherein the
ROR1 protein is a human ROR1 protein.
[0585] 57. The antibody or fragment of embodiment 55, wherein the
ROR1 protein is a mouse ROR1 protein.
[0586] 58. The antibody or fragment of any of embodiments 1-57,
wherein:
[0587] said antibody or fragment has a binding affinity for a ROR1
protein with an EC50 that is from or from about 0.1 nM to 100 nM,
0.5 nM to 50 nM or 1 nM to 10 nM; or
[0588] said antibody or fragment has a binding affinity for a ROR1
protein with an EC50 that is less than or less than about 100 nM,
less than or less than about 50 nM, less than or less than about 10
nM or less than or less than about 1 nM.
[0589] 59. The antibody or fragment of any of embodiments 1-58,
wherein said antibody or fragment has a binding affinity for a
human ROR1 protein that is at least as high or substantially as
high as the binding affinity for the ROR1 protein of the
corresponding form of the anti-ROR1 antibody R12 or antigen-binding
fragment thereof, which is optionally an scFv fragment of R12.
[0590] 60. The antibody or fragment of any of embodiments 1-59,
wherein said antibody or fragment specifically binds to the same or
an overlapping epitope of a human ROR1 protein as the epitope
specifically bound by the anti-ROR1 antibody R12 or an
antigen-binding fragment thereof, which is optionally an scFv
fragment of R12.
[0591] 61. The antibody or fragment of any of embodiments 1-60,
wherein said antibody or fragment competes for binding to a human
ROR1 protein with anti-ROR1 antibody R12 or an antigen-binding
fragment thereof, which is optionally an scFv fragment of R12.
[0592] 62. The antibody or fragment of any of embodiments 1-61,
wherein said antibody or fragment inhibits the binding of the
anti-ROR1 antibody R12 or an antigen-binding fragment thereof,
which is optionally an scFv fragment of R12, to a human ROR1
protein by greater than or greater than about 80% or greater than
or greater than about 90%.
[0593] 63. The antibody or fragment of any of embodiments 1-62,
wherein the antibody or fragment binds to an overlapping epitope of
a human ROR1 protein as the epitope specifically bound by the
anti-ROR1 antibody R12 or an antigen-binding fragment thereof,
which is optionally an scFv fragment of R12 and the antibody or
fragment binds to mouse ROR1.
[0594] 64. The antibody or antigen-binding fragment of any of
embodiments 55, 56 and 58-63, wherein said human ROR1 protein
comprises an amino acid sequence set forth in SEQ ID NO: 103.
[0595] 65. The antibody or antigen-binding fragment of any of
embodiments 55, 56 and 58-64, which
[0596] binds an epitope within an extracellular portion of the ROR1
protein; and/or
[0597] binds to an epitope of said ROR1 protein comprising residues
within the fz domain or the Ig domain of the ROR1 protein.
[0598] 66. The antibody or antigen-binding fragment of embodiment
65, wherein the epitope comprises a residue within the fz domain of
the ROR1 protein and a residue within the Ig domain of the ROR1
protein.
[0599] 67. The antibody or antigen-binding fragment thereof of
embodiment 65 or embodiment 66, wherein said Ig domain comprises
residues 13-118 of the amino acid sequence set forth in SEQ ID NO:
103; and/or said fz domain comprises residues 136-270 of the amino
acid sequence set forth in SEQ ID NO:103.
[0600] 68. The antibody or antigen binding fragment of embodiment
65, wherein the extracellular portion comprises amino acids 1-377
of SEQ ID NO:103.
[0601] 69. The antibody or fragment thereof of any of embodiments
1-56, 58-62 and 64-68, wherein the antibody does not specifically
bind to a mouse ROR1 protein or does not specifically bind to a
protein having the amino acid sequence set forth in SEQ ID NO:
106.
[0602] 70. The antibody or fragment of any of embodiments 1-7 and
9-69, which does not comprise the CDR-H1, CDR-H2, CDR-H3 and/or
CDR-L1, CDR-L2, CDR-L3 sequences of the anti-ROR1 antibody, R12,
and/or of the anti-ROR1 antibody 2A2.
[0603] 71. The antibody or fragment of any of embodiments 1-7 and
9-70, which does not comprise CDR-H1, CDR-H2, CDR-H3 and/or CDR-L1,
CDR-L2, CDR-L3 sequences having at least 90% identity to the
CDR-H1, CDR-H2, CDR-H3 and/or CDR-L1, CDR-L2, CDR-L3 sequences of
the anti-ROR1 antibody, R12, and/or of the anti-ROR1 antibody
2A2.
[0604] 72. The antibody or fragment of any of embodiments 1-71,
wherein the antibody or fragment is human.
[0605] 73. A human antibody or antigen-binding fragment thereof
that specifically binds to the same or an overlapping epitope of a
ROR1 protein as the epitope specifically bound by a reference
antibody, wherein the reference antibody is the antibody or
fragment thereof of any of embodiments 1-72 or is the anti-ROR1
antibody, R12, or antigen binding fragment thereof, said human
antibody or fragment comprising heavy and light chain CDRs that are
distinct from the CDRs present in R12 and/or 2A2.
[0606] 74. A human antibody or antigen-binding fragment thereof
that specifically binds to ROR1 and competes for binding to ROR1
with a reference antibody, wherein the reference antibody is the
antibody or fragment of any of embodiments 1-72 or is the anti-ROR1
antibody R12 or an antigen binding fragment thereof, said human
antibody or fragment comprising heavy and light chain CDRs that are
distinct from the CDRs present in R12 and/or 2A2.
[0607] 75. The human antibody or fragment of any of embodiments
72-74, wherein:
[0608] the antibody comprises a heavy chain variable (V.sub.H)
region, said V.sub.H region comprises a portion having at least
95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid
sequence encoded by a germline nucleotide human heavy chain V
segment, a portion with at least 95%, 96%, 97%, 98%, 99%, or 100%
sequence identity to an amino acid sequence encoded by a germline
nucleotide human heavy chain D segment, and/or a portion having at
least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an
amino acid sequence encoded by a germline nucleotide human heavy
chain J segment; and/or
[0609] the antibody comprises a light chain variable (V.sub.L)
region, said V.sub.L region comprises a portion with at least 95%,
96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid
sequence encoded by a germline nucleotide human kappa or lambda
chain V segment, and/or a portion with at least 95%, 96%, 97%, 98%,
99%, or 100% sequence identity to an amino acid sequence encoded by
a germline nucleotide human kappa or lambda chain J segment.
[0610] 76. The human antibody or fragment of any of embodiments
72-75, wherein:
[0611] the CDR-H1 and/or CDR-H2 comprises a sequence 100% identical
or with no more than one amino acid difference as compared to an
amino acid sequence of a CDR-H1 and/or CDR-H2, respectively, within
a sequence encoded by a germline nucleotide human heavy chain V
segment; and/or
[0612] the CDR-L1 and/or CDR-L2 comprises a sequence 100% identical
or with no more than one amino acid difference as compared to an
amino acid sequence of a CDR-L1 and/or CDR-L2, respectively, within
a sequence encoded by a germline nucleotide human kappa or lambda v
segment.
[0613] 77. The antibody or fragment of any of embodiments 1-76,
wherein the antibody or fragment is recombinant.
[0614] 78. The antibody or fragment of any of embodiments 1-77,
which is monoclonal.
[0615] 79. The antibody or fragment of any of embodiments 1-78 that
is an antigen-binding fragment.
[0616] 80. The antibody or fragment of any of any of embodiments
1-79, which is a single chain fragment.
[0617] 81. The antibody or fragment of any of embodiments 31-80,
which is a fragment comprising antibody V.sub.H and V.sub.L regions
joined by a flexible linker.
[0618] 82. The antibody or fragment of embodiment 80 or embodiment
81, wherein the fragment comprises an scFv.
[0619] 83. The antibody or fragment of embodiment 82, wherein the
scFv comprises a linker comprising the sequence set forth SEQ ID
NO: 91.
[0620] 84. The antibody or fragment of embodiment 82 or embodiment
83, wherein the scFv comprises the amino acid sequence set forth in
SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254, 255, 256,
257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or 268, or a
sequence of amino acids that exhibits at least 90% sequence
identity to the amino acid sequence set forth in SEQ ID NO: 2, 4,
6, 12, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260,
261, 262, 263, 264, 265, 266, 267 or 268.
[0621] 85. The antibody or fragment of any of embodiments 82-84,
wherein the scFv comprises the amino acid sequence set forth in SEQ
ID NO: 2, 4, 6, or 12, or a sequence of amino acids that exhibits
at least 90% sequence identity to the amino acid sequence set forth
in SEQ ID NO: 2, 4, 6, or 12.
[0622] 86. The antibody or fragment of any of embodiments 82-85,
wherein the scFv comprises the amino acid sequence set forth in SEQ
ID NO: 2, 4, 6, or 12.
[0623] 87. The antibody or fragment of any of embodiments 31-86,
wherein the antibody or fragment comprises the V.sub.H region set
forth in SEQ ID NO: 19 and the V.sub.L region set forth in SEQ ID
NO: 18, and/or the antibody or fragment comprises the sequence of
amino acids set forth in SEQ ID NO: 12.
[0624] 88. The antibody or fragment of any of embodiments 31-86,
wherein the antibody or fragment comprises the V.sub.H region set
forth in SEQ ID NO: 13 and the V.sub.L region set forth in SEQ ID
NO: 14, and/or the antibody or fragment comprises the sequence of
amino acids set forth in SEQ ID NO: 6.
[0625] 89. The antibody or fragment of any of embodiments 31-86,
wherein the antibody or fragment comprises the V.sub.H region set
forth in SEQ ID NO: 15 and the V.sub.L region set forth in SEQ ID
NO: 16, and/or the antibody or fragment comprises the sequence of
amino acids set forth in SEQ ID NO: 4.
[0626] 90. The antibody or fragment of any of embodiments 31-86,
wherein the antibody or fragment comprises the V.sub.H region set
forth in SEQ ID NO: 17 and the V.sub.L region set forth in SEQ ID
NO: 18, and/or the antibody or fragment comprises the sequence of
amino acids set forth in SEQ ID NO: 2.
[0627] 91. A single chain cell-surface protein, comprising the
antibody or fragment of any of embodiments 1-90.
[0628] 92. A single chain cell surface protein comprising the scFv
sequence of SEQ ID NO: 2, 4, 6, 12, 249, 250, 251, 252, 253, 254,
255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267 or
268 or comprising the V.sub.H sequence set forth in SEQ ID NO: 8,
10, 13, 15, 17, 19, 175, 176, 177, 178, 179, 180, 181, 182, 183,
184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196,
197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208 or
209.
[0629] 93. The single chain cell surface protein of embodiment 92,
comprising the scFv sequence of SEQ ID NO: 2, 4, 6 or 12 or
comprising the V.sub.H sequence set forth in SEQ ID NO: 8, 10, 13,
15, 17, or 19.
[0630] 94. The antibody or fragment of any of embodiments 1-90,
which further comprises at least a portion of an immunoglobulin
constant region.
[0631] 95. The antibody or fragment of embodiment 94, further
comprising a spacer set forth in SEQ ID NO:108.
[0632] 96. The antibody or fragment of embodiment 94, wherein the
at least a portion of an immunoglobulin constant region comprises
an Fc region.
[0633] 97. The antibody or fragment of embodiment 96, wherein the
Fc region is an Fc region of a human IgG.
[0634] 98. A conjugate, comprising the antibody or fragment of any
of embodiments 1-97 and a heterologous molecule or moiety.
[0635] 99. A chimeric antigen receptor (CAR) comprising an
extracellular portion comprising the antibody or fragment of any of
embodiments 1-97 and an intracellular signaling domain.
[0636] 100. The chimeric antigen receptor of embodiment 99, wherein
the antibody or fragment comprises a VH sdAb, an scFv and the
intracellular signaling domain comprises an ITAM.
[0637] 101. The chimeric antigen receptor of embodiment 99 or 100,
wherein the intracellular signaling domain comprises a signaling
domain of a zeta chain of a CD3-zeta (CD3) chain.
[0638] 102. The chimeric antigen receptor of any of embodiments
99-101, further comprising a transmembrane domain linking the
extracellular domain and the intracellular signaling domain.
[0639] 103. The chimeric antigen receptor of embodiment 102,
wherein the transmembrane domain comprises a transmembrane portion
of CD28.
[0640] 104. The chimeric antigen receptor of any of embodiments
99-103, further comprising an intracellular signaling domain of a T
cell costimulatory molecule.
[0641] 105. The chimeric antigen receptor of embodiment 104,
wherein the T cell costimulatory molecule is selected from the
group consisting of CD28 and 41BB.
[0642] 106. A nucleic acid encoding the antibody or fragment
thereof of any of embodiments 1-97, conjugate of embodiment 98 or
the chimeric antigen receptor of any of embodiments 99-105.
[0643] 107. An engineered cell expressing a receptor comprising the
antibody or fragment of any of embodiments 1-97, conjugate of
embodiment 98 or the chimeric antigen receptor of any of
embodiments 99-105.
[0644] 108. The engineered cell of embodiment 107, which is a T
cell.
[0645] 109. A composition comprising the antibody or fragment
thereof of any of embodiments 1-97, conjugate of embodiment 98, the
CAR of any of embodiments 99-105, or the cell of embodiment 107 or
108.
[0646] 110. The composition of embodiment 109, further comprising a
pharmaceutically acceptable excipient.
[0647] 111. A method of treatment, comprising administering the
composition of embodiment 109 or embodiment 110 to a subject having
a disease or disorder associated with ROR1.
[0648] 112. A method of treatment, comprising administering an
antibody or fragment of any of embodiments 1-97, conjugate of
embodiment 98, a CAR of any of embodiments 99-103 or the cell of
embodiment 107 or 108 to a subject having a disease or disorder
associated with ROR1.
[0649] 113. A method of treatment, comprising administering the
cell of embodiment 107 or embodiment 108 to a subject having a
disease or disorder associated with ROR1.
[0650] 114. The method of any of embodiments 112-113, wherein the
disease or disorder is a ROR1-expressing cancer.
[0651] 115. The method of embodiment any of embodiments 112-114,
wherein the ROR1-expressing cancer is selected from the group
consisting of B cell leukemia, lymphoma, B cell chronic lymphocytic
leukemia (CLL), AML, acute myeloid leukemia (AML), acute
lymphocytic leukemia (ALL), Burkett's Lymphoma, mantle cell
lymphoma (MCL), non-small cell lung cancer (NSCLC), neuroblastoma,
renal cell carcinoma, colon cancer, colorectal cancer, breast
cancer, epithelial squamous cell cancer, melanoma, myeloma, stomach
cancer, brain cancer, lung cancer, pancreatic cancer, cervical
cancer, ovarian cancer, liver cancer, bladder cancer, prostate
cancer, testicular cancer, thyroid cancer, uterine cancer, adrenal
cancer and head and neck cancer.
[0652] 116. A composition of embodiment 109 or embodiment 110 for
use in treating a disease or disorder associated with ROR1.
[0653] 117. Use of a composition of embodiment 109 or embodiment
110 for the manufacture of a medicament for treating a disease or
disorder associated with ROR1.
[0654] 118. The composition for use of embodiment 116 or the use of
embodiment 117, wherein the disease or disorder is a
ROR1-expressing cancer.
[0655] 119. The composition for use or use of embodiment 118,
wherein the ROR1-expressing cancer is selected from the group
consisting of B cell leukemia, lymphoma, B cell chronic lymphocytic
leukemia (CLL), AML, acute myeloid leukemia (AML), acute
lymphocytic leukemia (ALL), Burkett's Lymphoma, mantle cell
lymphoma (MCL), non-small cell lung cancer (NSCLC), neuroblastoma,
renal cell carcinoma, colon cancer, colorectal cancer, breast
cancer, epithelial squamous cell cancer, melanoma, myeloma, stomach
cancer, brain cancer, lung cancer, pancreatic cancer, cervical
cancer, ovarian cancer, liver cancer, bladder cancer, prostate
cancer, testicular cancer, thyroid cancer, uterine cancer, adrenal
cancer and head and neck cancer.
V. EXAMPLES
[0656] The following examples are included for illustrative
purposes only and are not intended to limit the scope of the
invention.
Example 1
Generation and Assessment of Anti-ROR1 Antibodies (VHs)
[0657] Exemplary anti-ROR1 antibodies, variable heavy (VH) chains
that specifically bound to ROR1, even in the absence of a variable
light (V.sub.L) chain, were generated and assessed. The anti-ROR1
antibodies (VHs) resulted from selections based on ability to
specifically bind to ROR1-expressing cells, and/or to compete for
binding with a rabbit-derived anti-ROR1 reference antibody.
1A. Library Selection, Antibody Generation
[0658] Exemplary anti-ROR1 antibodies (VHs) were generated through
a series of selection steps carried out on dsDNA-encoded human
naive antibody V.sub.H libraries displayed in a cell-free system.
Members of a V.sub.H library were selected for binding to live
cells through five successive rounds, enriching for members that
bound specifically to stably-transfected ROR1-expressing CHOK1,
K562, and/or HEK293 cells, but not parental K562 and/or CHOK1 cells
that did not express ROR1. To recover V.sub.H binders, a further
selection was performed. In branch (a), surface stripping was
applied to all 5 rounds of selection to recover ROR1 V.sub.H
binders that cover broad epitopes and affinity ranges. In another
branch (b), after two rounds of surface stripping, competitive
elution was applied using a rabbit anti-ROR1 antibody, R12 scFv
(having the sequence set forth in SEQ ID NO: 84, including the
V.sub.H and V.sub.L sequences from the rabbit-human antibody
designated R12), to enrich for binders that competed with R12 scFv
for binding to ROR1, such as to the R12 scFv epitope.
[0659] Certain resulting clones were sequenced using forward and
reverse primers to determine amino acid sequences. Table 2A lists
sequence identifiers of the VH sequence of exemplary clones and the
corresponding exemplary CDR-H1, CDR-H2 and CDR-H3 therein. Table 2B
lists sequence identifiers corresponding to exemplary CDR-H3
(Kabat) amino acid sequences for exemplary clones. A V.sub.H
sequence for clone V70 is set forth in SEQ ID NO: 8, which had
CDR-H1 and CDR-H2 (Kabat) sequences as set forth in SEQ ID NOs: 27
and 28, respectively. A V.sub.H sequence for clone V353 is set
forth in SEQ ID NO: 10, which had CDR-H1 and CDR-H2 (Kabat)
sequences set forth in SEQ ID NOs: 33 and 34, respectively. Table
2B also lists a CDR-H3 (Kabat) sequence of a rabbit-derived
reference antibody R12 (which has a V.sub.H sequence set forth in
SEQ ID NO: 85), an scFv fragment of which was used as a control in
this study. Clone V355 had a heavy chain framework with a sequence
derived from a V.sub.H1 sequence; clones V331 and V345 had heavy
chain frameworks with sequences derived from human V.sub.H4
sequences. All other clones (aside from R12) listed in Table 2A and
2B contained frameworks with sequences derived from human V.sub.H3
sequences.
TABLE-US-00002 TABLE 2A Sequences for Exemplary Clones (SEQ ID NO.)
Heavy Chain Heavy Chain Variable CDR-H Framework Clone (V.sub.H)
Region (1, 2, 3) (Kabat) Derived # (Amino Acid) (nucleotide) (Amino
Acid) From V70 8 7 27, 28, 29 V.sub.H3 V420 206 162, 170, 50
V.sub.H3 V282 203 162, 170, 51 V.sub.H3 V353 10 9 33, 34, 52
V.sub.H3 V163 193 33, 34, 53 V.sub.H3 V355 201 161, 169,54 V.sub.H1
V18 179 33, 34, 35 V.sub.H3 V224 192 33, 34, 55 V.sub.H3 V95 194
33, 34, 56 V.sub.H3 V316 198 159, 167,57 V.sub.H3 V331 199 160,
168, 58 V.sub.H4 V357 202 33, 34, 59 V.sub.H3 V397 205 33, 171, 60
V.sub.H3 V312 197 33, 34, 61 V.sub.H3 V278 200 158, 166, 62
V.sub.H3 V86 191 158, 166, 63 V.sub.H3 V102 195 27, 164, 64
V.sub.H3 V365 204 158, 166, 65 V.sub.H3 V181 196 27, 164, 66
V.sub.H3 V128 188 156, 34, 35 V.sub.H3 V71 190 157, 165, 67
V.sub.H3 V68 189 27, 164, 68 V.sub.H3 V336 208/209 163, 173,
V.sub.H3 69/174 V9 187 33, 34, 70 V.sub.H3 V345 207 160, 172, 71
V.sub.H4
TABLE-US-00003 TABLE 2B Clone# CDR-H3 Sequence (Kabat) SEQ ID NO:
V70 VSNYEYYFDY 29 V420 VNGGEYYFDY 50 V282 VRGSEYYFDY 51 V353
DFGRWGYYFDY 52 V163 QGDSSSWYVEVYYFDY 53 V355 ITPPDAFDI 54 V18
DFGRWSYYFDY 35 V224 TYSSSWYESLLFDY 55 V95 GSGELRFLESYYFDY 56 V316
VDSERFLEWYYFDY 57 V331 GQIAAHVWGWFDP 58 V357 DMVGAWLVLSYFDY 59 V397
AKGLWFGESYYFDY 60 V312 TSRGRFLEWLLFDY 61 V278 ERSRWGDNWFDP 62 V86
VIFGVVNIPDY 63 V102 VGPSWDYYFDY 64 V365 GIGYSSSWYEIWTFDY 65 V181
DFEVREAHLSYFDY 66 V128 DFGRWSYYFDY 35 V71 VLRSGFLEWNLFDY 67 V68
DFEVRGAHLSYFDY 68 V336 VYGYDYRDFGWFDP 69 V9 GSNERFLEWLNFDY 70 V345
GPLRPQKVLPFQI 71 R12 scFv DSYADDGALFNI 72 reference antibody
1B. Binding Affinities, Competition with Reference Antibody
[0660] Exemplary ROR1 binding V.sub.H clones, generated in the
selection process described in Example 1A, were further assessed.
Clones were purified and titrated, and their binding affinities
(EC.sub.50) to ROR1-expressing K562 and CHOK1 cells assessed by
flow cytometry, with EC.sub.50 of the reference antibody (R12 scFv)
serving as a positive control.
[0661] Assays also were performed to assess competition of the
clones with the reference antibody (R12 scFv), for binding to
ROR1-expressing cells. V.sub.H clones were titrated against 2 nM
Myc-R12 on ROR1/K562 cells and competition assessed with an
anti-Myc-Alexa647 secondary antibody, and the half maximal
inhibitory concentration (IC.sub.50) determined for respective
clones.
[0662] Additionally, percent (%) maximum (max) binding to
ROR1-expressing cells and % max competition with the reference
antibody (R12 scFv) were calculated. Percent max binding and
competition values were calculated based on predicted plateaus
(measured by Prism.RTM. using four parameter non-linear
regression), relative to values for R12 scFv binding and
inhibition, respectively, assigned as 100% in each study.
[0663] Results are presented in Table 2C, listing mean EC.sub.50
(binding affinity), IC.sub.50 (competition), % max binding, and %
max competition values, based on the indicated number of
experiments for various clones. As expected, the reference antibody
(R12 scFv) was confirmed in this study to specifically bind to ROR1
and compete with itself. The results demonstrated ROR1-specific
binding and competition with the R12 scFv reference antibody, to
varying degrees for various clones. Among the clones generated were
those exhibiting similar affinity (EC.sub.50) for ROR1 and similar
levels of competition for binding to ROR1 with the reference
antibody.
[0664] Two preps of clone V9 were tested in a single R12 scFv
competition assay and found not to have any detectable competitive
binding activity.
TABLE-US-00004 TABLE 2C Results from Various Binding and
Competition Assays Binding affinity to ROR1-Expressing Cells
Competition for binding with R12 scFv Clone % Max % Max # EC.sub.50
(nM) Binding IC.sub.50 (nM) Competition V70 3.1 .+-. 0.3 (n = 7) 92
.+-. 6 38.2 .+-. 4.8 (n = 8) 92 .+-. 12 V420 8.0 (n = 1) 74 71.5 (n
= 1) 58 V282 13.1 (n = 1) 64 94.3 (n = 1) 48 V353 0.7 (n = 2) 35
.+-. 5 .4 (n = 2) 62 V163 92.9 (n = 1) 122 154.2 (n = 1) 58 V355
0.9 (n = 1) 54 1.9 .+-. 0.4 (n = 2) 53 .+-. 8 V18 0.2 .+-. 0.1 (n =
2) 37 .+-. 12 3.4 .+-. 0.8 (n = 3) 54 .+-. 6 V224 46.2 (n = 1) 74
94.6 .+-. 56.7 32 .+-. 17 V95 35.5 .+-. 2.1 (n = 2) 61 .+-. 14 19.0
.+-. 2.1 (n = 2) 36 .+-. 7 V316 28.7 (n = 1) 78 28.8 .+-. 4.9 (n =
2) 37 .+-. 14 V331 18.8 (n = 1) 70 32.4 (n = 1) 31 V357 46.0 (n =
1) 22 74.0 (n = 1) 44 V397 49.7 (n = 1) 18 25.2 (n = 1) 18 V312
23.7 (n = 1) 29 5.6 (n = 1) 19 V278 31.5 (n = 1) 22 ND (n = 2) V86
97.7 .+-. 62.1 (n = 2) ND (n = 2) V102 128.9 .+-. 46.0 (n = 2) ND
(n = 1) V365 >200 (n = 1) 8 ND (n = 1) V181 >200 (n = 1)
>200 (n = 1) 76 V128 >200 (n = 1) >200 (n = 1) V71 >200
(n = 2) ND (n = 2) V68 >200 (n = 2) ND (n = 2) V336 >200 (n =
1) 72 ND (n = 1) V345 ND (n = 1) ND (n = 1) R12 scFv 0.8 .+-. 0.1
(n = 20) 100 3.3 .+-. 0.2 (n = 17) 100 reference antibody ND = not
detected
Example 2
Generation and Assessment of Anti-ROR1 Antibodies (scFvs)
[0665] Exemplary anti-ROR1 antibodies (scFvs) that specifically
bound to ROR1 were generated and assessed, including those that
competed for binding with the R12 scFv reference antibody.
2A. Library Selection, Antibody Generation
[0666] Exemplary anti-ROR1 scFv antibodies were generated through
various selection approaches, carried out on dsDNA-encoded human
naive antibody libraries displayed in a cell-free system. In some
approaches, V.sub.L library members were paired with ROR1-specific
VH-only antibodies generated in the study described in Example
1.
[0667] In one approach, a V.sub.H library was enriched through
three successive rounds for members that bound specifically to
stably-transfected ROR1-expressing CHOK1, K562, and/or HEK293
cells, but not parental ROR1-negative cells. The resulting enriched
V.sub.H libraries were converted to scFv libraries by shuffling
with a naive human V.sub.L library, in VH-(G4S).sub.3-V.sub.L
format. The shuffled scFv libraries then were enriched in a fourth
and fifth round of selection for specific binding to
ROR1-expressing (but not parental) CHOK1 cells, with elution by
surface stripping. In a sixth round, negative selection enriched
for members that did not bind parental cells (K562, CHOK1),
followed by positive selection for binding to ROR1-expressing K562
and/or CHOK1 cells. Elution pools were generated by either (a)
surface stripping, or (b) R12 competitive elution.
[0668] In another approach, de novo selection was carried out by
enriching a naive human scFv library for ROR1-specific binding with
ROR1-HEK293, ROR1-CHO, and ROR1-K562 cells and not HEK293, CHO-K1,
and K562 parental cells over multiple rounds by alternating cell
lines each round, followed by a combination of surface stripping
(R1), competitive elution with R12 scFv (R2-4) and
immunoprecipitation (R5) to recover scFv binders.
[0669] In another approach, ROR1-specific V.sub.H-only antibodies
generated in the study described in Example 1B were non-covalently
paired with members of a human naive V.sub.L library (constructed
from the same set of donors as naive V.sub.H library) by dsDNA
display, followed by selection for ROR1 binding for 3 successive
rounds with ROR1-HEK293 and ROR1-CHO cells. Sequences of selected
V.sub.Ls were used to generate scFv clones.
[0670] For scFv clones selected in these various approaches,
specific binding to ROR1-expressing K562 cells, as compared to
control cells not expressing ROR1, was assessed by flow cytometry
either with in vitro translated crude cell lysate or with
bacterially-produced supernatant. Certain clones displaying binding
preference for ROR1 were further analyzed.
[0671] Clones were sequenced using forward and reverse primers.
Exemplary CDR-H3 (Kabat) amino acid sequences for exemplary clones
and respective sequence identifiers are listed Table 3A. Clone
"83B," a de-glycosylation variant of clone 83, was generated by a
introducing a serine (S) to asparagine (N) substitution at V.sub.H
position 53 (Kabat) to remove the N-glycosylation motif of clone
83. Table 3B lists sequence identifiers for V.sub.H and V.sub.L
sequences and exemplary CDR-H 1, 2, and 3 (Kabat) and CDR-L
sequences of exemplary clones. Table 3A also lists the respective
light chain human v-segment from which framework sequences of
individual antibodies were derived. Each antibody in this table
included a heavy chain framework sequence derived from a human VH3
sequence.
TABLE-US-00005 TABLE 3A Exemplary Clones Light Chain SEQ SEQ
Framework Clone/ ID ID Derived Antibody CDR-H3 NO. CDR-L3 NO: From
83B DSSYDAFDI 22 QQYESLPYT 25 Vk1 83 DSSYDAFDI 22 QQYESLPYT 25 Vk1
305 VSNYEYYFDY 29 QVWDNDSDHRV 40 V.lamda.3 298 VSNYEYYFDY 29
QVWDDTGDHPV 32 V.lamda.3 350 VSNYEYYFDY 29 QSYDSSNHV 41 V.lamda.6
20 DFGRWSYYFDY 35 QQLKSRPLS 42 Vk1 16 DFGRWSYYFDY 35 QQLNSYPLT 43
Vk1 48 DFGRWSYYFDY 35 AAWDDSLSGVV 39 V.lamda.3 43 DFGRWSYYFDY 35
AAWDDSLSGVV 39 V.lamda.1 366 VSNYEYYFDY 29 AAWDDSLNGYV 44 V.lamda.1
40 DFGRWSYYFDY 35 QSYDGRNLM 45 V.lamda.6 461 DFEVREAHLSYFDY 46
QVWDSSSDHRV 47 V.lamda.3 65 DFGRWSYYFDY 35 KSWDSSGSLYV 48 V.lamda.3
81 DFGRWSYYFDY 35 QVWDSSSDHYV 49 V.lamda.3 7 DFGRWSYYFDY 35
QAWDSSTVV 50 V.lamda.3 R12 scFv DSYADDGALFN 73 GADYIGGYV 74 Rb
reference antibody
TABLE-US-00006 TABLE 3B Sequences for Exemplary Clones and
Reference Antibody (SEQ ID NO:) Heavy Light Chain Chain Variable
Variable CDR-H Heavy Light (V.sub.H) (V.sub.L) ScFv (1, 2, 3) CDR-L
Chain Chain Region Region Sequence (Kabat) (1, 2, 3) Framework
Framework Clone (Amino (Amino Amino Acid (Amino (Kabat) Derived
Derived # Acid) Acid) (Nucleotide) Acid) (Amino Acid) From From 83
17 18 2 (1) 20, 21, 22 23, 24, 25 V.sub.H3 Vk1 .sup. 83B 19 18 12
(11) 20, 26, 22 23, 24, 25 V.sub.H3 Vk1 305 182 246 265 27, 28, 29
218, 229, 39 V.sub.H3 V.lamda.3 298 15 16 4 (3) 27, 28, 29 30, 31,
32 V.sub.H3 V.lamda.3 350 182 242 258 27, 28, 29 216, 227, 40
V.sub.H3 V.lamda.6 20 183/184 243/244 259/260/ 33, 34, 35 217, 228,
41 V.sub.H3 Vk1 261/262 16 177 238 253 33, 34, 35 212, 223, 42
V.sub.H3 Vk1 48 13 14 6 (5) 33, 34, 35 36, 37, 38 V.sub.H3
V.lamda.3 43 183/184 245 263/264 33, 34, 35 36, 37, 38 V.sub.H3
V.lamda.1 366 182 247 266 27, 28, 29 219, 230, 43 V.sub.H3
V.lamda.1 40 180/181 241 256/257 33, 34, 35 215, 226, 44 V.sub.H3
V.lamda.6 461 185/186 248 267/268 27, 164, 45 220, 231, 46 V.sub.H3
V.lamda.3 65 178 239 254 155, 34, 35 213, 224, 47 V.sub.H3
V.lamda.3 81 176 236/237 251/252 33, 34, 35 211, 222, 48 V.sub.H3
V.lamda.3 7 175 234/235 249/250 33, 318, 35 210, 221, 49/233
V.sub.H3 V.lamda.3 R12 scFv 85 86 84 87, 88, 72 89, 90, 73 Rb Rb
reference antibody
2B. Binding Affinities, Competition with Reference Antibody
[0672] Clones were purified and titrated, and their binding
affinities (EC.sub.50) to ROR1-expressing K562 and CHOK1 cells
assessed by flow cytometry. EC.sub.50 for the R12 scFv reference
antibody in this study served as a positive control.
[0673] Assays also were performed to assess competition (measured
as half maximal inhibitory concentration (IC.sub.50)) of the clones
with the R12 scFv reference antibody for binding to ROR1-expressing
cells, as described in Example 1. Percent (%) max ROR1 and % max
competition, as compared to the R12 scFv reference antibody, were
determined as described in Example 1.
[0674] Results are presented in Table 3C, listing mean EC.sub.50
(binding affinity), IC.sub.50 (competition), % max binding, and %
max competition values for various clones, as determined over a
plurality of experiments. As expected, the reference antibody was
confirmed to exhibited ROR1-specific binding and competition with
itself in this study. The results demonstrated varying degrees of
ROR1-specific binding affinities and competition with the R12 scFv
reference antibody among the various clones. Among the assayed
clones were those with similar ROR1 binding affinity as compared to
the reference antibody and those that competed for binding with the
reference antibodies to similar degrees as compared to the
reference antibody itself.
TABLE-US-00007 TABLE 3C Results from Various Binding and
Competition Assays Binding affinity to ROR1-Expressing Cells
Competition for binding with R12 scFv Clone# EC.sub.50 (nM) % Max
IC.sub.50 (nM) % Max .sup. 83B 6.4 (n = 1) 140 15.0 (n = 1) 103 83
2.5 .+-. 0.3 (n = 2) 70 .+-. 7 11.1 .+-. 3.4 (n = 3) 103 .+-. 3 305
5.1 (n = 1) 86 62.5 (n = 1) 97 298 5.9 (n = 1) 96 41.3 (n = 1) 88
350 22.9 (n = 1) 137 49.1 (n = 1) 80 20 2.6 .+-. 1.1 (n = 9) 97
.+-. 18 4.7 .+-. 2.2 (n = 5) 77 .+-. 7 16 3.7 .+-. 1.3 (n = 6) 91
.+-. 23 4.2 .+-. 1.8 (n = 4) 71 .+-. 8 48 9.2 .+-. 1.9 (n = 4) 69
.+-. 24 53.7 .+-. 18.7 (n = 3) 55 .+-. 11 43 10.6 .+-. 3.4 (n = 4)
66 .+-. 14 56.1 .+-. 28.4 56 .+-. 17 366 10.0 (n = 1) 104 53.9 (n =
1) 71 40 3.2 .+-. 0.8 (n = 4) 81 .+-. 20 22.8 .+-. 11.2 (n = 4) 70
.+-. 11 461 22.8 (n = 1) 63 99.8 (n = 1) 48 65 18.4 .+-. 11.6 (n =
2) ND (n = 3) 81 >200 (n = 2) not assayed R12 scFv 0.8 .+-. 0.1
(n = 20) 100 3.3 .+-. 0.2 (n = 17) 100 reference antibody ND = none
detected
Example 3
Generation of Chimeric Antigen Receptors (CARs) Against ROR1,
Engineering of Cells Expressing Such CARs, and Assessment of
Effector Functions of Such CAR-Expressing Cells
[0675] Various exemplary chimeric antigen receptors (CARs) were
generated, with antigen-binding regions containing human anti-ROR1
antigen-binding domains as described in Example 1. Specifically,
nucleic acid molecules were generated that encoded CARs containing
either an scFv antigen-binding domains in the VH-VL format (Clone
83B, Clone 298 or Clone 48) or a VH only antigen-binding domain
(Clone V70 and Clone V353). For exemplary scFv antigen-binding
domains, constructs encoding a CAR having the same VH and VL
sequences, but present in the reverse orientation (VL-VH), also
were generated. A CAR containing a rabbit anti-ROR1 scFv (R12) (in
the VH-VL orientation) was used as a control. Each CAR further
contained an Ig-derived hinge only spacer, a human CD28-derived
transmembrane domain, a human 4-1BB-derived intracellular signaling
domain, a human CD3 zeta-derived signaling domain, and a truncated
EGFR (tEGFR) sequence for use as a transduction marker, separated
from the CAR sequence by a self-cleaving T2A sequence.
[0676] Primary human T cell populations expressing the various CARs
were generated. Nucleic acid molecules encoding each CAR were
individually cloned into a lentiviral vector, which was used to
transduce CD8+ T cells in populations isolated from human PBMC
samples obtained from healthy donors (essentially as described by
Yam et al. (2002) Mol. Ther. 5:479; WO2015/095895). As a control, a
lentiviral vector containing nucleic acid encoding only the tEGFR
sequence was used to generate control cells expressing the tEGFR
only. The genetically engineered human CD8+ T cells expressing
various CARs containing human anti-ROR1 antigen-binding domains,
produced as described above, were assessed for various responses
following co-culture with ROR1-expressing cells.
[0677] A. Cytolytic Activity
[0678] ROR1-expressing target cells were incubated with CD8+ T
cells expressing the various CARs or tEGFR alone (negative
control). Following incubation, lysis of target cells was
monitored. Specifically, lysis of ROR1-transduced K562 cells
(K562/ROR1), JeKo-1 (mantle cell lymphoma line) cells, and
non-transduced K562 control cells (negative control) (FIG. 1A) were
tested.
[0679] The target cells (K562/ROR1, JeKo-1, or non-transduced K562
control cells) were labeled overnight with .sup.51Cr. Labeled cells
were washed and incubated with effector T cells (CAR-expressing and
negative control CD8+ cells) at a single effector to target (E:T)
ratio. To measure spontaneous lysis, target cells were incubated
with an equal volume of media but without effector cells and
maximum lysis was determined following incubation of target cells
with detergent to completely lyse the target cells. Supernatants
were harvested for .gamma.-counting after a 4 hour incubation. The
percent specific lysis for the experimental conditions was
calculated as:
[(Experimental Release-Spontaneous Release)/(Maximum
Release-Spontaneous Release)].times.100.
[0680] The results are set forth in FIG. 1A. As shown in FIG. 1A,
engineered CD8+ T cells expressing various human anti-ROR1
antigen-binding domain-containing CARs exhibited antigen-specific
cytolytic activity against K562/ROR1 cells, as did cells expressing
the CAR containing the rabbit anti-ROR1 (R12) scFv. This cytotoxic
activity was generally not observed against control K562 cells not
expressing ROR1. The results showed that cells engineered with a
CAR containing the exemplary V353 clone containing only the VH
domain exhibited comparable cytolytic activity to CARs containing
an antigen-binding domain in the scFv format. The degree of
cytolytic activity observed for cells expressing a CAR with a given
human scFv in the VH-VL orientation was generally greater than that
observed for cells expressing a CAR with the corresponding scFv in
the reverse VL-VH orientation (LH).
[0681] B. Cytokine Release
[0682] Cytokine release was assessed following incubation of the
CAR-expressing cells with antigen-expressing and control target
cells. Transduced CD8+ T cells were co-cultured with target cells
(K562, K562/ROR1, JeKo-1) at a single effector to target (E:T)
ratio. The co-cultured cells were incubated for about 24 hours, and
then supernatants were collected for measurement of IFN-.gamma.
using a cytokine immunoassay.
[0683] The results are set forth in FIG. 1B. Engineered CD8+ T
cells expressing various human anti-ROR1 antigen-binding
domain-containing CARs were observed to secrete IFN-.gamma. in an
antigen-specific manner following incubation with K562/ROR1 cells,
as did cells expressing the CAR containing the rabbit anti-ROR1
(R12) scFv. The cytokine secretion was generally not observed
following incubation with control K562 cells not expressing ROR1.
The results showed that cells engineered with a CAR containing the
exemplary V353 clone containing only the VH domain exhibited
comparable levels of IFN-.gamma. secretion to CARs containing an
antigen-binding domain in the scFv format. The degree of IFN.gamma.
secretion observed for cells expressing a CAR with a given human
scFv in the VH-VL orientation was generally greater that observed
for cells expressing a CAR with the corresponding scFv in the
reverse (VL-VH) orientation.
Example 4
Assessment of Effector Functions of CAR-Expressing Cells Against
Cells Expressing Human or Mouse ROR1
[0684] Various exemplary chimeric antigen receptors (CARs) were
generated and used to generate CAR-expressing CD8+ T cells as
described in Example 3.
[0685] Cytokine release was assessed following incubation of the
CAR-expressing cells with either K562/human ROR1 (hROR1) or
K562/mouse ROR1 (mROR1) antigen-expressing cells. Transduced CD8+ T
cells were co-cultured with antigen-expressing cells at a single
effector to target (E:T). The co-cultured cells were incubated for
about 24 hours, and then supernatants were collected for
measurement of IFN-.gamma. using a cytokine immunoassay.
[0686] The results are set forth in FIG. 2. Engineered CD8+ T cells
expressing the various human anti-ROR1 antigen-binding
domain-containing CARs were observed to secrete IFN-.gamma. at
comparable levels following incubation with either hROR1-expressing
cells or mROR1-expressing cells. In contrast, cells engineered with
the rabbit anti-ROR1 (R12) scFv were observed to secrete
IFN-.gamma. only following incubation with hROR-1-expressing cells
and not following incubation with mROR-1-expressing cells. This
result is consistent with the reported specificity of R12 for human
and not mouse ROR1 (Yang et al. (2011) PLoS ONE, 6:e21018). Thus,
together with the results in Example 2, the results showed that the
tested human anti-ROR1 antigen-binding binding domains of the CARs
bind to an epitope in human ROR1 that may overlap with R12, but
also bind to an epitope in mouse ROR1 that is not recognized by
R12.
[0687] The present invention is not intended to be limited in scope
to the particular disclosed embodiments, which are provided, for
example, to illustrate various aspects of the invention. Various
modifications to the compositions and methods described will become
apparent from the description and teachings herein. Such variations
may be practiced without departing from the true scope and spirit
of the disclosure and are intended to fall within the scope of the
present disclosure.
TABLE-US-00008 SEQUENCES SEQ ID NO: Sequence Description 1
CAGGTCCAGCTTGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCT Clone 83 scFv
CAGTGAAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTA
TATGCACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGG
AATAATCAACCCTAGTGGTGGTAGCACAAGCTACGCACAGAAGTTCCAG
GGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTACATG
GAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGA
GAGATAGCAGCTATGATGCTTTTGATATCTGGGGCCAAGGGACAATGGT
CACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGT
GGCGGATCGGCCATCCAGTTGACCCAATCTCCTTCCACCCTGTCTGCATC
TGTAGGAGACAGAGTCACCATCACTTGCCAGGCGAGTCAGGACATCAGC
AATTATTTAAATTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAACTCC
TGATCAACGATGCATCCTATTTGGAGACAGGGGTCCCATCAAGGTTCAG
TGGAAGTGGATCTGGGACAGATTTTACTTTAACCATCAGCAGCCTGCAG
CCTGAAGATATTGCAACATATTACTGTCAACAGTATGAAAGTCTCCCGT
ACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA 2
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWM Clone 83 scFv
GIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDS
SYDAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSAIQLTQSPSTLSASVGDR
VTITCQASQDISNYLNWYQQKPGKAPKLLINDASYLETGVPSRFSGSGSGTD
FTLTISSLQPEDIATYYCQQYESLPYTFGQGTKLEIK 3
GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGG Clone 298
TCCCTGAGACTCTCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGC scFv
GATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTC
AAGTATTAGTGGTAGTGGTCGTAGCACAGACCACGCAGACTACGTGAAG
GGCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGGTATATCTGC
AAATGAACAGGCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCAA
AAGTCAGTAACTACGAGTATTACTTTGACTACTGGGCCCAGGGAACCCT
GGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGC
GGTGGCGGATCGGAAATTGTGCTGACTCAGTCTCCCTCGGTGTCAGTGG
CCCCAGGACAGACGGCCAGAATTACCTGTGGGGGAAGCAACATTGGAT
CTGAGAGTGTCAACTGGTACCAGTGGAAGTCGGGCCAGGTTCCTGTCTT
GGTCGTCTCTGACACTACCGACCGACCCTCAGGGATCCCTGGGCGATTC
ACTGGCACCCGGTCTGGGACCACGGCCACCTTGACCATCAGTGGGGTCG
AAGCCGGGGATGAGGCCGACTATCACTGTCAGGTGTGGGATGACACTG
GTGATCATCCTGTCTTCGGCGGAGGGACCAAGCTGACCGTCCTA 4
EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone 298
ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS scFv
NYEYYFDYWAQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPSVSVAPGQ
TARITCGGSNIGSESVNWYQWKSGQVPVLVVSDTTDRPSGIPGRFTGTRSGT
TATLTISGVEAGDEADYHCQVWDDTGDHPVFGGGTKLTVL 5
CAGGTCACCTTGAAGGAGTCTGGGGGAGGCTTGGTAAAGCCTGGGGGG Clone 48 scFv
TCCCTTAGACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTAACGCCTG
GATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTTGG
CCGTATTAAAAGCAAAACTGATGGTGGGACAACAGACTACGCTGCACCC
GTGAAAGGCAGATTCACCATCTCAAGAGATGATTCAAAAAACACGCTGT
ATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTG
TGCGAGAGATTTCGGACGATGGAGCTACTACTTTGACTACTGGAGCCAG
GGAACCCTGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTG
GCTCTGGCGGTGGCGGATCGCAGTCTGTGCTGACTCAGCCATCCTCAGT
GTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGC
TCCAACATCGGAAGTAATTATGTATACTGGTACCAGCAGCTCCCAGGAA
CGGCCCCCAAACTCCTCATCTATAGGAATAATCAGCGGCCCTCAGGGGT
CCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCA
TCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATG
GGATGACAGCCTGAGTGGTGTGGTATTCGGCGGAGGGACCAAGCTCACC GTCCTA 6
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 48 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR (aa)
DFGRWSYYFDYWSQGTLVTVSSGGGGSGGGGSGGGGSQSVLTQPSSVSGT
PGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSG
SKSGTSASLAISGLRSEDEADYYCAAWDDSLSGVVFGGGTKLTVL 7
CAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGT Clone V70 V.sub.H
CCCTGAGACTCTCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCG
ATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCA
AGTATTAGTGGTAGTGGTCGTAGCACAGACCACGCAGACTACGTGAAGG
GCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGGTATATCTGCA
AATGAACAGGCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCAAA
AGTCAGTAACTACGAGTATTACTTTGACTACTGGGCCCAGGGAACCCTG GTCACCGTCTCCTCA 8
QVQLLESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone V70
V.sub.H ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS
NYEYYFDYWAQGTLVTVSS 9
CAGGTCACCTTGAAGGAGTCTGGGGGAGGCTTGGTAAAGCCTGGGGGG Clone V353
TCCCTTAGACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTAACGCCTG V.sub.H
GATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTTGG
CCGTATTAAAAGCAAAACTGATGGTGGGACAACAGACTACGCTGCACCC
GTGAAAGGCAGATTCACCATCTCAAGAGATGATTCAAAAAACACGCTGT
ATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTG
TGCGAGAGATTTCGGACGATGGGGCTACTACTTTGACTACTGGAGCCAG
GGAACCCTGGTCACCGTCTCCTCA 10
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V353
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR V.sub.H
DFGRWGYYFDYWSQGTLVTVSS 11
CAGGTCCAGCTTGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCT Clone 83B
CAGTGAAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTA scFv
TATGCACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGG
AATAATCAACCCTAATGGTGGTAGCACAAGCTACGCACAGAAGTTCCAG
GGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTACATG
GAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGA
GAGATAGCAGCTATGATGCTTTTGATATCTGGGGCCAAGGGACAATGGT
CACCGTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGT
GGCGGATCGGCCATCCAGTTGACCCAATCTCCTTCCACCCTGTCTGCATC
TGTAGGAGACAGAGTCACCATCACTTGCCAGGCGAGTCAGGACATCAGC
AATTATTTAAATTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAACTCC
TGATCAACGATGCATCCTATTTGGAGACAGGGGTCCCATCAAGGTTCAG
TGGAAGTGGATCTGGGACAGATTTTACTTTAACCATCAGCAGCCTGCAG
CCTGAAGATATTGCAACATATTACTGTCAACAGTATGAAAGTCTCCCGT
ACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA 12
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWM Clone 83B
GIINPNGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARD scFv
SSYDAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSAIQLTQSPSTLSASVGD
RVTITCQASQDISNYLNWYQQKPGKAPKLLINDASYLETGVPSRFSGSGSGT
DFTLTISSLQPEDIATYYCQQYESLPYTFGQGTKLEIK 13
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 48 V.sub.H
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSS 14
QSVLTQPSSVSGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRN Clone 48
V.sub.L NQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSGVVFGG GTKLTVL
15 EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone 298
V.sub.H ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS
NYEYYFDYWAQGTLVTVSS 16
EIVLTQSPSVSVAPGQTARITCGGSNIGSESVNWYQWKSGQVPVLVVSDTT Clone 298
V.sub.L DRPSGIPGRFTGTRSGTTATLTISGVEAGDEADYHCQVWDDTGDHPVFGGG TKLTVL
17 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWM Clone 83
V.sub.H GIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDS
SYDAFDIWGQGTMVTVSS 18
AIQLTQSPSTLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLINDAS Clone 83, 83B
YLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQYESLPYTFGQGTKLEI V.sub.L K 19
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWM Clone 83B V.sub.H
GIINPNGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARD
SSYDAFDIWGQGTMVTVSS 20 SYYMH Clone 83, 83B CDR-H1 21
IINPSGGSTSYAQKFQG Clone 83 CDR-H2 22 DSSYDAFDI Clone 83, 83B CDR-H3
23 QASQDISNYLN Clone 83, 83B CDR-L1 24 DASYLET Clone 83, 83B CDR-L2
25 QQYESLPYT Clone 83, 83B CDR-L3 26 IINPNGGSTSYAQKFQG Clone 83B
CDR-H2 27 DYAMS Clone 298, V70, 350, 305, 366, 461, V68, V102, V181
CDR-H1 28 SISGSGRSTDHADYVKG Clone 298, V70, 350, 305, 366 CDR-H2 29
VSNYEYYFDY Clone 298, 305, 350, 366, V70 CDR-H3 30 GGSNIGSESVN
Clone 298 CDR-L1 31 DTTDRPS Clone 298 CDR-L2 32 QVWDDTGDHPV Clone
298 CDR-L3 33 NAWMS Clone 48, V353, 7, 81, 16, V18, 40, 20, 43, V9,
V224, V163, V95, V312, V357, V397 CDR-H1 34 RIKSKTDGGTTDYAAPVKG
Clone 48, V353, 81, 16, 65, V18, 40, 20, 43, V9, V128, V224, V163,
V95, V312, V357 CDR-H2 35 DFGRWSYYFDY Clones 16, 20, 43, 48, 40,
65, 81, 7, V128, V18 CDR-H3 36 SGSSSNIGSNYVY Clone 48, 43 CDR-L1 37
RNNQRPS Clone 48, 43 CDR-L2 38 AAWDDSLSGVV Clones 43, 48 CDR-L3 39
QVWDNDSDHRV Clone 305 CDR-L3 40 QSYDSSNHV Clone 350 CDR-L3 41
QQLKSRPLS Clone 20 CDR-L3 42 QQLNSYPLT Clone 16 CDR-L3 43
AAWDDSLNGYV Clone 366 CDR-L3 44 QSYDGRNLM Clone 40 CDR-L3 45
DFEVREAHLSYFDY Clone 461 CDR-H3 46 QVWDSSSDHRV Clone 461 CDR-L3 47
KSWDSSGSLYV Clone 65
CDR-L3 48 QVWDSSSDHYV Clone 81 CDR-L3 49 QAWDSSTVV Clone 7 CDR- L3
50 VNGGEYYFDY Clone V420 CDR-H3 51 VRGSEYYFDY Clone V282 CDR-H3 52
DFGRWGYYFDY Clone V353 CDR-H3 53 QGDSSSWYVEVYYFDY Clone V163 CDR-H3
54 ITPPDAFDI Clone V355 CDR-H3 55 TYSSSWYESLLFDY Clone V224 CDR-H3
56 GSGELRFLESYYFDY Clone V95 CDR-H3 57 VDSERFLEWYYFDY Clone V316
CDR-H3 58 GQIAAHVWGWFDP Clone V331 CDR-H3 59 DMVGAWLVLSYFDY Clone
V357 CDR-H3 60 AKGLWFGESYYFDY Clone V397 CDR-H3 61 TSRGRFLEWLLFDY
Clone V312 CDR-H3 62 ERSRWGDNWFDP Clone V278 CDR-H3 63 VIFGVVNIPDY
Clone V86 CDR-H3 64 VGPSWDYYFDY Clone V102 CDR-H3 65
GIGYSSSWYEIWTFDY Clone V365 CDR-H3 66 DFEVREAHLSYFDY Clone V181
CDR-H3 67 VLRSGFLEWNLFDY Clone V71 CDR-H3 68 DFEVRGAHLSYFDY Clone
V68 CDR-H3 69 VYGYDYRDFGWFDP Clone V336 CDR-H3 70 GSNERFLEWLNFDY
Clone V9 CDR-H3 71 GPLRPQKVLPFQI Clone V345 CDR-H3 72 DSYADDGALFNI
R12 CDR-H3 73 GADYIGGYV R12 CDR-L3 74 GYTFTS Clone 83, 83B CDR-H1
75 GYTFTSYYMH Clone 83, 83B CDR-H1 76 GFTFGD Clone 298, V70, 350,
305, 366, 461, V68, V102, V181 CDR-H1 77 GFTFGDYAMS Clone 298, V70,
350, 305, 366, 461, V68, V102, V181 78 GFTFSN CDR-H1 V353, 7, 81,
16, V18, 40, 20, 43, V9, V163, V95, V312, V357, V397 CDR-H1 79
GFTFSNAWMS Clone 48, V353, 7, 81, 16, V18, 40, 20, 43, V9, V163,
V95, V312, V357, V397 CDR-H1 80 IINPSGGS Clone 83 CDR-H2 81
SISGSGRS Clone 298, V70 CDR-H2 82 RIKSKTDGGT Clone 48, V353 CDR- H2
83 IINPNGGS Clone 83B CDR-H2 84
QEQLVESGGRLVTPGGSLTLSCKASGFDFSAYYMSWVRQAPGKGLEWIATI R12 scFv
YPSSGKTYYATWVNGRFTISSDNAQNTVDLQMNSLTAADRATYFCARDSY
ADDGALFNIWGPGTLVTISSGGGGSGGGGSGGGGSELVLTQSPSVSAALGS
PAKITCTLSSAHKTDTIDWYQQLQGEAPRYLMQVQSDGSYTKRPGVPDRFS
GSSSGADRYLIIPSVQADDEADYYCGADYIGGYVFGGGTQLTVTG 85
QEQLVESGGRLVTPGGSLTLSCKASGFDFSAYYMSWVRQAPGKGLEWIATI R12 V.sub.H
YPSSGKTYYATWVNGRFTISSDNAQNTVDLQMNSLTAADRATYFCARDSY
ADDGALFNIWGPGTLVTISS 86
ELVLTQSPSVSAALGSPAKITCTLSSAHKTDTIDWYQQLQGEAPRYLMQVQ R12 V.sub.L
SDGSYTKRPGVPDRFSGSSSGADRYLIIPSVQADDEADYYCGADYIGGYVF GGGTQLTVTG 87
AYYMS R12 CDR-H1 88 TIYPSSGKTYYATWVNG R12 CDR-H2 89 TLSSAHKTDTID
R12 CDR-L1 90 GSYTKRP R12 CDR-L2 91 GGGGSGGGGSGGGGS Linker 92
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10-
X.sub.11X.sub.12X.sub.13X.sub.14X.sub.15X.sub.16 Consensus X.sub.1
= D, V, Q, I, T, G, A, or E; CDR-H3 X.sub.2 = S, F, N, R, G, T, Y,
D, Q, M, K, I, L, or P; X.sub.3 = S, N, G, E, D, P, I, V, R, F, N,
or L; X.sub.4 = Y, R, V, G, S, P, E, A, or L; X.sub.5 = D, E, W, R,
S, L, A, V, G, or P; X.sub.6 = A, W, S, E, G, Y, R, F, H, V, D, S,
or Q; X.sub.7 = F, Y, A, W, L, G, D, V, N, S, K, or R; X.sub.8 = F,
Y, H, E, L, W, V, N, I, D, or null; X.sub.9 = F, L, V, S, E, W, G,
P, Y, or null; X.sub.10 = S, E, L, Y, W, F, N, G, P, or null;
X.sub.11 = Y, V, L, F, I, W, N, or null; X.sub.12 = F, Y, W, or
null; X.sub.13 = Y, F, T, or null; X.sub.14 = F or null; X.sub.15 =
D or Q; X.sub.16 = I, Y, or P 93
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10-
X.sub.11X.sub.12X.sub.13DX.sub.14 Consensus X.sub.1 = D or V;
CDR-H3 X.sub.2 = S or F; X.sub.3 = S, N, G, or E; X.sub.4 = Y, R,
or V; X.sub.5 = D, E, W, or R; X.sub.6 = A, Y, S, or E; X.sub.7 =
F, Y, or A; X.sub.8 = F, Y, H, or null; X.sub.9 = F, L, or null;
X.sub.10 = S or null; X.sub.11 = Y or null; X.sub.12 = F or null;
X.sub.14 = I or Y 94
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9DY
Consensus X.sub.1 = V or D; CDR-H3 X.sub.2 = S or F; X.sub.3 = N or
G; X.sub.4 = Y or R; X.sub.5 = E or W; X.sub.6 = Y or G; X.sub.8 =
F or Y; X.sub.9 = F or null 95 X.sub.1X.sub.2X.sub.3MXS Consensus
X.sub.1 = S, D, or N; CDR-H1 X.sub.2 = Y or A; X.sub.3 = Y, A, or
W; X.sub.5 = H or S 96
X.sub.1IX.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10TX.sub-
.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17X.sub.18G Consensus
X.sub.1 = I, S, or R; CDR-H2 X.sub.3 = N, S, or K; X.sub.4 = P, G,
or S; X.sub.5 = K or null; X.sub.6 = T or null; X.sub.7 = S, D, or
N; X.sub.9 = G or R; X.sub.10 = S or T; X.sub.12 = S or D; X.sub.13
= Y or H; X.sub.15 = Q, D, or A; X.sub.16 = K, Y, or P; X.sub.17 =
F or V; X.sub.18 = Q or K 97 X.sub.1X.sub.2X.sub.3MS Consensus
X.sub.1 = D or N; CDR-H1 X.sub.2 = Y or A; X.sub.3 = A or W 98
X.sub.1IX.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10TX.sub-
.12X.sub.13AX.sub.14X.sub.15X.sub.16X.sub.17X.sub.18G Consensus
X.sub.1 = I, S, or R; CDR-H2 X.sub.3 = N, S, or K; X.sub.4 = P, G,
or S; X.sub.5 = K or null; X.sub.6 = T or null; X.sub.7 = S, D, or
N; X.sub.9 = G or R; X.sub.10 = S or T; X.sub.12 = S or D; X.sub.13
= Y or H; X.sub.15 = Q, D, or A; X.sub.16 = K, Y, or P; X.sub.17 =
F or V; X.sub.18 = Q or K 99
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10-
X.sub.11X.sub.12X.sub.13X.sub.14 Consensus X.sub.1 = Q, A, or K;
CDR-L3 X.sub.2 = Q, V, A, or S; X.sub.3 = Y, W, or L; X.sub.4 = E,
D, K, or N; X.sub.5 = S, D, N, or G; X.sub.6 = L, T, S, D, R, or Y;
X.sub.7 = P, G, L, S, N, or T; X.sub.8 = D, S, N, or null;
X.sub.9 = H, G, L, or null; X.sub.10 = Y, P, V, R, H, or L;
X.sub.11 = T, V, S, or M 100
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.1-
0X.sub.11X.sub.12X.sub.13X.sub.14 Consensus X.sub.1 = Q or A;
CDR-L3 X.sub.2 = Q, V, or A; X.sub.3 = Y or W; X.sub.4 = E or D;
X.sub.5 = S or D; X.sub.6 = L, T, or S; X.sub.7 = P, G, or L;
X.sub.8 = D, S, or null; X.sub.9 = H, G, or null; X.sub.10 = Y, P,
or V; X.sub.11 = T or V 101
X.sub.1X.sub.2SX.sub.4X.sub.5X.sub.6X.sub.7X.sub.8SX.sub.10X.sub.11X.s-
ub.12X.sub.13 Consensus X.sub.1 = Q, G, or S; CDR-L1 X.sub.2 = A or
G; X.sub.4 = Q, N, or S; X.sub.5 = S or null; X.sub.6 = N or null;
X.sub.7 = D or I; X.sub.8 = I or G; X.sub.10 = N or E; X.sub.11 = Y
or S; X.sub.12 = L or V; X.sub.13 = N or Y 102
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7 Consensus X.sub.1
= D or R; CDR-L2 X.sub.2 = A, T, or N; X.sub.3 = S, T, or N;
X.sub.4 = Y, D, or Q; X.sub.5 = L or R; X.sub.6 = E or P; X.sub.7 =
T or S 103 QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKV
Human ROR1; SGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT
GenBank No. NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRT
NP_005003.2 VYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDET
SSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESP
EAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYP
HTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDS
KDSKEKNKMEILYILVPSVAIPLAIALLFFFICVCRNNQKSSSAPVQRQPKHV
RGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPG
MDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQ
PVCMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQI
AAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSK
SLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIE
MVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSS
HTSSTTPSGGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFIG
PPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTGPPRVIQHCPPPKSRSPSSASGS
TSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL 104
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKV ROR1 Isoform
SGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT short
NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRT
VYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDET
SSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESP
EAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYP
HTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDS
KDSKEKNKMEILYILVPSVAIPLAIALLFFFICVCRNNQKSSSAPVQRQPKHV
RGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPG
MDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQ PVC 105
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKV ROR1 isoform
SGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT 3
NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRT
VYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDET
SSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESP
EAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYP
HTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK 106
QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKV Mouse ROR1;
SGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVA GenBank No.
TNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNR NP_038873
TVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDE
TSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPE
SPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQ
YPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC
DSKDSKEKNKMEILYILVPSVAIPLAIAFLFFFICVCRNNQKSSSPPVQRQPKP
VRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECTFGKIYKGHLYLP
GMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQE
QPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIA
IQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQ
SKSSLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVI
EMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLS
SHTSSTTPSGGNATTQTTSLSASPVSNLSNPRFPNYMFPSQGITPQGQIAGFIG
PAIPQNQRFIPINGYPIPPGYAAFPAAHYQPAGPPRVIQHCPPPKSRSPSSASG
STSTGHVASLPSSGSNQEANVPLLPHMSIPNHPGGMGITVFGNKSQKPYKID
SKQSSLLGDSHIHGHTESMISAEV 107 GAATCTAAGTACGGACCGCCCTGCCCCCCTTGCCCT
spacer (IgG4hinge) 108 ESKYGPPCPPCP spacer (IgG4hinge) 109
X.sub.1SX.sub.3YX.sub.5X.sub.6X.sub.7X.sub.8DX.sub.10 Consensus
X.sub.1 = V or D; CDR-H3 X.sub.3 = S or N; X.sub.5 = D or E;
X.sub.6 = Y or A; X.sub.7 = F or Y; X.sub.8 = F or null; X.sub.10 =
I or Y; 110 VX.sub.2X.sub.3X.sub.4EYYFDY Consensus X.sub.2 = S, N,
or R; CDR-H3 X.sub.3 = N or G; X.sub.4 = Y, G, or S; 111 GGGGS 4GS
linker 112 GGGS 3GS linker 113 GSTSGSGKPGSGEGSTKG Linker 114
QVQLQQSGAELVRPGASVTLSCKASGYTFSDYEMHWVIQTPVHGLEWIGAI 2A2 V.sub.H
DPETGGTAYNQKFKGKAILTADKSSSTAYMELRSLTSEDSAVYYCTGYYD
YDSFTYWGQGTLVTVSA 115
DIVMTQSQKIMSTTVGDRVSITCKASQNVDAAVAWYQQKPGQSPKLLIYSA 2A2 V.sub.L
SNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYDIYPYTFGGGT KLEIK 116 DYEMH
2A2 CDR-H1 117 AIDPETGGTAYNQKFKG 2A2 CDR-H2 118 YYDYDSFTY 2A2
CDR-H3 119 KASQNVDAAVA 2A2 CDR-L1 120 SASNRYT 2A2 CDR-L2 121
QQYDIYPYT 2A2 CDR-L3 122
QVQLQESGPGLVKPSQTLSLTCTVSGYAFTAYNIHWVRQAPGQGLEWMGS 99961 FDPYDGGSSY
humanized V.sub.H NQKFKDRLTISKDTSKNQVVLTMTNMDPVDTATYYCARGWYYFDYWGH
GTLVTVSS 123 QVQLQESGPGLVKPSQTLSLTCTVSGYAFTAYNIHWVRQAPGQGLEWMGS
99961 FDPYDGGSSY humanized V.sub.H
NQKFKDRLTISKDTSKNQVVLTMTNMDPVDTATYYCARGWYYFDYWGH GTLVTVSS 124
QVQLQESGPGLVKPSQTLSLTCTVSGYAFTAYNIHWIRQPPGKGLEWIGSFD 99961 PYDGGSSY
humanized V.sub.H NQKFKDRLTISKDTSKNQVVLTMTNMDPVDTATYYCARGWYYFDYWGH
GTLVTVSS 125 QVQLQESGPGLVKPSQTLSLTCTVSGYAFTAYNIHWIRQPPGKGLEWIGSFD
99961 PYDGGSSY humanized V.sub.H
NQKFKDRLTISKDTSKNQVVLTMTNMDPVDTATYYCARGWYYFDYWGH GTLVTVSS 126
DIVMTQTPLSLPVTPGEPASISCRASKSISKYLAWYQQKPGQAPRLLIYSGST 99961 LQSGIPP
humanized V.sub.L RFSGSGYGTDFTLTINNIESEDAAYYFCQQHDESPYTFGEGTKVEIK
127 DVVMTQSPLSLPVTLGQPASISCRASKSISKYLAWYQQKPGKAPKLLIYSGS 99961
TLQSGIPP humanized V.sub.L
RFSGSGYGTDFTLTINNIESEDAAYYFCQQHDESPYTFGEGTKVEIK 128
DIVMTQTPLSLPVTPGEPASISCRASKSISKYLAWYQQKPGQAPRLLIYSGST 99961 LQSGIPP
humanized V.sub.L RFSGSGYGTDFTLTINNIESEDAAYYFCQQHDESPYTFGEGTKVEIK
129 DVVMTQSPLSLPVTLGQPASISCRASKSISKYLAWYQQKPGKAPKLLIYSGS 99961
TLQSGIPP humanized V.sub.L
RFSGSGYGTDFTLTINNIESEDAAYYFCQQHDESPYTFGEGTKVEIK 130 SGYAFTAYNIHWVRQ
99961 humanized CDR-H1 131 GSFDPYDGGSSYNQKFKD 99961 humanized
CDR-H2 132 YYCARGWYYFDYWGHGTLVTVSS 99961 humanized CDR-H3 133
GYAFTAYN 99961 humanized CDR-H1 134 FDPYDGGS 99961 humanized CDR-H2
135 GWYYFDY 99961 humanized CDR-H3 136 CRASKSISKYLAWY 99961
humanized CDR-L1 137 LLIYSGSTLQSG 99961 humanized CDR-L2 138
CQQHDESPYTFGEGTK 99961 humanized CDR-L3 139 KSISKY 99961 humanized
CDR-L1 140 SGS 99961 humanized CDR-L2 141 QQHDESPY 99961 humanized
CDR-L3 142 ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVE
Hinge-CH3 WESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE spacer
ALHNHYTQKSLSLSLGK 143
ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP Hinge-CH2-
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CH3 spacer
CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVF
SCSVMHEALHNHYTQKSLSLSLGK 144
RWPESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEK IgD-hinge-Fc
EEQEERETKTPECPSHTQPLGVYLLTPAVQDLWLRDKATFTCFVVGSDLKD
AHLTWEVAGKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNAGTSVTC
TLNHPSLPPQRLMALREPAAQAPVKLSLNLLASSDPPEAASWLLCEVSGFSP
PNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPAT
YTCVVSHEDSRTLLNASRSLEVSYVTDH 145 FWVLVVVGGVLACYSLLVTVAFIIFWV CD28
(amino acids 153-179 of Accession No. P10747)
146 IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP CD28 (amino
FWVLVVVGGVLACYSLLVTVAFIIFWV acids 114-179 of Accession No. P10747)
147 RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS CD28 (amino acids
180-220 of P10747) 148 RSKRSRGGHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
CD28 (LL to GG) 149 KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
4-1BB (amino acids 214-255 of Q07011.1) 150
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP CD3 zeta
RRKNPQEGLYN ELQKDKMAEA YSEIGMKGER RRGKGHDGLY QGLSTATKDTYDALHMQALP
PR 151 RVKFSRSAEPPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR CD3 zeta
RKNPQEGLYN ELQKDKMAEA YSEIGMKGER RRGKGHDGLY QGLSTATKDTYDALHMQALP PR
152 RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP CD3 zeta
RRKNPQEGLYN ELQKDKMAEA YSEIGMKGER RRGKGHDGLY QGLSTATKDTYDALHMQALP
PR 153 LEGGGEGRGSLLTCGDVEENPGPR T2A 154
MLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSI tEGFR
SGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLH
AFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYA
NTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDC
VSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRG
PDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNC
TYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM 155 X.sub.aaRLDE Clone
65 CDR-H1 156 TFWMS Clone V128 CDR-H1 157 TSAMS Clone V71 CDR-H1
158 SYAMS Clone V86, V278, V365 CDR-H1 159 RTWMS Clone V316 CDR-H1
160 GYYWS Clone V331, V345 CDR-H1 161 SYAIS Clone V355 CDR-H1 162
SYWMS Clone V420, V282 CDR-H1 163 SYAMH Clone V336 CDR-H1 164
FIRSKAYGGTTEYAASVKG Clone 461, V68, V102, V181 CDR-H2 165
TISTDGATTWYADSVRG Clone V71 CDR-H2 166 AISGSGGSTYYADSVKG Clone V86,
V278, V365 CDR-H2 167 SINDDGSEKYYVDSVKG Clone V316 CDR-H2 168
KINHSGSTNYNPSLKS Clone V331 CDR-H2 169 GIIPIFGTANYAQKFQG Clone V355
CDR-H2 170 NIKQDGSEKYYVDSVKG Clone V282, V420 CDR-H2 171
RIKSKTDGGTTDYAAPLKG Clone V397 CDR-H2 172 EINHSGSTNYNPSLKS Clone
V345 CDR-H2 173 VISYDGSTNYNPSLX.sub.aaS Clone V336 CDR-H2 174
VYGYDYX.sub.aaDFGWFDP Clone V336 CDR-H3 175
QITLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone 7 VH
IRSKTDGGTTDYAALVKGRFTISRDDSENTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSS 176
QITLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone 81 VH
IKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSS 177
RSPX.sub.aaRSLGEAX.sub.aaVKPGGSLRLSCAASGFTFSNAWMSGSAQAPGKGLEWV
Clone 16 VH GRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCA
RDFGRWSYYFDYWSQGTLVTVSS 178
QVTLKESGGGLVKPGGSLRLSCAASGFTFQX.sub.aaRLDEWVRQAPGKGLEWVG Clone 65
VH RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSS 179
QVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V18 VH
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWGQGTLVTVSS 180
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 40 VH
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLRTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSS 181
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 40 VH
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLRTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSS 182
EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone 350,
ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS 305, 366 VH
NYEYYFDYWAQGTLVTVSS 183
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 20, 43
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
DFGRWSYYFDYWSQGTLVTVSS 184
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 20, 43
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
DFGRWSYYFDYWSQGTLVTVSS 185
QVQLVESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGF Clone 461 VH
IRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAKD
FEVREAHLSYFDYWGQGTLVTVSS 186
EVQLVESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGF Clone 461 VH
IRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAKD
FEVREAHLSYFDYWGQGTLVTVSS 187
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKELEWVG Clone V9 VH
RIKSKTDGGTTDYAAPVKGRFTISRDDSKKTLYLQMNSLKTEDTAVYYCAR
GSNERFLEWLNFDYWGQGTLVTVSS 188
EVQLLESGGGVVQPGGSLRLSCAASGFTFDTFWMSWVRQAPGKGLEWVG Clone V128
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
DFGRWSYYFDYWSQGTLVTVSS 189
QITLKESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFI Clone V68 VH
RSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAKDF
EVRGAHLSYFDYWGQGTLVTVSS 190
QVQLVESGGGLVQPGGSLRLSCAASGFTFSTSAMSWVRQAPGKGLEWVSTI Clone V71 VH
STDGATTWYADSVRGRFSVSRDNSKNTLYLQMTGLRAEDTAVYYCARVL
RSGFLEWNLFDYWGQGTLVTVSS 191
QVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA Clone V86 VH
ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVIF
GVVNIPDYWGQGTLVTVSS 192
QVQLVESGGGLVKPGGSLRLSCAASGFTFINAWMSWVRQAPGKGLEWVG Clone V224
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
TYSSSWYESLLFDYWGQGTLVTVSS 193
QVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V163
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
QGDSSSWYVEVYYFDYWGQGTLVTVSS 194
QVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V95 VH
RIKSKTDGGTTDYAAPVKGRFTISRDDSKKTLYLQMNSLKTEDTAVYYCAR
GSGELRFLESYYFDYWGQGTLVTVSS 195
QVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVG Clone V102
FIRSKAYGGTTEYAASVKGRFTISRDDSQSIAYLQMDSLKTEDTAVYYCAK VH
VGPSWDYYFDYWGQGTLVTVSS 196
QITLKESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFI Clone V181
RSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAKDF VH
EVREAHLSYFDYWGQGTLVTVSS 197
EVQLVESGGGLVKPRGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V312
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
TSRGRFLEWLLFDYWGQGTLVTVSS 198
EVQLVESGGGLVRPGGSLRLSCAASGLTFSRTWMSWVRQAPGKGLEWVAS Clone V316
INDDGSEKYYVDSVKGRFTISRDNARNSLYLQMNRLRAEDTAVYYCARVD VH
SERFLEWYYFDYWGQGTLVTVSS 199
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGK Clone V331
INHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGQIAA VH
HVWGWFDPWGQGTLVTVSS 200
QITLKESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAI Clone V278
SGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKERSR VH
WGDNWFDPWGQGTLVTVSS 201
EVQLVESGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG Clone V355
IIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARIYPPD VH
AFDIWGQGTMVTVSS 202
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V357
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR VH
DMVGAWLVLSYFDYWGQGTLVTVSS 203
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVA Clone V282
NIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARV VH
RGSEYYFDYWGQGTLVTVSS 204
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA Clone V365
ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGIG VH
YSSSWYEIWTFDYWGQGTLVTVSS 205
QITLKESGGGLVQPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone V397
IKSKTDGGTTDYAAPLKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARA VH
KGLWFGESYYFDYWGQGTLVTVSS 206
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVA Clone V420
NIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARV VH
NGGEYYFDYWGQGTLVTVSS 207
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEI Clone V345
NHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAEDTAVYYCARGPLRPQ VH
KVLPFQIGAQGTLVTVSS 208
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVA Clone V336
VISYDGSTNYNPSLX.sub.aaSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARVYG VH
YDYRDFGWFDPWGQGTLVTVSS 209
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVA Clone V336
VISYDGSTNYNPSLX.sub.aaSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARVYG VH
YDYX.sub.aaDFGWFDPWGQGTLVTVSS 210 SGDKLGDKYAC Clone 7 CDR- L1 211
GGNNIGTKSVH Clone 81 CDR-L1 212 RASQGISSYLA Clone 16 CDR-L1
213 PRRQPQKTIMQ Clone 65 CDR-L1 214 GGNNLGSKNVH Clone V18 CDR-L1
215 TRSSGNIASNFVQ Clone 40 CDR-L1 216 TRSSGSIASNYVQ Clone 350
CDR-L1 217 RASQSINKWLA Clone 20 CDR-L1 218 GGNNIGSTSVH Clone 305
CDR-L1 219 SGSRFNIGSNTVN Clone 366 CDR-L1 220 GGNRIGTKAVH Clone 461
CDR-L1 221 QDSKRPS Clone 7 CDR-L2 222 DESDRPS Clone 81 CDR-L2 223
AASTLQS Clone 16 CDR-L2 224 GKNDRPS Clone 65 CDR-L2 225 DDDNRPS
Clone V18 CDR-L2 226 EDTQRPS Clone 40 CDR-L2 227 EDNQRPS Clone 350
CDR-L2 228 DASTLES Clone 20 CDR-L2 229 DDSDRPS Clone 305 CDR-L2 230
SNNQRPS Clone 366 CDR-L2 231 DDTDRPS Clone 461 CDR-L2 232
QVWDSSSRHVV Clone V18 CDR-L3 233 X.sub.aaAWDSSTVV Clone 7 CDR-L3
234 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDS Clone 7 VL
KRPSGIPERFSGSNSGNTATLTISGTQAMDEADYX.sub.aaX.sub.aaX.sub.aaAWDSSTVVFG
GGTKLTVL 235 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDS
Clone 7 VL
KRPSGIPERFSGSNSGNTATLTISGTQAMDEADYX.sub.aaX.sub.aaQAWDSSTVVFGG
GTKLTVL 236 QSVLTQPPSVSVAPGQTARITCGGNNIGTKSVHWYQQKPGQAPVLVLYDES
Clone 81 VL
DRPSGIPERFSGSX.sub.aaSGNTATLTISRVEAGDEADX.sub.aaLLSGVGX.sub.aaX.sub.aaX.s-
ub.aaX.sub.aaSLC FGSGTKLTVL 237
QSVLTQPPSVSVAPGQTARITCGGNNIGTKSVHWYQQKPGQAPVLVLYDES Clone 81 VL
DRPS GIPERFS GSX.sub.aaSGNTATLTISRVEAGDEADX.sub.aaLLQVWD SS
SDHYVFGS GTKLTVL 238
EIVMTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAAS Clone 16 VL
TLQSGSHQGFSGSGSGTEFTLTISSLQPEDFATYYC 239
QSALTQDPAVSVALGTDSQDHMPRRQPQKTIMQWYQQKPGQAPALVIYGK Clone 65 VL
NDRPSGIPDRFSGSTSGNTASLTITGAQAEDEADYYX.sub.aa 240
VLTQPPSVSVAPGKTARITCGGNNLGSKNVHWYQQKPGQAPVLVIYDDDN Clone V18 VL
RPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSRHVVFGGGT KLTVL 241
QPVLTQPHSVSESPGKTVTISCTRSSGNIASNFVQWYQRRPDGATTNVIYED Clone 40 VL
TQRPSGVSGRFSGSIDRSSNSASLTISGLRAEDEADYYCQSYDGRNLMFGGG TKVTVL 242
QPVLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYED Clone 350 VL
NQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVFGTGT KLTVL 243
NIQMTQSPSSLSASVGDRVTITCRASQSINKWLAWYQQKPGKAPKLLIHDA Clone 20 VL
STLESGVPSRFSGSGSGTEFTLTISSLHPDDSATYYCQQLKSPPAQFGEGTKL EIK 244
NIQMTQSPSSLSASVGDRVTITCRASQSINKWLAWYQQKPGKAPKLLIHDA Clone 20 VL
STLESGVPSRFSGSGSGTEFTLTISSLHPDDSATYYCQQLKSRPLSFGEGTKL EIK 245
QSVLTQPSSVSGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRN Clone 43 VL
NQRPSGVPDRFSGSKSGTSASLGHQWAPGPRMRLIITAAWDDSLSGVVFGG GTKLTVL 246
QSVLTQPPSVSVAPGQTARITCGGNNIGSTSVHWFQQKPGQAPVLVVYDDS Clone 305 VL
DRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDNDSDHRVFGGG TKLTVL 247
QSVLTQPPSVPGTPGQRVTITCSGSRFNIGSNTVNWYQQLPGTAPKLLIYSN Clone 366 VL
NQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGT GTKLTVL 248
QSVLTQPPSVSVAPGQTARITCGGNRIGTKAVHWYQQKSGQAPVLVVRDD Clone 461 VL
TDRPSGSLRDSLAPTLGTX.sub.aaATLTISGVEAGDEADYYQVWDSSSDHRVFGG GTKLTVL
249 QITLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone 7 scFv
IRSKTDGGTTDYAALVKGRFTISRDDSENTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSSSYELTQPPSVSVSPGQTASITCSGDKLGDK
YACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDE
ADYX.sub.aaX.sub.aaX.sub.aaAWDSSTVVFGGGTKLTVL 250
QITLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone 7 scFv
IRSKTDGGTTDYAALVKGRFTISRDDSENTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSSSYELTQPPSVSVSPGQTASITCSGDKLGDK
YACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDE
ADYX.sub.aaX.sub.aaQAWDSSTVVFGGGTKLTVL 251
QITLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone 81 scFv
IKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSSQSVLTQPPSVSVAPGQTARITCGGNNIGTK
SVHWYQQKPGQAPVLVLYDESDRPSGIPERFSGSX.sub.aaSGNTATLTISRVEAGD
EADX.sub.aaLLSGVGX.sub.aaX.sub.aaX.sub.aaX.sub.aaSLCFGSGTKLTVL 252
QITLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR Clone 81 scFv
IKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSSQSVLTQPPSVSVAPGQTARITCGGNNIGTK
SVHWYQQKPGQAPVLVLYDESDRPSGIPERFSGSX.sub.aaSGNTATLTISRVEAGD
EADX.sub.aaLLQVWDSSSDHYVFGSGTKLTVL 253
RSPX.sub.aaRSLGEAX.sub.aaVKPGGSLRLSCAASGFTFSNAWMSGSAQAPGKGLEWV
Clone 16 scFv GRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCA
RDFGRWSYYFDYWSQGTLVTVSSEIVMTQSPSFLSASVGDRVTITCRASQGI
SSYLAWYQQKPGKAPKLLIYAASTLQSGSHQGFSGSGSGTEFTLTISSLQPE DFATYYC 254
QVTLKESGGGLVKPGGSLRLSCAASGFTFQ*RLDEWVRQAPGKGLEWVGR Clone 65 scFv
IKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARD
FGRWSYYFDYWSQGTLVTVSSQSALTQDPAVSVALGTDSQDHMPRRQPQK
TIMQWYQQKPGQAPALVIYGKNDRPSGIPDRFSGSTSGNTASLTITGAQAED EADYYX.sub.aa
255 QVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone V18
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR scFv
DFGRWSYYFDYWGQGTLVTVSSVLTQPPSVSVAPGKTARITCGGNNLGSK
NVHWYQQKPGQAPVLVIYDDDNRPSGIPERFSGSNSGNTATLTISRVEAGD
EADYYCQVWDSSSRHVVFGGGTKLTVL 256
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 40 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLRTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSQPVLTQPHSVSESPGKTVTISCTRSSGNIA
SNFVQWYQRRPDGATTNVIYEDTQRPSGVSGRFSGSIDRSSNSASLTISGLR
AEDEADYYCQSYDGRNLMFGGGTKVTVL 257
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 40 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLRTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSQPVLTQPHSVSESPGKTVTISCTRSSGNIA
SNFVQWYQRRPDGATTNVIYEDTQRPSGVSGRFSGSIDRSSNSASLTISGLR
AEDEADYYCQSYDGRNLMFGGGTKVTVL 258
EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone 350
ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS scFv
NYEYYFDYWAQGTLVTVSSQPVLTQPHSVSESPGKTVTISCTRSSGSIASNY
VQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDE
ADYYCQSYDSSNHVFGTGTKLTVL 259
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 20 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSNIQMTQSPSSLSASVGDRVTITCRASQSIN
KWLAWYQQKPGKAPKLLIHDASTLESGVPSRFSGSGSGTEFTLTISSLHPDD
SATYYCQQLKSPPAQFGEGTKLEIK 260
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 20 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSNIQMTQSPSSLSASVGDRVTITCRASQSIN
KWLAWYQQKPGKAPKLLIHDASTLESGVPSRFSGSGSGTEFTLTISSLHPDD
SATYYCQQLKSRPLSFGEGTKLEIK 261
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 20 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSNIQMTQSPSSLSASVGDRVTITCRASQSIN
KWLAWYQQKPGKAPKLLIHDASTLESGVPSRFSGSGSGTEFTLTISSLHPDD
SATYYCQQLKSPPAQFGEGTKLEIK 262
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 20 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSNIQMTQSPSSLSASVGDRVTITCRASQSIN
KWLAWYQQKPGKAPKLLIHDASTLESGVPSRFSGSGSGTEFTLTISSLHPDD
SATYYCQQLKSRPLSFGEGTKLEIK 263
QVTLKESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 43 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSQSVLTQPSSVSGTPGQRVTISCSGSSSNIG
SNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLGHQWAP
GPRMRLIITAAWDDSLSGVVFGGGTKLTVL 264
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVG Clone 43 scFv
RIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
DFGRWSYYFDYWSQGTLVTVSSQSVLTQPSSVSGTPGQRVTISCSGSSSNIG
SNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLGHQWAP
GPRMRLIITAAWDDSLSGVVFGGGTKLTVL 265
EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone 305
ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS scFv
NYEYYFDYWAQGTLVTVSSQSVLTQPPSVSVAPGQTARITCGGNNIGSTSV
HWFQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEA
DYYCQVWDNDSDHRVFGGGTKLTVL 266
EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVSS Clone 366
ISGSGRSTDHADYVKGRFTISRDNSKNTVYLQMNRLRAEDTAVYYCAKVS scFv
NYEYYFDYWAQGTLVTVSSQSVLTQPPSVPGTPGQRVTITCSGSRFNIGSNT
VNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEA
DYYCAAWDDSLNGYVFGTGTKLTVL 267
QVQLVESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGF Clone 461
IRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAKD scFv
FEVREAHLSYFDYWGQGTLVTVSSQSVLTQPPSVSVAPGQTARITCGGNRI
GTKAVHWYQQKSGQAPVLVVRDDTDRPSGSLRDSLAPTLGTX.sub.aaATLTISGV
EAGDEADYYQVWDSSSDHRVFGGGTKLTVL 268
EVQLVESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGF Clone 461
IRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAKD scFv
FEVREAHLSYFDYWGQGTLVTVSSQSVLTQPPSVSVAPGQTARITCGGNRI
GTKAVHWYQQKSGQAPVLVVRDDTDRPSGSLRDSLAPTLGTX.sub.aaATLTISGV
EAGDEADYYQVWDSSSDHRVFGGGTKLTVL 269 GYTFTSY Clone 83, 83B CDR-H1 270
GFTFGDY Clone 298, V70, 350, 305, 366, 461, V68, V102, V181
CDR-H1
271 GFTFSNA Clone 48, V353, 7, 81, 16, V18, 40, 20, 43, V9, V163,
V95, V312, V357, V397 CDR-H1 272 GFTFSTS Clone V71 CDR-H1 273
GFTFSSY Clone V86, V278, V282, V365, V420, V336 CDR-H1 274
GFTFQX.sub.aaR Clone 65 CDR-H1 275 GFTFDTF Clone V128 CDR-H1 276
GFTFINA Clone V224 CDR-H1 277 GLTFSRT Clone V316 CDR-H1 278 GGSFSGY
Clone V331, V345 CDR-H1 279 GGTFSSY Clone V355 CDR-H1 280
GFTFQX.sub.aaRLDE Clone 65 CDR-H1 281 GFTFSTSAMS Clone V71 CDR-H1
282 GFTFSSYAMS Clone 86, V278, V365 CDR-H1 283 GFTFDTFWMS Clone
V128 CDR-H1 284 GFTFINAWMS Clone V224 CDR-H1 285 GLTFSRTWMS Clone
V316 CDR-H1 286 GGSFSGYYWS Clone V331 CDR-H1 287 GGTFSSYAIS Clone
V355 CDR-H1 288 GFTFSSYWMS Clone V282, V420 CDR-H1 289 GGSFSGYYWS
Clone V345 CDR-H1 290 GFTFSSYAMH Clone V336 CDR-H1 291 KSKTDGGT
Clone V353, V48, V81, V16, V65, V18, V40 , V20, V43, 9, 128, V224,
V163, V95, V312, V357, V397 CDR-H2 292 SGSGRS Clone V298, V70,
V350, V305, V366 CDR-H2 293 NPSGGS Clone V83 CDR-H2 294 NPNGGS
Clone V83B CDR-H2 295 RSKTDGGT Clone 7 CDR-H2 296 RSKAYGGT Clone
V68, V102, 461, 181 CDR-H2 297 STDGAT Clone V71 CDR-H2 298 SGSGGS
Clone V86, V278, V365 CDR-H2 299 NDDGSE Clone V316 CDR-H2 300 NHSGS
Clone V331, V345 CDR-H2 301 IPIFGT Clone V355 CDR-H2 302 KQDGSE
Clone V282 , V420 CDR-H2 303 SYDGS Clone V336 CDR-H2 304
RIKSKTDGGTTD Clone V353, V48, V81, V16, V65, V18, V40, V20, V43, 9,
128, V224, V163, V95, V312, V357, V397 CDR-H2 305 SISGSGRSTD Clone
298, V70, V350, V305, V366 CDR-H2 306 IINPSGGSTS Clone V83 CDR-H2
307 IINPNGGSTS Clone V83B CDR-H2 308 RIRSKTDGGTTD Clone 7 CDR-H2
309 FIRSKAYGGTTE Clone V68, V102, V181, 461 CDR-H2 310 TISTDGATTW
Clone V71 CDR-H2 311 AISGSGGSTY Clone V86, V278, V365 CDR-H2 312
SINDDGSEKY Clone V316 CDR-H2 313 KINHSGSTN Clone V331 CDR-H2 314
GIIPIFGTAN Clone V355 CDR-H2 315 NIKQDGSEKY Clone V282, V420 CDR-H2
316 EINHSGSTN Clone V345 CDR-H2 317 VISYDGSTN Clone V336 CDR-H2 318
RIRSKTDGGTTDYAALVKG Clone 7 CDR-H2
Sequence CWU 1
1
3181720DNAHomo sapiensClone 83 scFv 1caggtccagc ttgtgcagtc
tggggctgag gtgaagaagc ctggggcctc agtgaaggtt 60tcctgcaagg catctggata
caccttcacc agctactata tgcactgggt gcgacaggcc 120cctggacaag
ggcttgagtg gatgggaata atcaacccta gtggtggtag cacaagctac
180gcacagaagt tccagggcag agtcaccatg accagggaca cgtccacgag
cacagtctac 240atggagctga gcagcctgag atctgaggac acggccgtgt
attactgtgc gagagatagc 300agctatgatg cttttgatat ctggggccaa
gggacaatgg tcaccgtctc ctcaggtgga 360ggcggttcag gcggaggtgg
ctctggcggt ggcggatcgg ccatccagtt gacccaatct 420ccttccaccc
tgtctgcatc tgtaggagac agagtcacca tcacttgcca ggcgagtcag
480gacatcagca attatttaaa ttggtatcag cagaaaccag ggaaagcccc
taaactcctg 540atcaacgatg catcctattt ggagacaggg gtcccatcaa
ggttcagtgg aagtggatct 600gggacagatt ttactttaac catcagcagc
ctgcagcctg aagatattgc aacatattac 660tgtcaacagt atgaaagtct
cccgtacact tttggccagg ggaccaagct ggagatcaaa 7202240PRTHomo
sapiensClone 83 scFv 2Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Tyr Met His Trp Val Arg Gln
Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Ile Ile Asn Pro
Ser Gly Gly Ser Thr Ser Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg
Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80 Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Arg Asp Ser Ser Tyr Asp Ala Phe Asp Ile Trp Gly Gln Gly Thr
100 105 110 Met Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser 115 120 125 Gly Gly Gly Gly Ser Ala Ile Gln Leu Thr Gln Ser
Pro Ser Thr Leu 130 135 140 Ser Ala Ser Val Gly Asp Arg Val Thr Ile
Thr Cys Gln Ala Ser Gln145 150 155 160 Asp Ile Ser Asn Tyr Leu Asn
Trp Tyr Gln Gln Lys Pro Gly Lys Ala 165 170 175 Pro Lys Leu Leu Ile
Asn Asp Ala Ser Tyr Leu Glu Thr Gly Val Pro 180 185 190 Ser Arg Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile 195 200 205 Ser
Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr 210 215
220 Glu Ser Leu Pro Tyr Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile
Lys225 230 235 240 3726DNAHomo sapiensClone 298 scFv 3gaggtgcagc
tggtggagtc tgggggaggc ttggtacagc cagggcggtc cctgagactc 60tcctgtacag
cttctggatt cacctttggt gattatgcga tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcaagt attagtggta gtggtcgtag
cacagaccac 180gcagactacg tgaagggccg gttcaccatc tccagagaca
attccaagaa cacggtatat 240ctgcaaatga acaggctgag agccgaggac
acggccgtgt attactgtgc aaaagtcagt 300aactacgagt attactttga
ctactgggcc cagggaaccc tggtcaccgt ctcctcaggt 360ggaggcggtt
caggcggagg tggctctggc ggtggcggat cggaaattgt gctgactcag
420tctccctcgg tgtcagtggc cccaggacag acggccagaa ttacctgtgg
gggaagcaac 480attggatctg agagtgtcaa ctggtaccag tggaagtcgg
gccaggttcc tgtcttggtc 540gtctctgaca ctaccgaccg accctcaggg
atccctgggc gattcactgg cacccggtct 600gggaccacgg ccaccttgac
catcagtggg gtcgaagccg gggatgaggc cgactatcac 660tgtcaggtgt
gggatgacac tggtgatcat cctgtcttcg gcggagggac caagctgacc 720gtccta
7264242PRTHomo sapiensClone 298 scFv 4Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser
Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp His Ala Asp Tyr Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Val
Tyr65 70 75 80 Leu Gln Met Asn Arg Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Val Ser Asn Tyr Glu Tyr Tyr Phe Asp
Tyr Trp Ala Gln Gly 100 105 110 Thr Leu Val Thr Val Ser Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly 115 120 125 Ser Gly Gly Gly Gly Ser Glu
Ile Val Leu Thr Gln Ser Pro Ser Val 130 135 140 Ser Val Ala Pro Gly
Gln Thr Ala Arg Ile Thr Cys Gly Gly Ser Asn145 150 155 160 Ile Gly
Ser Glu Ser Val Asn Trp Tyr Gln Trp Lys Ser Gly Gln Val 165 170 175
Pro Val Leu Val Val Ser Asp Thr Thr Asp Arg Pro Ser Gly Ile Pro 180
185 190 Gly Arg Phe Thr Gly Thr Arg Ser Gly Thr Thr Ala Thr Leu Thr
Ile 195 200 205 Ser Gly Val Glu Ala Gly Asp Glu Ala Asp Tyr His Cys
Gln Val Trp 210 215 220 Asp Asp Thr Gly Asp His Pro Val Phe Gly Gly
Gly Thr Lys Leu Thr225 230 235 240 Val Leu5741DNAHomo sapiensClone
48 scFv 5caggtcacct tgaaggagtc tgggggaggc ttggtaaagc ctggggggtc
ccttagactc 60tcctgtgcag cctctggatt cactttcagt aacgcctgga tgagctgggt
ccgccaggct 120ccagggaagg ggctggagtg ggttggccgt attaaaagca
aaactgatgg tgggacaaca 180gactacgctg cacccgtgaa aggcagattc
accatctcaa gagatgattc aaaaaacacg 240ctgtatctgc aaatgaacag
cctgaaaacc gaggacacag ccgtgtatta ctgtgcgaga 300gatttcggac
gatggagcta ctactttgac tactggagcc agggaaccct ggtcaccgtc
360tcctcaggtg gaggcggttc aggcggaggt ggctctggcg gtggcggatc
gcagtctgtg 420ctgactcagc catcctcagt gtctgggacc cccgggcaga
gggtcaccat ctcttgttct 480ggaagcagct ccaacatcgg aagtaattat
gtatactggt accagcagct cccaggaacg 540gcccccaaac tcctcatcta
taggaataat cagcggccct caggggtccc tgaccgattc 600tctggctcca
agtctggcac ctcagcctcc ctggccatca gtgggctccg gtccgaggat
660gaggctgatt attactgtgc agcatgggat gacagcctga gtggtgtggt
attcggcgga 720gggaccaagc tcaccgtcct a 7416247PRTHomo sapiensClone
48 scFv 6Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro
Gly Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr
Phe Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp
Gly Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln
Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys
Ala Arg Asp Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110
Ser Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly 115
120 125 Gly Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln
Pro 130 135 140 Ser Ser Val Ser Gly Thr Pro Gly Gln Arg Val Thr Ile
Ser Cys Ser145 150 155 160 Gly Ser Ser Ser Asn Ile Gly Ser Asn Tyr
Val Tyr Trp Tyr Gln Gln 165 170 175 Leu Pro Gly Thr Ala Pro Lys Leu
Leu Ile Tyr Arg Asn Asn Gln Arg 180 185 190 Pro Ser Gly Val Pro Asp
Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser 195 200 205 Ala Ser Leu Ala
Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr 210 215 220 Tyr Cys
Ala Ala Trp Asp Asp Ser Leu Ser Gly Val Val Phe Gly Gly225 230 235
240 Gly Thr Lys Leu Thr Val Leu 245 7357DNAHomo sapiensClone V70 VH
7caggtgcagc tgttggagtc tgggggaggc ttggtacagc cagggcggtc cctgagactc
60tcctgtacag cttctggatt cacctttggt gattatgcga tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcaagt attagtggta gtggtcgtag
cacagaccac 180gcagactacg tgaagggccg gttcaccatc tccagagaca
attccaagaa cacggtatat 240ctgcaaatga acaggctgag agccgaggac
acggccgtgt attactgtgc aaaagtcagt 300aactacgagt attactttga
ctactgggcc cagggaaccc tggtcaccgt ctcctca 3578119PRTHomo
sapiensClone V70 VH 8Gln Val Gln Leu Leu Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser
Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Ser Gly
Ser Gly Arg Ser Thr Asp His Ala Asp Tyr Val 50 55 60 Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Val Tyr65 70 75 80 Leu
Gln Met Asn Arg Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Lys Val Ser Asn Tyr Glu Tyr Tyr Phe Asp Tyr Trp Ala Gln Gly
100 105 110 Thr Leu Val Thr Val Ser Ser 115 9366DNAHomo
sapiensClone V353 VH 9caggtcacct tgaaggagtc tgggggaggc ttggtaaagc
ctggggggtc ccttagactc 60tcctgtgcag cctctggatt cactttcagt aacgcctgga
tgagctgggt ccgccaggct 120ccagggaagg ggctggagtg ggttggccgt
attaaaagca aaactgatgg tgggacaaca 180gactacgctg cacccgtgaa
aggcagattc accatctcaa gagatgattc aaaaaacacg 240ctgtatctgc
aaatgaacag cctgaaaacc gaggacacag ccgtgtatta ctgtgcgaga
300gatttcggac gatggggcta ctactttgac tactggagcc agggaaccct
ggtcaccgtc 360tcctca 36610122PRTHomo sapiensClone V353 VH 10Gln Val
Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20
25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp
Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys
Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly
Arg Trp Gly Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu
Val Thr Val Ser Ser 115 120 11720DNAHomo sapiensClone 83B scFv
11caggtccagc ttgtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtt
60tcctgcaagg catctggata caccttcacc agctactata tgcactgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggaata atcaacccta atggtggtag
cacaagctac 180gcacagaagt tccagggcag agtcaccatg accagggaca
cgtccacgag cacagtctac 240atggagctga gcagcctgag atctgaggac
acggccgtgt attactgtgc gagagatagc 300agctatgatg cttttgatat
ctggggccaa gggacaatgg tcaccgtctc ctcaggtgga 360ggcggttcag
gcggaggtgg ctctggcggt ggcggatcgg ccatccagtt gacccaatct
420ccttccaccc tgtctgcatc tgtaggagac agagtcacca tcacttgcca
ggcgagtcag 480gacatcagca attatttaaa ttggtatcag cagaaaccag
ggaaagcccc taaactcctg 540atcaacgatg catcctattt ggagacaggg
gtcccatcaa ggttcagtgg aagtggatct 600gggacagatt ttactttaac
catcagcagc ctgcagcctg aagatattgc aacatattac 660tgtcaacagt
atgaaagtct cccgtacact tttggccagg ggaccaagct ggagatcaaa
72012240PRTHomo sapiensClone 83B scFv 12Gln Val Gln Leu Val Gln Ser
Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Tyr Met His
Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly
Ile Ile Asn Pro Asn Gly Gly Ser Thr Ser Tyr Ala Gln Lys Phe 50 55
60 Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val
Tyr65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Asp Ser Ser Tyr Asp Ala Phe Asp Ile
Trp Gly Gln Gly Thr 100 105 110 Met Val Thr Val Ser Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser 115 120 125 Gly Gly Gly Gly Ser Ala Ile
Gln Leu Thr Gln Ser Pro Ser Thr Leu 130 135 140 Ser Ala Ser Val Gly
Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln145 150 155 160 Asp Ile
Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala 165 170 175
Pro Lys Leu Leu Ile Asn Asp Ala Ser Tyr Leu Glu Thr Gly Val Pro 180
185 190 Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile 195 200 205 Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys
Gln Gln Tyr 210 215 220 Glu Ser Leu Pro Tyr Thr Phe Gly Gln Gly Thr
Lys Leu Glu Ile Lys225 230 235 240 13122PRTHomo sapiensClone 48 VH
13Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn
Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser
Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 14110PRTHomo sapiensClone 48 VL
14Gln Ser Val Leu Thr Gln Pro Ser Ser Val Ser Gly Thr Pro Gly Gln1
5 10 15 Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser
Asn 20 25 30 Tyr Val Tyr Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro
Lys Leu Leu 35 40 45 Ile Tyr Arg Asn Asn Gln Arg Pro Ser Gly Val
Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser
Leu Ala Ile Ser Gly Leu Arg65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr
Tyr Cys Ala Ala Trp Asp Asp Ser Leu 85 90 95 Ser Gly Val Val Phe
Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110 15119PRTHomo
sapiensClone 298 VH 15Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser
Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Ser Gly
Ser Gly Arg Ser Thr Asp His Ala Asp Tyr Val 50 55 60 Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Val Tyr65 70 75 80 Leu
Gln Met Asn Arg Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Lys Val Ser Asn Tyr Glu Tyr Tyr Phe Asp Tyr Trp Ala Gln Gly
100 105 110 Thr Leu Val Thr Val Ser Ser 115 16108PRTHomo
sapiensClone 298 VL 16Glu Ile Val Leu Thr Gln Ser Pro Ser Val Ser
Val Ala Pro Gly Gln1 5 10 15 Thr Ala Arg Ile Thr Cys Gly Gly Ser
Asn Ile Gly Ser Glu Ser Val 20 25 30 Asn Trp Tyr Gln Trp Lys Ser
Gly Gln Val Pro Val Leu Val Val Ser 35 40 45 Asp Thr Thr Asp Arg
Pro Ser Gly Ile Pro Gly Arg Phe Thr Gly Thr 50 55 60 Arg Ser Gly
Thr Thr Ala Thr Leu Thr Ile Ser Gly Val Glu Ala Gly65 70 75 80 Asp
Glu Ala Asp Tyr His Cys Gln Val Trp Asp Asp Thr Gly Asp His 85 90
95 Pro Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
100 105 17118PRTHomo sapiensClone 83 VH 17Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Tyr Met
His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45
Gly Ile Ile Asn Pro Ser Gly Gly Ser Thr Ser Tyr Ala Gln Lys Phe 50
55 60 Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val
Tyr65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Asp Ser Ser Tyr Asp Ala Phe Asp Ile
Trp Gly Gln Gly Thr 100 105 110 Met Val Thr Val Ser Ser 115
18107PRTHomo sapiensClone 83, 83B VL 18Ala Ile Gln Leu Thr Gln Ser
Pro Ser Thr Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr Ile
Thr Cys Gln Ala Ser Gln Asp Ile Ser Asn Tyr 20 25 30 Leu Asn Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Asn
Asp Ala Ser Tyr Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Glu Ser
Leu Pro Tyr 85 90 95 Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys
100 105 19118PRTHomo sapiensClone 83B VH 19Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Tyr Met
His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45
Gly Ile Ile Asn Pro Asn Gly Gly Ser Thr Ser Tyr Ala Gln Lys Phe 50
55 60 Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val
Tyr65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Asp Ser Ser Tyr Asp Ala Phe Asp Ile
Trp Gly Gln Gly Thr 100 105 110 Met Val Thr Val Ser Ser 115
205PRTHomo sapiensClone 83, 83B CDR-H1 20Ser Tyr Tyr Met His1 5
2117PRTHomo sapiensClone 83 CDR-H2 21Ile Ile Asn Pro Ser Gly Gly
Ser Thr Ser Tyr Ala Gln Lys Phe Gln1 5 10 15 Gly229PRTHomo
sapiensClone 83, 83B CDR-H3 22Asp Ser Ser Tyr Asp Ala Phe Asp Ile1
5 2311PRTHomo sapiensClone 83, 83B CDR-L1 23Gln Ala Ser Gln Asp Ile
Ser Asn Tyr Leu Asn1 5 10 247PRTHomo sapiensClone 83, 83B CDR-L2
24Asp Ala Ser Tyr Leu Glu Thr1 5 259PRTHomo sapiensClone 83, 83B
CDR-L3 25Gln Gln Tyr Glu Ser Leu Pro Tyr Thr1 5 2617PRTHomo
sapiensClone 83B CDR-H2 26Ile Ile Asn Pro Asn Gly Gly Ser Thr Ser
Tyr Ala Gln Lys Phe Gln1 5 10 15 Gly275PRTHomo sapiensClone 298,
V70 CDR-H1 27Asp Tyr Ala Met Ser1 5 2817PRTHomo sapiensClone 298,
V70 CDR-H2 28Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp His Ala Asp
Tyr Val Lys1 5 10 15 Gly2910PRTHomo sapiensClone 298, 305, 350,
366, V70 CDR-H3 29Val Ser Asn Tyr Glu Tyr Tyr Phe Asp Tyr1 5 10
3011PRTHomo sapiensClone 298 CDR-L1 30Gly Gly Ser Asn Ile Gly Ser
Glu Ser Val Asn1 5 10 317PRTHomo sapiensClone 298 CDR-L2 31Asp Thr
Thr Asp Arg Pro Ser1 5 3211PRTHomo sapiensClone 298 CDR-L3 32Gln
Val Trp Asp Asp Thr Gly Asp His Pro Val1 5 10 335PRTHomo
sapiensClone 48, V353 CDR-H1 33Asn Ala Trp Met Ser1 5 3419PRTHomo
sapiensClone 48, V353 CDR-H2 34Arg Ile Lys Ser Lys Thr Asp Gly Gly
Thr Thr Asp Tyr Ala Ala Pro1 5 10 15 Val Lys Gly3511PRTHomo
sapiensClones 16, 20, 43, 48, 40, 65, 81, 7, V128, V18 CDR-H3 35Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr1 5 10 3613PRTHomo
sapiensClone 48 CDR-L1 36Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn
Tyr Val Tyr1 5 10 377PRTHomo sapiensClone 48 CDR-L2 37Arg Asn Asn
Gln Arg Pro Ser1 5 3811PRTHomo sapiensClones 43, 48 CDR-L3 38Ala
Ala Trp Asp Asp Ser Leu Ser Gly Val Val1 5 10 3911PRTHomo
sapiensClone 305 CDR-L3 39Gln Val Trp Asp Asn Asp Ser Asp His Arg
Val1 5 10 409PRTHomo sapiensClone 350 CDR-L3 40Gln Ser Tyr Asp Ser
Ser Asn His Val1 5 419PRTHomo sapiensClone 20 CDR-L3 41Gln Gln Leu
Lys Ser Arg Pro Leu Ser1 5 429PRTHomo sapiensClone 16 CDR-L3 42Gln
Gln Leu Asn Ser Tyr Pro Leu Thr1 5 4311PRTHomo sapiensClone 366
CDR-L3 43Ala Ala Trp Asp Asp Ser Leu Asn Gly Tyr Val1 5 10
449PRTHomo sapiensClone 40 CDR-L3 44Gln Ser Tyr Asp Gly Arg Asn Leu
Met1 5 4514PRTHomo sapiensClone 461 CDR-H3 45Asp Phe Glu Val Arg
Glu Ala His Leu Ser Tyr Phe Asp Tyr1 5 10 4611PRTHomo sapiensClone
461 CDR-L3 46Gln Val Trp Asp Ser Ser Ser Asp His Arg Val1 5 10
4711PRTHomo sapiensClone 65 CDR-L3 47Lys Ser Trp Asp Ser Ser Gly
Ser Leu Tyr Val1 5 10 4811PRTHomo sapiensClone 81 CDR-L3 48Gln Val
Trp Asp Ser Ser Ser Asp His Tyr Val1 5 10 499PRTHomo sapiensClone 7
CDR-L3 49Gln Ala Trp Asp Ser Ser Thr Val Val1 5 5010PRTHomo
sapiensClone V420 CDR-H3 50Val Asn Gly Gly Glu Tyr Tyr Phe Asp Tyr1
5 10 5110PRTHomo sapiensClone V282 CDR-H3 51Val Arg Gly Ser Glu Tyr
Tyr Phe Asp Tyr1 5 10 5211PRTHomo sapiensClone V353 CDR-H3 52Asp
Phe Gly Arg Trp Gly Tyr Tyr Phe Asp Tyr1 5 10 5316PRTHomo
sapiensClone V163 CDR-H3 53Gln Gly Asp Ser Ser Ser Trp Tyr Val Glu
Val Tyr Tyr Phe Asp Tyr1 5 10 15 549PRTHomo sapiensClone V355
CDR-H3 54Ile Thr Pro Pro Asp Ala Phe Asp Ile1 5 5514PRTHomo
sapiensClone V224 CDR-H3 55Thr Tyr Ser Ser Ser Trp Tyr Glu Ser Leu
Leu Phe Asp Tyr1 5 10 5615PRTHomo sapiensClone V95 CDR-H3 56Gly Ser
Gly Glu Leu Arg Phe Leu Glu Ser Tyr Tyr Phe Asp Tyr1 5 10 15
5714PRTHomo sapiensClone V316 CDR-H3 57Val Asp Ser Glu Arg Phe Leu
Glu Trp Tyr Tyr Phe Asp Tyr1 5 10 5813PRTHomo sapiensClone V331
CDR-H3 58Gly Gln Ile Ala Ala His Val Trp Gly Trp Phe Asp Pro1 5 10
5914PRTHomo sapiensClone V357 CDR-H3 59Asp Met Val Gly Ala Trp Leu
Val Leu Ser Tyr Phe Asp Tyr1 5 10 6014PRTHomo sapiensClone V397
CDR-H3 60Ala Lys Gly Leu Trp Phe Gly Glu Ser Tyr Tyr Phe Asp Tyr1 5
10 6114PRTHomo sapiensClone V312 CDR-H3 61Thr Ser Arg Gly Arg Phe
Leu Glu Trp Leu Leu Phe Asp Tyr1 5 10 6212PRTHomo sapiensClone V278
CDR-H3 62Glu Arg Ser Arg Trp Gly Asp Asn Trp Phe Asp Pro1 5 10
6311PRTHomo sapiensClone V86 CDR-H3 63Val Ile Phe Gly Val Val Asn
Ile Pro Asp Tyr1 5 10 6411PRTHomo sapiensClone V102 CDR-H3 64Val
Gly Pro Ser Trp Asp Tyr Tyr Phe Asp Tyr1 5 10 6516PRTHomo
sapiensClone V365 CDR-H3 65Gly Ile Gly Tyr Ser Ser Ser Trp Tyr Glu
Ile Trp Thr Phe Asp Tyr1 5 10 15 6614PRTHomo sapiensClone V181
CDR-H3 66Asp Phe Glu Val Arg Glu Ala His Leu Ser Tyr Phe Asp Tyr1 5
10 6714PRTHomo sapiensClone V71 CDR-H3 67Val Leu Arg Ser Gly Phe
Leu Glu Trp Asn Leu Phe Asp Tyr1 5 10 6814PRTHomo sapiensClone V68
CDR-H3 68Asp Phe Glu Val Arg Gly Ala His Leu Ser Tyr Phe Asp Tyr1 5
10 6914PRTHomo sapiensClone V336 CDR-H3 69Val Tyr Gly Tyr Asp Tyr
Arg Asp Phe Gly Trp Phe Asp Pro1 5 10 7014PRTHomo sapiensClone V9
CDR-H3 70Gly Ser Asn Glu Arg Phe Leu Glu Trp Leu Asn Phe Asp Tyr1 5
10 7113PRTHomo sapiensClone V345 CDR-H3 71Gly Pro Leu Arg Pro Gln
Lys Val Leu Pro Phe Gln Ile1 5 10 7212PRTRabbitR12 CDR-H3 72Asp Ser
Tyr Ala Asp Asp Gly Ala Leu Phe Asn Ile1 5 10 739PRTRabbitR12
CDR-L3 73Gly Ala Asp Tyr Ile Gly Gly Tyr Val1 5 746PRTHomo
sapiensClone 83, 83B CDR-H1 74Gly Tyr Thr Phe Thr Ser1 5
7510PRTHomo sapiensClone 83, 83B CDR-H1 75Gly Tyr Thr Phe Thr Ser
Tyr Tyr Met His1 5 10 766PRTHomo sapiensClone 298, V70 CDR-H1 76Gly
Phe Thr Phe Gly Asp1 5 7710PRTHomo sapiensClone 298, V70 CDR-H1
77Gly Phe Thr Phe Gly Asp Tyr Ala Met Ser1 5 10 786PRTHomo
sapiensClone 48, V353 CDR-H1 78Gly Phe Thr Phe Ser Asn1 5
7910PRTHomo sapiensClone 48, V353 CDR-H1 79Gly Phe Thr Phe Ser Asn
Ala Trp Met Ser1 5 10 808PRTHomo sapiensClone 83 CDR-H2 80Ile Ile
Asn Pro Ser Gly Gly Ser1 5 818PRTHomo sapiensClone 298, V70 CDR-H2
81Ser Ile Ser Gly Ser Gly Arg Ser1 5 8210PRTHomo sapiensClone 48,
V353 CDR -H2 82Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr1 5 10
838PRTHomo sapiensClone 83B CDR-H2 83Ile Ile Asn Pro Asn Gly Gly
Ser1 5 84248PRTRabbitR12 scFv 84Gln Glu Gln Leu Val Glu Ser Gly Gly
Arg Leu Val Thr Pro Gly Gly1 5 10 15 Ser Leu Thr Leu Ser Cys Lys
Ala Ser Gly Phe Asp Phe Ser Ala Tyr 20 25 30 Tyr Met Ser Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45 Ala Thr Ile
Tyr Pro Ser Ser Gly Lys Thr Tyr Tyr Ala Thr Trp Val 50 55 60 Asn
Gly Arg Phe Thr Ile Ser Ser Asp Asn Ala Gln Asn Thr Val Asp65 70 75
80 Leu Gln Met Asn Ser Leu Thr Ala Ala Asp Arg Ala Thr Tyr Phe Cys
85 90 95 Ala Arg Asp Ser Tyr Ala Asp Asp Gly Ala Leu Phe Asn Ile
Trp Gly 100 105 110 Pro Gly Thr Leu Val Thr Ile Ser Ser Gly Gly Gly
Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gly Gly Gly Gly Ser Glu Leu
Val Leu Thr Gln Ser Pro 130 135 140 Ser Val Ser Ala Ala Leu Gly Ser
Pro Ala Lys Ile Thr Cys Thr Leu145 150 155 160 Ser Ser Ala His Lys
Thr Asp Thr Ile Asp Trp Tyr Gln Gln Leu Gln 165 170 175 Gly Glu Ala
Pro Arg Tyr Leu Met Gln Val Gln Ser Asp Gly Ser Tyr 180 185 190 Thr
Lys Arg Pro Gly Val Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly 195 200
205 Ala Asp Arg Tyr Leu Ile Ile Pro Ser Val Gln Ala Asp Asp Glu Ala
210 215 220 Asp Tyr Tyr Cys Gly Ala Asp Tyr Ile Gly Gly Tyr Val Phe
Gly Gly225 230 235 240 Gly Thr Gln Leu Thr Val Thr Gly 245
85121PRTRabbitR12 VH 85Gln Glu Gln Leu Val Glu Ser Gly Gly Arg Leu
Val Thr Pro Gly Gly1 5 10 15 Ser Leu Thr Leu Ser Cys Lys Ala Ser
Gly Phe Asp Phe Ser Ala Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45 Ala Thr Ile Tyr Pro
Ser Ser Gly Lys Thr Tyr Tyr Ala Thr Trp Val 50 55 60 Asn Gly Arg
Phe Thr Ile Ser Ser Asp Asn Ala Gln Asn Thr Val Asp65 70 75 80 Leu
Gln Met Asn Ser Leu Thr Ala Ala Asp Arg Ala Thr Tyr Phe Cys 85 90
95 Ala Arg Asp Ser Tyr Ala Asp Asp Gly Ala Leu Phe Asn Ile Trp Gly
100 105 110 Pro Gly Thr Leu Val Thr Ile Ser Ser 115 120
86112PRTRabbitR12 VL 86Glu Leu Val Leu Thr Gln Ser Pro Ser Val Ser
Ala Ala Leu Gly Ser1 5 10 15 Pro Ala Lys Ile Thr Cys Thr Leu Ser
Ser Ala His Lys Thr Asp Thr 20 25 30 Ile Asp Trp Tyr Gln Gln Leu
Gln Gly Glu Ala Pro Arg Tyr Leu Met 35 40 45 Gln Val Gln Ser Asp
Gly Ser Tyr Thr Lys Arg Pro Gly Val Pro Asp 50 55 60 Arg Phe Ser
Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro65 70 75 80 Ser
Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr 85 90
95 Ile Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr Gly
100 105 110 875PRTRabbitR12 CDR-H1 87Ala Tyr Tyr Met Ser1 5
8817PRTRabbitR12 CDR-H2 88Thr Ile Tyr Pro Ser Ser Gly Lys Thr Tyr
Tyr Ala Thr Trp Val Asn1 5 10 15 Gly8912PRTRabbitR12 CDR-L1 89Thr
Leu Ser Ser Ala His Lys Thr Asp Thr Ile Asp1 5 10 907PRTRabbitR12
CDR-L2 90Gly Ser Tyr Thr Lys Arg Pro1 5 9115PRTArtificial
SequenceSynthetic linker 91Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser1 5 10 15 9216PRTHomo sapiensConsensus CDR-H3
92Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa1
5 10 15 9314PRTHomo sapiensConsensus CDR-H3 93Xaa Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Asp Xaa1 5 10 9411PRTHomo
sapiensConsensus CDR-H3 94Xaa Xaa Xaa Xaa Xaa Xaa Tyr Xaa Xaa Asp
Tyr1 5 10 955PRTHomo sapiensConsensus CDR-H1 95Xaa Xaa Xaa Met Xaa1
5 9619PRTHomo sapiensConsensus CDR-H2 96Xaa Ile Xaa Xaa Xaa Xaa Xaa
Gly Xaa Xaa Thr Xaa Xaa Ala Xaa Xaa1 5 10 15 Xaa Xaa Gly975PRTHomo
sapiensConsensus CDR-H1 97Xaa Xaa Xaa Met Ser1 59819PRTHomo
sapiensConsensus CDR-H2 98Xaa Ile Xaa Xaa Xaa Xaa Xaa Gly Xaa Xaa
Thr Xaa Xaa Ala Xaa Xaa1 5 10 15 Xaa Xaa Gly9911PRTHomo
sapiensConsensus CDR-L3 99Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
Xaa1 5 10 10011PRTHomo sapiensConsensus CDR-L3 100Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5 10 10113PRTHomo sapiensConsensus
CDR-L1 101Xaa Xaa Ser Xaa Xaa Xaa Xaa Xaa Ser Xaa Xaa Xaa Xaa1 5 10
1027PRTHomo sapiensConsensus CDR-L2 102Xaa Xaa Xaa Xaa Xaa Xaa Xaa1
5 103908PRTHomo sapiensHuman ROR1, GenBank No. NP_005003.2 103Gln
Glu Thr Glu Leu Ser Val Ser Ala Glu Leu Val Pro Thr Ser Ser1 5 10
15 Trp Asn Ile Ser Ser Glu Leu Asn Lys Asp Ser Tyr Leu Thr Leu Asp
20 25 30 Glu Pro Met Asn Asn Ile Thr Thr Ser Leu Gly Gln Thr Ala
Glu Leu 35 40 45 His Cys Lys Val Ser Gly Asn Pro Pro Pro Thr Ile
Arg Trp Phe Lys 50 55 60 Asn Asp Ala Pro Val Val Gln Glu Pro Arg
Arg Leu Ser Phe Arg Ser65 70 75 80 Thr Ile Tyr Gly Ser Arg Leu Arg
Ile Arg Asn Leu Asp Thr Thr Asp 85 90 95 Thr Gly Tyr Phe Gln Cys
Val Ala Thr Asn Gly Lys Glu Val Val Ser 100 105 110 Ser Thr Gly Val
Leu Phe Val Lys Phe Gly Pro Pro Pro Thr Ala Ser 115 120 125 Pro Gly
Tyr Ser Asp Glu Tyr Glu Glu Asp Gly Phe Cys Gln Pro Tyr 130 135 140
Arg Gly Ile Ala Cys Ala Arg Phe Ile Gly Asn Arg Thr Val Tyr Met145
150
155 160 Glu Ser Leu His Met Gln Gly Glu Ile Glu Asn Gln Ile Thr Ala
Ala 165 170 175 Phe Thr Met Ile Gly Thr Ser Ser His Leu Ser Asp Lys
Cys Ser Gln 180 185 190 Phe Ala Ile Pro Ser Leu Cys His Tyr Ala Phe
Pro Tyr Cys Asp Glu 195 200 205 Thr Ser Ser Val Pro Lys Pro Arg Asp
Leu Cys Arg Asp Glu Cys Glu 210 215 220 Ile Leu Glu Asn Val Leu Cys
Gln Thr Glu Tyr Ile Phe Ala Arg Ser225 230 235 240 Asn Pro Met Ile
Leu Met Arg Leu Lys Leu Pro Asn Cys Glu Asp Leu 245 250 255 Pro Gln
Pro Glu Ser Pro Glu Ala Ala Asn Cys Ile Arg Ile Gly Ile 260 265 270
Pro Met Ala Asp Pro Ile Asn Lys Asn His Lys Cys Tyr Asn Ser Thr 275
280 285 Gly Val Asp Tyr Arg Gly Thr Val Ser Val Thr Lys Ser Gly Arg
Gln 290 295 300 Cys Gln Pro Trp Asn Ser Gln Tyr Pro His Thr His Thr
Phe Thr Ala305 310 315 320 Leu Arg Phe Pro Glu Leu Asn Gly Gly His
Ser Tyr Cys Arg Asn Pro 325 330 335 Gly Asn Gln Lys Glu Ala Pro Trp
Cys Phe Thr Leu Asp Glu Asn Phe 340 345 350 Lys Ser Asp Leu Cys Asp
Ile Pro Ala Cys Asp Ser Lys Asp Ser Lys 355 360 365 Glu Lys Asn Lys
Met Glu Ile Leu Tyr Ile Leu Val Pro Ser Val Ala 370 375 380 Ile Pro
Leu Ala Ile Ala Leu Leu Phe Phe Phe Ile Cys Val Cys Arg385 390 395
400 Asn Asn Gln Lys Ser Ser Ser Ala Pro Val Gln Arg Gln Pro Lys His
405 410 415 Val Arg Gly Gln Asn Val Glu Met Ser Met Leu Asn Ala Tyr
Lys Pro 420 425 430 Lys Ser Lys Ala Lys Glu Leu Pro Leu Ser Ala Val
Arg Phe Met Glu 435 440 445 Glu Leu Gly Glu Cys Ala Phe Gly Lys Ile
Tyr Lys Gly His Leu Tyr 450 455 460 Leu Pro Gly Met Asp His Ala Gln
Leu Val Ala Ile Lys Thr Leu Lys465 470 475 480 Asp Tyr Asn Asn Pro
Gln Gln Trp Thr Glu Phe Gln Gln Glu Ala Ser 485 490 495 Leu Met Ala
Glu Leu His His Pro Asn Ile Val Cys Leu Leu Gly Ala 500 505 510 Val
Thr Gln Glu Gln Pro Val Cys Met Leu Phe Glu Tyr Ile Asn Gln 515 520
525 Gly Asp Leu His Glu Phe Leu Ile Met Arg Ser Pro His Ser Asp Val
530 535 540 Gly Cys Ser Ser Asp Glu Asp Gly Thr Val Lys Ser Ser Leu
Asp His545 550 555 560 Gly Asp Phe Leu His Ile Ala Ile Gln Ile Ala
Ala Gly Met Glu Tyr 565 570 575 Leu Ser Ser His Phe Phe Val His Lys
Asp Leu Ala Ala Arg Asn Ile 580 585 590 Leu Ile Gly Glu Gln Leu His
Val Lys Ile Ser Asp Leu Gly Leu Ser 595 600 605 Arg Glu Ile Tyr Ser
Ala Asp Tyr Tyr Arg Val Gln Ser Lys Ser Leu 610 615 620 Leu Pro Ile
Arg Trp Met Pro Pro Glu Ala Ile Met Tyr Gly Lys Phe625 630 635 640
Ser Ser Asp Ser Asp Ile Trp Ser Phe Gly Val Val Leu Trp Glu Ile 645
650 655 Phe Ser Phe Gly Leu Gln Pro Tyr Tyr Gly Phe Ser Asn Gln Glu
Val 660 665 670 Ile Glu Met Val Arg Lys Arg Gln Leu Leu Pro Cys Ser
Glu Asp Cys 675 680 685 Pro Pro Arg Met Tyr Ser Leu Met Thr Glu Cys
Trp Asn Glu Ile Pro 690 695 700 Ser Arg Arg Pro Arg Phe Lys Asp Ile
His Val Arg Leu Arg Ser Trp705 710 715 720 Glu Gly Leu Ser Ser His
Thr Ser Ser Thr Thr Pro Ser Gly Gly Asn 725 730 735 Ala Thr Thr Gln
Thr Thr Ser Leu Ser Ala Ser Pro Val Ser Asn Leu 740 745 750 Ser Asn
Pro Arg Tyr Pro Asn Tyr Met Phe Pro Ser Gln Gly Ile Thr 755 760 765
Pro Gln Gly Gln Ile Ala Gly Phe Ile Gly Pro Pro Ile Pro Gln Asn 770
775 780 Gln Arg Phe Ile Pro Ile Asn Gly Tyr Pro Ile Pro Pro Gly Tyr
Ala785 790 795 800 Ala Phe Pro Ala Ala His Tyr Gln Pro Thr Gly Pro
Pro Arg Val Ile 805 810 815 Gln His Cys Pro Pro Pro Lys Ser Arg Ser
Pro Ser Ser Ala Ser Gly 820 825 830 Ser Thr Ser Thr Gly His Val Thr
Ser Leu Pro Ser Ser Gly Ser Asn 835 840 845 Gln Glu Ala Asn Ile Pro
Leu Leu Pro His Met Ser Ile Pro Asn His 850 855 860 Pro Gly Gly Met
Gly Ile Thr Val Phe Gly Asn Lys Ser Gln Lys Pro865 870 875 880 Tyr
Lys Ile Asp Ser Lys Gln Ala Ser Leu Leu Gly Asp Ala Asn Ile 885 890
895 His Gly His Thr Glu Ser Met Ile Ser Ala Glu Leu 900 905
104520PRTHomo sapiensROR1 Isoform short 104Gln Glu Thr Glu Leu Ser
Val Ser Ala Glu Leu Val Pro Thr Ser Ser1 5 10 15 Trp Asn Ile Ser
Ser Glu Leu Asn Lys Asp Ser Tyr Leu Thr Leu Asp 20 25 30 Glu Pro
Met Asn Asn Ile Thr Thr Ser Leu Gly Gln Thr Ala Glu Leu 35 40 45
His Cys Lys Val Ser Gly Asn Pro Pro Pro Thr Ile Arg Trp Phe Lys 50
55 60 Asn Asp Ala Pro Val Val Gln Glu Pro Arg Arg Leu Ser Phe Arg
Ser65 70 75 80 Thr Ile Tyr Gly Ser Arg Leu Arg Ile Arg Asn Leu Asp
Thr Thr Asp 85 90 95 Thr Gly Tyr Phe Gln Cys Val Ala Thr Asn Gly
Lys Glu Val Val Ser 100 105 110 Ser Thr Gly Val Leu Phe Val Lys Phe
Gly Pro Pro Pro Thr Ala Ser 115 120 125 Pro Gly Tyr Ser Asp Glu Tyr
Glu Glu Asp Gly Phe Cys Gln Pro Tyr 130 135 140 Arg Gly Ile Ala Cys
Ala Arg Phe Ile Gly Asn Arg Thr Val Tyr Met145 150 155 160 Glu Ser
Leu His Met Gln Gly Glu Ile Glu Asn Gln Ile Thr Ala Ala 165 170 175
Phe Thr Met Ile Gly Thr Ser Ser His Leu Ser Asp Lys Cys Ser Gln 180
185 190 Phe Ala Ile Pro Ser Leu Cys His Tyr Ala Phe Pro Tyr Cys Asp
Glu 195 200 205 Thr Ser Ser Val Pro Lys Pro Arg Asp Leu Cys Arg Asp
Glu Cys Glu 210 215 220 Ile Leu Glu Asn Val Leu Cys Gln Thr Glu Tyr
Ile Phe Ala Arg Ser225 230 235 240 Asn Pro Met Ile Leu Met Arg Leu
Lys Leu Pro Asn Cys Glu Asp Leu 245 250 255 Pro Gln Pro Glu Ser Pro
Glu Ala Ala Asn Cys Ile Arg Ile Gly Ile 260 265 270 Pro Met Ala Asp
Pro Ile Asn Lys Asn His Lys Cys Tyr Asn Ser Thr 275 280 285 Gly Val
Asp Tyr Arg Gly Thr Val Ser Val Thr Lys Ser Gly Arg Gln 290 295 300
Cys Gln Pro Trp Asn Ser Gln Tyr Pro His Thr His Thr Phe Thr Ala305
310 315 320 Leu Arg Phe Pro Glu Leu Asn Gly Gly His Ser Tyr Cys Arg
Asn Pro 325 330 335 Gly Asn Gln Lys Glu Ala Pro Trp Cys Phe Thr Leu
Asp Glu Asn Phe 340 345 350 Lys Ser Asp Leu Cys Asp Ile Pro Ala Cys
Asp Ser Lys Asp Ser Lys 355 360 365 Glu Lys Asn Lys Met Glu Ile Leu
Tyr Ile Leu Val Pro Ser Val Ala 370 375 380 Ile Pro Leu Ala Ile Ala
Leu Leu Phe Phe Phe Ile Cys Val Cys Arg385 390 395 400 Asn Asn Gln
Lys Ser Ser Ser Ala Pro Val Gln Arg Gln Pro Lys His 405 410 415 Val
Arg Gly Gln Asn Val Glu Met Ser Met Leu Asn Ala Tyr Lys Pro 420 425
430 Lys Ser Lys Ala Lys Glu Leu Pro Leu Ser Ala Val Arg Phe Met Glu
435 440 445 Glu Leu Gly Glu Cys Ala Phe Gly Lys Ile Tyr Lys Gly His
Leu Tyr 450 455 460 Leu Pro Gly Met Asp His Ala Gln Leu Val Ala Ile
Lys Thr Leu Lys465 470 475 480 Asp Tyr Asn Asn Pro Gln Gln Trp Thr
Glu Phe Gln Gln Glu Ala Ser 485 490 495 Leu Met Ala Glu Leu His His
Pro Asn Ile Val Cys Leu Leu Gly Ala 500 505 510 Val Thr Gln Glu Gln
Pro Val Cys 515 520 105364PRTHomo sapiensROR1 isoform 3 105Gln Glu
Thr Glu Leu Ser Val Ser Ala Glu Leu Val Pro Thr Ser Ser1 5 10 15
Trp Asn Ile Ser Ser Glu Leu Asn Lys Asp Ser Tyr Leu Thr Leu Asp 20
25 30 Glu Pro Met Asn Asn Ile Thr Thr Ser Leu Gly Gln Thr Ala Glu
Leu 35 40 45 His Cys Lys Val Ser Gly Asn Pro Pro Pro Thr Ile Arg
Trp Phe Lys 50 55 60 Asn Asp Ala Pro Val Val Gln Glu Pro Arg Arg
Leu Ser Phe Arg Ser65 70 75 80 Thr Ile Tyr Gly Ser Arg Leu Arg Ile
Arg Asn Leu Asp Thr Thr Asp 85 90 95 Thr Gly Tyr Phe Gln Cys Val
Ala Thr Asn Gly Lys Glu Val Val Ser 100 105 110 Ser Thr Gly Val Leu
Phe Val Lys Phe Gly Pro Pro Pro Thr Ala Ser 115 120 125 Pro Gly Tyr
Ser Asp Glu Tyr Glu Glu Asp Gly Phe Cys Gln Pro Tyr 130 135 140 Arg
Gly Ile Ala Cys Ala Arg Phe Ile Gly Asn Arg Thr Val Tyr Met145 150
155 160 Glu Ser Leu His Met Gln Gly Glu Ile Glu Asn Gln Ile Thr Ala
Ala 165 170 175 Phe Thr Met Ile Gly Thr Ser Ser His Leu Ser Asp Lys
Cys Ser Gln 180 185 190 Phe Ala Ile Pro Ser Leu Cys His Tyr Ala Phe
Pro Tyr Cys Asp Glu 195 200 205 Thr Ser Ser Val Pro Lys Pro Arg Asp
Leu Cys Arg Asp Glu Cys Glu 210 215 220 Ile Leu Glu Asn Val Leu Cys
Gln Thr Glu Tyr Ile Phe Ala Arg Ser225 230 235 240 Asn Pro Met Ile
Leu Met Arg Leu Lys Leu Pro Asn Cys Glu Asp Leu 245 250 255 Pro Gln
Pro Glu Ser Pro Glu Ala Ala Asn Cys Ile Arg Ile Gly Ile 260 265 270
Pro Met Ala Asp Pro Ile Asn Lys Asn His Lys Cys Tyr Asn Ser Thr 275
280 285 Gly Val Asp Tyr Arg Gly Thr Val Ser Val Thr Lys Ser Gly Arg
Gln 290 295 300 Cys Gln Pro Trp Asn Ser Gln Tyr Pro His Thr His Thr
Phe Thr Ala305 310 315 320 Leu Arg Phe Pro Glu Leu Asn Gly Gly His
Ser Tyr Cys Arg Asn Pro 325 330 335 Gly Asn Gln Lys Glu Ala Pro Trp
Cys Phe Thr Leu Asp Glu Asn Phe 340 345 350 Lys Ser Asp Leu Cys Asp
Ile Pro Ala Cys Gly Lys 355 360 106908PRTMus musculusMouse ROR1,
GenBank No. NP_038873 106Gln Glu Thr Glu Leu Ser Val Ser Ala Glu
Leu Val Pro Thr Ser Ser1 5 10 15 Trp Asn Thr Ser Ser Glu Ile Asp
Lys Gly Ser Tyr Leu Thr Leu Asp 20 25 30 Glu Pro Met Asn Asn Ile
Thr Thr Ser Leu Gly Gln Thr Ala Glu Leu 35 40 45 His Cys Lys Val
Ser Gly Asn Pro Pro Pro Ser Ile Arg Trp Phe Lys 50 55 60 Asn Asp
Ala Pro Val Val Gln Glu Pro Arg Arg Ile Ser Phe Arg Ala65 70 75 80
Thr Asn Tyr Gly Ser Arg Leu Arg Ile Arg Asn Leu Asp Thr Thr Asp 85
90 95 Thr Gly Tyr Phe Gln Cys Val Ala Thr Asn Gly Lys Lys Val Val
Ser 100 105 110 Thr Thr Gly Val Leu Phe Val Lys Phe Gly Pro Pro Pro
Thr Ala Ser 115 120 125 Pro Gly Ser Ser Asp Glu Tyr Glu Glu Asp Gly
Phe Cys Gln Pro Tyr 130 135 140 Arg Gly Ile Ala Cys Ala Arg Phe Ile
Gly Asn Arg Thr Val Tyr Met145 150 155 160 Glu Ser Leu His Met Gln
Gly Glu Ile Glu Asn Gln Ile Thr Ala Ala 165 170 175 Phe Thr Met Ile
Gly Thr Ser Ser His Leu Ser Asp Lys Cys Ser Gln 180 185 190 Phe Ala
Ile Pro Ser Leu Cys His Tyr Ala Phe Pro Tyr Cys Asp Glu 195 200 205
Thr Ser Ser Val Pro Lys Pro Arg Asp Leu Cys Arg Asp Glu Cys Glu 210
215 220 Val Leu Glu Asn Val Leu Cys Gln Thr Glu Tyr Ile Phe Ala Arg
Ser225 230 235 240 Asn Pro Met Ile Leu Met Arg Leu Lys Leu Pro Asn
Cys Glu Asp Leu 245 250 255 Pro Gln Pro Glu Ser Pro Glu Ala Ala Asn
Cys Ile Arg Ile Gly Ile 260 265 270 Pro Met Ala Asp Pro Ile Asn Lys
Asn His Lys Cys Tyr Asn Ser Thr 275 280 285 Gly Val Asp Tyr Arg Gly
Thr Val Ser Val Thr Lys Ser Gly Arg Gln 290 295 300 Cys Gln Pro Trp
Asn Ser Gln Tyr Pro His Thr His Ser Phe Thr Ala305 310 315 320 Leu
Arg Phe Pro Glu Leu Asn Gly Gly His Ser Tyr Cys Arg Asn Pro 325 330
335 Gly Asn Gln Lys Glu Ala Pro Trp Cys Phe Thr Leu Asp Glu Asn Phe
340 345 350 Lys Ser Asp Leu Cys Asp Ile Pro Ala Cys Asp Ser Lys Asp
Ser Lys 355 360 365 Glu Lys Asn Lys Met Glu Ile Leu Tyr Ile Leu Val
Pro Ser Val Ala 370 375 380 Ile Pro Leu Ala Ile Ala Phe Leu Phe Phe
Phe Ile Cys Val Cys Arg385 390 395 400 Asn Asn Gln Lys Ser Ser Ser
Pro Pro Val Gln Arg Gln Pro Lys Pro 405 410 415 Val Arg Gly Gln Asn
Val Glu Met Ser Met Leu Asn Ala Tyr Lys Pro 420 425 430 Lys Ser Lys
Ala Lys Glu Leu Pro Leu Ser Ala Val Arg Phe Met Glu 435 440 445 Glu
Leu Gly Glu Cys Thr Phe Gly Lys Ile Tyr Lys Gly His Leu Tyr 450 455
460 Leu Pro Gly Met Asp His Ala Gln Leu Val Ala Ile Lys Thr Leu
Lys465 470 475 480 Asp Tyr Asn Asn Pro Gln Gln Trp Thr Glu Phe Gln
Gln Glu Ala Ser 485 490 495 Leu Met Ala Glu Leu His His Pro Asn Ile
Val Cys Leu Leu Gly Ala 500 505 510 Val Thr Gln Glu Gln Pro Val Cys
Met Leu Phe Glu Tyr Met Asn Gln 515 520 525 Gly Asp Leu His Glu Phe
Leu Ile Met Arg Ser Pro His Ser Asp Val 530 535 540 Gly Cys Ser Ser
Asp Glu Asp Gly Thr Val Lys Ser Ser Leu Asp His545 550 555 560 Gly
Asp Phe Leu His Ile Ala Ile Gln Ile Ala Ala Gly Met Glu Tyr 565 570
575 Leu Ser Ser His Phe Phe Val His Lys Asp Leu Ala Ala Arg Asn Ile
580 585 590 Leu Ile Gly Glu Gln Leu His Val Lys Ile Ser Asp Leu Gly
Leu Ser 595 600 605 Arg Glu Ile Tyr Ser Ala Asp Tyr Tyr Arg Val Gln
Ser Lys Ser Ser 610 615 620 Leu Pro Ile Arg Trp Met Pro Pro Glu Ala
Ile Met Tyr Gly Lys Phe625 630 635 640 Ser Ser Asp Ser Asp Ile Trp
Ser Phe Gly Val Val Leu Trp Glu Ile 645 650 655 Phe Ser Phe Gly Leu
Gln Pro Tyr Tyr Gly
Phe Ser Asn Gln Glu Val 660 665 670 Ile Glu Met Val Arg Lys Arg Gln
Leu Leu Pro Cys Ser Glu Asp Cys 675 680 685 Pro Pro Arg Met Tyr Ser
Leu Met Thr Glu Cys Trp Asn Glu Ile Pro 690 695 700 Ser Arg Arg Pro
Arg Phe Lys Asp Ile His Val Arg Leu Arg Ser Trp705 710 715 720 Glu
Gly Leu Ser Ser His Thr Ser Ser Thr Thr Pro Ser Gly Gly Asn 725 730
735 Ala Thr Thr Gln Thr Thr Ser Leu Ser Ala Ser Pro Val Ser Asn Leu
740 745 750 Ser Asn Pro Arg Phe Pro Asn Tyr Met Phe Pro Ser Gln Gly
Ile Thr 755 760 765 Pro Gln Gly Gln Ile Ala Gly Phe Ile Gly Pro Ala
Ile Pro Gln Asn 770 775 780 Gln Arg Phe Ile Pro Ile Asn Gly Tyr Pro
Ile Pro Pro Gly Tyr Ala785 790 795 800 Ala Phe Pro Ala Ala His Tyr
Gln Pro Ala Gly Pro Pro Arg Val Ile 805 810 815 Gln His Cys Pro Pro
Pro Lys Ser Arg Ser Pro Ser Ser Ala Ser Gly 820 825 830 Ser Thr Ser
Thr Gly His Val Ala Ser Leu Pro Ser Ser Gly Ser Asn 835 840 845 Gln
Glu Ala Asn Val Pro Leu Leu Pro His Met Ser Ile Pro Asn His 850 855
860 Pro Gly Gly Met Gly Ile Thr Val Phe Gly Asn Lys Ser Gln Lys
Pro865 870 875 880 Tyr Lys Ile Asp Ser Lys Gln Ser Ser Leu Leu Gly
Asp Ser His Ile 885 890 895 His Gly His Thr Glu Ser Met Ile Ser Ala
Glu Val 900 905 10736DNAArtificial SequenceSynthetic 107gaatctaagt
acggaccgcc ctgcccccct tgccct 3610812PRTArtificial SequenceSynthetic
108Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro1 5 10
10910PRTHomo sapiensConsensus CDR-H3 109Xaa Ser Xaa Tyr Xaa Xaa Xaa
Xaa Asp Xaa1 5 10 11010PRTHomo sapiensConsensus CDR-H3 110Val Xaa
Xaa Xaa Glu Tyr Tyr Phe Asp Tyr1 5 10 1115PRTArtificial
SequenceSynthetic 111Gly Gly Gly Gly Ser1 5 1124PRTArtificial
SequenceSynthetic 112Gly Gly Gly Ser1 11318PRTArtificial
SequenceSynthetic 113Gly Ser Thr Ser Gly Ser Gly Lys Pro Gly Ser
Gly Glu Gly Ser Thr1 5 10 15 Lys Gly114118PRTMus musculus2A2 VH
114Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Arg Pro Gly Ala1
5 10 15 Ser Val Thr Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser Asp
Tyr 20 25 30 Glu Met His Trp Val Ile Gln Thr Pro Val His Gly Leu
Glu Trp Ile 35 40 45 Gly Ala Ile Asp Pro Glu Thr Gly Gly Thr Ala
Tyr Asn Gln Lys Phe 50 55 60 Lys Gly Lys Ala Ile Leu Thr Ala Asp
Lys Ser Ser Ser Thr Ala Tyr65 70 75 80 Met Glu Leu Arg Ser Leu Thr
Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Thr Gly Tyr Tyr Asp
Tyr Asp Ser Phe Thr Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr
Val Ser Ala 115 115107PRTMus musculus2A2 VL 115Asp Ile Val Met Thr
Gln Ser Gln Lys Ile Met Ser Thr Thr Val Gly1 5 10 15 Asp Arg Val
Ser Ile Thr Cys Lys Ala Ser Gln Asn Val Asp Ala Ala 20 25 30 Val
Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile 35 40
45 Tyr Ser Ala Ser Asn Arg Tyr Thr Gly Val Pro Asp Arg Phe Thr Gly
50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Met
Gln Ser65 70 75 80 Glu Asp Leu Ala Asp Tyr Phe Cys Gln Gln Tyr Asp
Ile Tyr Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile
Lys 100 105 1165PRTMus musculus2A2 CDR-H1 116Asp Tyr Glu Met His1 5
11717PRTMus musculus2A2 CDR-H2 117Ala Ile Asp Pro Glu Thr Gly Gly
Thr Ala Tyr Asn Gln Lys Phe Lys1 5 10 15 Gly1189PRTMus musculus2A2
CDR-H3 118Tyr Tyr Asp Tyr Asp Ser Phe Thr Tyr1 5 11911PRTMus
musculus2A2 CDR-L1 119Lys Ala Ser Gln Asn Val Asp Ala Ala Val Ala1
5 10 1207PRTMus musculus2A2 CDR-L2 120Ser Ala Ser Asn Arg Tyr Thr1
5 1219PRTMus musculus2A2 CDR-L3 121Gln Gln Tyr Asp Ile Tyr Pro Tyr
Thr1 5 122116PRTArtificial SequenceSynthetic 122Gln Val Gln Leu Gln
Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15 Thr Leu Ser
Leu Thr Cys Thr Val Ser Gly Tyr Ala Phe Thr Ala Tyr 20 25 30 Asn
Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45 Gly Ser Phe Asp Pro Tyr Asp Gly Gly Ser Ser Tyr Asn Gln Lys Phe
50 55 60 Lys Asp Arg Leu Thr Ile Ser Lys Asp Thr Ser Lys Asn Gln
Val Val65 70 75 80 Leu Thr Met Thr Asn Met Asp Pro Val Asp Thr Ala
Thr Tyr Tyr Cys 85 90 95 Ala Arg Gly Trp Tyr Tyr Phe Asp Tyr Trp
Gly His Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115
123116PRTArtificial SequenceSynthetic 123Gln Val Gln Leu Gln Glu
Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15 Thr Leu Ser Leu
Thr Cys Thr Val Ser Gly Tyr Ala Phe Thr Ala Tyr 20 25 30 Asn Ile
His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45
Gly Ser Phe Asp Pro Tyr Asp Gly Gly Ser Ser Tyr Asn Gln Lys Phe 50
55 60 Lys Asp Arg Leu Thr Ile Ser Lys Asp Thr Ser Lys Asn Gln Val
Val65 70 75 80 Leu Thr Met Thr Asn Met Asp Pro Val Asp Thr Ala Thr
Tyr Tyr Cys 85 90 95 Ala Arg Gly Trp Tyr Tyr Phe Asp Tyr Trp Gly
His Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115
124116PRTArtificial SequenceSynthetic 124Gln Val Gln Leu Gln Glu
Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15 Thr Leu Ser Leu
Thr Cys Thr Val Ser Gly Tyr Ala Phe Thr Ala Tyr 20 25 30 Asn Ile
His Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45
Gly Ser Phe Asp Pro Tyr Asp Gly Gly Ser Ser Tyr Asn Gln Lys Phe 50
55 60 Lys Asp Arg Leu Thr Ile Ser Lys Asp Thr Ser Lys Asn Gln Val
Val65 70 75 80 Leu Thr Met Thr Asn Met Asp Pro Val Asp Thr Ala Thr
Tyr Tyr Cys 85 90 95 Ala Arg Gly Trp Tyr Tyr Phe Asp Tyr Trp Gly
His Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115
125116PRTArtificial SequenceSynthetic 125Gln Val Gln Leu Gln Glu
Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15 Thr Leu Ser Leu
Thr Cys Thr Val Ser Gly Tyr Ala Phe Thr Ala Tyr 20 25 30 Asn Ile
His Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45
Gly Ser Phe Asp Pro Tyr Asp Gly Gly Ser Ser Tyr Asn Gln Lys Phe 50
55 60 Lys Asp Arg Leu Thr Ile Ser Lys Asp Thr Ser Lys Asn Gln Val
Val65 70 75 80 Leu Thr Met Thr Asn Met Asp Pro Val Asp Thr Ala Thr
Tyr Tyr Cys 85 90 95 Ala Arg Gly Trp Tyr Tyr Phe Asp Tyr Trp Gly
His Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115
126107PRTArtificial SequenceSynthetic 126Asp Ile Val Met Thr Gln
Thr Pro Leu Ser Leu Pro Val Thr Pro Gly1 5 10 15 Glu Pro Ala Ser
Ile Ser Cys Arg Ala Ser Lys Ser Ile Ser Lys Tyr 20 25 30 Leu Ala
Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45
Tyr Ser Gly Ser Thr Leu Gln Ser Gly Ile Pro Pro Arg Phe Ser Gly 50
55 60 Ser Gly Tyr Gly Thr Asp Phe Thr Leu Thr Ile Asn Asn Ile Glu
Ser65 70 75 80 Glu Asp Ala Ala Tyr Tyr Phe Cys Gln Gln His Asp Glu
Ser Pro Tyr 85 90 95 Thr Phe Gly Glu Gly Thr Lys Val Glu Ile Lys
100 105 127107PRTArtificial SequenceSynthetic 127Asp Val Val Met
Thr Gln Ser Pro Leu Ser Leu Pro Val Thr Leu Gly1 5 10 15 Gln Pro
Ala Ser Ile Ser Cys Arg Ala Ser Lys Ser Ile Ser Lys Tyr 20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr Ser Gly Ser Thr Leu Gln Ser Gly Ile Pro Pro Arg Phe Ser
Gly 50 55 60 Ser Gly Tyr Gly Thr Asp Phe Thr Leu Thr Ile Asn Asn
Ile Glu Ser65 70 75 80 Glu Asp Ala Ala Tyr Tyr Phe Cys Gln Gln His
Asp Glu Ser Pro Tyr 85 90 95 Thr Phe Gly Glu Gly Thr Lys Val Glu
Ile Lys 100 105 128107PRTArtificial SequenceSynthetic 128Asp Ile
Val Met Thr Gln Thr Pro Leu Ser Leu Pro Val Thr Pro Gly1 5 10 15
Glu Pro Ala Ser Ile Ser Cys Arg Ala Ser Lys Ser Ile Ser Lys Tyr 20
25 30 Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu
Ile 35 40 45 Tyr Ser Gly Ser Thr Leu Gln Ser Gly Ile Pro Pro Arg
Phe Ser Gly 50 55 60 Ser Gly Tyr Gly Thr Asp Phe Thr Leu Thr Ile
Asn Asn Ile Glu Ser65 70 75 80 Glu Asp Ala Ala Tyr Tyr Phe Cys Gln
Gln His Asp Glu Ser Pro Tyr 85 90 95 Thr Phe Gly Glu Gly Thr Lys
Val Glu Ile Lys 100 105 129107PRTArtificial SequenceSynthetic
129Asp Val Val Met Thr Gln Ser Pro Leu Ser Leu Pro Val Thr Leu Gly1
5 10 15 Gln Pro Ala Ser Ile Ser Cys Arg Ala Ser Lys Ser Ile Ser Lys
Tyr 20 25 30 Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile 35 40 45 Tyr Ser Gly Ser Thr Leu Gln Ser Gly Ile Pro
Pro Arg Phe Ser Gly 50 55 60 Ser Gly Tyr Gly Thr Asp Phe Thr Leu
Thr Ile Asn Asn Ile Glu Ser65 70 75 80 Glu Asp Ala Ala Tyr Tyr Phe
Cys Gln Gln His Asp Glu Ser Pro Tyr 85 90 95 Thr Phe Gly Glu Gly
Thr Lys Val Glu Ile Lys 100 105 13015PRTArtificial
SequenceSynthetic 130Ser Gly Tyr Ala Phe Thr Ala Tyr Asn Ile His
Trp Val Arg Gln1 5 10 15 13118PRTArtificial SequenceSynthetic
131Gly Ser Phe Asp Pro Tyr Asp Gly Gly Ser Ser Tyr Asn Gln Lys Phe1
5 10 15 Lys Asp13223PRTArtificial SequenceSynthetic 132Tyr Tyr Cys
Ala Arg Gly Trp Tyr Tyr Phe Asp Tyr Trp Gly His Gly1 5 10 15 Thr
Leu Val Thr Val Ser Ser 20 1338PRTArtificial SequenceSynthetic
133Gly Tyr Ala Phe Thr Ala Tyr Asn1 5 1348PRTArtificial
SequenceSynthetic 134Phe Asp Pro Tyr Asp Gly Gly Ser1 5
1357PRTArtificial SequenceSynthetic 135Gly Trp Tyr Tyr Phe Asp Tyr1
5 13614PRTArtificial SequenceSynthetic 136Cys Arg Ala Ser Lys Ser
Ile Ser Lys Tyr Leu Ala Trp Tyr1 5 10 13712PRTArtificial
SequenceSynthetic 137Leu Leu Ile Tyr Ser Gly Ser Thr Leu Gln Ser
Gly1 5 10 13816PRTArtificial SequenceSynthetic 138Cys Gln Gln His
Asp Glu Ser Pro Tyr Thr Phe Gly Glu Gly Thr Lys1 5 10 15
1396PRTArtificial SequenceSynthetic 139Lys Ser Ile Ser Lys Tyr1 5
1403PRTArtificial SequenceSynthetic 140Ser Gly Ser1
1418PRTArtificial SequenceSynthetic 141Gln Gln His Asp Glu Ser Pro
Tyr1 5 142119PRTArtificial SequenceSynthetic 142Glu Ser Lys Tyr Gly
Pro Pro Cys Pro Pro Cys Pro Gly Gln Pro Arg1 5 10 15 Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys 20 25 30 Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 35 40
45 Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
50 55 60 Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser65 70 75 80 Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly
Asn Val Phe Ser 85 90 95 Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser 100 105 110 Leu Ser Leu Ser Leu Gly Lys 115
143229PRTArtificial SequenceSynthetic 143Glu Ser Lys Tyr Gly Pro
Pro Cys Pro Pro Cys Pro Ala Pro Glu Phe1 5 10 15 Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 20 25 30 Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 35 40 45
Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val 50
55 60 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn
Ser65 70 75 80 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu 85 90 95 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Gly Leu Pro Ser 100 105 110 Ser Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro 115 120 125 Gln Val Tyr Thr Leu Pro Pro
Ser Gln Glu Glu Met Thr Lys Asn Gln 130 135 140 Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala145 150 155 160 Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 165 170 175
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu 180
185 190 Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys
Ser 195 200 205 Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser 210 215 220 Leu Ser Leu Gly Lys225 144282PRTHomo
sapiensIgD-hinge-Fc 144Arg Trp Pro Glu Ser Pro Lys Ala Gln Ala Ser
Ser Val Pro Thr Ala1 5 10 15 Gln Pro Gln Ala Glu Gly Ser Leu Ala
Lys Ala Thr Thr Ala Pro Ala 20 25 30 Thr Thr Arg Asn Thr Gly Arg
Gly Gly Glu Glu Lys Lys Lys Glu Lys 35 40 45 Glu Lys Glu Glu Gln
Glu Glu Arg Glu Thr Lys Thr Pro Glu Cys Pro 50 55 60 Ser His Thr
Gln Pro Leu Gly Val Tyr Leu Leu Thr Pro Ala Val Gln65 70 75 80 Asp
Leu Trp Leu Arg Asp Lys Ala Thr Phe Thr Cys Phe Val Val Gly 85 90
95 Ser Asp Leu Lys Asp Ala His Leu Thr Trp Glu Val Ala Gly Lys Val
100 105 110 Pro Thr Gly Gly Val Glu Glu Gly Leu Leu Glu Arg His Ser
Asn Gly 115 120 125 Ser Gln Ser Gln His Ser Arg Leu Thr Leu Pro Arg
Ser Leu Trp Asn 130 135 140 Ala Gly Thr Ser Val Thr
Cys Thr Leu Asn His Pro Ser Leu Pro Pro145 150 155 160 Gln Arg Leu
Met Ala Leu Arg Glu Pro Ala Ala Gln Ala Pro Val Lys 165 170 175 Leu
Ser Leu Asn Leu Leu Ala Ser Ser Asp Pro Pro Glu Ala Ala Ser 180 185
190 Trp Leu Leu Cys Glu Val Ser Gly Phe Ser Pro Pro Asn Ile Leu Leu
195 200 205 Met Trp Leu Glu Asp Gln Arg Glu Val Asn Thr Ser Gly Phe
Ala Pro 210 215 220 Ala Arg Pro Pro Pro Gln Pro Gly Ser Thr Thr Phe
Trp Ala Trp Ser225 230 235 240 Val Leu Arg Val Pro Ala Pro Pro Ser
Pro Gln Pro Ala Thr Tyr Thr 245 250 255 Cys Val Val Ser His Glu Asp
Ser Arg Thr Leu Leu Asn Ala Ser Arg 260 265 270 Ser Leu Glu Val Ser
Tyr Val Thr Asp His 275 280 14527PRTHomo sapiensCD28, Accession No.
P10747 145Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr
Ser Leu1 5 10 15 Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val 20 25
14666PRTHomo sapiensCD28, Accession No. P10747 146Ile Glu Val Met
Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn1 5 10 15 Gly Thr
Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu 20 25 30
Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly 35
40 45 Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile
Phe 50 55 60 Trp Val65 14741PRTHomo sapiensCD28, Accession No.
P10747 147Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn
Met Thr1 5 10 15 Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln
Pro Tyr Ala Pro 20 25 30 Pro Arg Asp Phe Ala Ala Tyr Arg Ser 35 40
14841PRTHomo sapiensCD28, LL to GG 148Arg Ser Lys Arg Ser Arg Gly
Gly His Ser Asp Tyr Met Asn Met Thr1 5 10 15 Pro Arg Arg Pro Gly
Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro 20 25 30 Pro Arg Asp
Phe Ala Ala Tyr Arg Ser 35 40 14942PRTHomo sapiens4-1BB, Accession
No. Q07011.1 149Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln
Pro Phe Met1 5 10 15 Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly
Cys Ser Cys Arg Phe 20 25 30 Pro Glu Glu Glu Glu Gly Gly Cys Glu
Leu 35 40 150112PRTHomo sapiensCD3 zeta 150Arg Val Lys Phe Ser Arg
Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly1 5 10 15 Gln Asn Gln Leu
Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr 20 25 30 Asp Val
Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35 40 45
Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys 50
55 60 Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu
Arg65 70 75 80 Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu
Ser Thr Ala 85 90 95 Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln
Ala Leu Pro Pro Arg 100 105 110 151112PRTHomo sapiensCD3 zeta
151Arg Val Lys Phe Ser Arg Ser Ala Glu Pro Pro Ala Tyr Gln Gln Gly1
5 10 15 Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu
Tyr 20 25 30 Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met
Gly Gly Lys 35 40 45 Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr
Asn Glu Leu Gln Lys 50 55 60 Asp Lys Met Ala Glu Ala Tyr Ser Glu
Ile Gly Met Lys Gly Glu Arg65 70 75 80 Arg Arg Gly Lys Gly His Asp
Gly Leu Tyr Gln Gly Leu Ser Thr Ala 85 90 95 Thr Lys Asp Thr Tyr
Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 100 105 110
152112PRTHomo sapiensCD3 zeta 152Arg Val Lys Phe Ser Arg Ser Ala
Asp Ala Pro Ala Tyr Lys Gln Gly1 5 10 15 Gln Asn Gln Leu Tyr Asn
Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr 20 25 30 Asp Val Leu Asp
Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35 40 45 Pro Arg
Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys 50 55 60
Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg65
70 75 80 Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser
Thr Ala 85 90 95 Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala
Leu Pro Pro Arg 100 105 110 15324PRTArtificial SequenceSynthetic
153Leu Glu Gly Gly Gly Glu Gly Arg Gly Ser Leu Leu Thr Cys Gly Asp1
5 10 15 Val Glu Glu Asn Pro Gly Pro Arg 20 154357PRTArtificial
SequenceSynthetic 154Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys
Glu Leu Pro His Pro1 5 10 15 Ala Phe Leu Leu Ile Pro Arg Lys Val
Cys Asn Gly Ile Gly Ile Gly 20 25 30 Glu Phe Lys Asp Ser Leu Ser
Ile Asn Ala Thr Asn Ile Lys His Phe 35 40 45 Lys Asn Cys Thr Ser
Ile Ser Gly Asp Leu His Ile Leu Pro Val Ala 50 55 60 Phe Arg Gly
Asp Ser Phe Thr His Thr Pro Pro Leu Asp Pro Gln Glu65 70 75 80 Leu
Asp Ile Leu Lys Thr Val Lys Glu Ile Thr Gly Phe Leu Leu Ile 85 90
95 Gln Ala Trp Pro Glu Asn Arg Thr Asp Leu His Ala Phe Glu Asn Leu
100 105 110 Glu Ile Ile Arg Gly Arg Thr Lys Gln His Gly Gln Phe Ser
Leu Ala 115 120 125 Val Val Ser Leu Asn Ile Thr Ser Leu Gly Leu Arg
Ser Leu Lys Glu 130 135 140 Ile Ser Asp Gly Asp Val Ile Ile Ser Gly
Asn Lys Asn Leu Cys Tyr145 150 155 160 Ala Asn Thr Ile Asn Trp Lys
Lys Leu Phe Gly Thr Ser Gly Gln Lys 165 170 175 Thr Lys Ile Ile Ser
Asn Arg Gly Glu Asn Ser Cys Lys Ala Thr Gly 180 185 190 Gln Val Cys
His Ala Leu Cys Ser Pro Glu Gly Cys Trp Gly Pro Glu 195 200 205 Pro
Arg Asp Cys Val Ser Cys Arg Asn Val Ser Arg Gly Arg Glu Cys 210 215
220 Val Asp Lys Cys Asn Leu Leu Glu Gly Glu Pro Arg Glu Phe Val
Glu225 230 235 240 Asn Ser Glu Cys Ile Gln Cys His Pro Glu Cys Leu
Pro Gln Ala Met 245 250 255 Asn Ile Thr Cys Thr Gly Arg Gly Pro Asp
Asn Cys Ile Gln Cys Ala 260 265 270 His Tyr Ile Asp Gly Pro His Cys
Val Lys Thr Cys Pro Ala Gly Val 275 280 285 Met Gly Glu Asn Asn Thr
Leu Val Trp Lys Tyr Ala Asp Ala Gly His 290 295 300 Val Cys His Leu
Cys His Pro Asn Cys Thr Tyr Gly Cys Thr Gly Pro305 310 315 320 Gly
Leu Glu Gly Cys Pro Thr Asn Gly Pro Lys Ile Pro Ser Ile Ala 325 330
335 Thr Gly Met Val Gly Ala Leu Leu Leu Leu Leu Val Val Ala Leu Gly
340 345 350 Ile Gly Leu Phe Met 355 1555PRTHomo sapiensClone 65
CDR-H1 155Xaa Arg Leu Asp Glu1 5 1565PRTHomo sapiensClone V128
CDR-H1 156Thr Phe Trp Met Ser1 5 1575PRTHomo sapiensClone V71
CDR-H1 157Thr Ser Ala Met Ser1 5 1585PRTHomo sapiensClone V86,
V278, V365 CDR-H1 158Ser Tyr Ala Met Ser1 5 1595PRTHomo
sapiensClone V316 CDR-H1 159Arg Thr Trp Met Ser1 5 1605PRTHomo
sapiensClone V331, V345 CDR-H1 160Gly Tyr Tyr Trp Ser1 5
1615PRTHomo sapiensClone V355 CDR-H1 161Ser Tyr Ala Ile Ser1 5
1625PRTHomo sapiensClone V420, V282 CDR-H1 162Ser Tyr Trp Met Ser1
5 1635PRTHomo sapiensClone V336 CDR-H1 163Ser Tyr Ala Met His1 5
16419PRTHomo sapiensClone 461, V68, V102, V181 CDR-H2 164Phe Ile
Arg Ser Lys Ala Tyr Gly Gly Thr Thr Glu Tyr Ala Ala Ser1 5 10 15
Val Lys Gly16517PRTHomo sapiensClone V71 CDR-H2 165Thr Ile Ser Thr
Asp Gly Ala Thr Thr Trp Tyr Ala Asp Ser Val Arg1 5 10 15
Gly16617PRTHomo sapiensClone V86, V278, V365 CDR-H2 166Ala Ile Ser
Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15
Gly16717PRTHomo sapiensClone V316 CDR-H2 167Ser Ile Asn Asp Asp Gly
Ser Glu Lys Tyr Tyr Val Asp Ser Val Lys1 5 10 15 Gly16816PRTHomo
sapiensClone V331 CDR-H2 168Lys Ile Asn His Ser Gly Ser Thr Asn Tyr
Asn Pro Ser Leu Lys Ser1 5 10 15 16917PRTHomo sapiensClone V355
CDR-H2 169Gly Ile Ile Pro Ile Phe Gly Thr Ala Asn Tyr Ala Gln Lys
Phe Gln1 5 10 15 Gly17017PRTHomo sapiensClone V282, V420 CDR-H2
170Asn Ile Lys Gln Asp Gly Ser Glu Lys Tyr Tyr Val Asp Ser Val Lys1
5 10 15 Gly17119PRTHomo sapiensClone V397 CDR-H2 171Arg Ile Lys Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala Pro1 5 10 15 Leu Lys
Gly17216PRTHomo sapiensClone V345 CDR-H2 172Glu Ile Asn His Ser Gly
Ser Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10 15 17316PRTHomo
sapiensClone V336 CDR-H2 173Val Ile Ser Tyr Asp Gly Ser Thr Asn Tyr
Asn Pro Ser Leu Xaa Ser1 5 10 15 17414PRTHomo sapiensClone V336
CDR-H3 174Val Tyr Gly Tyr Asp Tyr Xaa Asp Phe Gly Trp Phe Asp Pro1
5 10 175122PRTHomo sapiensClone 7 VH 175Gln Ile Thr Leu Lys Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Arg Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Leu Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Glu Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr
Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser
Ser 115 120 176122PRTHomo sapiensClone 81 VH 176Gln Ile Thr Leu Lys
Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala
50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys
Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp
Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser
Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 177122PRTHomo sapiensClone 16 VH 177Arg Ser Pro Xaa
Arg Ser Leu Gly Glu Ala Xaa Val Lys Pro Gly Gly1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30
Trp Met Ser Gly Ser Ala Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala
Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser
Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu
Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp
Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr
Val Ser Ser 115 120 178122PRTHomo sapiensClone 65 VH 178Gln Val Thr
Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Gln Xaa Arg 20 25
30 Leu Asp Glu Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr
Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp
Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr
Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg
Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 179122PRTHomo sapiensClone V18 VH 179Gln
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala
20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr
Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Asn Ser65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu
Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe
Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Gly Gln Gly Thr
Leu Val Thr Val Ser Ser 115 120 180122PRTHomo sapiensClone 40 VH
180Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn
Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser
Leu Arg Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 181122PRTHomo sapiensClone 40
VH 181Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly
Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys
Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly
Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met
Asn Ser Leu Arg Thr Glu Asp Thr Ala Val Tyr 85
90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr
Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
182119PRTHomo sapiensClone 350, 305, 366 VH 182Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg
Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45 Ser Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp His Ala Asp Tyr Val
50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr
Val Tyr65 70 75 80 Leu Gln Met Asn Arg Leu Arg Ala Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Ala Lys Val Ser Asn Tyr Glu Tyr Tyr Phe
Asp Tyr Trp Ala Gln Gly 100 105 110 Thr Leu Val Thr Val Ser Ser 115
183122PRTHomo sapiensClone 20, 43 VH 183Gln Val Thr Leu Lys Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr
Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser
Ser 115 120 184122PRTHomo sapiensClone 20, 43 VH 184Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30
Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala
Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser
Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu
Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp
Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr
Val Ser Ser 115 120 185125PRTHomo sapiensClone 461 VH 185Gln Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Arg1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20
25 30 Ala Met Ser Trp Phe Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Gly Phe Ile Arg Ser Lys Ala Tyr Gly Gly Thr Thr Glu
Tyr Ala Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asp Ser Lys Ser Ile65 70 75 80 Ala Tyr Leu Gln Met Asn Ser Leu Lys
Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Lys Asp Phe Glu
Val Arg Glu Ala His Leu Ser Tyr Phe 100 105 110 Asp Tyr Trp Gly Gln
Gly Thr Leu Val Thr Val Ser Ser 115 120 125 186125PRTHomo
sapiensClone 461 VH 186Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser
Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser Trp Phe Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Phe Ile Arg Ser
Lys Ala Tyr Gly Gly Thr Thr Glu Tyr Ala Ala 50 55 60 Ser Val Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Ser Ile65 70 75 80 Ala
Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90
95 Tyr Cys Ala Lys Asp Phe Glu Val Arg Glu Ala His Leu Ser Tyr Phe
100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115
120 125 187125PRTHomo sapiensClone V9 VH 187Gln Val Thr Leu Lys Glu
Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met
Ser Trp Val Arg Gln Ala Pro Gly Lys Glu Leu Glu Trp Val 35 40 45
Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50
55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Lys
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Gly Ser Asn Glu Arg Phe Leu
Glu Trp Leu Asn Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 125 188122PRTHomo sapiensClone V128 VH
188Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Val Val Gln Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Thr
Phe 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser
Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 189125PRTHomo sapiensClone V68
VH 189Gln Ile Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly
Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe
Gly Asp Tyr 20 25 30 Ala Met Ser Trp Phe Arg Gln Ala Pro Gly Lys
Gly Leu Glu Trp Val 35 40 45 Gly Phe Ile Arg Ser Lys Ala Tyr Gly
Gly Thr Thr Glu Tyr Ala Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asp Ser Lys Ser Ile65 70 75 80 Ala Tyr Leu Gln Met
Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala
Lys Asp Phe Glu Val Arg Gly Ala His Leu Ser Tyr Phe 100 105 110 Asp
Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125
190123PRTHomo sapiensClone V71 VH 190Gln Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Thr Ser 20 25 30 Ala Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Thr Ile Ser Thr Asp Gly Ala Thr Thr Trp Tyr Ala Asp Ser Val 50 55
60 Arg Gly Arg Phe Ser Val Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80 Leu Gln Met Thr Gly Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Val Leu Arg Ser Gly Phe Leu Glu Trp
Asn Leu Phe Asp Tyr 100 105 110 Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 191120PRTHomo sapiensClone V86 VH 191Gln Val Gln
Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15 Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25
30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45 Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp
Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Val Ile Phe Gly Val Val
Asn Ile Pro Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Leu Val Thr Val
Ser Ser 115 120 192125PRTHomo sapiensClone V224 VH 192Gln Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ile Asn Ala 20 25
30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr
Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp
Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr
Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Thr Tyr Ser Ser
Ser Trp Tyr Glu Ser Leu Leu Phe 100 105 110 Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 125 193127PRTHomo sapiensClone
V163 VH 193Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro
Gly Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr
Phe Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp
Gly Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln
Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys
Ala Arg Gln Gly Asp Ser Ser Ser Trp Tyr Val Glu Val Tyr 100 105 110
Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
125 194126PRTHomo sapiensClone V95 VH 194Gln Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met
Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45
Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50
55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Lys
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Gly Ser Gly Glu Leu Arg Phe
Leu Glu Ser Tyr Tyr 100 105 110 Phe Asp Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser 115 120 125 195122PRTHomo sapiensClone V102 VH
195Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1
5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp
Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Phe Ile Arg Ser Lys Ala Tyr Gly Gly Thr
Thr Glu Tyr Ala Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Gln Ser Ile65 70 75 80 Ala Tyr Leu Gln Met Asp Ser
Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Lys Val
Gly Pro Ser Trp Asp Tyr Tyr Phe Asp Tyr Trp 100 105 110 Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 196125PRTHomo sapiensClone V181
VH 196Gln Ile Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly
Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe
Gly Asp Tyr 20 25 30 Ala Met Ser Trp Phe Arg Gln Ala Pro Gly Lys
Gly Leu Glu Trp Val 35 40 45 Gly Phe Ile Arg Ser Lys Ala Tyr Gly
Gly Thr Thr Glu Tyr Ala Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asp Ser Lys Ser Ile65 70 75 80 Ala Tyr Leu Gln Met
Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala
Lys Asp Phe Glu Val Arg Glu Ala His Leu Ser Tyr Phe 100 105 110 Asp
Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125
197125PRTHomo sapiensClone V312 VH 197Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Lys Pro Arg Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Thr Ser Arg Gly Arg Phe Leu
Glu Trp Leu Leu Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 125 198123PRTHomo sapiensClone V316 VH
198Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Leu Thr Phe Ser Arg
Thr 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Ala Ser Ile Asn Asp Asp Gly Ser Glu Lys Tyr
Tyr Val Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Arg Asn Ser Leu Tyr65 70 75 80 Leu Gln Met Asn Arg Leu Arg
Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Val Asp Ser
Glu Arg Phe Leu Glu Trp Tyr Tyr Phe Asp Tyr 100 105 110 Trp Gly Gln
Gly Thr Leu Val Thr Val Ser Ser 115 120 199121PRTHomo sapiensClone
V331 VH 199Gln Val Gln Leu Gln Gln Trp Gly Ala Gly Leu Leu Lys Pro
Ser Glu1 5 10 15 Thr Leu Ser Leu Thr Cys Ala Val Tyr Gly Gly Ser
Phe Ser Gly Tyr 20 25 30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly
Lys Gly Leu Glu Trp Ile 35 40 45 Gly Lys Ile Asn His Ser Gly Ser
Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Ile Ser
Val Asp Thr Ser Lys Asn Gln Phe Ser Leu65 70 75 80 Lys Leu Ser Ser
Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90
95 Arg Gly Gln Ile Ala Ala His Val Trp Gly Trp Phe Asp Pro Trp Gly
100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
200121PRTHomo sapiensClone V278 VH 200Gln Ile Thr Leu Lys Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Ala Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Glu Arg Ser Arg Trp Gly Asp Asn Trp
Phe Asp Pro Trp Gly 100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser
115 120 201118PRTHomo sapiensClone V355 VH 201Glu Val Gln Leu Val
Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15 Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr 20 25 30 Ala
Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45 Gly Gly Ile Ile Pro Ile Phe Gly Thr Ala Asn Tyr Ala Gln Lys Phe
50 55 60 Gln Gly Arg Val Thr Ile Thr Ala Asp Glu Ser Thr Ser Thr
Ala Tyr65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Ala Arg Ile Tyr Pro Pro Asp Ala Phe Asp
Ile Trp Gly Gln Gly Thr 100 105 110 Met Val Thr Val Ser Ser 115
202125PRTHomo sapiensClone V357 VH 202Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Met Val Gly Ala Trp Leu
Val Leu Ser Tyr Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 125 203119PRTHomo sapiensClone V282 VH
203Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Ala Asn Ile Lys Gln Asp Gly Ser Glu Lys Tyr
Tyr Val Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Ser Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg
Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Val Arg Gly
Ser Glu Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly 100 105 110 Thr Leu Val
Thr Val Ser Ser 115 204125PRTHomo sapiensClone V365 VH 204Gln Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20
25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Gly Ile Gly Tyr Ser
Ser Ser Trp Tyr Glu Ile Trp Thr Phe 100 105 110 Asp Tyr Trp Gly Gln
Gly Thr Leu Val Thr Val Ser Ser 115 120 125 205125PRTHomo
sapiensClone V397 VH 205Gln Ile Thr Leu Lys Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Pro Leu Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu
Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90
95 Tyr Cys Ala Arg Ala Lys Gly Leu Trp Phe Gly Glu Ser Tyr Tyr Phe
100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115
120 125 206119PRTHomo sapiensClone V420 VH 206Gln Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15 Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Trp
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45 Ala Asn Ile Lys Gln Asp Gly Ser Glu Lys Tyr Tyr Val Asp Ser Val
50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser
Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95 Ala Arg Val Asn Gly Gly Glu Tyr Tyr Phe
Asp Tyr Trp Gly Gln Gly 100 105 110 Thr Leu Val Thr Val Ser Ser 115
207121PRTHomo sapiensClone V345 VH 207Gln Val Gln Leu Gln Gln Trp
Gly Ala Gly Leu Leu Lys Pro Ser Glu1 5 10 15 Thr Leu Ser Leu Thr
Cys Ala Val Tyr Gly Gly Ser Phe Ser Gly Tyr 20 25 30 Tyr Trp Ser
Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45 Gly
Glu Ile Asn His Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu Lys 50 55
60 Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe Ser
Leu65 70 75 80 Lys Leu Ser Ser Val Thr Ala Glu Asp Thr Ala Val Tyr
Tyr Cys Ala 85 90 95 Arg Gly Pro Leu Arg Pro Gln Lys Val Leu Pro
Phe Gln Ile Gly Ala 100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser
115 120 208122PRTHomo sapiensClone V336 VH 208Gln Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Ala
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45 Ala Val Ile Ser Tyr Asp Gly Ser Thr Asn Tyr Asn Pro Ser Leu Xaa
50 55 60 Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe
Ser Leu65 70 75 80 Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val
Tyr Tyr Cys Ala 85 90 95 Arg Val Tyr Gly Tyr Asp Tyr Arg Asp Phe
Gly Trp Phe Asp Pro Trp 100 105 110 Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 209122PRTHomo sapiensClone V336 VH 209Gln Val Gln
Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15 Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25
30 Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45 Ala Val Ile Ser Tyr Asp Gly Ser Thr Asn Tyr Asn Pro Ser
Leu Xaa 50 55 60 Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn
Gln Phe Ser Leu65 70 75 80 Lys Leu Ser Ser Val Thr Ala Ala Asp Thr
Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Val Tyr Gly Tyr Asp Tyr Xaa
Asp Phe Gly Trp Phe Asp Pro Trp 100 105 110 Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 21011PRTHomo sapiensClone 7 CDR-L1 210Ser
Gly Asp Lys Leu Gly Asp Lys Tyr Ala Cys1 5 10 21111PRTHomo
sapiensClone 81 CDR-L1 211Gly Gly Asn Asn Ile Gly Thr Lys Ser Val
His1 5 10 21211PRTHomo sapiensClone 16 CDR-L1 212Arg Ala Ser Gln
Gly Ile Ser Ser Tyr Leu Ala1 5 10 21311PRTHomo sapiensClone 65
CDR-L1 213Pro Arg Arg Gln Pro Gln Lys Thr Ile Met Gln1 5 10
21411PRTHomo sapiensClone V18 CDR-L1 214Gly Gly Asn Asn Leu Gly Ser
Lys Asn Val His1 5 10 21513PRTHomo sapiensClone 40 CDR-L1 215Thr
Arg Ser Ser Gly Asn Ile Ala Ser Asn Phe Val Gln1 5 10 21613PRTHomo
sapiensClone 350 CDR-L1 216Thr Arg Ser Ser Gly Ser Ile Ala Ser Asn
Tyr Val Gln1 5 10 21711PRTHomo sapiensClone 20 CDR-L1 217Arg Ala
Ser Gln Ser Ile Asn Lys Trp Leu Ala1 5 10 21811PRTHomo sapiensClone
305 CDR-L1 218Gly Gly Asn Asn Ile Gly Ser Thr Ser Val His1 5 10
21913PRTHomo sapiensClone 366 CDR-L1 219Ser Gly Ser Arg Phe Asn Ile
Gly Ser Asn Thr Val Asn1 5 10 22011PRTHomo sapiensClone 461 CDR-L1
220Gly Gly Asn Arg Ile Gly Thr Lys Ala Val His1 5 10 2217PRTHomo
sapiensClone 7 CDR-L2 221Gln Asp Ser Lys Arg Pro Ser1 5 2227PRTHomo
sapiensClone 81 CDR-L2 222Asp Glu Ser Asp Arg Pro Ser1 5
2237PRTHomo sapiensClone 16 CDR-L2 223Ala Ala Ser Thr Leu Gln Ser1
5 2247PRTHomo sapiensClone 65 CDR-L2 224Gly Lys Asn Asp Arg Pro
Ser1 5 2257PRTHomo sapiensClone V18 CDR-L2 225Asp Asp Asp Asn Arg
Pro Ser1 5 2267PRTHomo sapiensClone 40 CDR-L2 226Glu Asp Thr Gln
Arg Pro Ser1 5 2277PRTHomo sapiensClone 350 CDR-L2 227Glu Asp Asn
Gln Arg Pro Ser1 5 2287PRTHomo sapiensClone 20 CDR-L2 228Asp Ala
Ser Thr Leu Glu Ser1 5 2297PRTHomo sapiensClone 305 CDR-L2 229Asp
Asp Ser Asp Arg Pro Ser1 5 2307PRTHomo sapiensClone 366 CDR-L2
230Ser Asn Asn Gln Arg Pro Ser1 5 2317PRTHomo sapiensClone 461
CDR-L2 231Asp Asp Thr Asp Arg Pro Ser1 5 23211PRTHomo sapiensClone
V18 CDR-L3 232Gln Val Trp Asp Ser Ser Ser Arg His Val Val1 5 10
2339PRTHomo sapiensClone 7 CDR-L3 233Xaa Ala Trp Asp Ser Ser Thr
Val Val1 5 234106PRTHomo sapiensClone 7 VL 234Ser Tyr Glu Leu Thr
Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln1 5 10 15 Thr Ala Ser
Ile Thr Cys Ser Gly Asp Lys Leu Gly Asp Lys Tyr Ala 20 25 30 Cys
Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr 35 40
45 Gln Asp Ser Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser
50 55 60 Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln
Ala Met65 70 75 80 Asp Glu Ala Asp Tyr Xaa Xaa Xaa Ala Trp Asp Ser
Ser Thr Val Val 85 90 95 Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
100 105 235106PRTHomo sapiensClone 7 VL 235Ser Tyr Glu Leu Thr Gln
Pro Pro Ser Val Ser Val Ser Pro Gly Gln1 5 10 15 Thr Ala Ser Ile
Thr Cys Ser Gly Asp Lys Leu Gly Asp Lys Tyr Ala 20 25 30 Cys Trp
Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr 35 40 45
Gln Asp Ser Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50
55 60 Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln Ala
Met65 70 75 80 Asp Glu Ala Asp Tyr Xaa Xaa Gln Ala Trp Asp Ser Ser
Thr Val Val 85 90 95 Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100
105 236108PRTHomo sapiensClone 81 VL 236Gln Ser Val Leu Thr Gln Pro
Pro Ser Val Ser Val Ala Pro Gly Gln1 5 10 15 Thr Ala Arg Ile Thr
Cys Gly Gly Asn Asn Ile Gly Thr Lys Ser Val 20 25 30 His Trp Tyr
Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Leu Tyr 35 40 45 Asp
Glu Ser Asp Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55
60 Xaa Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Arg Val Glu Ala
Gly65 70 75 80 Asp Glu Ala Asp Xaa Leu Leu Ser Gly Val Gly Xaa Xaa
Xaa Xaa Ser 85 90 95 Leu Cys Phe Gly Ser Gly Thr Lys Leu Thr Val
Leu 100 105 237108PRTHomo sapiensClone 81 VL 237Gln Ser Val Leu Thr
Gln Pro Pro Ser Val Ser Val Ala Pro Gly Gln1 5 10 15 Thr Ala Arg
Ile Thr Cys Gly Gly Asn Asn Ile Gly Thr Lys Ser Val 20 25 30 His
Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Leu Tyr 35 40
45 Asp Glu Ser Asp Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser
50 55 60 Xaa Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Arg Val Glu
Ala Gly65 70 75 80 Asp Glu Ala Asp Xaa Leu Leu Gln Val Trp Asp Ser
Ser Ser Asp His 85 90 95 Tyr Val Phe Gly Ser Gly Thr Lys Leu Thr
Val Leu 100 105 23888PRTHomo sapiensClone 16 VL 238Glu Ile Val Met
Thr Gln Ser Pro Ser Phe Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Ser Ser Tyr 20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr Ala Ala Ser Thr Leu Gln Ser Gly Ser His Gln Gly Phe Ser
Gly 50 55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys 85
23987PRTHomo sapiensClone 65 VL 239Gln Ser Ala Leu Thr Gln Asp Pro
Ala Val Ser Val Ala Leu Gly Thr1 5 10 15 Asp Ser Gln Asp His Met
Pro Arg Arg Gln Pro Gln Lys Thr Ile Met 20 25 30 Gln Trp Tyr Gln
Gln Lys Pro Gly Gln Ala Pro Ala Leu Val Ile Tyr 35 40 45 Gly Lys
Asn Asp Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser 50 55 60
Thr Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu65
70 75 80 Asp Glu Ala Asp Tyr Tyr Xaa 85 240106PRTHomo sapiensClone
V18 VL 240Val Leu Thr Gln Pro Pro Ser Val Ser Val Ala Pro Gly Lys
Thr Ala1 5 10 15 Arg Ile Thr Cys Gly Gly Asn Asn Leu Gly Ser Lys
Asn Val His Trp 20 25 30 Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val
Leu Val Ile
Tyr Asp Asp 35 40 45 Asp Asn Arg Pro Ser Gly Ile Pro Glu Arg Phe
Ser Gly Ser Asn Ser 50 55 60 Gly Asn Thr Ala Thr Leu Thr Ile Ser
Arg Val Glu Ala Gly Asp Glu65 70 75 80 Ala Asp Tyr Tyr Cys Gln Val
Trp Asp Ser Ser Ser Arg His Val Val 85 90 95 Phe Gly Gly Gly Thr
Lys Leu Thr Val Leu 100 105 241110PRTHomo sapiensClone 40 VL 241Gln
Pro Val Leu Thr Gln Pro His Ser Val Ser Glu Ser Pro Gly Lys1 5 10
15 Thr Val Thr Ile Ser Cys Thr Arg Ser Ser Gly Asn Ile Ala Ser Asn
20 25 30 Phe Val Gln Trp Tyr Gln Arg Arg Pro Asp Gly Ala Thr Thr
Asn Val 35 40 45 Ile Tyr Glu Asp Thr Gln Arg Pro Ser Gly Val Ser
Gly Arg Phe Ser 50 55 60 Gly Ser Ile Asp Arg Ser Ser Asn Ser Ala
Ser Leu Thr Ile Ser Gly65 70 75 80 Leu Arg Ala Glu Asp Glu Ala Asp
Tyr Tyr Cys Gln Ser Tyr Asp Gly 85 90 95 Arg Asn Leu Met Phe Gly
Gly Gly Thr Lys Val Thr Val Leu 100 105 110 242110PRTHomo
sapiensClone 350 VL 242Gln Pro Val Leu Thr Gln Pro His Ser Val Ser
Glu Ser Pro Gly Lys1 5 10 15 Thr Val Thr Ile Ser Cys Thr Arg Ser
Ser Gly Ser Ile Ala Ser Asn 20 25 30 Tyr Val Gln Trp Tyr Gln Gln
Arg Pro Gly Ser Ala Pro Thr Thr Val 35 40 45 Ile Tyr Glu Asp Asn
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Ile
Asp Ser Ser Ser Asn Ser Ala Ser Leu Thr Ile Ser Gly65 70 75 80 Leu
Lys Thr Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser 85 90
95 Ser Asn His Val Phe Gly Thr Gly Thr Lys Leu Thr Val Leu 100 105
110 243107PRTHomo sapiensClone 20 VL 243Asn Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Ser Ile Asn Lys Trp 20 25 30 Leu Ala Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 His
Asp Ala Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu His
Pro65 70 75 80 Asp Asp Ser Ala Thr Tyr Tyr Cys Gln Gln Leu Lys Ser
Pro Pro Ala 85 90 95 Gln Phe Gly Glu Gly Thr Lys Leu Glu Ile Lys
100 105 244107PRTHomo sapiensClone 20 VL 244Asn Ile Gln Met Thr Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser Gln Ser Ile Asn Lys Trp 20 25 30 Leu Ala
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45
His Asp Ala Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50
55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu His
Pro65 70 75 80 Asp Asp Ser Ala Thr Tyr Tyr Cys Gln Gln Leu Lys Ser
Arg Pro Leu 85 90 95 Ser Phe Gly Glu Gly Thr Lys Leu Glu Ile Lys
100 105 245110PRTHomo sapiensClone 43 VL 245Gln Ser Val Leu Thr Gln
Pro Ser Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15 Arg Val Thr Ile
Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Tyr Val
Tyr Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45
Ile Tyr Arg Asn Asn Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50
55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Gly His Gln Trp Ala
Pro65 70 75 80 Gly Pro Arg Met Arg Leu Ile Ile Thr Ala Ala Trp Asp
Asp Ser Leu 85 90 95 Ser Gly Val Val Phe Gly Gly Gly Thr Lys Leu
Thr Val Leu 100 105 110 246108PRTHomo sapiensClone 305 VL 246Gln
Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val Ala Pro Gly Gln1 5 10
15 Thr Ala Arg Ile Thr Cys Gly Gly Asn Asn Ile Gly Ser Thr Ser Val
20 25 30 His Trp Phe Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val
Val Tyr 35 40 45 Asp Asp Ser Asp Arg Pro Ser Gly Ile Pro Glu Arg
Phe Ser Gly Ser 50 55 60 Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile
Ser Arg Val Glu Ala Gly65 70 75 80 Asp Glu Ala Asp Tyr Tyr Cys Gln
Val Trp Asp Asn Asp Ser Asp His 85 90 95 Arg Val Phe Gly Gly Gly
Thr Lys Leu Thr Val Leu 100 105 247110PRTHomo sapiensClone 366 VL
247Gln Ser Val Leu Thr Gln Pro Pro Ser Val Pro Gly Thr Pro Gly Gln1
5 10 15 Arg Val Thr Ile Thr Cys Ser Gly Ser Arg Phe Asn Ile Gly Ser
Asn 20 25 30 Thr Val Asn Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro
Lys Leu Leu 35 40 45 Ile Tyr Ser Asn Asn Gln Arg Pro Ser Gly Val
Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser
Leu Ala Ile Ser Gly Leu Gln65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr
Tyr Cys Ala Ala Trp Asp Asp Ser Leu 85 90 95 Asn Gly Tyr Val Phe
Gly Thr Gly Thr Lys Leu Thr Val Leu 100 105 110 248107PRTHomo
sapiensClone 461 VL 248Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser
Val Ala Pro Gly Gln1 5 10 15 Thr Ala Arg Ile Thr Cys Gly Gly Asn
Arg Ile Gly Thr Lys Ala Val 20 25 30 His Trp Tyr Gln Gln Lys Ser
Gly Gln Ala Pro Val Leu Val Val Arg 35 40 45 Asp Asp Thr Asp Arg
Pro Ser Gly Ser Leu Arg Asp Ser Leu Ala Pro 50 55 60 Thr Leu Gly
Thr Xaa Ala Thr Leu Thr Ile Ser Gly Val Glu Ala Gly65 70 75 80 Asp
Glu Ala Asp Tyr Tyr Gln Val Trp Asp Ser Ser Ser Asp His Arg 85 90
95 Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105
249228PRTHomo sapiensClone 7 scFv 249Gln Ile Thr Leu Lys Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Arg Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Leu Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Glu Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr
Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser
Ser Ser Tyr Glu Leu Thr Gln 115 120 125 Pro Pro Ser Val Ser Val Ser
Pro Gly Gln Thr Ala Ser Ile Thr Cys 130 135 140 Ser Gly Asp Lys Leu
Gly Asp Lys Tyr Ala Cys Trp Tyr Gln Gln Lys145 150 155 160 Pro Gly
Gln Ser Pro Val Leu Val Ile Tyr Gln Asp Ser Lys Arg Pro 165 170 175
Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Asn Ser Gly Asn Thr Ala 180
185 190 Thr Leu Thr Ile Ser Gly Thr Gln Ala Met Asp Glu Ala Asp Tyr
Xaa 195 200 205 Xaa Xaa Ala Trp Asp Ser Ser Thr Val Val Phe Gly Gly
Gly Thr Lys 210 215 220 Leu Thr Val Leu225 250228PRTHomo
sapiensClone 7 scFv 250Gln Ile Thr Leu Lys Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Arg Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Leu Val Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Glu Asn Thr65 70 75 80 Leu
Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90
95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp
100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser Ser Ser Tyr Glu Leu
Thr Gln 115 120 125 Pro Pro Ser Val Ser Val Ser Pro Gly Gln Thr Ala
Ser Ile Thr Cys 130 135 140 Ser Gly Asp Lys Leu Gly Asp Lys Tyr Ala
Cys Trp Tyr Gln Gln Lys145 150 155 160 Pro Gly Gln Ser Pro Val Leu
Val Ile Tyr Gln Asp Ser Lys Arg Pro 165 170 175 Ser Gly Ile Pro Glu
Arg Phe Ser Gly Ser Asn Ser Gly Asn Thr Ala 180 185 190 Thr Leu Thr
Ile Ser Gly Thr Gln Ala Met Asp Glu Ala Asp Tyr Xaa 195 200 205 Xaa
Gln Ala Trp Asp Ser Ser Thr Val Val Phe Gly Gly Gly Thr Lys 210 215
220 Leu Thr Val Leu225 251230PRTHomo sapiensClone 81 scFv 251Gln
Ile Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala
20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr
Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu
Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe
Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr
Leu Val Thr Val Ser Ser Gln Ser Val Leu Thr Gln 115 120 125 Pro Pro
Ser Val Ser Val Ala Pro Gly Gln Thr Ala Arg Ile Thr Cys 130 135 140
Gly Gly Asn Asn Ile Gly Thr Lys Ser Val His Trp Tyr Gln Gln Lys145
150 155 160 Pro Gly Gln Ala Pro Val Leu Val Leu Tyr Asp Glu Ser Asp
Arg Pro 165 170 175 Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Xaa Ser
Gly Asn Thr Ala 180 185 190 Thr Leu Thr Ile Ser Arg Val Glu Ala Gly
Asp Glu Ala Asp Xaa Leu 195 200 205 Leu Ser Gly Val Gly Xaa Xaa Xaa
Xaa Ser Leu Cys Phe Gly Ser Gly 210 215 220 Thr Lys Leu Thr Val
Leu225 230 252230PRTHomo sapiensClone 81 scFv 252Gln Ile Thr Leu
Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30
Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala
Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser
Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu
Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp
Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr
Val Ser Ser Gln Ser Val Leu Thr Gln 115 120 125 Pro Pro Ser Val Ser
Val Ala Pro Gly Gln Thr Ala Arg Ile Thr Cys 130 135 140 Gly Gly Asn
Asn Ile Gly Thr Lys Ser Val His Trp Tyr Gln Gln Lys145 150 155 160
Pro Gly Gln Ala Pro Val Leu Val Leu Tyr Asp Glu Ser Asp Arg Pro 165
170 175 Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser Xaa Ser Gly Asn Thr
Ala 180 185 190 Thr Leu Thr Ile Ser Arg Val Glu Ala Gly Asp Glu Ala
Asp Xaa Leu 195 200 205 Leu Gln Val Trp Asp Ser Ser Ser Asp His Tyr
Val Phe Gly Ser Gly 210 215 220 Thr Lys Leu Thr Val Leu225 230
253210PRTHomo sapiensClone 16 scFv 253Arg Ser Pro Xaa Arg Ser Leu
Gly Glu Ala Xaa Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Gly Ser Ala Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr
Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser
Ser Glu Ile Val Met Thr Gln 115 120 125 Ser Pro Ser Phe Leu Ser Ala
Ser Val Gly Asp Arg Val Thr Ile Thr 130 135 140 Cys Arg Ala Ser Gln
Gly Ile Ser Ser Tyr Leu Ala Trp Tyr Gln Gln145 150 155 160 Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Thr Leu 165 170 175
Gln Ser Gly Ser His Gln Gly Phe Ser Gly Ser Gly Ser Gly Thr Glu 180
185 190 Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr
Tyr 195 200 205 Tyr Cys 210 254209PRTHomo sapiensClone 65 scFv
254Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Gln Xaa
Arg 20 25 30 Leu Asp Glu Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser
Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly
Thr Leu Val Thr Val Ser Ser Gln Ser Ala Leu Thr Gln 115 120 125 Asp
Pro Ala Val Ser Val Ala Leu Gly Thr Asp Ser Gln Asp His Met 130 135
140 Pro Arg Arg Gln Pro Gln Lys Thr Ile Met Gln Trp Tyr Gln Gln
Lys145 150 155 160 Pro Gly Gln Ala Pro Ala Leu Val Ile Tyr Gly Lys
Asn Asp Arg Pro 165 170 175 Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser
Thr Ser Gly Asn Thr Ala
180 185 190 Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp
Tyr Tyr 195 200 205 Xaa255228PRTHomo sapiensClone V18 scFv 255Gln
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala
20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr
Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Asn Ser65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu
Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe
Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Gly Gln Gly Thr
Leu Val Thr Val Ser Ser Val Leu Thr Gln Pro Pro 115 120 125 Ser Val
Ser Val Ala Pro Gly Lys Thr Ala Arg Ile Thr Cys Gly Gly 130 135 140
Asn Asn Leu Gly Ser Lys Asn Val His Trp Tyr Gln Gln Lys Pro Gly145
150 155 160 Gln Ala Pro Val Leu Val Ile Tyr Asp Asp Asp Asn Arg Pro
Ser Gly 165 170 175 Ile Pro Glu Arg Phe Ser Gly Ser Asn Ser Gly Asn
Thr Ala Thr Leu 180 185 190 Thr Ile Ser Arg Val Glu Ala Gly Asp Glu
Ala Asp Tyr Tyr Cys Gln 195 200 205 Val Trp Asp Ser Ser Ser Arg His
Val Val Phe Gly Gly Gly Thr Lys 210 215 220 Leu Thr Val Leu225
256232PRTHomo sapiensClone 40 scFv 256Gln Val Thr Leu Lys Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr
Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser
Ser Gln Pro Val Leu Thr Gln 115 120 125 Pro His Ser Val Ser Glu Ser
Pro Gly Lys Thr Val Thr Ile Ser Cys 130 135 140 Thr Arg Ser Ser Gly
Asn Ile Ala Ser Asn Phe Val Gln Trp Tyr Gln145 150 155 160 Arg Arg
Pro Asp Gly Ala Thr Thr Asn Val Ile Tyr Glu Asp Thr Gln 165 170 175
Arg Pro Ser Gly Val Ser Gly Arg Phe Ser Gly Ser Ile Asp Arg Ser 180
185 190 Ser Asn Ser Ala Ser Leu Thr Ile Ser Gly Leu Arg Ala Glu Asp
Glu 195 200 205 Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Gly Arg Asn Leu
Met Phe Gly 210 215 220 Gly Gly Thr Lys Val Thr Val Leu225 230
257232PRTHomo sapiensClone 40 scFv 257Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55
60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn
Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Thr Glu Asp Thr
Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr
Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser
Ser Gln Pro Val Leu Thr Gln 115 120 125 Pro His Ser Val Ser Glu Ser
Pro Gly Lys Thr Val Thr Ile Ser Cys 130 135 140 Thr Arg Ser Ser Gly
Asn Ile Ala Ser Asn Phe Val Gln Trp Tyr Gln145 150 155 160 Arg Arg
Pro Asp Gly Ala Thr Thr Asn Val Ile Tyr Glu Asp Thr Gln 165 170 175
Arg Pro Ser Gly Val Ser Gly Arg Phe Ser Gly Ser Ile Asp Arg Ser 180
185 190 Ser Asn Ser Ala Ser Leu Thr Ile Ser Gly Leu Arg Ala Glu Asp
Glu 195 200 205 Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Gly Arg Asn Leu
Met Phe Gly 210 215 220 Gly Gly Thr Lys Val Thr Val Leu225 230
258229PRTHomo sapiensClone 350 scFv 258Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser
Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp His Ala Asp Tyr Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Val
Tyr65 70 75 80 Leu Gln Met Asn Arg Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Val Ser Asn Tyr Glu Tyr Tyr Phe Asp
Tyr Trp Ala Gln Gly 100 105 110 Thr Leu Val Thr Val Ser Ser Gln Pro
Val Leu Thr Gln Pro His Ser 115 120 125 Val Ser Glu Ser Pro Gly Lys
Thr Val Thr Ile Ser Cys Thr Arg Ser 130 135 140 Ser Gly Ser Ile Ala
Ser Asn Tyr Val Gln Trp Tyr Gln Gln Arg Pro145 150 155 160 Gly Ser
Ala Pro Thr Thr Val Ile Tyr Glu Asp Asn Gln Arg Pro Ser 165 170 175
Gly Val Pro Asp Arg Phe Ser Gly Ser Ile Asp Ser Ser Ser Asn Ser 180
185 190 Ala Ser Leu Thr Ile Ser Gly Leu Lys Thr Glu Asp Glu Ala Asp
Tyr 195 200 205 Tyr Cys Gln Ser Tyr Asp Ser Ser Asn His Val Phe Gly
Thr Gly Thr 210 215 220 Lys Leu Thr Val Leu225 259229PRTHomo
sapiensClone 20 scFv 259Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu
Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90
95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp
100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser Ser Asn Ile Gln Met
Thr Gln 115 120 125 Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg
Val Thr Ile Thr 130 135 140 Cys Arg Ala Ser Gln Ser Ile Asn Lys Trp
Leu Ala Trp Tyr Gln Gln145 150 155 160 Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile His Asp Ala Ser Thr Leu 165 170 175 Glu Ser Gly Val Pro
Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Glu 180 185 190 Phe Thr Leu
Thr Ile Ser Ser Leu His Pro Asp Asp Ser Ala Thr Tyr 195 200 205 Tyr
Cys Gln Gln Leu Lys Ser Pro Pro Ala Gln Phe Gly Glu Gly Thr 210 215
220 Lys Leu Glu Ile Lys225 260229PRTHomo sapiensClone 20 scFv
260Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn
Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser
Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly
Thr Leu Val Thr Val Ser Ser Asn Ile Gln Met Thr Gln 115 120 125 Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr 130 135
140 Cys Arg Ala Ser Gln Ser Ile Asn Lys Trp Leu Ala Trp Tyr Gln
Gln145 150 155 160 Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile His Asp
Ala Ser Thr Leu 165 170 175 Glu Ser Gly Val Pro Ser Arg Phe Ser Gly
Ser Gly Ser Gly Thr Glu 180 185 190 Phe Thr Leu Thr Ile Ser Ser Leu
His Pro Asp Asp Ser Ala Thr Tyr 195 200 205 Tyr Cys Gln Gln Leu Lys
Ser Arg Pro Leu Ser Phe Gly Glu Gly Thr 210 215 220 Lys Leu Glu Ile
Lys225 261229PRTHomo sapiensClone 20 scFv 261Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala
50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys
Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp
Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser
Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr Leu Val Thr Val
Ser Ser Asn Ile Gln Met Thr Gln 115 120 125 Ser Pro Ser Ser Leu Ser
Ala Ser Val Gly Asp Arg Val Thr Ile Thr 130 135 140 Cys Arg Ala Ser
Gln Ser Ile Asn Lys Trp Leu Ala Trp Tyr Gln Gln145 150 155 160 Lys
Pro Gly Lys Ala Pro Lys Leu Leu Ile His Asp Ala Ser Thr Leu 165 170
175 Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Glu
180 185 190 Phe Thr Leu Thr Ile Ser Ser Leu His Pro Asp Asp Ser Ala
Thr Tyr 195 200 205 Tyr Cys Gln Gln Leu Lys Ser Pro Pro Ala Gln Phe
Gly Glu Gly Thr 210 215 220 Lys Leu Glu Ile Lys225 262229PRTHomo
sapiensClone 20 scFv 262Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ala 20 25 30 Trp Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu
Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90
95 Tyr Cys Ala Arg Asp Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp
100 105 110 Ser Gln Gly Thr Leu Val Thr Val Ser Ser Asn Ile Gln Met
Thr Gln 115 120 125 Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg
Val Thr Ile Thr 130 135 140 Cys Arg Ala Ser Gln Ser Ile Asn Lys Trp
Leu Ala Trp Tyr Gln Gln145 150 155 160 Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile His Asp Ala Ser Thr Leu 165 170 175 Glu Ser Gly Val Pro
Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Glu 180 185 190 Phe Thr Leu
Thr Ile Ser Ser Leu His Pro Asp Asp Ser Ala Thr Tyr 195 200 205 Tyr
Cys Gln Gln Leu Lys Ser Arg Pro Leu Ser Phe Gly Glu Gly Thr 210 215
220 Lys Leu Glu Ile Lys225 263232PRTHomo sapiensClone 43 scFv
263Gln Val Thr Leu Lys Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn
Ala 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser
Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp
Phe Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly
Thr Leu Val Thr Val Ser Ser Gln Ser Val Leu Thr Gln 115 120 125 Pro
Ser Ser Val Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys 130 135
140 Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn Tyr Val Tyr Trp Tyr
Gln145 150 155 160 Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr
Arg Asn Asn Gln 165 170 175 Arg Pro Ser Gly Val Pro Asp Arg Phe Ser
Gly Ser Lys Ser Gly Thr 180 185 190 Ser Ala Ser Leu Gly His Gln Trp
Ala Pro Gly Pro Arg Met Arg Leu 195 200 205 Ile Ile Thr Ala Ala Trp
Asp Asp Ser Leu Ser Gly Val Val Phe Gly 210 215 220 Gly Gly Thr Lys
Leu Thr Val Leu225 230 264232PRTHomo sapiensClone 43 scFv 264Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10
15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala
20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45 Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr
Asp Tyr Ala Ala 50 55 60 Pro Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Asn Thr65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu
Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Phe
Gly Arg Trp Ser Tyr Tyr Phe Asp Tyr Trp 100 105 110 Ser Gln Gly Thr
Leu Val Thr Val Ser Ser Gln Ser Val Leu Thr Gln 115 120 125 Pro Ser
Ser Val Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys 130 135 140
Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn Tyr Val Tyr Trp Tyr Gln145
150 155 160 Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu Ile
Tyr Arg Asn Asn Gln 165 170 175 Arg Pro Ser Gly Val Pro Asp Arg Phe
Ser Gly Ser Lys Ser Gly Thr 180 185 190 Ser Ala Ser Leu Gly His Gln
Trp Ala Pro Gly Pro Arg Met Arg Leu 195 200 205 Ile Ile Thr Ala Ala
Trp Asp Asp Ser Leu Ser Gly Val Val Phe Gly 210 215 220 Gly Gly Thr
Lys Leu Thr Val Leu225 230 265227PRTHomo sapiensClone 305 scFv
265Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1
5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp
Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Ser Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp
His Ala Asp Tyr Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ser Lys Asn Thr Val Tyr65 70 75 80 Leu Gln Met Asn Arg Leu Arg
Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Val Ser Asn
Tyr Glu Tyr Tyr Phe Asp Tyr Trp Ala Gln Gly 100 105 110 Thr Leu Val
Thr Val Ser Ser Gln Ser Val Leu Thr Gln Pro Pro Ser 115 120 125 Val
Ser Val Ala Pro Gly Gln Thr Ala Arg Ile Thr Cys Gly Gly Asn 130 135
140 Asn Ile Gly Ser Thr Ser Val His Trp Phe Gln Gln Lys Pro Gly
Gln145 150 155 160 Ala Pro Val Leu Val Val Tyr Asp Asp Ser Asp Arg
Pro Ser Gly Ile 165 170 175 Pro Glu Arg Phe Ser Gly Ser Asn Ser Gly
Asn Thr Ala Thr Leu Thr 180 185 190 Ile Ser Arg Val Glu Ala Gly Asp
Glu Ala Asp Tyr Tyr Cys Gln Val 195 200 205 Trp Asp Asn Asp Ser Asp
His Arg Val Phe Gly Gly Gly Thr Lys Leu 210 215 220 Thr Val Leu225
266229PRTHomo sapiensClone 366 scFv 266Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser
Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser
Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp His Ala Asp Tyr Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Val
Tyr65 70 75 80 Leu Gln Met Asn Arg Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Lys Val Ser Asn Tyr Glu Tyr Tyr Phe Asp
Tyr Trp Ala Gln Gly 100 105 110 Thr Leu Val Thr Val Ser Ser Gln Ser
Val Leu Thr Gln Pro Pro Ser 115 120 125 Val Pro Gly Thr Pro Gly Gln
Arg Val Thr Ile Thr Cys Ser Gly Ser 130 135 140 Arg Phe Asn Ile Gly
Ser Asn Thr Val Asn Trp Tyr Gln Gln Leu Pro145 150 155 160 Gly Thr
Ala Pro Lys Leu Leu Ile Tyr Ser Asn Asn Gln Arg Pro Ser 165 170 175
Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser 180
185 190 Leu Ala Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr
Cys 195 200 205 Ala Ala Trp Asp Asp Ser Leu Asn Gly Tyr Val Phe Gly
Thr Gly Thr 210 215 220 Lys Leu Thr Val Leu225 267232PRTHomo
sapiensClone 461 scFv 267Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala
Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser Trp Phe Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Phe Ile Arg
Ser Lys Ala Tyr Gly Gly Thr Thr Glu Tyr Ala Ala 50 55 60 Ser Val
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Ser Ile65 70 75 80
Ala Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85
90 95 Tyr Cys Ala Lys Asp Phe Glu Val Arg Glu Ala His Leu Ser Tyr
Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
Gln Ser Val 115 120 125 Leu Thr Gln Pro Pro Ser Val Ser Val Ala Pro
Gly Gln Thr Ala Arg 130 135 140 Ile Thr Cys Gly Gly Asn Arg Ile Gly
Thr Lys Ala Val His Trp Tyr145 150 155 160 Gln Gln Lys Ser Gly Gln
Ala Pro Val Leu Val Val Arg Asp Asp Thr 165 170 175 Asp Arg Pro Ser
Gly Ser Leu Arg Asp Ser Leu Ala Pro Thr Leu Gly 180 185 190 Thr Xaa
Ala Thr Leu Thr Ile Ser Gly Val Glu Ala Gly Asp Glu Ala 195 200 205
Asp Tyr Tyr Gln Val Trp Asp Ser Ser Ser Asp His Arg Val Phe Gly 210
215 220 Gly Gly Thr Lys Leu Thr Val Leu225 230 268232PRTHomo
sapiensClone 461 scFv 268Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala
Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser Trp Phe Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Phe Ile Arg
Ser Lys Ala Tyr Gly Gly Thr Thr Glu Tyr Ala Ala 50 55 60 Ser Val
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Ser Ile65 70 75 80
Ala Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85
90 95 Tyr Cys Ala Lys Asp Phe Glu Val Arg Glu Ala His Leu Ser Tyr
Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
Gln Ser Val 115 120 125 Leu Thr Gln Pro Pro Ser Val Ser Val Ala Pro
Gly Gln Thr Ala Arg 130 135 140 Ile Thr Cys Gly Gly Asn Arg Ile Gly
Thr Lys Ala Val His Trp Tyr145 150 155 160 Gln Gln Lys Ser Gly Gln
Ala Pro Val Leu Val Val Arg Asp Asp Thr 165 170 175 Asp Arg Pro Ser
Gly Ser Leu Arg Asp Ser Leu Ala Pro Thr Leu Gly 180 185 190 Thr Xaa
Ala Thr Leu Thr Ile Ser Gly Val Glu Ala Gly Asp Glu Ala 195 200 205
Asp Tyr Tyr Gln Val Trp Asp Ser Ser Ser Asp His Arg Val Phe Gly 210
215 220 Gly Gly Thr Lys Leu Thr Val Leu225 230 2697PRTHomo
sapiensClone 83, 83B CDR-H1 269Gly Tyr Thr Phe Thr Ser Tyr1 5
2707PRTHomo sapiensClone 298, V70, Clone 350, 305, 366, 461, V68,
V102, V181 CDR-H1 270Gly Phe Thr Phe Gly Asp Tyr1 5 2717PRTHomo
sapiensClone 48, V353, Clone 7, 81, 16, V18, 40, 20, 43, V9, V163,
V95, V312, V357, V397 CDR-H1 271Gly Phe Thr Phe Ser Asn Ala1 5
2727PRTHomo sapiensClone V71 CDR-H1 272Gly Phe Thr Phe Ser Thr Ser1
5 2737PRTHomo sapiensClone V86, V278, V282, V365, V420, V336 CDR-H1
273Gly Phe Thr Phe Ser Ser Tyr1 5 2747PRTHomo sapiensVARIANT6Xaa =
any amino acid 274Gly Phe Thr Phe Gln Xaa Arg1 5 2757PRTHomo
sapiensClone V128 CDR-H1 275Gly Phe Thr Phe Asp Thr Phe1 5
2767PRTHomo sapiensClone V224 CDR-H1 276Gly Phe Thr Phe Ile Asn
Ala1 5 2777PRTHomo sapiensClone V316 CDR-H1 277Gly Leu Thr Phe Ser
Arg Thr1 5 2787PRTHomo sapiensClone V331, V345 CDR-H1 278Gly Gly
Ser Phe Ser Gly Tyr1 5 2797PRTHomo sapiensClone V355 CDR-H1 279Gly
Gly Thr Phe Ser Ser Tyr1 5 28010PRTHomo sapiensClone 65 CDR-H1
280Gly Phe Thr Phe Gln Xaa Arg Leu Asp Glu1 5 10 28110PRTHomo
sapiensClone V71 CDR-H1 281Gly Phe Thr Phe Ser Thr Ser Ala Met Ser1
5 10 28210PRTHomo sapiensClone 86, V278, V365 CDR-H1 282Gly Phe Thr
Phe Ser Ser Tyr Ala Met Ser1 5 10 28310PRTHomo sapiensClone V128
CDR-H1 283Gly Phe Thr Phe Asp Thr Phe Trp Met Ser1 5 10
28410PRTHomo sapiensClone V224 CDR-H1 284Gly Phe Thr Phe Ile Asn
Ala Trp Met Ser1 5 10 28510PRTHomo sapiensClone V316 CDR-H1 285Gly
Leu Thr Phe Ser Arg Thr Trp Met Ser1 5 10 28610PRTHomo sapiensClone
V331 CDR-H1 286Gly Gly Ser Phe Ser Gly Tyr Tyr Trp Ser1 5 10
28710PRTHomo sapiensClone V355 CDR-H1 287Gly Gly Thr Phe Ser Ser
Tyr Ala Ile Ser1 5 10 28810PRTHomo sapiensClone V282, V420 CDR-H1
288Gly Phe Thr Phe Ser Ser Tyr Trp Met Ser1 5 10 28910PRTHomo
sapiensClone V345 CDR-H1 289Gly Gly Ser Phe Ser Gly Tyr Tyr Trp
Ser1 5 10 29010PRTHomo sapiensClone V336 CDR-H1 290Gly Phe Thr Phe
Ser Ser Tyr Ala Met His1 5 10 2918PRTHomo sapiensClone V353 , V48,
V81, V16, V65, V18, V40 , V20, V43, V224, V163, V95, V312, V357,
V397 CDR-H2 291Lys Ser Lys Thr Asp Gly Gly Thr1 5 2926PRTHomo
sapiensClone V298, V350, V305, V366 CDR-H2 292Ser Gly Ser Gly Arg
Ser1 5 2936PRTHomo sapiensClone V83 CDR-H2 293Asn Pro Ser Gly Gly
Ser1 5 2946PRTHomo sapiensClone V83B CDR-H2 294Asn Pro Asn Gly Gly
Ser1 5 2958PRTHomo sapiensClone 7 CDR-H2 295Arg Ser Lys Thr Asp Gly
Gly Thr1 5 2968PRTHomo sapiensClone V68, V102 CDR-H2 296Arg Ser Lys
Ala Tyr Gly Gly Thr1 5 2976PRTHomo sapiensClone V71 CDR-H2 297Ser
Thr Asp Gly Ala Thr1 5 2986PRTHomo sapiensClone V86, V278, V365
CDR-H2 298Ser Gly Ser Gly Gly Ser1 5 2996PRTHomo sapiensClone V316
CDR-H2 299Asn Asp Asp Gly Ser Glu1 5 3005PRTHomo sapiensClone V331,
V345 CDR-H2 300Asn His Ser Gly Ser1 5 3016PRTHomo sapiensClone V355
CDR-H2 301Ile Pro Ile Phe Gly Thr1 5 3026PRTHomo sapiensClone V282
, V420 CDR-H2 302Lys Gln Asp Gly Ser Glu1 5 3035PRTHomo
sapiensClone V336 CDR-H2 303Ser Tyr Asp Gly Ser1 5 30412PRTHomo
sapiensClone V353 , V48, V81, V16, V65, V18, V40, V20, V43, V224,
V163, V95, V312, V357, V397 CDR-H2 304Arg Ile Lys Ser Lys Thr Asp
Gly Gly Thr Thr Asp1 5 10 30510PRTHomo sapiensClone 298 , V350,
V305, V366 CDR-H2 305Ser Ile Ser Gly Ser Gly Arg Ser Thr Asp1 5 10
30610PRTHomo sapiensClone V83 CDR-H2 306Ile Ile Asn Pro Ser Gly Gly
Ser Thr Ser1 5 10 30710PRTHomo sapiensClone V83B CDR-H2 307Ile Ile
Asn Pro Asn Gly Gly Ser Thr Ser1 5 10 30812PRTHomo sapiensClone 7
CDR-H2 308Arg Ile Arg Ser Lys Thr Asp Gly Gly Thr Thr Asp1 5 10
30912PRTHomo sapiensClone V68, V102, V181 CDR-H2 309Phe Ile Arg Ser
Lys Ala Tyr Gly Gly Thr Thr Glu1 5 10 31010PRTHomo sapiensClone V71
CDR-H2 310Thr Ile Ser Thr Asp Gly Ala Thr Thr Trp1 5 10
31110PRTHomo sapiensClone V86, V278, V365 CDR-H2 311Ala Ile Ser Gly
Ser Gly Gly Ser Thr Tyr1 5 10 31210PRTHomo sapiensClone V316 CDR-H2
312Ser Ile Asn Asp Asp Gly Ser Glu Lys Tyr1 5 10 3139PRTHomo
sapiensClone V331 CDR-H2 313Lys Ile Asn His Ser Gly Ser Thr Asn1 5
31410PRTHomo sapiensClone V355 CDR-H2 314Gly Ile Ile Pro Ile Phe
Gly Thr Ala Asn1 5 10 31510PRTHomo sapiensClone V282, V420 CDR-H2
315Asn Ile Lys Gln Asp Gly Ser Glu Lys Tyr1 5 10 3169PRTHomo
sapiensClone V345 CDR-H2 316Glu Ile Asn His Ser Gly Ser Thr Asn1 5
3179PRTHomo sapiensClone V336 CDR-H2 317Val Ile Ser Tyr Asp Gly Ser
Thr Asn1 5 31819PRTHomo sapiensClone 7 CDR-H2 318Arg Ile Arg Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala Leu1 5 10 15 Val Lys
Gly
* * * * *